2Y9WC

Crystal structure of ppo3, a tyrosinase from agaricus bisporus, in deoxy-form that contains additional unknown lectin-like subunit
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
142
structure length
136
Chain Sequence
b'LDLPGTRILNGANWANNSATSGTLIIFDQSTPGQDADRWLIHNYLDGYKIFNMGSNNWASVSRGNTVLGVSEFDGQTCKWSIEYSGNGEEFWIRVPREGGGGAVWTIKPASSQGPTTVFLDLLKETDPNQRIKFAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLYPHENOL OXIDASE
publication title Crystal Structure of Agaricus Bisporus Mushroom Tyrosinase: Identity of the Tetramer Subunits and Interaction with Tropolone.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 29
structure length 136
sequence length 142
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2y9wC00
1I1BA 1JQZA 4OWLA 4LO1A 4QKRA 4XFUA 1BFGA 1HWMB 1TFMB 5FNWA 3LTQA 2FFUA 5DVHA 3AH4A 2K43A 4LO3C 1BFFA 1Z2VA 3FJ8A 31BIA 4JKXB 4EFPA 1NUNA 4DENA 1W3GA 4WBCA 2NP0A 1R8OA 4QC4A 1FV3A 5BOWA 5E24E 4Q9GA 3FFZA 3BAOA 4OWJA 4J2SA 4ZFUB 1FV2A 1HCEA 1ISVA 2GO2A 3CA6A 1N4KA 3WINC 1DZDA 4LO3A 1TOOA 4FGFA 2L5XA 2RG9B 3O4AA 5BVPI 4LO7B 4LO7C 1AF9A 4IY8A 4ZOTA 4OUJA 1G9CA 4USOA 3NBEA 1T9FA 3CA0A 3VUOA 3RTIB 4KBBA 1S0BA 1OQLB 1Q03A 4H04A 3NJ5A 3FJIA 4P0JA 4I4PA 1JT3A 1DQGA 2Z48A 3BAHA 3WINA 4HR6C 4IY9A 3BAUA 1S0LA 3CRGA 4LO2C 2Z49A 1I1EA 4JAWA 4Q91A 4P0LA 5I1BA 1G9BA 3FJAA 4I4OA 5D61A 4ZBVB 1Z4SA 2WRYA 1T4QA 1P63A 3AKFA 3NBNA 2NTDA 2IWTB 3N7KA 3QR5A 3Q7XA 2NYYA 2KLLA 5FZUA 3PHZA 4A7KA 1E0OA 3R4UA 3OJ2A 3AH1A 3BAGA 2AXMA 5JLVA 1V6VA 1XG6A 2D22A 3P53A 3Q7WA 3ZXGA 1BA7A 3O4BA 2D1ZA 1YBIA 1DFCA 2DS0A 1TP0A 1W3FA 4P0KA 1G82A 4I96A 3H6QA 3P6JA 3JRRA 4I4SA 4IHZA 3UD7A 1EVTA 1JLXA 5BXRA 4IZEA 4JKQA 1V6XA 4CJMA 3VWCA 3IIRA 5D62A 4F34A 4EFRA 3ZXDA 2Y9XE 3BRFA 5BP5C 4JPZA 1JLYA 3UJ4A 2VUAA 1JTCA 1V6WA 2NM1A 4I4UA 4LO8B 1R8NA 1CVSA 4USPA 4I3NA 4X39A 4D8HA 3HALA 9ILBA 3FGMA 4ZGRB 2AQZA 1AXMA 1BARA 3FJKA 1PWAA 4I8MA 1XYFA 1IRPA 1G9AA 4JRAA 2DRYA 2KH2A 3AZWA 4G9MA 4ZFWB 3ZX7A 3CA4A 3WMVA 2MC2A 1TWEA 3PMEA 2D43A 4XFTA 1BLAA 1SR4C 2Q3NB 2VU9A 4I4RA 4QO3A 3ILAA 4ISQA 1PUMB 2DRZA 2RSTA 2F2FA 4I0YA 3CU1B 1BLDA 3BADA 5G00A 2XOAA 4I2SA 1ITBA 4GAIA 8I1BA 4DEPA 2D23A 1EV2A 3I29B 4J23B 2NVHA 4P6AA 2J3PA 4OWKA 1TWMA 4PC4A 1ABRB 3S8JA 3A07A 2D44A 2M49A 4KEIA 2NZ9A 2KKIA 3O5WB 1S0CA 2P23A 2RQ9A 4KEKA 3FJ9A 3SNVA 4I4QA 3AH2A 3K1XA 1ISYA 2D24A 3B9UA 4LO0C 5EC5A 4X37A 1IRAX 1IT0A 2AFGA 1FN0A 3HOMA 1JT4A 1EPWA 2D7IA 4J2XA 3OBRA 3CQAA 2Y9FA 5B2HA 4II0A 1EYLA 3PG0A 3WO3A 1ISXA 2MIBA 2HWAA 3N7JA 1FQ9A 1D0HA 1S0EA 1PC8B 4EEEB 4OEEA 4ISRA 4ENDA 5DUYA 1K5VA 2ESUA 4Z8SB 4LO0A 1HKNA 3RMYA 4QD2B 4QD2C 4X38A 3A22A 1FGAA 4OEFA 2QYIB 1ILR1 3IAGC 4IQPA 5D63A 1Z0HA 3F1RA 5F8WA 3FJFA 4IONA 1AVAC 4KC3A 4LO2A 1S0GA 3FUQA 3VSFA 4AN7B 5EHAA 3HSMA 4HJJA 4R6UB 1IILA 2QN4A 2ZQOA 2F8XC 1L2HA 1GGPB 1M2TB 3CRIA 3IM6A 1HWNB 3UJ0A 4D0ZA 4F83A 5F90A 2VXRA 4H9WA 2VSEA 1WBAA 1W3AA 3PUBA 5F8SA 3OGFA 5FZZA 3T8SA 3BA7A 2E4MC 4G6JA 3EF2A 3HMYA 1DZCA 3VEQA 4DCKC 3I2AA 3AZVA 5BQUC 4EKXB 3D7WB 4TLPA 3FJJA 3RSJA 3O4OA 2LIQA 3W9TA 2ERMA 1YF8B 1Q1UA 2HW9A 2WBCA 3BB2A 1AVXB 4EB2B 4J2KA 3A23A 4ZLBB 3NBDA 3H6SE 2YUGA 1QQKA 1J0SA 3CA1A 1AVUA 3CAHA 4I4XA 4JQ0A 3RTJB 5BXSA 3FJDA 5GAQA 1HWOB 1M16A 4ZA3B 2ZQNA 3BRGC 5BQUA 3BAQA 5BP5A 3VT2A 5BXTA 3A21A 5JMCA 41BIA 3QYDA 1PZZA 3BAVA 4I37A 3AKIA 5FNXA 3V0AB 1TTUA 1DFQA 1DJSB 1XZZA 1AVWB 3HBWA 3N7MA 2KI4A 2BEBA 1PUUB 2KI6B 2X2SA 4L4IA 1VCLA 1IJTA 2VXTI 3ZC8A 1FWVA 1SR4A 3C9ZA 1UPSA 3BX1C 4I4VA 4Z9WB 3VSZA 6I1BA 2BFHA 3FJHA 5FZYA 3OBTA 4I1BA 3UD8A 4A7ZA 1ISWA 1S0DA 4KEJA 3R4SA 4GAFA 1IOBA 3V0AA 4XKIA 2I1BA 3JUTA 3O4CA 3E8LC 4I4YA 3KMVA 2DREA 2P39A 4GP3A 1MD6A 4OW4A 3HN1A 1RZOB 3FUOA 3RMXA 4QBVA 3IM7A 2Y9WC 4IZXA 1RY7A 3AKHA 4ZFYB 7I1BA 1IHKA 3WMUA 3FJBA 4I7IA 3O49A 3WO4A 1DQOA 1CE7B 3BRDA 4FVVA 1AFCA 3O44A 1WD4A 1V6UA 1QQLA 4GOVA 4ZKTB 2ZR1B 1F31A 3LLPA 1DIWA 1Q04A 2FGFA 1BFCA 4G1RA 3POKA 2Q9XA 4G9NA 4J2YA 3H6RB 4A7YA 3NBCA 3VT1A 3TC2A 3OGGA 4D0TA 3CA3A 5BXPA 3CRHA 4Q9PA 1JY0A 1BASA 2D7RA 3ZC9A 1S0FA 1YTOA 2UUSA 1G9DA 3CA5A 2GZBA 2K8RA 5EG6C 1BFBA 1ONKB 1XHBA 2AAIB 3FJCA 5HPZA 3WA1A 1HIBA 2FFVA 5DZUA 2R9KB 3WO2A 3O3QA 4I6IA 1II4A 3P6IA 2IHOA 4QALA 1K5UA 2VSAA 3V0BB 3MPPG 1HWPB 3AJ6A 4JP0A 3H6RA 1YYNA 2K4AB 2Y9GA 3N7LA 3V79C 1QXMA 2MLLB 3AKGA 1FMMS 2ET2A 3BA5A 1YXWA 1DLLA 2LIEA 4EFQA 2X2TA 2VLCA 1WBCA 4GP0A 4QKSA 2HZ9A 4HA2A 1JT5A 2BEAA 3OJVA 3S8KA 1JT7A 1FMZA 3O4DA 1HCDA 1FWUA 3AJ5A 3UDAA 1TIEA 3V0BA 2FO1A 1ISZA 4AN6A 3Q7YA 2E4MA 3I2XA 3BTAA 1RG8A 4G6MA 4IYBA 21BIA 1SZ6B 4YOLA 1RMLA 4LO1C 1WD3A 4XFSA 3FJEA 3N0KA 4I1EA 5DSSB 3UD9A 2FDBM 1MC9A 3IM5A 1A8DA 3OJMA 2F2FC 3MALA 4X3AA 3VT0A 3BA4A 2HWMA 4OEGA 4L4HA 1KNMA 3F62B 1NZKA 4QBCA 5F8YA 4GOYA 2D20A
chains in the Genus database with same CATH superfamily
1I1BA 1JQZA 4OWLA 4LO1A 4QKRA 4XFUA 1BFGA 1HWMB 1TFMB 5FNWA 3LTQA 2FFUA 5DVHA 3AH4A 2K43A 4LO3C 1BFFA 1Z2VA 3FJ8A 31BIA 4JKXB 4EFPA 1NUNA 4DENA 1W3GA 4WBCA 2NP0A 1R8OA 4QC4A 1FV3A 5BOWA 5E24E 4Q9GA 3FFZA 3BAOA 4OWJA 4J2SA 4ZFUB 1FV2A 1HCEA 1ISVA 2GO2A 3CA6A 1N4KA 3WINC 1DZDA 4LO3A 1TOOA 4FGFA 2L5XA 2RG9B 3O4AA 5BVPI 4LO7B 4LO7C 1AF9A 4IY8A 4ZOTA 4OUJA 1G9CA 4H75A 4USOA 3NBEA 1T9FA 3CA0A 3VUOA 3RTIB 4KBBA 1S0BA 1OQLB 1Q03A 4H04A 3NJ5A 3FJIA 4P0JA 4I4PA 1JT3A 1DQGA 2Z48A 3BAHA 3WINA 4HR6C 4IY9A 3BAUA 1S0LA 3CRGA 4LO2C 2Z49A 1I1EA 4JAWA 4Q91A 4P0LA 5I1BA 1G9BA 3FJAA 4I4OA 5D61A 4ZBVB 1Z4SA 2WRYA 1T4QA 1P63A 3AKFA 3NBNA 2NTDA 2IWTB 3N7KA 3QR5A 3Q7XA 2NYYA 2KLLA 5FZUA 3PHZA 4A7KA 1E0OA 3R4UA 3OJ2A 3AH1A 3BAGA 2AXMA 5JLVA 1V6VA 1XG6A 2D22A 3P53A 3Q7WA 3ZXGA 1BA7A 3O4BA 2D1ZA 1YBIA 1DFCA 2DS0A 1TP0A 1W3FA 4P0KA 1G82A 4I96A 3H6QA 3P6JA 3JRRA 4I4SA 4IHZA 3UD7A 1EVTA 1JLXA 5BXRA 4IZEA 4JKQA 1V6XA 4CJMA 3VWCA 3IIRA 5D62A 4F34A 4EFRA 3ZXDA 2Y9XE 3BRFA 5BP5C 4JPZA 1JLYA 3UJ4A 2VUAA 1JTCA 1V6WA 2NM1A 4I4UA 4LO8B 1R8NA 1CVSA 4USPA 4I3NA 4X39A 4D8HA 3HALA 9ILBA 3FGMA 4ZGRB 2AQZA 1AXMA 1BARA 3FJKA 1PWAA 4I8MA 1XYFA 1IRPA 1G9AA 4JRAA 2DRYA 2KH2A 3AZWA 4G9MA 4ZFWB 3ZX7A 3CA4A 3WMVA 2MC2A 1TWEA 3PMEA 2D43A 4XFTA 1BLAA 1SR4C 2Q3NB 2VU9A 4I4RA 4QO3A 3ILAA 4ISQA 1PUMB 2DRZA 2RSTA 2F2FA 4I0YA 3CU1B 1BLDA 3BADA 5G00A 2XOAA 4I2SA 1ITBA 4GAIA 8I1BA 4DEPA 2D23A 1EV2A 3I29B 4J23B 2NVHA 4P6AA 2J3PA 4OWKA 1TWMA 4PC4A 1ABRB 3S8JA 3A07A 2D44A 2M49A 4KEIA 2NZ9A 2KKIA 3O5WB 1S0CA 2P23A 2RQ9A 4KEKA 3FJ9A 3SNVA 4I4QA 3AH2A 3K1XA 1ISYA 2D24A 3B9UA 4LO0C 5EC5A 4X37A 1IRAX 1IT0A 2AFGA 1FN0A 3HOMA 1JT4A 1EPWA 2D7IA 4J2XA 3OBRA 3CQAA 2Y9FA 5B2HA 4II0A 1EYLA 3PG0A 3WO3A 1ISXA 2MIBA 2HWAA 3N7JA 1FQ9A 1D0HA 1S0EA 1PC8B 4EEEB 4MZHA 4OEEA 4ISRA 4ENDA 5DUYA 1K5VA 2ESUA 4Z8SB 4LO0A 1HKNA 3RMYA 4QD2B 4QD2C 4X38A 3A22A 1FGAA 4OEFA 2QYIB 1ILR1 3IAGC 4IQPA 5D63A 1Z0HA 3F1RA 5F8WA 3FJFA 4IONA 1AVAC 4KC3A 4LO2A 1S0GA 3FUQA 3VSFA 4AN7B 5EHAA 3HSMA 4HJJA 4R6UB 1IILA 2QN4A 2ZQOA 2F8XC 1L2HA 1GGPB 1M2TB 3CRIA 3IM6A 1HWNB 3UJ0A 4D0ZA 4F83A 5F90A 2VXRA 4H9WA 2VSEA 1WBAA 1W3AA 3PUBA 5F8SA 3OGFA 5FZZA 3T8SA 3BA7A 2E4MC 4G6JA 3EF2A 3HMYA 1DZCA 4MZFB 4UY4A 3VEQA 4DCKC 3I2AA 3AZVA 5BQUC 4EKXB 3D7WB 4TLPA 3FJJA 3RSJA 3O4OA 2LIQA 3W9TA 2ERMA 1YF8B 1Q1UA 2HW9A 2WBCA 3BB2A 1AVXB 4EB2B 4J2KA 3A23A 4ZLBB 3NBDA 3H6SE 2YUGA 1QQKA 1J0SA 3CA1A 1AVUA 3CAHA 4I4XA 4JQ0A 3RTJB 5BXSA 3FJDA 5GAQA 1HWOB 1M16A 4ZA3B 2ZQNA 3BRGC 5BQUA 3BAQA 5BP5A 3VT2A 5BXTA 3A21A 5JMCA 41BIA 3QYDA 1PZZA 3BAVA 4I37A 3AKIA 5FNXA 3V0AB 1TTUA 1DFQA 1DJSB 1XZZA 1AVWB 3HBWA 3N7MA 2KI4A 2BEBA 1PUUB 2KI6B 2X2SA 4L4IA 1VCLA 1IJTA 2VXTI 3ZC8A 1FWVA 1SR4A 3C9ZA 1UPSA 3BX1C 4I4VA 4Z9WB 3VSZA 6I1BA 2BFHA 3FJHA 5FZYA 3OBTA 4I1BA 3UD8A 4A7ZA 1ISWA 1S0DA 4KEJA 3R4SA 4GAFA 1IOBA 3V0AA 4XKIA 2I1BA 3JUTA 3O4CA 3E8LC 4I4YA 3KMVA 2DREA 2P39A 4GP3A 1MD6A 4OW4A 3HN1A 1RZOB 3FUOA 3RMXA 4QBVA 3IM7A 2Y9WC 4IZXA 1RY7A 3AKHA 4ZFYB 7I1BA 1IHKA 3WMUA 3FJBA 4I7IA 3O49A 3WO4A 1DQOA 1CE7B 3BRDA 4FVVA 1AFCA 3O44A 1WD4A 1V6UA 1QQLA 4GOVA 4ZKTB 2ZR1B 1F31A 3LLPA 1DIWA 1Q04A 2FGFA 1BFCA 4G1RA 3POKA 2Q9XA 4G9NA 4J2YA 3H6RB 4A7YA 3NBCA 3VT1A 3TC2A 3OGGA 4D0TA 3CA3A 5BXPA 3CRHA 4Q9PA 1JY0A 1BASA 2D7RA 3ZC9A 1S0FA 1YTOA 2UUSA 1G9DA 3CA5A 2GZBA 2K8RA 5EG6C 1BFBA 1ONKB 1XHBA 2AAIB 3FJCA 5HPZA 3WA1A 1HIBA 2FFVA 5DZUA 2R9KB 3WO2A 3O3QA 4I6IA 1II4A 4MZGB 3P6IA 2IHOA 4QALA 1K5UA 2VSAA 3V0BB 3MPPG 1HWPB 3AJ6A 4JP0A 3H6RA 1YYNA 2K4AB 2Y9GA 3N7LA 3V79C 1QXMA 2MLLB 3AKGA 1FMMS 2ET2A 3BA5A 1YXWA 1DLLA 2LIEA 4EFQA 2X2TA 2VLCA 1WBCA 4GP0A 4QKSA 2HZ9A 4HA2A 1JT5A 2BEAA 3OJVA 3S8KA 1JT7A 1FMZA 3O4DA 1HCDA 1FWUA 3AJ5A 3UDAA 1TIEA 3V0BA 2FO1A 1ISZA 4AN6A 3Q7YA 2E4MA 2NS2A 3I2XA 3BTAA 1RG8A 4G6MA 4IYBA 21BIA 1SZ6B 4YOLA 1RMLA 4LO1C 1WD3A 4XFSA 3FJEA 3N0KA 4I1EA 5DSSB 3UD9A 2FDBM 1MC9A 3IM5A 1A8DA 3OJMA 2F2FC 3MALA 4X3AA 3VT0A 3BA4A 2HWMA 4OEGA 4L4HA 1KNMA 3F62B 1NZKA 4QBCA 5F8YA 4GOYA 2D20A
chains in the Genus database with same CATH topology
1I1BA 1JQZA 4OWLA 4LO1A 4QKRA 4XFUA 1BFGA 1HWMB 1TFMB 5FNWA 3LTQA 2FFUA 5DVHA 3AH4A 2K43A 4LO3C 1BFFA 1Z2VA 3FJ8A 31BIA 4JKXB 4EFPA 1NUNA 4DENA 1W3GA 4WBCA 2NP0A 1R8OA 4QC4A 1FV3A 5BOWA 5E24E 4Q9GA 3FFZA 3BAOA 4OWJA 4J2SA 4ZFUB 1FV2A 1HCEA 1ISVA 2GO2A 3CA6A 1N4KA 3WINC 1DZDA 4LO3A 1TOOA 4FGFA 2L5XA 2RG9B 3O4AA 5BVPI 4LO7B 4LO7C 1AF9A 4IY8A 4ZOTA 4OUJA 1G9CA 4H75A 4USOA 3NBEA 1T9FA 3CA0A 3VUOA 3RTIB 4KBBA 1S0BA 1OQLB 1Q03A 4H04A 3NJ5A 3FJIA 4P0JA 4I4PA 1JT3A 1DQGA 2Z48A 3BAHA 3WINA 4HR6C 4IY9A 3BAUA 1S0LA 3CRGA 4LO2C 2Z49A 1I1EA 4JAWA 4Q91A 4P0LA 5I1BA 1G9BA 3FJAA 4I4OA 5D61A 4ZBVB 1Z4SA 2WRYA 1T4QA 1P63A 3AKFA 3NBNA 2NTDA 2IWTB 3N7KA 3QR5A 3Q7XA 2NYYA 2KLLA 5FZUA 3PHZA 4A7KA 1E0OA 3R4UA 3OJ2A 3AH1A 3BAGA 2AXMA 5JLVA 1V6VA 1XG6A 2D22A 3P53A 3Q7WA 3ZXGA 1BA7A 3O4BA 2D1ZA 1YBIA 1DFCA 2DS0A 1TP0A 1W3FA 4P0KA 1G82A 4I96A 3H6QA 3P6JA 3JRRA 4I4SA 4IHZA 3UD7A 1EVTA 1JLXA 5BXRA 4IZEA 4JKQA 1V6XA 4CJMA 3VWCA 3IIRA 5D62A 4F34A 4EFRA 3ZXDA 2Y9XE 3BRFA 5BP5C 4JPZA 1JLYA 3UJ4A 2VUAA 1JTCA 1V6WA 2NM1A 4I4UA 4LO8B 1R8NA 1CVSA 4USPA 4I3NA 4X39A 4D8HA 3HALA 9ILBA 3FGMA 4ZGRB 2AQZA 1AXMA 1BARA 3FJKA 1PWAA 4I8MA 1XYFA 1IRPA 1G9AA 4JRAA 2DRYA 2KH2A 3AZWA 4G9MA 4ZFWB 3ZX7A 3CA4A 3WMVA 2MC2A 1TWEA 3PMEA 2D43A 4XFTA 1BLAA 1SR4C 2Q3NB 2VU9A 4I4RA 4QO3A 3ILAA 4ISQA 1PUMB 2DRZA 2RSTA 2F2FA 4I0YA 3CU1B 1BLDA 3BADA 5G00A 2XOAA 4I2SA 1ITBA 4GAIA 8I1BA 4DEPA 2D23A 1EV2A 3I29B 4J23B 2NVHA 4P6AA 2J3PA 4OWKA 1TWMA 4PC4A 1ABRB 3S8JA 3A07A 2D44A 2M49A 4KEIA 2NZ9A 2KKIA 3O5WB 1S0CA 2P23A 2RQ9A 4KEKA 3FJ9A 3SNVA 4I4QA 3AH2A 3K1XA 1ISYA 2D24A 3B9UA 4LO0C 5EC5A 4X37A 1IRAX 1IT0A 2AFGA 1FN0A 3HOMA 1JT4A 1EPWA 2D7IA 4J2XA 3OBRA 3CQAA 2Y9FA 5B2HA 4II0A 1EYLA 3PG0A 3WO3A 1ISXA 2MIBA 2HWAA 3N7JA 1FQ9A 1D0HA 1S0EA 1PC8B 4EEEB 4MZHA 4OEEA 4ISRA 4ENDA 5DUYA 1K5VA 2ESUA 4Z8SB 4LO0A 1HKNA 3RMYA 4QD2B 4QD2C 4X38A 3A22A 1FGAA 4OEFA 2QYIB 1ILR1 3IAGC 4IQPA 5D63A 1Z0HA 3F1RA 5F8WA 3FJFA 4IONA 1AVAC 4KC3A 4LO2A 1S0GA 3FUQA 3VSFA 4AN7B 5EHAA 3HSMA 4HJJA 4R6UB 1IILA 2QN4A 2ZQOA 2F8XC 1L2HA 1GGPB 1M2TB 3CRIA 3IM6A 1HWNB 3UJ0A 4D0ZA 4F83A 5F90A 2VXRA 4H9WA 2VSEA 1WBAA 1W3AA 3PUBA 5F8SA 3OGFA 5FZZA 3T8SA 3BA7A 2E4MC 4G6JA 3EF2A 3HMYA 1DZCA 4MZFB 4UY4A 3VEQA 4DCKC 3I2AA 3AZVA 5BQUC 4EKXB 3D7WB 4TLPA 3FJJA 3RSJA 3O4OA 2LIQA 3W9TA 2ERMA 1YF8B 1Q1UA 2HW9A 2WBCA 3BB2A 1AVXB 4EB2B 4J2KA 3A23A 4ZLBB 3NBDA 3H6SE 2YUGA 1QQKA 1J0SA 3CA1A 1AVUA 3CAHA 4I4XA 4JQ0A 3RTJB 5BXSA 3FJDA 5GAQA 1HWOB 1M16A 4ZA3B 2ZQNA 3BRGC 5BQUA 3BAQA 5BP5A 3VT2A 5BXTA 3A21A 5JMCA 41BIA 3QYDA 1PZZA 3BAVA 4I37A 3AKIA 5FNXA 3V0AB 1TTUA 1DFQA 1DJSB 1XZZA 1AVWB 3HBWA 3N7MA 2KI4A 2BEBA 1PUUB 2KI6B 2X2SA 4L4IA 1VCLA 1IJTA 2VXTI 3ZC8A 1FWVA 1SR4A 3C9ZA 1UPSA 3BX1C 4I4VA 4Z9WB 3VSZA 6I1BA 2BFHA 3FJHA 5FZYA 3OBTA 4I1BA 3UD8A 4A7ZA 1ISWA 1S0DA 4KEJA 3R4SA 4GAFA 1IOBA 3V0AA 4XKIA 2I1BA 3JUTA 3O4CA 3E8LC 4I4YA 3KMVA 2DREA 2P39A 4GP3A 1MD6A 4OW4A 3HN1A 1RZOB 3FUOA 3RMXA 4QBVA 3IM7A 2Y9WC 4IZXA 1RY7A 3AKHA 4ZFYB 7I1BA 1IHKA 3WMUA 3FJBA 4I7IA 3O49A 3WO4A 1DQOA 1CE7B 3BRDA 4FVVA 1AFCA 3O44A 1WD4A 1V6UA 1QQLA 4GOVA 4ZKTB 2ZR1B 1F31A 3LLPA 1DIWA 1Q04A 2FGFA 1BFCA 4G1RA 3POKA 2Q9XA 4G9NA 4J2YA 3H6RB 4A7YA 3NBCA 3VT1A 3TC2A 3OGGA 4D0TA 3CA3A 5BXPA 3CRHA 4Q9PA 1JY0A 1BASA 2D7RA 3ZC9A 1S0FA 1YTOA 2UUSA 1G9DA 3CA5A 2GZBA 2K8RA 5EG6C 1BFBA 1ONKB 1XHBA 2AAIB 3FJCA 5HPZA 3WA1A 1HIBA 2FFVA 5DZUA 2R9KB 3WO2A 3O3QA 4I6IA 1II4A 4MZGB 3P6IA 2IHOA 4QALA 1K5UA 2VSAA 3V0BB 3MPPG 1HWPB 3AJ6A 4JP0A 3H6RA 1YYNA 2K4AB 2Y9GA 3N7LA 3V79C 1QXMA 2MLLB 3AKGA 1FMMS 2ET2A 3BA5A 1YXWA 1DLLA 2LIEA 4EFQA 2X2TA 2VLCA 1WBCA 4GP0A 4QKSA 2HZ9A 4HA2A 1JT5A 2BEAA 3OJVA 3S8KA 1JT7A 1FMZA 3O4DA 1HCDA 1FWUA 3AJ5A 3UDAA 1TIEA 3V0BA 2FO1A 1ISZA 4AN6A 3Q7YA 2E4MA 2NS2A 3I2XA 3BTAA 1RG8A 4G6MA 4IYBA 21BIA 1SZ6B 4YOLA 1RMLA 4LO1C 1WD3A 4XFSA 3FJEA 3N0KA 4I1EA 5DSSB 3UD9A 2FDBM 1MC9A 3IM5A 1A8DA 3OJMA 2F2FC 3MALA 4X3AA 3VT0A 3BA4A 2HWMA 4OEGA 4L4HA 1KNMA 3F62B 1NZKA 4QBCA 5F8YA 4GOYA 2D20A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I1B A;  1JQZ A;  4OWL A;  4LO1 A;  4QKR A;  4XFU A;  1BFG A;  1HWM B;  1TFM B;  5FNW A;  3LTQ A;  2FFU A;  5DVH A;  3AH4 A;  2K43 A;  4LO3 C;  1BFF A;  1Z2V A;  3FJ8 A;  31BI A;  4JKX B;  4EFP A;  1NUN A;  4DEN A;  1W3G A;  4WBC A;  2NP0 A;  1R8O A;  4QC4 A;  1FV3 A;  5BOW A;  5E24 E;  4Q9G A;  3FFZ A;  3BAO A;  4OWJ A;  4J2S A;  4ZFU B;  1FV2 A;  1HCE A;  1ISV A;  2GO2 A;  3CA6 A;  1N4K A;  3WIN C;  1DZD A;  4LO3 A;  1TOO A;  4FGF A;  2L5X A;  2RG9 B;  3O4A A;  5BVP I;  4LO7 B;  4LO7 C;  1AF9 A;  4IY8 A;  4ZOT A;  4OUJ A;  1G9C A;  4USO A;  3NBE A;  1T9F A;  3CA0 A;  3VUO A;  3RTI B;  4KBB A;  1S0B A;  1OQL B;  1Q03 A;  4H04 A;  3NJ5 A;  3FJI A;  4P0J A;  4I4P A;  1JT3 A;  1DQG A;  2Z48 A;  3BAH A;  3WIN A;  4HR6 C;  4IY9 A;  3BAU A;  1S0L A;  3CRG A;  4LO2 C;  2Z49 A;  1I1E A;  4JAW A;  4Q91 A;  4P0L A;  5I1B A;  1G9B A;  3FJA A;  4I4O A;  5D61 A;  4ZBV B;  1Z4S A;  2WRY A;  1T4Q A;  1P63 A;  3AKF A;  3NBN A;  2NTD A;  2IWT B;  3N7K A;  3QR5 A;  3Q7X A;  2NYY A;  2KLL A;  5FZU A;  3PHZ A;  4A7K A;  1E0O A;  3R4U A;  3OJ2 A;  3AH1 A;  3BAG A;  2AXM A;  5JLV A;  1V6V A;  1XG6 A;  2D22 A;  3P53 A;  3Q7W A;  3ZXG A;  1BA7 A;  3O4B A;  2D1Z A;  1YBI A;  1DFC A;  2DS0 A;  1TP0 A;  1W3F A;  4P0K A;  1G82 A;  4I96 A;  3H6Q A;  3P6J A;  3JRR A;  4I4S A;  4IHZ A;  3UD7 A;  1EVT A;  1JLX A;  5BXR A;  4IZE A;  4JKQ A;  1V6X A;  4CJM A;  3VWC A;  3IIR A;  5D62 A;  4F34 A;  4EFR A;  3ZXD A;  2Y9X E;  3BRF A;  5BP5 C;  4JPZ A;  1JLY A;  3UJ4 A;  2VUA A;  1JTC A;  1V6W A;  2NM1 A;  4I4U A;  4LO8 B;  1R8N A;  1CVS A;  4USP A;  4I3N A;  4X39 A;  4D8H A;  3HAL A;  9ILB A;  3FGM A;  4ZGR B;  2AQZ A;  1AXM A;  1BAR A;  3FJK A;  1PWA A;  4I8M A;  1XYF A;  1IRP A;  1G9A A;  4JRA A;  2DRY A;  2KH2 A;  3AZW A;  4G9M A;  4ZFW B;  3ZX7 A;  3CA4 A;  3WMV A;  2MC2 A;  1TWE A;  3PME A;  2D43 A;  4XFT A;  1BLA A;  1SR4 C;  2Q3N B;  2VU9 A;  4I4R A;  4QO3 A;  3ILA A;  4ISQ A;  1PUM B;  2DRZ A;  2RST A;  2F2F A;  4I0Y A;  3CU1 B;  1BLD A;  3BAD A;  5G00 A;  2XOA A;  4I2S A;  1ITB A;  4GAI A;  8I1B A;  4DEP A;  2D23 A;  1EV2 A;  3I29 B;  4J23 B;  2NVH A;  4P6A A;  2J3P A;  4OWK A;  1TWM A;  4PC4 A;  1ABR B;  3S8J A;  3A07 A;  2D44 A;  2M49 A;  4KEI A;  2NZ9 A;  2KKI A;  3O5W B;  1S0C A;  2P23 A;  2RQ9 A;  4KEK A;  3FJ9 A;  3SNV A;  4I4Q A;  3AH2 A;  3K1X A;  1ISY A;  2D24 A;  3B9U A;  4LO0 C;  5EC5 A;  4X37 A;  1IRA X;  1IT0 A;  2AFG A;  1FN0 A;  3HOM A;  1JT4 A;  1EPW A;  2D7I A;  4J2X A;  3OBR A;  3CQA A;  2Y9F A;  5B2H A;  4II0 A;  1EYL A;  3PG0 A;  3WO3 A;  1ISX A;  2MIB A;  2HWA A;  3N7J A;  1FQ9 A;  1D0H A;  1S0E A;  1PC8 B;  4EEE B;  4OEE A;  4ISR A;  4END A;  5DUY A;  1K5V A;  2ESU A;  4Z8S B;  4LO0 A;  1HKN A;  3RMY A;  4QD2 B;  4QD2 C;  4X38 A;  3A22 A;  1FGA A;  4OEF A;  2QYI B;  1ILR 1;  3IAG C;  4IQP A;  5D63 A;  1Z0H A;  3F1R A;  5F8W A;  3FJF A;  4ION A;  1AVA C;  4KC3 A;  4LO2 A;  1S0G A;  3FUQ A;  3VSF A;  4AN7 B;  5EHA A;  3HSM A;  4HJJ A;  4R6U B;  1IIL A;  2QN4 A;  2ZQO A;  2F8X C;  1L2H A;  1GGP B;  1M2T B;  3CRI A;  3IM6 A;  1HWN B;  3UJ0 A;  4D0Z A;  4F83 A;  5F90 A;  2VXR A;  4H9W A;  2VSE A;  1WBA A;  1W3A A;  3PUB A;  5F8S A;  3OGF A;  5FZZ A;  3T8S A;  3BA7 A;  2E4M C;  4G6J A;  3EF2 A;  3HMY A;  1DZC A;  3VEQ A;  4DCK C;  3I2A A;  3AZV A;  5BQU C;  4EKX B;  3D7W B;  4TLP A;  3FJJ A;  3RSJ A;  3O4O A;  2LIQ A;  3W9T A;  2ERM A;  1YF8 B;  1Q1U A;  2HW9 A;  2WBC A;  3BB2 A;  1AVX B;  4EB2 B;  4J2K A;  3A23 A;  4ZLB B;  3NBD A;  3H6S E;  2YUG A;  1QQK A;  1J0S A;  3CA1 A;  1AVU A;  3CAH A;  4I4X A;  4JQ0 A;  3RTJ B;  5BXS A;  3FJD A;  5GAQ A;  1HWO B;  1M16 A;  4ZA3 B;  2ZQN A;  3BRG C;  5BQU A;  3BAQ A;  5BP5 A;  3VT2 A;  5BXT A;  3A21 A;  5JMC A;  41BI A;  3QYD A;  1PZZ A;  3BAV A;  4I37 A;  3AKI A;  5FNX A;  3V0A B;  1TTU A;  1DFQ A;  1DJS B;  1XZZ A;  1AVW B;  3HBW A;  3N7M A;  2KI4 A;  2BEB A;  1PUU B;  2KI6 B;  2X2S A;  4L4I A;  1VCL A;  1IJT A;  2VXT I;  3ZC8 A;  1FWV A;  1SR4 A;  3C9Z A;  1UPS A;  3BX1 C;  4I4V A;  4Z9W B;  3VSZ A;  6I1B A;  2BFH A;  3FJH A;  5FZY A;  3OBT A;  4I1B A;  3UD8 A;  4A7Z A;  1ISW A;  1S0D A;  4KEJ A;  3R4S A;  4GAF A;  1IOB A;  3V0A A;  4XKI A;  2I1B A;  3JUT A;  3O4C A;  3E8L C;  4I4Y A;  3KMV A;  2DRE A;  2P39 A;  4GP3 A;  1MD6 A;  4OW4 A;  3HN1 A;  1RZO B;  3FUO A;  3RMX A;  4QBV A;  3IM7 A;  2Y9W C;  4IZX A;  1RY7 A;  3AKH A;  4ZFY B;  7I1B A;  1IHK A;  3WMU A;  3FJB A;  4I7I A;  3O49 A;  3WO4 A;  1DQO A;  1CE7 B;  3BRD A;  4FVV A;  1AFC A;  3O44 A;  1WD4 A;  1V6U A;  1QQL A;  4GOV A;  4ZKT B;  2ZR1 B;  1F31 A;  3LLP A;  1DIW A;  1Q04 A;  2FGF A;  1BFC A;  4G1R A;  3POK A;  2Q9X A;  4G9N A;  4J2Y A;  3H6R B;  4A7Y A;  3NBC A;  3VT1 A;  3TC2 A;  3OGG A;  4D0T A;  3CA3 A;  5BXP A;  3CRH A;  4Q9P A;  1JY0 A;  1BAS A;  2D7R A;  3ZC9 A;  1S0F A;  1YTO A;  2UUS A;  1G9D A;  3CA5 A;  2GZB A;  2K8R A;  5EG6 C;  1BFB A;  1ONK B;  1XHB A;  2AAI B;  3FJC A;  5HPZ A;  3WA1 A;  1HIB A;  2FFV A;  5DZU A;  2R9K B;  3WO2 A;  3O3Q A;  4I6I A;  1II4 A;  3P6I A;  2IHO A;  4QAL A;  1K5U A;  2VSA A;  3V0B B;  3MPP G;  1HWP B;  3AJ6 A;  4JP0 A;  3H6R A;  1YYN A;  2K4A B;  2Y9G A;  3N7L A;  3V79 C;  1QXM A;  2MLL B;  3AKG A;  1FMM S;  2ET2 A;  3BA5 A;  1YXW A;  1DLL A;  2LIE A;  4EFQ A;  2X2T A;  2VLC A;  1WBC A;  4GP0 A;  4QKS A;  2HZ9 A;  4HA2 A;  1JT5 A;  2BEA A;  3OJV A;  3S8K A;  1JT7 A;  1FMZ A;  3O4D A;  1HCD A;  1FWU A;  3AJ5 A;  3UDA A;  1TIE A;  3V0B A;  2FO1 A;  1ISZ A;  4AN6 A;  3Q7Y A;  2E4M A;  3I2X A;  3BTA A;  1RG8 A;  4G6M A;  4IYB A;  21BI A;  1SZ6 B;  4YOL A;  1RML A;  4LO1 C;  1WD3 A;  4XFS A;  3FJE A;  3N0K A;  4I1E A;  5DSS B;  3UD9 A;  2FDB M;  1MC9 A;  3IM5 A;  1A8D A;  3OJM A;  2F2F C;  3MAL A;  4X3A A;  3VT0 A;  3BA4 A;  2HWM A;  4OEG A;  4L4H A;  1KNM A;  3F62 B;  1NZK A;  4QBC A;  5F8Y A;  4GOY A;  2D20 A; 
#chains in the Genus database with same CATH topology
 1I1B A;  1JQZ A;  4OWL A;  4LO1 A;  4QKR A;  4XFU A;  1BFG A;  1HWM B;  1TFM B;  5FNW A;  3LTQ A;  2FFU A;  5DVH A;  3AH4 A;  2K43 A;  4LO3 C;  1BFF A;  1Z2V A;  3FJ8 A;  31BI A;  4JKX B;  4EFP A;  1NUN A;  4DEN A;  1W3G A;  4WBC A;  2NP0 A;  1R8O A;  4QC4 A;  1FV3 A;  5BOW A;  5E24 E;  4Q9G A;  3FFZ A;  3BAO A;  4OWJ A;  4J2S A;  4ZFU B;  1FV2 A;  1HCE A;  1ISV A;  2GO2 A;  3CA6 A;  1N4K A;  3WIN C;  1DZD A;  4LO3 A;  1TOO A;  4FGF A;  2L5X A;  2RG9 B;  3O4A A;  5BVP I;  4LO7 B;  4LO7 C;  1AF9 A;  4IY8 A;  4ZOT A;  4OUJ A;  1G9C A;  4H75 A;  4USO A;  3NBE A;  1T9F A;  3CA0 A;  3VUO A;  3RTI B;  4KBB A;  1S0B A;  1OQL B;  1Q03 A;  4H04 A;  3NJ5 A;  3FJI A;  4P0J A;  4I4P A;  1JT3 A;  1DQG A;  2Z48 A;  3BAH A;  3WIN A;  4HR6 C;  4IY9 A;  3BAU A;  1S0L A;  3CRG A;  4LO2 C;  2Z49 A;  1I1E A;  4JAW A;  4Q91 A;  4P0L A;  5I1B A;  1G9B A;  3FJA A;  4I4O A;  5D61 A;  4ZBV B;  1Z4S A;  2WRY A;  1T4Q A;  1P63 A;  3AKF A;  3NBN A;  2NTD A;  2IWT B;  3N7K A;  3QR5 A;  3Q7X A;  2NYY A;  2KLL A;  5FZU A;  3PHZ A;  4A7K A;  1E0O A;  3R4U A;  3OJ2 A;  3AH1 A;  3BAG A;  2AXM A;  5JLV A;  1V6V A;  1XG6 A;  2D22 A;  3P53 A;  3Q7W A;  3ZXG A;  1BA7 A;  3O4B A;  2D1Z A;  1YBI A;  1DFC A;  2DS0 A;  1TP0 A;  1W3F A;  4P0K A;  1G82 A;  4I96 A;  3H6Q A;  3P6J A;  3JRR A;  4I4S A;  4IHZ A;  3UD7 A;  1EVT A;  1JLX A;  5BXR A;  4IZE A;  4JKQ A;  1V6X A;  4CJM A;  3VWC A;  3IIR A;  5D62 A;  4F34 A;  4EFR A;  3ZXD A;  2Y9X E;  3BRF A;  5BP5 C;  4JPZ A;  1JLY A;  3UJ4 A;  2VUA A;  1JTC A;  1V6W A;  2NM1 A;  4I4U A;  4LO8 B;  1R8N A;  1CVS A;  4USP A;  4I3N A;  4X39 A;  4D8H A;  3HAL A;  9ILB A;  3FGM A;  4ZGR B;  2AQZ A;  1AXM A;  1BAR A;  3FJK A;  1PWA A;  4I8M A;  1XYF A;  1IRP A;  1G9A A;  4JRA A;  2DRY A;  2KH2 A;  3AZW A;  4G9M A;  4ZFW B;  3ZX7 A;  3CA4 A;  3WMV A;  2MC2 A;  1TWE A;  3PME A;  2D43 A;  4XFT A;  1BLA A;  1SR4 C;  2Q3N B;  2VU9 A;  4I4R A;  4QO3 A;  3ILA A;  4ISQ A;  1PUM B;  2DRZ A;  2RST A;  2F2F A;  4I0Y A;  3CU1 B;  1BLD A;  3BAD A;  5G00 A;  2XOA A;  4I2S A;  1ITB A;  4GAI A;  8I1B A;  4DEP A;  2D23 A;  1EV2 A;  3I29 B;  4J23 B;  2NVH A;  4P6A A;  2J3P A;  4OWK A;  1TWM A;  4PC4 A;  1ABR B;  3S8J A;  3A07 A;  2D44 A;  2M49 A;  4KEI A;  2NZ9 A;  2KKI A;  3O5W B;  1S0C A;  2P23 A;  2RQ9 A;  4KEK A;  3FJ9 A;  3SNV A;  4I4Q A;  3AH2 A;  3K1X A;  1ISY A;  2D24 A;  3B9U A;  4LO0 C;  5EC5 A;  4X37 A;  1IRA X;  1IT0 A;  2AFG A;  1FN0 A;  3HOM A;  1JT4 A;  1EPW A;  2D7I A;  4J2X A;  3OBR A;  3CQA A;  2Y9F A;  5B2H A;  4II0 A;  1EYL A;  3PG0 A;  3WO3 A;  1ISX A;  2MIB A;  2HWA A;  3N7J A;  1FQ9 A;  1D0H A;  1S0E A;  1PC8 B;  4EEE B;  4MZH A;  4OEE A;  4ISR A;  4END A;  5DUY A;  1K5V A;  2ESU A;  4Z8S B;  4LO0 A;  1HKN A;  3RMY A;  4QD2 B;  4QD2 C;  4X38 A;  3A22 A;  1FGA A;  4OEF A;  2QYI B;  1ILR 1;  3IAG C;  4IQP A;  5D63 A;  1Z0H A;  3F1R A;  5F8W A;  3FJF A;  4ION A;  1AVA C;  4KC3 A;  4LO2 A;  1S0G A;  3FUQ A;  3VSF A;  4AN7 B;  5EHA A;  3HSM A;  4HJJ A;  4R6U B;  1IIL A;  2QN4 A;  2ZQO A;  2F8X C;  1L2H A;  1GGP B;  1M2T B;  3CRI A;  3IM6 A;  1HWN B;  3UJ0 A;  4D0Z A;  4F83 A;  5F90 A;  2VXR A;  4H9W A;  2VSE A;  1WBA A;  1W3A A;  3PUB A;  5F8S A;  3OGF A;  5FZZ A;  3T8S A;  3BA7 A;  2E4M C;  4G6J A;  3EF2 A;  3HMY A;  1DZC A;  4MZF B;  4UY4 A;  3VEQ A;  4DCK C;  3I2A A;  3AZV A;  5BQU C;  4EKX B;  3D7W B;  4TLP A;  3FJJ A;  3RSJ A;  3O4O A;  2LIQ A;  3W9T A;  2ERM A;  1YF8 B;  1Q1U A;  2HW9 A;  2WBC A;  3BB2 A;  1AVX B;  4EB2 B;  4J2K A;  3A23 A;  4ZLB B;  3NBD A;  3H6S E;  2YUG A;  1QQK A;  1J0S A;  3CA1 A;  1AVU A;  3CAH A;  4I4X A;  4JQ0 A;  3RTJ B;  5BXS A;  3FJD A;  5GAQ A;  1HWO B;  1M16 A;  4ZA3 B;  2ZQN A;  3BRG C;  5BQU A;  3BAQ A;  5BP5 A;  3VT2 A;  5BXT A;  3A21 A;  5JMC A;  41BI A;  3QYD A;  1PZZ A;  3BAV A;  4I37 A;  3AKI A;  5FNX A;  3V0A B;  1TTU A;  1DFQ A;  1DJS B;  1XZZ A;  1AVW B;  3HBW A;  3N7M A;  2KI4 A;  2BEB A;  1PUU B;  2KI6 B;  2X2S A;  4L4I A;  1VCL A;  1IJT A;  2VXT I;  3ZC8 A;  1FWV A;  1SR4 A;  3C9Z A;  1UPS A;  3BX1 C;  4I4V A;  4Z9W B;  3VSZ A;  6I1B A;  2BFH A;  3FJH A;  5FZY A;  3OBT A;  4I1B A;  3UD8 A;  4A7Z A;  1ISW A;  1S0D A;  4KEJ A;  3R4S A;  4GAF A;  1IOB A;  3V0A A;  4XKI A;  2I1B A;  3JUT A;  3O4C A;  3E8L C;  4I4Y A;  3KMV A;  2DRE A;  2P39 A;  4GP3 A;  1MD6 A;  4OW4 A;  3HN1 A;  1RZO B;  3FUO A;  3RMX A;  4QBV A;  3IM7 A;  2Y9W C;  4IZX A;  1RY7 A;  3AKH A;  4ZFY B;  7I1B A;  1IHK A;  3WMU A;  3FJB A;  4I7I A;  3O49 A;  3WO4 A;  1DQO A;  1CE7 B;  3BRD A;  4FVV A;  1AFC A;  3O44 A;  1WD4 A;  1V6U A;  1QQL A;  4GOV A;  4ZKT B;  2ZR1 B;  1F31 A;  3LLP A;  1DIW A;  1Q04 A;  2FGF A;  1BFC A;  4G1R A;  3POK A;  2Q9X A;  4G9N A;  4J2Y A;  3H6R B;  4A7Y A;  3NBC A;  3VT1 A;  3TC2 A;  3OGG A;  4D0T A;  3CA3 A;  5BXP A;  3CRH A;  4Q9P A;  1JY0 A;  1BAS A;  2D7R A;  3ZC9 A;  1S0F A;  1YTO A;  2UUS A;  1G9D A;  3CA5 A;  2GZB A;  2K8R A;  5EG6 C;  1BFB A;  1ONK B;  1XHB A;  2AAI B;  3FJC A;  5HPZ A;  3WA1 A;  1HIB A;  2FFV A;  5DZU A;  2R9K B;  3WO2 A;  3O3Q A;  4I6I A;  1II4 A;  4MZG B;  3P6I A;  2IHO A;  4QAL A;  1K5U A;  2VSA A;  3V0B B;  3MPP G;  1HWP B;  3AJ6 A;  4JP0 A;  3H6R A;  1YYN A;  2K4A B;  2Y9G A;  3N7L A;  3V79 C;  1QXM A;  2MLL B;  3AKG A;  1FMM S;  2ET2 A;  3BA5 A;  1YXW A;  1DLL A;  2LIE A;  4EFQ A;  2X2T A;  2VLC A;  1WBC A;  4GP0 A;  4QKS A;  2HZ9 A;  4HA2 A;  1JT5 A;  2BEA A;  3OJV A;  3S8K A;  1JT7 A;  1FMZ A;  3O4D A;  1HCD A;  1FWU A;  3AJ5 A;  3UDA A;  1TIE A;  3V0B A;  2FO1 A;  1ISZ A;  4AN6 A;  3Q7Y A;  2E4M A;  2NS2 A;  3I2X A;  3BTA A;  1RG8 A;  4G6M A;  4IYB A;  21BI A;  1SZ6 B;  4YOL A;  1RML A;  4LO1 C;  1WD3 A;  4XFS A;  3FJE A;  3N0K A;  4I1E A;  5DSS B;  3UD9 A;  2FDB M;  1MC9 A;  3IM5 A;  1A8D A;  3OJM A;  2F2F C;  3MAL A;  4X3A A;  3VT0 A;  3BA4 A;  2HWM A;  4OEG A;  4L4H A;  1KNM A;  3F62 B;  1NZK A;  4QBC A;  5F8Y A;  4GOY A;  2D20 A; 
#chains in the Genus database with same CATH homology
 1I1B A;  1JQZ A;  4OWL A;  4LO1 A;  4QKR A;  4XFU A;  1BFG A;  1HWM B;  1TFM B;  5FNW A;  3LTQ A;  2FFU A;  5DVH A;  3AH4 A;  2K43 A;  4LO3 C;  1BFF A;  1Z2V A;  3FJ8 A;  31BI A;  4JKX B;  4EFP A;  1NUN A;  4DEN A;  1W3G A;  4WBC A;  2NP0 A;  1R8O A;  4QC4 A;  1FV3 A;  5BOW A;  5E24 E;  4Q9G A;  3FFZ A;  3BAO A;  4OWJ A;  4J2S A;  4ZFU B;  1FV2 A;  1HCE A;  1ISV A;  2GO2 A;  3CA6 A;  1N4K A;  3WIN C;  1DZD A;  4LO3 A;  1TOO A;  4FGF A;  2L5X A;  2RG9 B;  3O4A A;  5BVP I;  4LO7 B;  4LO7 C;  1AF9 A;  4IY8 A;  4ZOT A;  4OUJ A;  1G9C A;  4H75 A;  4USO A;  3NBE A;  1T9F A;  3CA0 A;  3VUO A;  3RTI B;  4KBB A;  1S0B A;  1OQL B;  1Q03 A;  4H04 A;  3NJ5 A;  3FJI A;  4P0J A;  4I4P A;  1JT3 A;  1DQG A;  2Z48 A;  3BAH A;  3WIN A;  4HR6 C;  4IY9 A;  3BAU A;  1S0L A;  3CRG A;  4LO2 C;  2Z49 A;  1I1E A;  4JAW A;  4Q91 A;  4P0L A;  5I1B A;  1G9B A;  3FJA A;  4I4O A;  5D61 A;  4ZBV B;  1Z4S A;  2WRY A;  1T4Q A;  1P63 A;  3AKF A;  3NBN A;  2NTD A;  2IWT B;  3N7K A;  3QR5 A;  3Q7X A;  2NYY A;  2KLL A;  5FZU A;  3PHZ A;  4A7K A;  1E0O A;  3R4U A;  3OJ2 A;  3AH1 A;  3BAG A;  2AXM A;  5JLV A;  1V6V A;  1XG6 A;  2D22 A;  3P53 A;  3Q7W A;  3ZXG A;  1BA7 A;  3O4B A;  2D1Z A;  1YBI A;  1DFC A;  2DS0 A;  1TP0 A;  1W3F A;  4P0K A;  1G82 A;  4I96 A;  3H6Q A;  3P6J A;  3JRR A;  4I4S A;  4IHZ A;  3UD7 A;  1EVT A;  1JLX A;  5BXR A;  4IZE A;  4JKQ A;  1V6X A;  4CJM A;  3VWC A;  3IIR A;  5D62 A;  4F34 A;  4EFR A;  3ZXD A;  2Y9X E;  3BRF A;  5BP5 C;  4JPZ A;  1JLY A;  3UJ4 A;  2VUA A;  1JTC A;  1V6W A;  2NM1 A;  4I4U A;  4LO8 B;  1R8N A;  1CVS A;  4USP A;  4I3N A;  4X39 A;  4D8H A;  3HAL A;  9ILB A;  3FGM A;  4ZGR B;  2AQZ A;  1AXM A;  1BAR A;  3FJK A;  1PWA A;  4I8M A;  1XYF A;  1IRP A;  1G9A A;  4JRA A;  2DRY A;  2KH2 A;  3AZW A;  4G9M A;  4ZFW B;  3ZX7 A;  3CA4 A;  3WMV A;  2MC2 A;  1TWE A;  3PME A;  2D43 A;  4XFT A;  1BLA A;  1SR4 C;  2Q3N B;  2VU9 A;  4I4R A;  4QO3 A;  3ILA A;  4ISQ A;  1PUM B;  2DRZ A;  2RST A;  2F2F A;  4I0Y A;  3CU1 B;  1BLD A;  3BAD A;  5G00 A;  2XOA A;  4I2S A;  1ITB A;  4GAI A;  8I1B A;  4DEP A;  2D23 A;  1EV2 A;  3I29 B;  4J23 B;  2NVH A;  4P6A A;  2J3P A;  4OWK A;  1TWM A;  4PC4 A;  1ABR B;  3S8J A;  3A07 A;  2D44 A;  2M49 A;  4KEI A;  2NZ9 A;  2KKI A;  3O5W B;  1S0C A;  2P23 A;  2RQ9 A;  4KEK A;  3FJ9 A;  3SNV A;  4I4Q A;  3AH2 A;  3K1X A;  1ISY A;  2D24 A;  3B9U A;  4LO0 C;  5EC5 A;  4X37 A;  1IRA X;  1IT0 A;  2AFG A;  1FN0 A;  3HOM A;  1JT4 A;  1EPW A;  2D7I A;  4J2X A;  3OBR A;  3CQA A;  2Y9F A;  5B2H A;  4II0 A;  1EYL A;  3PG0 A;  3WO3 A;  1ISX A;  2MIB A;  2HWA A;  3N7J A;  1FQ9 A;  1D0H A;  1S0E A;  1PC8 B;  4EEE B;  4MZH A;  4OEE A;  4ISR A;  4END A;  5DUY A;  1K5V A;  2ESU A;  4Z8S B;  4LO0 A;  1HKN A;  3RMY A;  4QD2 B;  4QD2 C;  4X38 A;  3A22 A;  1FGA A;  4OEF A;  2QYI B;  1ILR 1;  3IAG C;  4IQP A;  5D63 A;  1Z0H A;  3F1R A;  5F8W A;  3FJF A;  4ION A;  1AVA C;  4KC3 A;  4LO2 A;  1S0G A;  3FUQ A;  3VSF A;  4AN7 B;  5EHA A;  3HSM A;  4HJJ A;  4R6U B;  1IIL A;  2QN4 A;  2ZQO A;  2F8X C;  1L2H A;  1GGP B;  1M2T B;  3CRI A;  3IM6 A;  1HWN B;  3UJ0 A;  4D0Z A;  4F83 A;  5F90 A;  2VXR A;  4H9W A;  2VSE A;  1WBA A;  1W3A A;  3PUB A;  5F8S A;  3OGF A;  5FZZ A;  3T8S A;  3BA7 A;  2E4M C;  4G6J A;  3EF2 A;  3HMY A;  1DZC A;  4MZF B;  4UY4 A;  3VEQ A;  4DCK C;  3I2A A;  3AZV A;  5BQU C;  4EKX B;  3D7W B;  4TLP A;  3FJJ A;  3RSJ A;  3O4O A;  2LIQ A;  3W9T A;  2ERM A;  1YF8 B;  1Q1U A;  2HW9 A;  2WBC A;  3BB2 A;  1AVX B;  4EB2 B;  4J2K A;  3A23 A;  4ZLB B;  3NBD A;  3H6S E;  2YUG A;  1QQK A;  1J0S A;  3CA1 A;  1AVU A;  3CAH A;  4I4X A;  4JQ0 A;  3RTJ B;  5BXS A;  3FJD A;  5GAQ A;  1HWO B;  1M16 A;  4ZA3 B;  2ZQN A;  3BRG C;  5BQU A;  3BAQ A;  5BP5 A;  3VT2 A;  5BXT A;  3A21 A;  5JMC A;  41BI A;  3QYD A;  1PZZ A;  3BAV A;  4I37 A;  3AKI A;  5FNX A;  3V0A B;  1TTU A;  1DFQ A;  1DJS B;  1XZZ A;  1AVW B;  3HBW A;  3N7M A;  2KI4 A;  2BEB A;  1PUU B;  2KI6 B;  2X2S A;  4L4I A;  1VCL A;  1IJT A;  2VXT I;  3ZC8 A;  1FWV A;  1SR4 A;  3C9Z A;  1UPS A;  3BX1 C;  4I4V A;  4Z9W B;  3VSZ A;  6I1B A;  2BFH A;  3FJH A;  5FZY A;  3OBT A;  4I1B A;  3UD8 A;  4A7Z A;  1ISW A;  1S0D A;  4KEJ A;  3R4S A;  4GAF A;  1IOB A;  3V0A A;  4XKI A;  2I1B A;  3JUT A;  3O4C A;  3E8L C;  4I4Y A;  3KMV A;  2DRE A;  2P39 A;  4GP3 A;  1MD6 A;  4OW4 A;  3HN1 A;  1RZO B;  3FUO A;  3RMX A;  4QBV A;  3IM7 A;  2Y9W C;  4IZX A;  1RY7 A;  3AKH A;  4ZFY B;  7I1B A;  1IHK A;  3WMU A;  3FJB A;  4I7I A;  3O49 A;  3WO4 A;  1DQO A;  1CE7 B;  3BRD A;  4FVV A;  1AFC A;  3O44 A;  1WD4 A;  1V6U A;  1QQL A;  4GOV A;  4ZKT B;  2ZR1 B;  1F31 A;  3LLP A;  1DIW A;  1Q04 A;  2FGF A;  1BFC A;  4G1R A;  3POK A;  2Q9X A;  4G9N A;  4J2Y A;  3H6R B;  4A7Y A;  3NBC A;  3VT1 A;  3TC2 A;  3OGG A;  4D0T A;  3CA3 A;  5BXP A;  3CRH A;  4Q9P A;  1JY0 A;  1BAS A;  2D7R A;  3ZC9 A;  1S0F A;  1YTO A;  2UUS A;  1G9D A;  3CA5 A;  2GZB A;  2K8R A;  5EG6 C;  1BFB A;  1ONK B;  1XHB A;  2AAI B;  3FJC A;  5HPZ A;  3WA1 A;  1HIB A;  2FFV A;  5DZU A;  2R9K B;  3WO2 A;  3O3Q A;  4I6I A;  1II4 A;  4MZG B;  3P6I A;  2IHO A;  4QAL A;  1K5U A;  2VSA A;  3V0B B;  3MPP G;  1HWP B;  3AJ6 A;  4JP0 A;  3H6R A;  1YYN A;  2K4A B;  2Y9G A;  3N7L A;  3V79 C;  1QXM A;  2MLL B;  3AKG A;  1FMM S;  2ET2 A;  3BA5 A;  1YXW A;  1DLL A;  2LIE A;  4EFQ A;  2X2T A;  2VLC A;  1WBC A;  4GP0 A;  4QKS A;  2HZ9 A;  4HA2 A;  1JT5 A;  2BEA A;  3OJV A;  3S8K A;  1JT7 A;  1FMZ A;  3O4D A;  1HCD A;  1FWU A;  3AJ5 A;  3UDA A;  1TIE A;  3V0B A;  2FO1 A;  1ISZ A;  4AN6 A;  3Q7Y A;  2E4M A;  2NS2 A;  3I2X A;  3BTA A;  1RG8 A;  4G6M A;  4IYB A;  21BI A;  1SZ6 B;  4YOL A;  1RML A;  4LO1 C;  1WD3 A;  4XFS A;  3FJE A;  3N0K A;  4I1E A;  5DSS B;  3UD9 A;  2FDB M;  1MC9 A;  3IM5 A;  1A8D A;  3OJM A;  2F2F C;  3MAL A;  4X3A A;  3VT0 A;  3BA4 A;  2HWM A;  4OEG A;  4L4H A;  1KNM A;  3F62 B;  1NZK A;  4QBC A;  5F8Y A;  4GOY A;  2D20 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...