2YANA

Crystal structure of the second glutaredoxin domain of human txnl2
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
105
structure length
105
Chain Sequence
SMAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKELKENGELLPILRGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUTAREDOXIN-3
publication title Crystal Structure of the Second Glutaredoxin Domain of Human Txnl2
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 36
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2yanA01
1Q4JA 4N30A 2J9HA 1V58A 3TOUA 5D8IA 5IMCA 1G6WA 3D6IA 2YOIA 3M0FA 1Y25A 3LYKA 2CVBA 3DYRA 1H75A 4JZQA 2WCIA 1EEJA 3HJPA 2B7JA 3IAS2 2H1BA 1BEDA 3D21A 1A8LA 3LGCA 2OACA 3EU3A 4BVXA 3GKKA 4IJ3A 5DBQA 1GP1A 1DBYA 3ZL5A 1X9SB 13GSA 4V2MA 2HZFA 2FA8A 3G7JA 4MF5A 1U87A 5ABRA 3FZAA 2VD0A 4X1UA 3C1SA 2XHFA 5A4WA 1GSSA 2H70A 3GTUA 4K7OA 2IWTA 2CX4A 4MABA 4KE3A 4PGTA 1Z6MA 1EGRA 5C04A 4MJCA 1ERVA 1Z7PA 2RUEA 1ZYQB 2HSYA 4IJIA 4HDEA 1V40A 1BAYA 3GV1A 2NTOA 4OWYA 1GSYA 2IPAA 4EVMA 2FUG2 2H1DA 2LQOA 2QGVA 4FH8A 2KP1A 3CTFA 4Q5QA 4O92A 3I6AA 2PWJA 3EVIA 1EGOA 1A0FA 3KZQA 1PD21 3DRNA 5DCHA 3MSZA 4D73A 2H76A 1M0UA 4YAVA 5FT3A 4L8EA 3QCPA 3ZREA 2QC7A 2C8UA 4ZB8A 2JADA 4BWQA 1JZRA 2R37A 1YZXA 4EE0A 2P31A 1GSUA 5CNWA 2FHEA 3H79A 4N11A 1FW1A 3ZMKA 3M1GA 3QDNA 4I2UA 3IPZA 3UBLA 2H75A 1OYJA 3GL3A 5FHIA 3VWVA 2HE3A 2NVLA 3C71A 3EYTA 4G10A 5EY6A 1ZMAA 4J56E 2V1MA 1MEKA 4GWRA 4ML6A 3TJFA 3GA4A 2C4JA 3VFIA 1V98A 5J4UA 4TRXA 1ABAA 4G2EA 1BQ7A 2WFCA 1MDJA 4BA7A 4MPGA 4LMVA 2MMOA 1T1VA 1M9BA 3GSSA 3D5JA 4H86A 3LEFA 1OKTA 3RHCA 3BD2A 1XWKA 4EUYA 2YNXA 5AIXA 1WRYA 4PNGA 1A2MA 5IPGA 4XHMA 1WMJA 3CSJA 1XVQA 3MNGA 3KXOA 1ZZYA 3TOTA 1PMTA 1K0DA 5KN3A 2E7PA 4JR6A 5B6NA 3LORA 1GL8A 2RLIA 4PUFC 3F4SA 3TDGA 3C1RA 1EV4A 3ZIVA 5A4UA 1XVWA 1OE7A 4HJMA 4PUAA 18GSA 5F0GA 3LSZA 2ALBA 2YWOA 1T8EB 1X5EA 2CZ2A 1N2AA 1F37A 2GQLA 2NDOA 2HZEA 4RI6A 3ZZXA 2ZUPA 1WPIA 3I43A 2HFDA 5F8BA 1G6YA 3VURA 3GFKA 2YWIA 2C3TA 3MAKA 4HEA2 4NAXA 4KX4A 5G1KA 2HRFA 1YY7A 1SD9A 1TP9A 3ME8A 5ECOB 1ML6A 1SKSB 3BBYA 3HY2A 4XS4A 3IDVA 2YANA 2IFQB 4WETA 2DJ1A 4KGIA 2H72A 1FB0A 4TR1B 2B5YA 4GXZA 1MTCA 3VPTA 4K2DA 2L4CA 2RUFA 2H01A 2EIQA 2PBJA 3QD9A 5J9BA 5EPFA 1GRXA 4CDOA 4LLRA 4IBPA 3GIXA 1JFUA 1GTUA 2YWNA 2GSQA 4MA9A 3GYKA 1QMVA 3SBCA 5LD0A 1U88A 2O85A 3KGKA 3HDCA 2H6YA 5HQPA 1GSEA 1BG5A 2HT9A 1JZWA 2CVKA 5ECNB 5IO2A 4F82A 4CHSA 3KJYA 1ERUA 3HXSA 1AQWA 3U5RE 1Z9HA 5JCWA 1DSBA 2GDRA 3PINA 2F8FA 2LNTA 4JE1A 5IO0A 1O8XA 3KEBA 17GSA 3WT1A 1TU7A 3F4TA 1YQ1A 3E3EA 5CRWA 3M9KA 1PX7A 2H73A 3ZVJD 2GT6A 1QQ2A 4K8MA 3TRXA 1VF4A 3GUSA 2OBKA 1TJDA 3L4NA 2N5FA 1ZYEA 3GX0A 4GSSA 5D9VA 1TW9A 2AHEA 3RPPA 1AAZA 4QQ7A 3APOA 4L5LA 3EE2A 2WDUA 4ZB9A 2R4VA 14GSA 4ML1A 4ZL7A 2LV3A 3RPNA 2ZNMA 3E9JB 2I4AA 3VWUA 3QAWA 3GKNA 5C00A 1GSDA 4TVEA 4HQZA 3FR9A 5DAKB 4TXVA 5E4WA 1AQXA 1S3AA 1RQMA 1NHYA 4L5OA 2K9FA 3CRUA 2EIOA 1OVNA 4POMA 1XOBA 2I1UA 2YP6A 2DBCA 1X5CA 1XWBA 4MDCA 8GSSA 4OMVA 2XBQA 1NSWA 1O8WA 1EV9A 3KTBA 2GT5A 3TB2A 4GLTA 2B3SA 3UARA 1SU9A 2FY6A 4WBRD 3KD0A 1A2JA 2V41A 5EL8A 3UIWA 3WT2A 4TKYA 4WEYA 1EEMA 2CV4A 3FYGA 4LL1B 5GAND 3D4TA 3GRXA 2I3YA 2M72A 2GGTA 3LJRA 1FVJA 1OC8A 1SKRB 2WULA 1TU8A 3F4RA 2YN1A 1GTBA 2YJ7A 1XW5A 3FR6A 3P2AA 2YV9A 1TRWA 2QSIA 2LRNA 5ID2B 2K18A 1HNAA 4O7HA 2VCXA 1ACVA 3QFAC 1T4YA 2H0HA 4IP6A 1PL1A 2LEGA 1EOGA 3D22A 2PMTA 1V9WA 3I9V2 4I6XA 2DJ3A 4V2NA 3IBHA 4KCAA 1EZKA 4HS1A 1TRUA 5GZZB 1U6TA 3P8WA 3CTGA 5DJLA 1KNGA 1TI1A 3GHAA 1MDIA 4ILFA 5GAPD 1YF0A 2C3NA 2FWFA 3M3MA 1PRXA 2MZCA 3VWXA 1VF2A 4IW9A 5G2ZA 1OC3A 2VD1A 3GURA 1M7TA 3GH9A 2AYTA 3LWAA 3FY7A 1VF1A 2PPTA 2X64A 3BCIA 3G7IA 4MLYA 1SJZA 3ERWA 5ECSA 5JWRB 2PN8A 4I97A 3RAZA 3ZLPA 3TJJA 1K0OA 2VUPA 4POBA 2PERA 3A3TA 3UMAA 4JEDA 2KUCA 2F9SA 10GSA 1XW6A 2GSSA 2FWHA 5D93A 5JWOB 2O89A 4NHZA 5IPHA 1G7EA 1THOA 2NPBA 2H19A 5HR2A 4OFNA 5D96A 1BJXA 3N5OA 3UJ1A 1VGLA 1VF3A 1H4OA 4PQHA 2HSHA 3EMXA 4EDZA 3L78A 4K1FA 3AY8A 5DCGA 5F06A 5ECHB 3GNJA 1AXDA 1FO5A 4F0CA 1GSQA 3Q19A 4KSMA 4ECJA 2JZTA 3UEMA 1E6BA 4YQUA 1OC9A 3O6TA 2VAFA 3I69A 1OE8A 1TRVA 2O8VB 4D73B 4J57E 1GULA 4HZ2A 4IELA 5ECLB 5H5QA 1GH2A 1TK5B 1PQNA 4G19A 2GZYA 4WKWA 1Z3EA 1F3BA 3KMNA 3LFLA 1UN2A 3KMOA 3P90A 2CQ9A 2JL4A 4ZILA 4ISDA 5EVOA 2DIZA 3F3QA 2MMNA 3F9UA 1WWJA 3PGTA 3IRAA 5CRDA 4X0XA 2V32A 4MMMA 3NOFA 1G7OA 4GF0A 4POKA 2VCQA 2OKAA 2OADA 4K0GA 2F8AA 1ZL9A 2WB9A 1GUKA 2H1AA 2GSTA 4ZBBA 1J08A 1PX6A 4ZXGA 3DEXA 1JLWA 5ECRB 2GZPA 1O73A 1LBKA 2DJ0A 3FHKA 5H5SA 1T7PB 3Q74A 4ECBA 2AUVA 4O5RA 1LJRA 4KNDA 2LJAA 4MZWA 3CXGA 1FVKA 1NW2A 4BVYA 4IGJA 2H6XA 5HFIA 5F07A 3KIJA 5AN1A 1S3CA 1XBSA 4LL4B 3ZITA 2JZSA 3J7Yk 1PGTA 2MMAA 3HJOA 4KAEA 3VWWA 3H93A 5KN1A 3LQ7A 1TTZA 4MZCA 2X8GA 3HZ8A 2CAQA 5DQSA 1GLQA 2PU9C 3DVWA 3ISOA 1QXHA 4AJ6A 2FD3A 3EINA 3F3RA 3QPMA 5HR1A 4MH2A 2G2QA 3IXRA 1U3IA 1URMA 2DIYA 2HZEB 4O32A 2PGTA 2MMZA 1SJIA 1OKDA 4WBJA 1K0AA 3L0HA 1O85A 2C3QA 2KHPA 1FG4A 3ZFLA 2DC5A 1ZOFA 5IIZA 4F9ZA 5AGYA 5CYYA 1R26A 4EF0A 2VM1A 5IMAA 1JHBA 4L0UA 1HYUA 3ZVJA 1A0RP 3H8QA 3W8JA 5IQYA 3LXTA 1QK8A 3FEUA 3ERGA 2I81A 2CA8A 3W8SA 1SK2A 2R3XA 3FKFA 4AF2A 4J2FA 2L4QA 2VL9A 2MBSA 2CVDA 5G30A 1J0FA 3FW2A 1HNBA 1EP7A 5IMZA 1AW9A 2XC2A 2HYXA 2YPMA 4ACSA 2WS2A 4OD7A 2X8HA 5G1LA 2C0FA 2XPDA 3QOUA 1RW1A 3TGZA 4YQVA 4FYCA 1SKWB 5GSSA 1I5GA 2JACA 3TJGA 3K8NA 4IKHA 4KCEA 6GSXA 5D9XA 3HJMA 4ID0A 1MD3A 4HJ2A 2J23A 3CSHA 16GSA 2YCDA 2AB6A 2PVOC 3DD3A 1USBA 5HFKA 4QL9A 3GH6A 2K8SA 4ECCA 4GRFA 1TKDB 2FNOA 5KN2A 4NPBA 5DDLA 1SYRA 5AISA 2XBIA 3LG6A 4WF4A 4IVFA 1O81A 2E0QA 4YH2A 2RM5A 3ZIJA 20GSA 4YAPA 1K0MA 4IP1A 4NV2A 3DVXA 5DALA 1ERTA 3P7XA 3ERFA 1AIUA 4DSSA 1GNWA 1N8JA 3HYPA 3L9VA 4OFTA 2OA7A 2FCHA 2IFQA 2VL3A 1R5AA 3A5WA 1GSFA 4I5QA 4KB3A 1GWCA 2ES7A 2GS3A 4HOJA 3DIEA 4TR0A 4EL1A 1VRSD 4TR1A 3O76A 1T3BA 1XIYA 3E0UA 4EXJA 1TI3A 4EKZA 3TKQA 1PSQA 2H6ZA 3WGDA 1R4WA 3QFBC 1V57A 3HVXA 4FYUA 4KDYA 12GSA 2REMA 3FZ5A 4GTUA 1XWGA 3MDKA 5B7CA 3D4MA 3RDWA 3FR3A 2WGRA 3LXZA 1ON4A 5DJMA 1M9AA 3TRQA 3EWLA 2R5GA 5B8BA 1YF1A 4KDUA 2YV7A 4V1Ap 3C7MA 5G5FA 3F6FA 4MCUA 2IMEA 1K3LA 3HD5A 5CO3A 2L59A 2IN3A 4AGSA 3G7YA 3TKSE 1XOAA 4HUAA 4ULXA 2V6OA 3CMIA 2OJLA 3F6DA 1K3YA 1X0RA 4WF5A 2MYGA 2O7KA 2GQKA 4CW9A 4HU9A 2CAIA 4NXIA 4PNFA 4WR5A 3G9BA 4LA1A 1IYIA 2C0EA 1G0TA 1A2LA 3GKXA 3FZ4A 4OCEA 3A2XA 4V1Ag 5KN0A 2VLVA 3NIVA 5A4VA 4XS6A 5ECQB 4LMWA 2ON7A 2HRNA 2CT6A 1AQVA 5KEJA 1ZGNA 1R5PA 3IK9A 3GL5A 3APSA 5IOXA 5ECMB 1LU4A 2FLSA 2OE1A 3D0ZA 2P5RA 4POLA 4K7IA 4MJEA 3J7Yb 6GSVA 1YKCA 5DAKA 1HQOA 3IR4A 4QL7A 4HQSA 3N9JA 1GLPA 1YDKA 3L9SA 2BTOT 3PR8A 3BOAA 1W89A 2FWEA 1IYHA 1XFLA 4KDXA 1FHEA 1V2AA 1WOUA 4PQ1A 1F9MA 3CBUA 3VLNA 3HKRA 1T00A 2GSRA 1SK1A 2IJYA 4V2LA 1YEXA 2OBIA 4BPYA 2AV4A 3QR6A 2WZ9A 2PVQA 2IMDA 2PUKC 4X43A 1C72A 1MDKA 4ZB6A 2VM2A 1ILOA 5L71A 3ZTLA 4KSOA 3EURA 4PURA 1U3AA 4GCIA 1YEPA 1B8XA 1E2YA 3KP8A 5CREA 6GSSA 3F63A 5IMDA 5D9WA 5IOWA 1O6JA 4GQCA 4ZL9A 2LSTA 3A2VA 3H1NA 1KTEA 3GKMA 3GSTA 2H74A 2VL2A 3EU4A 5ECPB 1WIKA 1XW9A 1JZDA 5ID2A 2F51A 5J5NA 5D73A 4I2TA 1J9BA 2LJRA 3TKRA 3V1WA 2CX3A 5B6MA 2VLUA 2TRXA 1K0CA 5F05A 3UVHA 3IHQA 1O7UA 3TKSC 1OC9B 1RK4A 4FIWA 4K7NA 4XCSA 4EDYA 3GTUB 3W6GA 2LRTA 4HU7A 3IV4A 2FWGA 4PX1A 3QMXA 4DSQA 3TCOA 3KCMA 3TKSA 5HR0A 4TXOA 2YZHA 1X9WB 3Q6OA 4MJBA 1FOVA 1W4VA 4KW6A 3HVVA 3VPQA 4AJ7A 5J3RA 3TUEA 5IMVA 1A8YA 1ST9A 1SL0B 1SL1B 2OE3A 5CP1A 4TR4A 1Z5YE 2KLXA 1B48A 1JZOA 3PH9A 2Z9SA 3FRCA 4F2IA 3M8NA 1XWCA 4BL7A 4FYBA 1DE2A 3UOMA 4K9ZA 2WJUA 4OO5A 2LUSA 4P3YB 1PKWA 1BYEA 4KA0A 1SYXA 4TN8A 3VI7A 3EC3A 3ME7A 1K0NA 5CAXA 1SL2B 3M9JA 3TKPA 1ERWA 4KH7A 2D2ZA 3DKSA 1GUHA 4NWYA 2VLTA 1XPVA 5ECIB 7GSSA 4N10A 2DLXA 1X5DA 2WRTA 4Z7XA 3IA1A 4L0WA 3R2QA 9GSSA 4Q5FA 4MP4A 4I8BA 1KBNA 3QAVA 1GTIA 1TRSA 2R2JA 1A23A 1A24A 4ZIJA 2HI7A 6GSYA 1B9XC 2K6VA 2N5BA 1M2BA 4MPFA 3UL3A 1R7HA 4Q5NA 2DJ2A 4ZL8A 2KOKA 2A2SA 1GUMA 2VCVA 1BX9A 2BJXA 1X9MB 3US3A 4F03A 2H1GA 4GSNA 1GNEA 4MH3A 3IC4A 2LS5A 3HZ4A 4MF7A 3CRTA 3GX8A 2L6CA 5ELGA 4K6XA 1GTAA 2HXKA 2IMIA 1CQGA 3DMLA 5G31A 4IQAA 4IN0A 1DUGA 5ENUA 5JCUA 4TR3A 4HI7A 5FWGA 2M46A 3ZMLA 2E2MA 4IQ1A 2A4VA 2VO4A 1TDIA 1FB6A 5D9TA 1OAZA 2VCWA 3O3TA 1B9YC 2DJJA 2MBTA 2IL3A 3FZ9A 2ON5A 1TOFA 4XS4B 3F8UA 3DWVA 4E8HA 5IM9A 1PKZA 2KP2A 3QAGA 4PQIA 3TRPA 2C0GA 2JSZA 4WXTA 2EIRA 6GSUA 1UA5A 2H8LA 5E59A 2R6KA 3OR5A 4XS1A 4PXOA 2DMMA 4ZBAA 2LTKA 2VOCA 2OE0A 1B4QA 3KTLA 2L5LA 3SWLA 3UVTA 5B8AA 2BMXA 3IOSA 1M99A 2LNSA 2DJKA 4KUNA 2HNLA 3CYNA 3NZNA 1I9DA 5A5KA 1DE1A 1PA3A 1PN9A 5DALB 1F3AA 3ZFBA 4Q5RA 4DSSB 5HFGA 4TW5A 4K0NA 2A2RA 1UVZA 3WGEA 2VCZA 2RIIA 2O87A 3A2WA 4RUVA 4N0ZA 1AC1A 2B1KA 3HVSA 4DSRA 4ECIA 2GVPA 2LQQA 1TXXA 1EWXA 2L5OA 2AAWA 5H5RA 4JRRA 3UBKA 4BWSA 2I9HA 2E2GA 1WP0A 2H71A 2TRCP 4WR4A 3JCML 3DXBA 1SD8A 2LJKA 4FO5A 5DVBA 4GQFA 2JSYA 4OCFA 3TJBA 3KM6A 5COHA 2ZCTA 3IE3A 5LNKe 4NHWA 1Q98A 5IMFA 3ZYWA 4N0VA 1K0BA 2GQMA 6GSTA 2VIMA 1JLVA 3EMPA 2P0GA 4TOPA 2K8VA 4XIHA 2IMKA 3H4KA 3U6VA 19GSA 2L6DA 1TK8B 6GSWA 4JBBA 1EP8A 2C80A 2GLRA 2XPEA 2B5XA 4DVCA 1F2EA 3GMFA 2M80A 4XRDA 1Y6EA 2QKEA 3TJKA 4MK3A 1AUCA 3HCZA 2NBSA 1M2AA 5G5EA 4IHUA 1KEBA 2RM6A 2GTUA 4EC0A 3LYPA 1UC7A 22GSA 2H0GA 3VK9A 3ZRDA 3WGXA 4EO3A 1EOHA 2YJHA 4RQXA 5ECKB 2B1LA 3C8EA 3Q18A 2P5QA 3F0IA 5JCGA 2AJQB 5J41A 5JWQB 4OO4A 1S3DA 1HNCA 2IIYA 5CRGA 5HR3A 2IMFA 2FA4A 4OFMA 4HZ4A 2B7KA 3RHBA 3HA9A 5INYA 3FK8A 3MWHA 4F0BA 5GSTA 1MD4A 3ED3A 3KP9A 1WJKA 1F6MC 1NM3A 1HD2A 1M2DA 1XWAA 3IK7A 1PL2A 2C0DA 5AIVA 5LCZA 4XTSA 2CZ3A 3L9UA 4NMUA 1SJ6A 4RQRA 2B6MA 3DGQA 4JR4A 2TIRA 3VI5A 4MF6A 2GZZA 3BCKA 3APQA 1THXA 3RBTA 2LRCA 1Z7RA 4JU5A 4DEJA 3C73A 1XCCA 1NHOA 5CRHA 1QFNA 4MJAA 1Z6NA 2H66A 1T4ZA 4IS0A 1YJ6A 2X99A 1XZOA 3KH9A 2L57A 2X8CA 2LKUA 1B4PA 1WE0A 5ELAA 4E8EA 5J9CA 2DSAA 4ZBDA 2YWMA 3WD6A 2JU5A 2VL2C 2V2GA 4MZBA 1CQHA 2N5AA 2DMLA 3CSIA 3BJ5A 3UAPA 1QUWA 4RI7A 1SENA 1YKAA 2H0IA 1TK0B 2YZUA 4TXOB 2G0FA 4AJ8A 1FAAA 2EC4A 2FGXA 3WYWA 2VCTA 4NV5A 1SK0A 2C1YA 3S9FA 4XRAA 4G9HA 4YQMA 1XXUA 1K3OA 3HHVA 11GSA 1ZCPA 2JZRA 2B5EA 4GSTA 3KH7A 1QGVA 2F3MA 2H30A 3GN3A 2V6KA 2HLSA 3IAM2 5DQYA
chains in the Genus database with same CATH superfamily
1Q4JA 4N30A 2J9HA 1V58A 3TOUA 5D8IA 5IMCA 1G6WA 3D6IA 2YOIA 3M0FA 1Y25A 3LYKA 2CVBA 3DYRA 5BRTA 1H75A 4JZQA 2WCIA 1EEJA 3HJPA 2B7JA 3IAS2 1ZYPA 2H1BA 1BEDA 3D21A 1A8LA 3LGCA 2OACA 3EU3A 4BVXA 3GKKA 4IJ3A 5DBQA 1GP1A 1DBYA 4Z2TA 3ZL5A 1X9SB 13GSA 4V2MA 2HZFA 2FA8A 3G7JA 4MF5A 1U87A 5ABRA 3FZAA 2VD0A 4X1UA 3C1SA 2XHFA 5A4WA 1GSSA 2H70A 3GTUA 4K7OA 2IWTA 2CX4A 4MABA 4KE3A 4PGTA 1Z6MA 1EGRA 5C04A 4MJCA 1ERVA 1Z7PA 2A2PA 2RUEA 1ZYQB 2HSYA 4IJIA 4HDEA 1V40A 1BAYA 3GV1A 2NTOA 4OWYA 1GSYA 2IPAA 4EVMA 2FUG2 2H1DA 2LQOA 2QGVA 4FH8A 2KP1A 3CTFA 4Q5QA 4O92A 3I6AA 2PWJA 3EVIA 1EGOA 3EPTA 1A0FA 3KZQA 1PD21 3DRNA 5DCHA 3MSZA 4D73A 2H76A 1M0UA 4YAVA 5FT3A 4L8EA 3QCPA 3ZREA 2QC7A 2C8UA 4ZB8A 2JADA 4BWQA 1JZRA 2R37A 1YZXA 4EE0A 2P31A 4G0LA 1GSUA 5CNWA 2FHEA 3H79A 4N11A 1FW1A 3ZMKA 3M1GA 3QDNA 4I2UA 3IPZA 3UBLA 2H75A 1OYJA 3GL3A 5FHIA 2DKIA 3VWVA 3MYDA 2HE3A 2NVLA 3C71A 3EYTA 4G10A 5EY6A 1ZMAA 4J56E 2V1MA 1MEKA 4GWRA 4ML6A 3TJFA 3GA4A 2C4JA 3VFIA 1V98A 5J4UA 4TRXA 1ABAA 4G2EA 1BQ7A 2WFCA 1MDJA 4BA7A 4MPGA 4LMVA 2MMOA 1T1VA 1M9BA 3GSSA 3D5JA 4H86A 3LEFA 1OKTA 3RHCA 3BD2A 1XWKA 4EUYA 2YNXA 5AIXA 1WRYA 4PNGA 1A2MA 5IPGA 4XHMA 4K5RA 1WMJA 3CSJA 1XVQA 3MNGA 3KXOA 1ZZYA 3TOTA 1PMTA 1K0DA 5KN3A 2E7PA 4JR6A 5B6NA 3LORA 1GL8A 2RLIA 4PUFC 3F4SA 3TDGA 3C1RA 1EV4A 3ZIVA 5A4UA 1XVWA 1OE7A 4HJMA 4PUAA 18GSA 5F0GA 3LSZA 2ALBA 2YWOA 1T8EB 1X5EA 2CZ2A 1N2AA 1F37A 2GQLA 2NDOA 2HZEA 4RI6A 3ZZXA 2ZUPA 1WPIA 3I43A 2HFDA 5F8BA 1G6YA 3VURA 3GFKA 2YWIA 2C3TA 3MAKA 4HEA2 4NAXA 4KX4A 5G1KA 2HRFA 1YY7A 1SD9A 1TP9A 3ME8A 5ECOB 1ML6A 1SKSB 3BBYA 3HY2A 4XS4A 3IDVA 2YANA 2IFQB 4WETA 2DJ1A 4KGIA 2H72A 1FB0A 4CY8A 4TR1B 2B5YA 4GXZA 1MTCA 3VPTA 4K2DA 2L4CA 2RUFA 2H01A 2EIQA 2PBJA 4EIQA 3QD9A 5J9BA 5EPFA 1GRXA 4CDOA 4LLRA 4IBPA 3GIXA 1JFUA 1GTUA 2YWNA 2GSQA 4MA9A 3GYKA 5KOWA 1QMVA 3SBCA 5LD0A 1U88A 2O85A 3KGKA 3HDCA 2H6YA 5HQPA 1GSEA 1BG5A 2HT9A 1JZWA 2CVKA 5ECNB 3PPUA 5IO2A 4F82A 4CHSA 3KJYA 3MIXA 1ERUA 3HXSA 1AQWA 3U5RE 1Z9HA 5JCWA 1DSBA 2GDRA 3PINA 2F8FA 2LNTA 4JE1A 5IO0A 1O8XA 3KEBA 17GSA 3WT1A 1TU7A 3F4TA 1YQ1A 3E3EA 5CRWA 3M9KA 1PX7A 2H73A 3ZVJD 2GT6A 1QQ2A 4K8MA 3TRXA 1VF4A 3GUSA 2OBKA 1TJDA 3L4NA 2N5FA 1ZYEA 2R0GA 3GX0A 4GSSA 5D9VA 1TW9A 2AHEA 3RPPA 1AAZA 4QQ7A 3APOA 4L5LA 3EE2A 2WDUA 4ZB9A 2R4VA 14GSA 4ML1A 4ZL7A 2LV3A 3RPNA 2ZNMA 3E9JB 2I4AA 3VWUA 3QAWA 3GKNA 5C00A 1GSDA 4TVEA 4HQZA 3FR9A 5DAKB 4TXVA 2HRAA 5E4WA 1AQXA 1S3AA 1RQMA 1NHYA 4L5OA 2K9FA 3CRUA 2EIOA 1OVNA 4POMA 1XOBA 2I1UA 2YP6A 2DBCA 1X5CA 1XWBA 4MDCA 8GSSA 4OMVA 2XBQA 1NSWA 1O8WA 1EV9A 3KTBA 2GT5A 3TB2A 4GLTA 2B3SA 3UARA 4YKGA 1SU9A 2FY6A 4WBRD 3KD0A 1A2JA 2V41A 5EL8A 3UIWA 3WT2A 4TKYA 4WEYA 1EEMA 2CV4A 3FYGA 4LL1B 5GAND 3D4TA 3GRXA 2I3YA 2M72A 2GGTA 3FMWA 3LJRA 1FVJA 2R0PA 1OC8A 1SKRB 2WULA 1TU8A 3F4RA 2YN1A 1GTBA 2YJ7A 1XW5A 3FR6A 3P2AA 2YV9A 1TRWA 2QSIA 4KF9A 2LRNA 5ID2B 2K18A 1HNAA 4O7HA 2VCXA 1ACVA 3QFAC 1T4YA 2H0HA 4IP6A 1PL1A 2LEGA 1EOGA 3D22A 2PMTA 1V9WA 3I9V2 4I6XA 2DJ3A 4V2NA 3IBHA 4KCAA 1EZKA 4HS1A 1TRUA 5GZZB 1U6TA 3P8WA 3CTGA 5DJLA 4EIPA 1KNGA 1TI1A 3GHAA 1MDIA 4ILFA 5GAPD 1YF0A 2C3NA 2FWFA 3M3MA 1PRXA 2MZCA 3VWXA 1VF2A 4IW9A 5G2ZA 1OC3A 2VD1A 3GURA 1M7TA 3GH9A 2AYTA 3LWAA 3FY7A 1VF1A 2PPTA 2X64A 4BVXB 2R0CA 3BCIA 3G7IA 4MLYA 1SJZA 3ERWA 5ECSA 5JWRB 2PN8A 4I97A 3RAZA 3ZLPA 3TJJA 1K0OA 2VUPA 4POBA 2PERA 4BL7B 3A3TA 3UMAA 4JEDA 2KUCA 2F9SA 10GSA 1XW6A 2GSSA 2FWHA 5D93A 5JWOB 2O89A 4NHZA 5IPHA 1G7EA 1THOA 2NPBA 2H19A 5HR2A 4OFNA 5D96A 1BJXA 3N5OA 3UJ1A 1VGLA 1VF3A 1H4OA 4PQHA 2HSHA 3EMXA 4EDZA 3L78A 4K1FA 3AY8A 5DCGA 5F06A 5ECHB 3GNJA 1AXDA 1FO5A 4F0CA 1GSQA 3Q19A 4KSMA 4ECJA 2JZTA 3UEMA 1E6BA 4YQUA 4PTSA 1OC9A 3O6TA 2VAFA 3I69A 1OE8A 1TRVA 2O8VB 4D73B 4J57E 1GULA 4HZ2A 4IELA 5ECLB 5H5QA 1GH2A 1TK5B 1PQNA 4G19A 2GZYA 4WKWA 1Z3EA 1F3BA 3KMNA 3LFLA 1UN2A 3KMOA 3P90A 2CQ9A 2JL4A 4ZILA 4ISDA 5EVOA 2DIZA 3F3QA 2MMNA 3F9UA 1WWJA 3PGTA 3IRAA 5CRDA 4X0XA 2V32A 4MMMA 3NOFA 1G7OA 4GF0A 4POKA 2VCQA 2OKAA 2OADA 4K0GA 2F8AA 1ZL9A 2WB9A 1GUKA 2H1AA 2GSTA 4ZBBA 1J08A 1PX6A 4ZXGA 3DEXA 1JLWA 5ECRB 2GZPA 1O73A 1LBKA 2DJ0A 3FHKA 5H5SA 1T7PB 3Q74A 4ECBA 2AUVA 4O5RA 1LJRA 4KNDA 2LJAA 4MZWA 3CXGA 1FVKA 1NW2A 4A5PA 4BVYA 4IGJA 2H6XA 5HFIA 5F07A 3KIJA 5AN1A 1S3CA 1XBSA 4LL4B 3ZITA 2JZSA 3J7Yk 1PGTA 2MMAA 3HJOA 4KAEA 3VWWA 3H93A 5KN1A 3R3EA 3LQ7A 1TTZA 4MZCA 2X8GA 3HZ8A 2CAQA 5DQSA 1GLQA 2PU9C 3DVWA 3ISOA 1QXHA 4AJ6A 2FD3A 3EINA 3F3RA 3QPMA 5HR1A 4MH2A 4BIKA 2G2QA 3IXRA 1U3IA 1URMA 2DIYA 2HZEB 4O32A 2PGTA 2MMZA 1SJIA 1OKDA 4WBJA 1K0AA 3L0HA 1O85A 2C3QA 2KHPA 1FG4A 3ZFLA 2DC5A 1ZOFA 5IIZA 4F9ZA 5AGYA 5CYYA 1R26A 2QA1A 4EF0A 2VM1A 5IMAA 1JHBA 4L0UA 1HYUA 4USSA 3ZVJA 1A0RP 3H8QA 3W8JA 5IQYA 3LXTA 1QK8A 3FEUA 3ERGA 2I81A 2CA8A 3W8SA 1SK2A 2R3XA 3FKFA 4AF2A 4J2FA 2L4QA 2VL9A 2MBSA 2CVDA 5G30A 1J0FA 3FW2A 1HNBA 1EP7A 5IMZA 1AW9A 2XC2A 2HYXA 2YPMA 4ACSA 2WS2A 4OD7A 2X8HA 5G1LA 2C0FA 2XPDA 3QOUA 1RW1A 3TGZA 1PN0A 4YQVA 4FYCA 1SKWB 5GSSA 1I5GA 2JACA 3TJGA 3K8NA 4IKHA 4KCEA 6GSXA 5D9XA 3HJMA 4ID0A 1MD3A 4HJ2A 2J23A 3CSHA 16GSA 2YCDA 2AB6A 2PVOC 3DD3A 1USBA 5HFKA 4QL9A 3GH6A 2K8SA 4ECCA 5BMUA 4GRFA 1TKDB 2FNOA 5KN2A 4NPBA 5DDLA 1SYRA 5AISA 2XBIA 3LG6A 4WF4A 4IVFA 1O81A 2E0QA 4YH2A 2RM5A 3ZIJA 2HSMA 20GSA 4YAPA 1K0MA 4IP1A 4NV2A 3DVXA 4X4JA 5DALA 1ERTA 3P7XA 3ERFA 1AIUA 4DSSA 1GNWA 1N8JA 3HYPA 3L9VA 4OFTA 2OA7A 2FCHA 2IFQA 2VL3A 1R5AA 3A5WA 3HVNA 1GSFA 4I5QA 4KB3A 1GWCA 2ES7A 2GS3A 4HOJA 3DIEA 4TR0A 4EL1A 1VRSD 4TR1A 3O76A 1T3BA 1XIYA 3E0UA 4EXJA 1TI3A 4EKZA 3TKQA 1PSQA 2H6ZA 3WGDA 1R4WA 3QFBC 1V57A 3HVXA 4FYUA 4KDYA 12GSA 2REMA 3FZ5A 4GTUA 1XWGA 3MDKA 5B7CA 3D4MA 3RDWA 3FR3A 2WGRA 3LXZA 1ON4A 5DJMA 1M9AA 3TRQA 3EWLA 2R5GA 5B8BA 1YF1A 4KDUA 2YV7A 4V1Ap 3C7MA 4O5QA 5G5FA 3F6FA 3IHGA 4MCUA 2IMEA 1K3LA 3LW9A 3HD5A 5CO3A 2L59A 2IN3A 4AGSA 3G7YA 3TKSE 1XOAA 2HRKA 4HUAA 4ULXA 2V6OA 3CMIA 2OJLA 3F6DA 1K3YA 1X0RA 4WF5A 2MYGA 2O7KA 2GQKA 4CW9A 4HU9A 2CAIA 4NXIA 4PNFA 4WR5A 3G9BA 4LA1A 1IYIA 2C0EA 4O5UA 1G0TA 1A2LA 3GKXA 3FZ4A 4OCEA 3A2XA 4V1Ag 5KN0A 2VLVA 3NIVA 5A4VA 4XS6A 5ECQB 4LMWA 2ON7A 2HRNA 2CT6A 1AQVA 5KEJA 1ZGNA 1R5PA 3IK9A 3GL5A 3APSA 5IOXA 5ECMB 2A4HA 1LU4A 2FLSA 2OE1A 3D0ZA 2P5RA 4POLA 4K7IA 4MJEA 3J7Yb 6GSVA 4MNNA 1YKCA 5DAKA 1HQOA 3IR4A 4QL7A 4HQSA 3N9JA 1GLPA 1YDKA 3L9SA 2BTOT 3PR8A 3BOAA 3CQFA 1W89A 2FWEA 1IYHA 1XFLA 4KDXA 1FHEA 1V2AA 1WOUA 4PQ1A 1F9MA 3CBUA 3VLNA 3HKRA 1T00A 2GSRA 1SK1A 2IJYA 4V2LA 1YEXA 2OBIA 4BPYA 2AV4A 3QR6A 2WZ9A 2PVQA 2IMDA 2PUKC 4X43A 1C72A 1MDKA 4ZB6A 2VM2A 1ILOA 5L71A 3ZTLA 4KSOA 3EURA 4PURA 1U3AA 4GCIA 1YEPA 1B8XA 1E2YA 3KP8A 5CREA 6GSSA 3F63A 5IMDA 5D9WA 5IOWA 1O6JA 4GQCA 4ZL9A 2LSTA 3A2VA 3H1NA 1KTEA 3GKMA 3GSTA 2H74A 2VL2A 3EU4A 5ECPB 1WIKA 1XW9A 1JZDA 5ID2A 2F51A 5J5NA 5D73A 4I2TA 1J9BA 2LJRA 3TKRA 3V1WA 2CX3A 5B6MA 2VLUA 2TRXA 1K0CA 5F05A 3UVHA 3IHQA 1O7UA 3TKSC 1OC9B 1RK4A 4FIWA 4K7NA 4XCSA 4EDYA 3GTUB 3W6GA 2LRTA 4HU7A 3IV4A 2FWGA 4PX1A 1M3IA 3QMXA 4DSQA 3TCOA 3KCMA 3TKSA 5HR0A 4TXOA 2YZHA 1X9WB 3Q6OA 4MJBA 1FOVA 1W4VA 4KW6A 3HVVA 3VPQA 4AJ7A 5J3RA 3TUEA 5IMVA 1A8YA 1ST9A 1S3RA 1SL0B 1SL1B 2OE3A 5CP1A 4TR4A 1Z5YE 2KLXA 1B48A 1JZOA 3PH9A 2Z9SA 2X4AA 3FRCA 4F2IA 3M8NA 1XWCA 4BL7A 4FYBA 1FOHA 1DE2A 3UOMA 3IC8A 4K9ZA 2WJUA 4OO5A 2LUSA 4P3YB 1PKWA 1BYEA 2QA2A 4KA0A 4BVYB 1SYXA 4TN8A 3VI7A 3EC3A 3ME7A 1K0NA 5CAXA 1SL2B 3M9JA 3TKPA 1ERWA 4KH7A 2D2ZA 3DKSA 4CY6A 1GUHA 2UZ8A 4NWYA 2VLTA 1XPVA 5ECIB 7GSSA 4N10A 2DLXA 1X5DA 2WRTA 4Z7XA 3IA1A 4L0WA 3R2QA 9GSSA 4Q5FA 4MP4A 4HSCX 4I8BA 1KBNA 3QAVA 1GTIA 1TRSA 2R2JA 1A23A 1A24A 4ZIJA 2HI7A 6GSYA 1B9XC 2K6VA 2N5BA 1M2BA 4MPFA 3UL3A 1R7HA 4Q5NA 2DJ2A 4ZL8A 2KOKA 2A2SA 1GUMA 2VCVA 1BX9A 2BJXA 1X9MB 3US3A 4F03A 2H1GA 4GSNA 1GNEA 4MH3A 3IC4A 2LS5A 3HZ4A 4MF7A 3CRTA 3GX8A 2L6CA 1PFOA 4Z2UA 5ELGA 4K6XA 1GTAA 2HXKA 2IMIA 1CQGA 3DMLA 5G31A 4IQAA 4IN0A 1DUGA 5ENUA 5JCUA 4TR3A 4HI7A 5FWGA 2M46A 3ZMLA 2E2MA 4IQ1A 2A4VA 2VO4A 1TDIA 1FB6A 5D9TA 1OAZA 2VCWA 3O3TA 1B9YC 2DJJA 2MBTA 2IL3A 3FZ9A 2ON5A 1TOFA 4XS4B 3F8UA 3DWVA 1XG8A 4K2XA 4E8HA 5IM9A 1PKZA 2KP2A 3QAGA 4PQIA 3TRPA 2C0GA 2JSZA 4WXTA 2EIRA 6GSUA 1UA5A 2H8LA 5E59A 2R6KA 3OR5A 4XS1A 4PXOA 2DMMA 4FQUA 4ZBAA 4Z2RA 2LTKA 2VOCA 2OE0A 1B4QA 3KTLA 2L5LA 3SWLA 3UVTA 5B8AA 2BMXA 3IOSA 1M99A 2LNSA 2DJKA 4KUNA 2HNLA 3CYNA 3NZNA 1I9DA 5A5KA 4K5SA 1DE1A 1PA3A 1PN9A 5DALB 1F3AA 3ZFBA 4Q5RA 4DSSB 4YKFA 5HFGA 4TW5A 4K0NA 2A2RA 1UVZA 3WGEA 2VCZA 2RIIA 2O87A 3A2WA 4RUVA 4N0ZA 1AC1A 2B1KA 3HVSA 4DSRA 4ECIA 2GVPA 2LQQA 1TXXA 1EWXA 1M3JA 2L5OA 2AAWA 5H5RA 4JRRA 3UBKA 4BWSA 2I9HA 2E2GA 1WP0A 2H71A 2TRCP 4WR4A 3JCML 3DXBA 1SD8A 2LJKA 4FO5A 5DVBA 4GQFA 2JSYA 4OCFA 3TJBA 3KM6A 5COHA 2ZCTA 3IE3A 5LNKe 4NHWA 1Q98A 5IMFA 3ZYWA 2X49A 4N0VA 1K0BA 2GQMA 6GSTA 2VIMA 1JLVA 3EMPA 2P0GA 4TOPA 2K8VA 4XIHA 2IMKA 3H4KA 3U6VA 19GSA 2L6DA 1TK8B 6GSWA 4JBBA 1EP8A 2C80A 2GLRA 2XPEA 2B5XA 4DVCA 1F2EA 3GMFA 2M80A 4XRDA 1Y6EA 2QKEA 3TJKA 4MK3A 1AUCA 3HCZA 2NBSA 1M2AA 5G5EA 4IHUA 1KEBA 2RM6A 2GTUA 4EC0A 3LYPA 1UC7A 22GSA 2H0GA 3VK9A 3ZRDA 3WGXA 4EO3A 1EOHA 2YJHA 4RQXA 5ECKB 2B1LA 3C8EA 3Q18A 2P5QA 3F0IA 5JCGA 2AJQB 5J41A 2DKHA 5JWQB 4OO4A 3A5IA 1S3DA 1HNCA 2IIYA 5CRGA 5HR3A 2IMFA 2FA4A 4OFMA 4HZ4A 2B7KA 3RHBA 3HA9A 5INYA 3FK8A 3MWHA 4F0BA 5GSTA 1MD4A 3ED3A 3KP9A 1WJKA 1F6MC 1NM3A 1HD2A 1M2DA 1XWAA 3IK7A 1PL2A 2C0DA 5AIVA 5LCZA 4XTSA 2CZ3A 3L9UA 4NMUA 1SJ6A 4RQRA 2B6MA 3DGQA 4JR4A 2TIRA 3VI5A 4MF6A 2GZZA 3BCKA 3APQA 1THXA 3RBTA 2LRCA 5KOXA 1Z7RA 4JU5A 4DEJA 3C73A 1XCCA 1NHOA 5CRHA 1QFNA 4MJAA 1Z6NA 2H66A 1T4ZA 4IS0A 1YJ6A 2X99A 1XZOA 3KH9A 2L57A 2X8CA 2LKUA 1B4PA 1WE0A 5ELAA 4E8EA 5J9CA 2DSAA 4ZBDA 2YWMA 3WD6A 2JU5A 2VL2C 2V2GA 4MZBA 1CQHA 2N5AA 2DMLA 3CSIA 3BJ5A 3UAPA 1QUWA 4RI7A 1SENA 1YKAA 2H0IA 1TK0B 2YZUA 4TXOB 2G0FA 4AJ8A 1FAAA 2EC4A 2FGXA 4G0KA 3WYWA 4ICYA 2VCTA 4NV5A 1SK0A 2C1YA 3S9FA 4XRAA 4G9HA 4YQMA 1ZYNA 1XXUA 1K3OA 3HHVA 11GSA 1ZCPA 2JZRA 2B5EA 4GSTA 3KH7A 1QGVA 2F3MA 2H30A 3GN3A 2V6KA 2HLSA 3IAM2 5DQYA 4G0IA
chains in the Genus database with same CATH topology
1Q4JA 4N30A 2J9HA 1V58A 3TOUA 5D8IA 5IMCA 1G6WA 3D6IA 2YOIA 3M0FA 1Y25A 3LYKA 2CVBA 3DYRA 5BRTA 1H75A 4JZQA 2WCIA 1EEJA 3HJPA 2B7JA 3IAS2 1ZYPA 2H1BA 1BEDA 3D21A 1A8LA 3LGCA 2OACA 3EU3A 4BVXA 3GKKA 4IJ3A 5DBQA 1GP1A 1DBYA 4Z2TA 3ZL5A 1X9SB 13GSA 4V2MA 2HZFA 2FA8A 3G7JA 4MF5A 1U87A 5ABRA 3FZAA 2VD0A 4X1UA 3C1SA 2XHFA 5A4WA 1GSSA 2H70A 3GTUA 4K7OA 2IWTA 2CX4A 4MABA 4KE3A 4PGTA 1Z6MA 1EGRA 5C04A 4MJCA 1ERVA 1Z7PA 2A2PA 2RUEA 1ZYQB 2HSYA 4IJIA 4HDEA 1V40A 1BAYA 3GV1A 2NTOA 4OWYA 1GSYA 2IPAA 4EVMA 2FUG2 2H1DA 2LQOA 2QGVA 4FH8A 2KP1A 3CTFA 4Q5QA 4O92A 3I6AA 2PWJA 3EVIA 1EGOA 3EPTA 1A0FA 3KZQA 1PD21 3DRNA 5DCHA 3MSZA 4D73A 2H76A 1M0UA 4YAVA 5FT3A 4L8EA 3QCPA 3ZREA 2QC7A 2C8UA 4ZB8A 2JADA 4BWQA 1JZRA 2R37A 1YZXA 4EE0A 2P31A 4G0LA 1GSUA 5CNWA 2FHEA 3H79A 4N11A 1FW1A 3ZMKA 3M1GA 3QDNA 4I2UA 3IPZA 3UBLA 2H75A 1OYJA 3GL3A 5FHIA 2DKIA 3VWVA 3MYDA 2HE3A 2NVLA 3C71A 3EYTA 4G10A 5EY6A 1ZMAA 4J56E 2V1MA 1MEKA 4GWRA 4ML6A 3TJFA 3GA4A 2C4JA 3VFIA 1V98A 5J4UA 4TRXA 1ABAA 4G2EA 1BQ7A 2WFCA 1MDJA 4BA7A 4MPGA 4LMVA 2MMOA 1T1VA 1M9BA 3GSSA 3D5JA 4H86A 3LEFA 1OKTA 3RHCA 3BD2A 1XWKA 4EUYA 2YNXA 5AIXA 1WRYA 4PNGA 1A2MA 5IPGA 4XHMA 4K5RA 1WMJA 3CSJA 1XVQA 3MNGA 3KXOA 1ZZYA 3TOTA 1PMTA 1K0DA 5KN3A 2E7PA 4JR6A 5B6NA 3LORA 1GL8A 2RLIA 4PUFC 3F4SA 3TDGA 3C1RA 1EV4A 3ZIVA 5A4UA 1XVWA 1OE7A 4HJMA 4PUAA 18GSA 5F0GA 3LSZA 2ALBA 2YWOA 1T8EB 1X5EA 2CZ2A 1N2AA 1F37A 2GQLA 2NDOA 2HZEA 4RI6A 3ZZXA 2ZUPA 1WPIA 3I43A 2HFDA 5F8BA 1G6YA 3VURA 3GFKA 2YWIA 2C3TA 3MAKA 4HEA2 4NAXA 4KX4A 5G1KA 2HRFA 1YY7A 1SD9A 1TP9A 3ME8A 5ECOB 1ML6A 1SKSB 3BBYA 3HY2A 4XS4A 3IDVA 2YANA 2IFQB 4WETA 2DJ1A 4KGIA 2H72A 1FB0A 4CY8A 4TR1B 2B5YA 4GXZA 1MTCA 3VPTA 4K2DA 2L4CA 2RUFA 2H01A 2EIQA 2PBJA 4EIQA 3QD9A 5J9BA 5EPFA 1GRXA 4CDOA 4LLRA 4IBPA 3GIXA 1JFUA 1GTUA 2YWNA 2GSQA 4MA9A 3GYKA 5KOWA 1QMVA 3SBCA 5LD0A 1U88A 2O85A 3KGKA 3HDCA 2H6YA 5HQPA 1GSEA 1BG5A 2HT9A 1JZWA 2CVKA 5ECNB 3PPUA 5IO2A 4F82A 4CHSA 3KJYA 3MIXA 1ERUA 3HXSA 1AQWA 3U5RE 1Z9HA 5JCWA 1DSBA 2GDRA 3PINA 2F8FA 2LNTA 4JE1A 5IO0A 1O8XA 3KEBA 17GSA 3WT1A 1TU7A 3F4TA 1YQ1A 3E3EA 5CRWA 3M9KA 1PX7A 2H73A 3ZVJD 2GT6A 1QQ2A 4K8MA 3TRXA 1VF4A 3GUSA 2OBKA 1TJDA 3L4NA 2N5FA 1ZYEA 2R0GA 3GX0A 4GSSA 5D9VA 1TW9A 2AHEA 3RPPA 1AAZA 4QQ7A 3APOA 4L5LA 3EE2A 2WDUA 4ZB9A 2R4VA 14GSA 4ML1A 4ZL7A 2LV3A 3RPNA 2ZNMA 3E9JB 2I4AA 3VWUA 3QAWA 3GKNA 5C00A 1GSDA 4TVEA 4HQZA 3FR9A 5DAKB 4TXVA 2HRAA 5E4WA 1AQXA 1S3AA 1RQMA 1NHYA 4L5OA 2K9FA 3CRUA 2EIOA 1OVNA 4POMA 1XOBA 2I1UA 2YP6A 2DBCA 1X5CA 1XWBA 4MDCA 8GSSA 4OMVA 2XBQA 1NSWA 1O8WA 1EV9A 3KTBA 2GT5A 3TB2A 4GLTA 2B3SA 3UARA 4YKGA 1SU9A 2FY6A 4WBRD 3KD0A 1A2JA 2V41A 5EL8A 3UIWA 3WT2A 4TKYA 4WEYA 1EEMA 2CV4A 3FYGA 4LL1B 5GAND 3D4TA 3GRXA 2I3YA 2M72A 2GGTA 3FMWA 3LJRA 1FVJA 2R0PA 1OC8A 1SKRB 2WULA 1TU8A 3F4RA 2YN1A 1GTBA 2YJ7A 1XW5A 3FR6A 3P2AA 2YV9A 1TRWA 2QSIA 4KF9A 2LRNA 5ID2B 2K18A 1HNAA 4O7HA 2VCXA 1ACVA 3QFAC 1T4YA 2H0HA 4IP6A 1PL1A 2LEGA 1EOGA 3D22A 2PMTA 1V9WA 3I9V2 4I6XA 2DJ3A 4V2NA 3IBHA 4KCAA 1EZKA 4HS1A 1TRUA 5GZZB 1U6TA 3P8WA 3CTGA 5DJLA 4EIPA 1KNGA 1TI1A 3GHAA 1MDIA 4ILFA 5GAPD 1YF0A 2C3NA 2FWFA 3M3MA 1PRXA 2MZCA 3VWXA 1VF2A 4IW9A 5G2ZA 1OC3A 2VD1A 3GURA 1M7TA 3GH9A 2AYTA 3LWAA 3FY7A 1VF1A 2PPTA 2X64A 4BVXB 2R0CA 3BCIA 3G7IA 4MLYA 1SJZA 3ERWA 5ECSA 5JWRB 2PN8A 4I97A 3RAZA 3ZLPA 3TJJA 1K0OA 2VUPA 4POBA 2PERA 4BL7B 3A3TA 3UMAA 4JEDA 2KUCA 2F9SA 10GSA 1XW6A 2GSSA 2FWHA 5D93A 5JWOB 2O89A 4NHZA 5IPHA 1G7EA 1THOA 2NPBA 2H19A 5HR2A 4OFNA 5D96A 1BJXA 3N5OA 3UJ1A 1VGLA 1VF3A 1H4OA 4PQHA 2HSHA 3EMXA 4EDZA 3L78A 4K1FA 3AY8A 5DCGA 5F06A 5ECHB 3GNJA 1AXDA 1FO5A 4F0CA 1GSQA 3Q19A 4KSMA 4ECJA 2JZTA 3UEMA 1E6BA 4YQUA 4PTSA 1OC9A 3O6TA 2VAFA 3I69A 1OE8A 1TRVA 2O8VB 4D73B 4J57E 1GULA 4HZ2A 4IELA 5ECLB 5H5QA 1GH2A 1TK5B 1PQNA 4G19A 2GZYA 4WKWA 1Z3EA 1F3BA 3KMNA 3LFLA 1UN2A 3KMOA 3P90A 2CQ9A 2JL4A 4ZILA 4ISDA 5EVOA 2DIZA 3F3QA 2MMNA 3F9UA 1WWJA 3PGTA 3IRAA 5CRDA 4X0XA 2V32A 4MMMA 3NOFA 1G7OA 4GF0A 4POKA 2VCQA 2OKAA 2OADA 4K0GA 2F8AA 1ZL9A 2WB9A 1GUKA 2H1AA 2GSTA 4ZBBA 1J08A 1PX6A 4ZXGA 3DEXA 1JLWA 5ECRB 2GZPA 1O73A 1LBKA 2DJ0A 3FHKA 5H5SA 1T7PB 3Q74A 4ECBA 2AUVA 4O5RA 1LJRA 4KNDA 2LJAA 4MZWA 3CXGA 1FVKA 1NW2A 4A5PA 4BVYA 4IGJA 2H6XA 5HFIA 5F07A 3KIJA 5AN1A 1S3CA 1XBSA 4LL4B 3ZITA 2JZSA 3J7Yk 1PGTA 2MMAA 3HJOA 4KAEA 3VWWA 3H93A 5KN1A 3R3EA 3LQ7A 1TTZA 4MZCA 2X8GA 3HZ8A 2CAQA 5DQSA 1GLQA 2PU9C 3DVWA 3ISOA 1QXHA 4AJ6A 2FD3A 3EINA 3F3RA 3QPMA 5HR1A 4MH2A 2G2QA 3IXRA 1U3IA 1URMA 2DIYA 2HZEB 4O32A 2PGTA 2MMZA 1SJIA 1OKDA 4WBJA 1K0AA 3L0HA 1O85A 2C3QA 2KHPA 1FG4A 3ZFLA 2DC5A 1ZOFA 5IIZA 4F9ZA 5AGYA 5CYYA 1R26A 2QA1A 4EF0A 2VM1A 5IMAA 1JHBA 4L0UA 1HYUA 4USSA 3ZVJA 1A0RP 3H8QA 3W8JA 5IQYA 3LXTA 1QK8A 3FEUA 3ERGA 2I81A 2CA8A 3W8SA 1SK2A 2R3XA 3FKFA 4AF2A 4J2FA 2L4QA 2VL9A 2MBSA 2CVDA 5G30A 1J0FA 3FW2A 1HNBA 1EP7A 5IMZA 1AW9A 2XC2A 2HYXA 2YPMA 4ACSA 2WS2A 4OD7A 2X8HA 5G1LA 2C0FA 2XPDA 3QOUA 1RW1A 3TGZA 1PN0A 4YQVA 4FYCA 1SKWB 5GSSA 1I5GA 2JACA 3TJGA 3K8NA 4IKHA 4KCEA 6GSXA 5D9XA 3HJMA 4ID0A 1MD3A 4HJ2A 2J23A 3CSHA 16GSA 2YCDA 2AB6A 2PVOC 3DD3A 1USBA 5HFKA 4QL9A 3GH6A 2K8SA 4ECCA 5BMUA 4GRFA 1TKDB 2FNOA 5KN2A 4NPBA 5DDLA 1SYRA 5AISA 2XBIA 3LG6A 4WF4A 4IVFA 1O81A 2E0QA 4YH2A 2RM5A 3ZIJA 2HSMA 20GSA 4YAPA 1K0MA 4IP1A 4NV2A 3DVXA 4X4JA 5DALA 1ERTA 3P7XA 3ERFA 1AIUA 4DSSA 1GNWA 1N8JA 3HYPA 3L9VA 4OFTA 2OA7A 2FCHA 2IFQA 2VL3A 1R5AA 3A5WA 1GSFA 4I5QA 4KB3A 1GWCA 2ES7A 2GS3A 4HOJA 3DIEA 4TR0A 4EL1A 1VRSD 4TR1A 3O76A 1T3BA 1XIYA 3E0UA 4EXJA 1TI3A 4EKZA 3TKQA 1PSQA 2H6ZA 3WGDA 1R4WA 3QFBC 1V57A 3HVXA 4FYUA 4KDYA 12GSA 2REMA 3FZ5A 4GTUA 1XWGA 3MDKA 5B7CA 3D4MA 3RDWA 3FR3A 2WGRA 3LXZA 1ON4A 5DJMA 1M9AA 3TRQA 3EWLA 2R5GA 5B8BA 1YF1A 4KDUA 2YV7A 4V1Ap 3C7MA 4O5QA 5G5FA 3F6FA 3IHGA 4MCUA 2IMEA 1K3LA 3LW9A 3HD5A 5CO3A 2L59A 2IN3A 4AGSA 3G7YA 3TKSE 1XOAA 2HRKA 4HUAA 4ULXA 2V6OA 3CMIA 2OJLA 3F6DA 1K3YA 1X0RA 4WF5A 2MYGA 2O7KA 2GQKA 4CW9A 4HU9A 2CAIA 4NXIA 4PNFA 4WR5A 3G9BA 4LA1A 1IYIA 2C0EA 4O5UA 1G0TA 1A2LA 3GKXA 3FZ4A 4OCEA 3A2XA 4V1Ag 5KN0A 2VLVA 3NIVA 5A4VA 4XS6A 5ECQB 4LMWA 2ON7A 2HRNA 2CT6A 1AQVA 5KEJA 1ZGNA 1R5PA 3IK9A 3GL5A 3APSA 5IOXA 5ECMB 2A4HA 1LU4A 2FLSA 2OE1A 3D0ZA 2P5RA 4POLA 4K7IA 4MJEA 3J7Yb 6GSVA 4MNNA 1YKCA 5DAKA 1HQOA 3IR4A 4QL7A 4HQSA 3N9JA 1GLPA 1YDKA 3L9SA 2BTOT 3PR8A 3BOAA 1W89A 2FWEA 1IYHA 1XFLA 4KDXA 1FHEA 1V2AA 1WOUA 4PQ1A 1F9MA 3CBUA 3VLNA 3HKRA 1T00A 2GSRA 1SK1A 2IJYA 4V2LA 1YEXA 2OBIA 4BPYA 2AV4A 3QR6A 2WZ9A 2PVQA 2IMDA 2PUKC 4X43A 1C72A 1MDKA 4ZB6A 2VM2A 1ILOA 5L71A 3ZTLA 4KSOA 3EURA 4PURA 1U3AA 4GCIA 1YEPA 1B8XA 1E2YA 3KP8A 5CREA 6GSSA 3F63A 5IMDA 5D9WA 5IOWA 1O6JA 4GQCA 4ZL9A 2LSTA 3A2VA 3H1NA 1KTEA 3GKMA 3GSTA 2H74A 2VL2A 3EU4A 5ECPB 1WIKA 1XW9A 1JZDA 5ID2A 2F51A 5J5NA 5D73A 4I2TA 1J9BA 2LJRA 3TKRA 3V1WA 2CX3A 5B6MA 2VLUA 2TRXA 1K0CA 5F05A 3UVHA 3IHQA 1O7UA 3TKSC 1OC9B 1RK4A 4FIWA 4K7NA 4XCSA 4EDYA 3GTUB 3W6GA 2LRTA 4HU7A 3IV4A 2FWGA 4PX1A 3QMXA 4DSQA 3TCOA 3KCMA 3TKSA 5HR0A 4TXOA 2YZHA 1X9WB 3Q6OA 4MJBA 1FOVA 1W4VA 4KW6A 3HVVA 3VPQA 4AJ7A 5J3RA 3TUEA 5IMVA 1A8YA 1ST9A 1SL0B 1SL1B 2OE3A 5CP1A 4TR4A 1Z5YE 2KLXA 1B48A 1JZOA 3PH9A 2Z9SA 2X4AA 3FRCA 4F2IA 3M8NA 1XWCA 4BL7A 4FYBA 1FOHA 1DE2A 3UOMA 3IC8A 4K9ZA 2WJUA 4OO5A 2LUSA 4P3YB 1PKWA 1BYEA 2QA2A 4KA0A 4BVYB 1SYXA 4TN8A 3VI7A 3EC3A 3ME7A 1K0NA 5CAXA 1SL2B 3M9JA 3TKPA 1ERWA 4KH7A 2D2ZA 3DKSA 4CY6A 1GUHA 2UZ8A 4NWYA 2VLTA 1XPVA 5ECIB 7GSSA 4N10A 2DLXA 1X5DA 2WRTA 4Z7XA 3IA1A 4L0WA 3R2QA 9GSSA 4Q5FA 4MP4A 4I8BA 1KBNA 3QAVA 1GTIA 1TRSA 2R2JA 1A23A 1A24A 4ZIJA 2HI7A 6GSYA 1B9XC 2K6VA 2N5BA 1M2BA 4MPFA 3UL3A 1R7HA 4Q5NA 2DJ2A 4ZL8A 2KOKA 2A2SA 1GUMA 2VCVA 1BX9A 2BJXA 1X9MB 3US3A 4F03A 2H1GA 4GSNA 1GNEA 4MH3A 3IC4A 2LS5A 3HZ4A 4MF7A 3CRTA 3GX8A 2L6CA 4Z2UA 5ELGA 4K6XA 1GTAA 2HXKA 2IMIA 1CQGA 3DMLA 5G31A 4IQAA 4IN0A 1DUGA 5ENUA 5JCUA 4TR3A 4HI7A 5FWGA 2M46A 3ZMLA 2E2MA 4IQ1A 2A4VA 2VO4A 1TDIA 1FB6A 5D9TA 1OAZA 2VCWA 3O3TA 1B9YC 2DJJA 2MBTA 2IL3A 3FZ9A 2ON5A 1TOFA 4XS4B 3F8UA 3DWVA 4K2XA 4E8HA 5IM9A 1PKZA 2KP2A 3QAGA 4PQIA 3TRPA 2C0GA 2JSZA 4WXTA 2EIRA 6GSUA 1UA5A 2H8LA 5E59A 2R6KA 3OR5A 4XS1A 4PXOA 2DMMA 4FQUA 4ZBAA 4Z2RA 2LTKA 2VOCA 2OE0A 1B4QA 3KTLA 2L5LA 3SWLA 3UVTA 5B8AA 2BMXA 3IOSA 1M99A 2LNSA 2DJKA 4KUNA 2HNLA 3CYNA 3NZNA 1I9DA 5A5KA 4K5SA 1DE1A 1PA3A 1PN9A 5DALB 1F3AA 3ZFBA 4Q5RA 4DSSB 4YKFA 5HFGA 4TW5A 4K0NA 2A2RA 1UVZA 3WGEA 2VCZA 2RIIA 2O87A 3A2WA 4RUVA 4N0ZA 1AC1A 2B1KA 3HVSA 4DSRA 4ECIA 2GVPA 2LQQA 1TXXA 1EWXA 2L5OA 2AAWA 5H5RA 4JRRA 3UBKA 4BWSA 2I9HA 2E2GA 1WP0A 2H71A 2TRCP 4WR4A 3JCML 3DXBA 1SD8A 2LJKA 4FO5A 5DVBA 4GQFA 2JSYA 4OCFA 3TJBA 3KM6A 5COHA 2ZCTA 3IE3A 5LNKe 4NHWA 1Q98A 5IMFA 3ZYWA 2X49A 4N0VA 1K0BA 2GQMA 6GSTA 2VIMA 1JLVA 3EMPA 2P0GA 4TOPA 2K8VA 4XIHA 2IMKA 3H4KA 3U6VA 19GSA 2L6DA 1TK8B 6GSWA 4JBBA 1EP8A 2C80A 2GLRA 2XPEA 2B5XA 4DVCA 1F2EA 3GMFA 2M80A 4XRDA 1Y6EA 2QKEA 3TJKA 4MK3A 1AUCA 3HCZA 2NBSA 1M2AA 5G5EA 4IHUA 1KEBA 2RM6A 2GTUA 4EC0A 3LYPA 1UC7A 22GSA 2H0GA 3VK9A 3ZRDA 3WGXA 4EO3A 1EOHA 2YJHA 4RQXA 5ECKB 2B1LA 3C8EA 3Q18A 2P5QA 3F0IA 5JCGA 2AJQB 5J41A 2DKHA 5JWQB 4OO4A 3A5IA 1S3DA 1HNCA 2IIYA 5CRGA 5HR3A 2IMFA 2FA4A 4OFMA 4HZ4A 2B7KA 3RHBA 3HA9A 5INYA 3FK8A 3MWHA 4F0BA 5GSTA 1MD4A 3ED3A 3KP9A 1WJKA 1F6MC 1NM3A 1HD2A 1M2DA 1XWAA 3IK7A 1PL2A 2C0DA 5AIVA 5LCZA 4XTSA 2CZ3A 3L9UA 4NMUA 1SJ6A 4RQRA 2B6MA 3DGQA 4JR4A 2TIRA 3VI5A 4MF6A 2GZZA 3BCKA 3APQA 1THXA 3RBTA 2LRCA 5KOXA 1Z7RA 4JU5A 4DEJA 3C73A 1XCCA 1NHOA 5CRHA 1QFNA 4MJAA 1Z6NA 2H66A 1T4ZA 4IS0A 1YJ6A 2X99A 1XZOA 3KH9A 2L57A 2X8CA 2LKUA 1B4PA 1WE0A 5ELAA 4E8EA 5J9CA 2DSAA 4ZBDA 2YWMA 3WD6A 2JU5A 2VL2C 2V2GA 4MZBA 1CQHA 2N5AA 2DMLA 3CSIA 3BJ5A 3UAPA 1QUWA 4RI7A 1SENA 1YKAA 2H0IA 1TK0B 2YZUA 4TXOB 2G0FA 4AJ8A 1FAAA 2EC4A 2FGXA 4G0KA 3WYWA 4ICYA 2VCTA 4NV5A 1SK0A 2C1YA 3S9FA 4XRAA 4G9HA 4YQMA 1ZYNA 1XXUA 1K3OA 3HHVA 11GSA 1ZCPA 2JZRA 2B5EA 4GSTA 3KH7A 1QGVA 2F3MA 2H30A 3GN3A 2V6KA 2HLSA 3IAM2 5DQYA 4G0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q4J A;  4N30 A;  2J9H A;  1V58 A;  3TOU A;  5D8I A;  5IMC A;  1G6W A;  3D6I A;  2YOI A;  3M0F A;  1Y25 A;  3LYK A;  2CVB A;  3DYR A;  1H75 A;  4JZQ A;  2WCI A;  1EEJ A;  3HJP A;  2B7J A;  3IAS 2;  2H1B A;  1BED A;  3D21 A;  1A8L A;  3LGC A;  2OAC A;  3EU3 A;  4BVX A;  3GKK A;  4IJ3 A;  5DBQ A;  1GP1 A;  1DBY A;  3ZL5 A;  1X9S B;  13GS A;  4V2M A;  2HZF A;  2FA8 A;  3G7J A;  4MF5 A;  1U87 A;  5ABR A;  3FZA A;  2VD0 A;  4X1U A;  3C1S A;  2XHF A;  5A4W A;  1GSS A;  2H70 A;  3GTU A;  4K7O A;  2IWT A;  2CX4 A;  4MAB A;  4KE3 A;  4PGT A;  1Z6M A;  1EGR A;  5C04 A;  4MJC A;  1ERV A;  1Z7P A;  2RUE A;  1ZYQ B;  2HSY A;  4IJI A;  4HDE A;  1V40 A;  1BAY A;  3GV1 A;  2NTO A;  4OWY A;  1GSY A;  2IPA A;  4EVM A;  2FUG 2;  2H1D A;  2LQO A;  2QGV A;  4FH8 A;  2KP1 A;  3CTF A;  4Q5Q A;  4O92 A;  3I6A A;  2PWJ A;  3EVI A;  1EGO A;  1A0F A;  3KZQ A;  1PD2 1;  3DRN A;  5DCH A;  3MSZ A;  4D73 A;  2H76 A;  1M0U A;  4YAV A;  5FT3 A;  4L8E A;  3QCP A;  3ZRE A;  2QC7 A;  2C8U A;  4ZB8 A;  2JAD A;  4BWQ A;  1JZR A;  2R37 A;  1YZX A;  4EE0 A;  2P31 A;  1GSU A;  5CNW A;  2FHE A;  3H79 A;  4N11 A;  1FW1 A;  3ZMK A;  3M1G A;  3QDN A;  4I2U A;  3IPZ A;  3UBL A;  2H75 A;  1OYJ A;  3GL3 A;  5FHI A;  3VWV A;  2HE3 A;  2NVL A;  3C71 A;  3EYT A;  4G10 A;  5EY6 A;  1ZMA A;  4J56 E;  2V1M A;  1MEK A;  4GWR A;  4ML6 A;  3TJF A;  3GA4 A;  2C4J A;  3VFI A;  1V98 A;  5J4U A;  4TRX A;  1ABA A;  4G2E A;  1BQ7 A;  2WFC A;  1MDJ A;  4BA7 A;  4MPG A;  4LMV A;  2MMO A;  1T1V A;  1M9B A;  3GSS A;  3D5J A;  4H86 A;  3LEF A;  1OKT A;  3RHC A;  3BD2 A;  1XWK A;  4EUY A;  2YNX A;  5AIX A;  1WRY A;  4PNG A;  1A2M A;  5IPG A;  4XHM A;  1WMJ A;  3CSJ A;  1XVQ A;  3MNG A;  3KXO A;  1ZZY A;  3TOT A;  1PMT A;  1K0D A;  5KN3 A;  2E7P A;  4JR6 A;  5B6N A;  3LOR A;  1GL8 A;  2RLI A;  4PUF C;  3F4S A;  3TDG A;  3C1R A;  1EV4 A;  3ZIV A;  5A4U A;  1XVW A;  1OE7 A;  4HJM A;  4PUA A;  18GS A;  5F0G A;  3LSZ A;  2ALB A;  2YWO A;  1T8E B;  1X5E A;  2CZ2 A;  1N2A A;  1F37 A;  2GQL A;  2NDO A;  2HZE A;  4RI6 A;  3ZZX A;  2ZUP A;  1WPI A;  3I43 A;  2HFD A;  5F8B A;  1G6Y A;  3VUR A;  3GFK A;  2YWI A;  2C3T A;  3MAK A;  4HEA 2;  4NAX A;  4KX4 A;  5G1K A;  2HRF A;  1YY7 A;  1SD9 A;  1TP9 A;  3ME8 A;  5ECO B;  1ML6 A;  1SKS B;  3BBY A;  3HY2 A;  4XS4 A;  3IDV A;  2YAN A;  2IFQ B;  4WET A;  2DJ1 A;  4KGI A;  2H72 A;  1FB0 A;  4TR1 B;  2B5Y A;  4GXZ A;  1MTC A;  3VPT A;  4K2D A;  2L4C A;  2RUF A;  2H01 A;  2EIQ A;  2PBJ A;  3QD9 A;  5J9B A;  5EPF A;  1GRX A;  4CDO A;  4LLR A;  4IBP A;  3GIX A;  1JFU A;  1GTU A;  2YWN A;  2GSQ A;  4MA9 A;  3GYK A;  1QMV A;  3SBC A;  5LD0 A;  1U88 A;  2O85 A;  3KGK A;  3HDC A;  2H6Y A;  5HQP A;  1GSE A;  1BG5 A;  2HT9 A;  1JZW A;  2CVK A;  5ECN B;  5IO2 A;  4F82 A;  4CHS A;  3KJY A;  1ERU A;  3HXS A;  1AQW A;  3U5R E;  1Z9H A;  5JCW A;  1DSB A;  2GDR A;  3PIN A;  2F8F A;  2LNT A;  4JE1 A;  5IO0 A;  1O8X A;  3KEB A;  17GS A;  3WT1 A;  1TU7 A;  3F4T A;  1YQ1 A;  3E3E A;  5CRW A;  3M9K A;  1PX7 A;  2H73 A;  3ZVJ D;  2GT6 A;  1QQ2 A;  4K8M A;  3TRX A;  1VF4 A;  3GUS A;  2OBK A;  1TJD A;  3L4N A;  2N5F A;  1ZYE A;  3GX0 A;  4GSS A;  5D9V A;  1TW9 A;  2AHE A;  3RPP A;  1AAZ A;  4QQ7 A;  3APO A;  4L5L A;  3EE2 A;  2WDU A;  4ZB9 A;  2R4V A;  14GS A;  4ML1 A;  4ZL7 A;  2LV3 A;  3RPN A;  2ZNM A;  3E9J B;  2I4A A;  3VWU A;  3QAW A;  3GKN A;  5C00 A;  1GSD A;  4TVE A;  4HQZ A;  3FR9 A;  5DAK B;  4TXV A;  5E4W A;  1AQX A;  1S3A A;  1RQM A;  1NHY A;  4L5O A;  2K9F A;  3CRU A;  2EIO A;  1OVN A;  4POM A;  1XOB A;  2I1U A;  2YP6 A;  2DBC A;  1X5C A;  1XWB A;  4MDC A;  8GSS A;  4OMV A;  2XBQ A;  1NSW A;  1O8W A;  1EV9 A;  3KTB A;  2GT5 A;  3TB2 A;  4GLT A;  2B3S A;  3UAR A;  1SU9 A;  2FY6 A;  4WBR D;  3KD0 A;  1A2J A;  2V41 A;  5EL8 A;  3UIW A;  3WT2 A;  4TKY A;  4WEY A;  1EEM A;  2CV4 A;  3FYG A;  4LL1 B;  5GAN D;  3D4T A;  3GRX A;  2I3Y A;  2M72 A;  2GGT A;  3LJR A;  1FVJ A;  1OC8 A;  1SKR B;  2WUL A;  1TU8 A;  3F4R A;  2YN1 A;  1GTB A;  2YJ7 A;  1XW5 A;  3FR6 A;  3P2A A;  2YV9 A;  1TRW A;  2QSI A;  2LRN A;  5ID2 B;  2K18 A;  1HNA A;  4O7H A;  2VCX A;  1ACV A;  3QFA C;  1T4Y A;  2H0H A;  4IP6 A;  1PL1 A;  2LEG A;  1EOG A;  3D22 A;  2PMT A;  1V9W A;  3I9V 2;  4I6X A;  2DJ3 A;  4V2N A;  3IBH A;  4KCA A;  1EZK A;  4HS1 A;  1TRU A;  5GZZ B;  1U6T A;  3P8W A;  3CTG A;  5DJL A;  1KNG A;  1TI1 A;  3GHA A;  1MDI A;  4ILF A;  5GAP D;  1YF0 A;  2C3N A;  2FWF A;  3M3M A;  1PRX A;  2MZC A;  3VWX A;  1VF2 A;  4IW9 A;  5G2Z A;  1OC3 A;  2VD1 A;  3GUR A;  1M7T A;  3GH9 A;  2AYT A;  3LWA A;  3FY7 A;  1VF1 A;  2PPT A;  2X64 A;  3BCI A;  3G7I A;  4MLY A;  1SJZ A;  3ERW A;  5ECS A;  5JWR B;  2PN8 A;  4I97 A;  3RAZ A;  3ZLP A;  3TJJ A;  1K0O A;  2VUP A;  4POB A;  2PER A;  3A3T A;  3UMA A;  4JED A;  2KUC A;  2F9S A;  10GS A;  1XW6 A;  2GSS A;  2FWH A;  5D93 A;  5JWO B;  2O89 A;  4NHZ A;  5IPH A;  1G7E A;  1THO A;  2NPB A;  2H19 A;  5HR2 A;  4OFN A;  5D96 A;  1BJX A;  3N5O A;  3UJ1 A;  1VGL A;  1VF3 A;  1H4O A;  4PQH A;  2HSH A;  3EMX A;  4EDZ A;  3L78 A;  4K1F A;  3AY8 A;  5DCG A;  5F06 A;  5ECH B;  3GNJ A;  1AXD A;  1FO5 A;  4F0C A;  1GSQ A;  3Q19 A;  4KSM A;  4ECJ A;  2JZT A;  3UEM A;  1E6B A;  4YQU A;  1OC9 A;  3O6T A;  2VAF A;  3I69 A;  1OE8 A;  1TRV A;  2O8V B;  4D73 B;  4J57 E;  1GUL A;  4HZ2 A;  4IEL A;  5ECL B;  5H5Q A;  1GH2 A;  1TK5 B;  1PQN A;  4G19 A;  2GZY A;  4WKW A;  1Z3E A;  1F3B A;  3KMN A;  3LFL A;  1UN2 A;  3KMO A;  3P90 A;  2CQ9 A;  2JL4 A;  4ZIL A;  4ISD A;  5EVO A;  2DIZ A;  3F3Q A;  2MMN A;  3F9U A;  1WWJ A;  3PGT A;  3IRA A;  5CRD A;  4X0X A;  2V32 A;  4MMM A;  3NOF A;  1G7O A;  4GF0 A;  4POK A;  2VCQ A;  2OKA A;  2OAD A;  4K0G A;  2F8A A;  1ZL9 A;  2WB9 A;  1GUK A;  2H1A A;  2GST A;  4ZBB A;  1J08 A;  1PX6 A;  4ZXG A;  3DEX A;  1JLW A;  5ECR B;  2GZP A;  1O73 A;  1LBK A;  2DJ0 A;  3FHK A;  5H5S A;  1T7P B;  3Q74 A;  4ECB A;  2AUV A;  4O5R A;  1LJR A;  4KND A;  2LJA A;  4MZW A;  3CXG A;  1FVK A;  1NW2 A;  4BVY A;  4IGJ A;  2H6X A;  5HFI A;  5F07 A;  3KIJ A;  5AN1 A;  1S3C A;  1XBS A;  4LL4 B;  3ZIT A;  2JZS A;  3J7Y k;  1PGT A;  2MMA A;  3HJO A;  4KAE A;  3VWW A;  3H93 A;  5KN1 A;  3LQ7 A;  1TTZ A;  4MZC A;  2X8G A;  3HZ8 A;  2CAQ A;  5DQS A;  1GLQ A;  2PU9 C;  3DVW A;  3ISO A;  1QXH A;  4AJ6 A;  2FD3 A;  3EIN A;  3F3R A;  3QPM A;  5HR1 A;  4MH2 A;  2G2Q A;  3IXR A;  1U3I A;  1URM A;  2DIY A;  2HZE B;  4O32 A;  2PGT A;  2MMZ A;  1SJI A;  1OKD A;  4WBJ A;  1K0A A;  3L0H A;  1O85 A;  2C3Q A;  2KHP A;  1FG4 A;  3ZFL A;  2DC5 A;  1ZOF A;  5IIZ A;  4F9Z A;  5AGY A;  5CYY A;  1R26 A;  4EF0 A;  2VM1 A;  5IMA A;  1JHB A;  4L0U A;  1HYU A;  3ZVJ A;  1A0R P;  3H8Q A;  3W8J A;  5IQY A;  3LXT A;  1QK8 A;  3FEU A;  3ERG A;  2I81 A;  2CA8 A;  3W8S A;  1SK2 A;  2R3X A;  3FKF A;  4AF2 A;  4J2F A;  2L4Q A;  2VL9 A;  2MBS A;  2CVD A;  5G30 A;  1J0F A;  3FW2 A;  1HNB A;  1EP7 A;  5IMZ A;  1AW9 A;  2XC2 A;  2HYX A;  2YPM A;  4ACS A;  2WS2 A;  4OD7 A;  2X8H A;  5G1L A;  2C0F A;  2XPD A;  3QOU A;  1RW1 A;  3TGZ A;  4YQV A;  4FYC A;  1SKW B;  5GSS A;  1I5G A;  2JAC A;  3TJG A;  3K8N A;  4IKH A;  4KCE A;  6GSX A;  5D9X A;  3HJM A;  4ID0 A;  1MD3 A;  4HJ2 A;  2J23 A;  3CSH A;  16GS A;  2YCD A;  2AB6 A;  2PVO C;  3DD3 A;  1USB A;  5HFK A;  4QL9 A;  3GH6 A;  2K8S A;  4ECC A;  4GRF A;  1TKD B;  2FNO A;  5KN2 A;  4NPB A;  5DDL A;  1SYR A;  5AIS A;  2XBI A;  3LG6 A;  4WF4 A;  4IVF A;  1O81 A;  2E0Q A;  4YH2 A;  2RM5 A;  3ZIJ A;  20GS A;  4YAP A;  1K0M A;  4IP1 A;  4NV2 A;  3DVX A;  5DAL A;  1ERT A;  3P7X A;  3ERF A;  1AIU A;  4DSS A;  1GNW A;  1N8J A;  3HYP A;  3L9V A;  4OFT A;  2OA7 A;  2FCH A;  2IFQ A;  2VL3 A;  1R5A A;  3A5W A;  1GSF A;  4I5Q A;  4KB3 A;  1GWC A;  2ES7 A;  2GS3 A;  4HOJ A;  3DIE A;  4TR0 A;  4EL1 A;  1VRS D;  4TR1 A;  3O76 A;  1T3B A;  1XIY A;  3E0U A;  4EXJ A;  1TI3 A;  4EKZ A;  3TKQ A;  1PSQ A;  2H6Z A;  3WGD A;  1R4W A;  3QFB C;  1V57 A;  3HVX A;  4FYU A;  4KDY A;  12GS A;  2REM A;  3FZ5 A;  4GTU A;  1XWG A;  3MDK A;  5B7C A;  3D4M A;  3RDW A;  3FR3 A;  2WGR A;  3LXZ A;  1ON4 A;  5DJM A;  1M9A A;  3TRQ A;  3EWL A;  2R5G A;  5B8B A;  1YF1 A;  4KDU A;  2YV7 A;  4V1A p;  3C7M A;  5G5F A;  3F6F A;  4MCU A;  2IME A;  1K3L A;  3HD5 A;  5CO3 A;  2L59 A;  2IN3 A;  4AGS A;  3G7Y A;  3TKS E;  1XOA A;  4HUA A;  4ULX A;  2V6O A;  3CMI A;  2OJL A;  3F6D A;  1K3Y A;  1X0R A;  4WF5 A;  2MYG A;  2O7K A;  2GQK A;  4CW9 A;  4HU9 A;  2CAI A;  4NXI A;  4PNF A;  4WR5 A;  3G9B A;  4LA1 A;  1IYI A;  2C0E A;  1G0T A;  1A2L A;  3GKX A;  3FZ4 A;  4OCE A;  3A2X A;  4V1A g;  5KN0 A;  2VLV A;  3NIV A;  5A4V A;  4XS6 A;  5ECQ B;  4LMW A;  2ON7 A;  2HRN A;  2CT6 A;  1AQV A;  5KEJ A;  1ZGN A;  1R5P A;  3IK9 A;  3GL5 A;  3APS A;  5IOX A;  5ECM B;  1LU4 A;  2FLS A;  2OE1 A;  3D0Z A;  2P5R A;  4POL A;  4K7I A;  4MJE A;  3J7Y b;  6GSV A;  1YKC A;  5DAK A;  1HQO A;  3IR4 A;  4QL7 A;  4HQS A;  3N9J A;  1GLP A;  1YDK A;  3L9S A;  2BTO T;  3PR8 A;  3BOA A;  1W89 A;  2FWE A;  1IYH A;  1XFL A;  4KDX A;  1FHE A;  1V2A A;  1WOU A;  4PQ1 A;  1F9M A;  3CBU A;  3VLN A;  3HKR A;  1T00 A;  2GSR A;  1SK1 A;  2IJY A;  4V2L A;  1YEX A;  2OBI A;  4BPY A;  2AV4 A;  3QR6 A;  2WZ9 A;  2PVQ A;  2IMD A;  2PUK C;  4X43 A;  1C72 A;  1MDK A;  4ZB6 A;  2VM2 A;  1ILO A;  5L71 A;  3ZTL A;  4KSO A;  3EUR A;  4PUR A;  1U3A A;  4GCI A;  1YEP A;  1B8X A;  1E2Y A;  3KP8 A;  5CRE A;  6GSS A;  3F63 A;  5IMD A;  5D9W A;  5IOW A;  1O6J A;  4GQC A;  4ZL9 A;  2LST A;  3A2V A;  3H1N A;  1KTE A;  3GKM A;  3GST A;  2H74 A;  2VL2 A;  3EU4 A;  5ECP B;  1WIK A;  1XW9 A;  1JZD A;  5ID2 A;  2F51 A;  5J5N A;  5D73 A;  4I2T A;  1J9B A;  2LJR A;  3TKR A;  3V1W A;  2CX3 A;  5B6M A;  2VLU A;  2TRX A;  1K0C A;  5F05 A;  3UVH A;  3IHQ A;  1O7U A;  3TKS C;  1OC9 B;  1RK4 A;  4FIW A;  4K7N A;  4XCS A;  4EDY A;  3GTU B;  3W6G A;  2LRT A;  4HU7 A;  3IV4 A;  2FWG A;  4PX1 A;  3QMX A;  4DSQ A;  3TCO A;  3KCM A;  3TKS A;  5HR0 A;  4TXO A;  2YZH A;  1X9W B;  3Q6O A;  4MJB A;  1FOV A;  1W4V A;  4KW6 A;  3HVV A;  3VPQ A;  4AJ7 A;  5J3R A;  3TUE A;  5IMV A;  1A8Y A;  1ST9 A;  1SL0 B;  1SL1 B;  2OE3 A;  5CP1 A;  4TR4 A;  1Z5Y E;  2KLX A;  1B48 A;  1JZO A;  3PH9 A;  2Z9S A;  3FRC A;  4F2I A;  3M8N A;  1XWC A;  4BL7 A;  4FYB A;  1DE2 A;  3UOM A;  4K9Z A;  2WJU A;  4OO5 A;  2LUS A;  4P3Y B;  1PKW A;  1BYE A;  4KA0 A;  1SYX A;  4TN8 A;  3VI7 A;  3EC3 A;  3ME7 A;  1K0N A;  5CAX A;  1SL2 B;  3M9J A;  3TKP A;  1ERW A;  4KH7 A;  2D2Z A;  3DKS A;  1GUH A;  4NWY A;  2VLT A;  1XPV A;  5ECI B;  7GSS A;  4N10 A;  2DLX A;  1X5D A;  2WRT A;  4Z7X A;  3IA1 A;  4L0W A;  3R2Q A;  9GSS A;  4Q5F A;  4MP4 A;  4I8B A;  1KBN A;  3QAV A;  1GTI A;  1TRS A;  2R2J A;  1A23 A;  1A24 A;  4ZIJ A;  2HI7 A;  6GSY A;  1B9X C;  2K6V A;  2N5B A;  1M2B A;  4MPF A;  3UL3 A;  1R7H A;  4Q5N A;  2DJ2 A;  4ZL8 A;  2KOK A;  2A2S A;  1GUM A;  2VCV A;  1BX9 A;  2BJX A;  1X9M B;  3US3 A;  4F03 A;  2H1G A;  4GSN A;  1GNE A;  4MH3 A;  3IC4 A;  2LS5 A;  3HZ4 A;  4MF7 A;  3CRT A;  3GX8 A;  2L6C A;  5ELG A;  4K6X A;  1GTA A;  2HXK A;  2IMI A;  1CQG A;  3DML A;  5G31 A;  4IQA A;  4IN0 A;  1DUG A;  5ENU A;  5JCU A;  4TR3 A;  4HI7 A;  5FWG A;  2M46 A;  3ZML A;  2E2M A;  4IQ1 A;  2A4V A;  2VO4 A;  1TDI A;  1FB6 A;  5D9T A;  1OAZ A;  2VCW A;  3O3T A;  1B9Y C;  2DJJ A;  2MBT A;  2IL3 A;  3FZ9 A;  2ON5 A;  1TOF A;  4XS4 B;  3F8U A;  3DWV A;  4E8H A;  5IM9 A;  1PKZ A;  2KP2 A;  3QAG A;  4PQI A;  3TRP A;  2C0G A;  2JSZ A;  4WXT A;  2EIR A;  6GSU A;  1UA5 A;  2H8L A;  5E59 A;  2R6K A;  3OR5 A;  4XS1 A;  4PXO A;  2DMM A;  4ZBA A;  2LTK A;  2VOC A;  2OE0 A;  1B4Q A;  3KTL A;  2L5L A;  3SWL A;  3UVT A;  5B8A A;  2BMX A;  3IOS A;  1M99 A;  2LNS A;  2DJK A;  4KUN A;  2HNL A;  3CYN A;  3NZN A;  1I9D A;  5A5K A;  1DE1 A;  1PA3 A;  1PN9 A;  5DAL B;  1F3A A;  3ZFB A;  4Q5R A;  4DSS B;  5HFG A;  4TW5 A;  4K0N A;  2A2R A;  1UVZ A;  3WGE A;  2VCZ A;  2RII A;  2O87 A;  3A2W A;  4RUV A;  4N0Z A;  1AC1 A;  2B1K A;  3HVS A;  4DSR A;  4ECI A;  2GVP A;  2LQQ A;  1TXX A;  1EWX A;  2L5O A;  2AAW A;  5H5R A;  4JRR A;  3UBK A;  4BWS A;  2I9H A;  2E2G A;  1WP0 A;  2H71 A;  2TRC P;  4WR4 A;  3JCM L;  3DXB A;  1SD8 A;  2LJK A;  4FO5 A;  5DVB A;  4GQF A;  2JSY A;  4OCF A;  3TJB A;  3KM6 A;  5COH A;  2ZCT A;  3IE3 A;  5LNK e;  4NHW A;  1Q98 A;  5IMF A;  3ZYW A;  4N0V A;  1K0B A;  2GQM A;  6GST A;  2VIM A;  1JLV A;  3EMP A;  2P0G A;  4TOP A;  2K8V A;  4XIH A;  2IMK A;  3H4K A;  3U6V A;  19GS A;  2L6D A;  1TK8 B;  6GSW A;  4JBB A;  1EP8 A;  2C80 A;  2GLR A;  2XPE A;  2B5X A;  4DVC A;  1F2E A;  3GMF A;  2M80 A;  4XRD A;  1Y6E A;  2QKE A;  3TJK A;  4MK3 A;  1AUC A;  3HCZ A;  2NBS A;  1M2A A;  5G5E A;  4IHU A;  1KEB A;  2RM6 A;  2GTU A;  4EC0 A;  3LYP A;  1UC7 A;  22GS A;  2H0G A;  3VK9 A;  3ZRD A;  3WGX A;  4EO3 A;  1EOH A;  2YJH A;  4RQX A;  5ECK B;  2B1L A;  3C8E A;  3Q18 A;  2P5Q A;  3F0I A;  5JCG A;  2AJQ B;  5J41 A;  5JWQ B;  4OO4 A;  1S3D A;  1HNC A;  2IIY A;  5CRG A;  5HR3 A;  2IMF A;  2FA4 A;  4OFM A;  4HZ4 A;  2B7K A;  3RHB A;  3HA9 A;  5INY A;  3FK8 A;  3MWH A;  4F0B A;  5GST A;  1MD4 A;  3ED3 A;  3KP9 A;  1WJK A;  1F6M C;  1NM3 A;  1HD2 A;  1M2D A;  1XWA A;  3IK7 A;  1PL2 A;  2C0D A;  5AIV A;  5LCZ A;  4XTS A;  2CZ3 A;  3L9U A;  4NMU A;  1SJ6 A;  4RQR A;  2B6M A;  3DGQ A;  4JR4 A;  2TIR A;  3VI5 A;  4MF6 A;  2GZZ A;  3BCK A;  3APQ A;  1THX A;  3RBT A;  2LRC A;  1Z7R A;  4JU5 A;  4DEJ A;  3C73 A;  1XCC A;  1NHO A;  5CRH A;  1QFN A;  4MJA A;  1Z6N A;  2H66 A;  1T4Z A;  4IS0 A;  1YJ6 A;  2X99 A;  1XZO A;  3KH9 A;  2L57 A;  2X8C A;  2LKU A;  1B4P A;  1WE0 A;  5ELA A;  4E8E A;  5J9C A;  2DSA A;  4ZBD A;  2YWM A;  3WD6 A;  2JU5 A;  2VL2 C;  2V2G A;  4MZB A;  1CQH A;  2N5A A;  2DML A;  3CSI A;  3BJ5 A;  3UAP A;  1QUW A;  4RI7 A;  1SEN A;  1YKA A;  2H0I A;  1TK0 B;  2YZU A;  4TXO B;  2G0F A;  4AJ8 A;  1FAA A;  2EC4 A;  2FGX A;  3WYW A;  2VCT A;  4NV5 A;  1SK0 A;  2C1Y A;  3S9F A;  4XRA A;  4G9H A;  4YQM A;  1XXU A;  1K3O A;  3HHV A;  11GS A;  1ZCP A;  2JZR A;  2B5E A;  4GST A;  3KH7 A;  1QGV A;  2F3M A;  2H30 A;  3GN3 A;  2V6K A;  2HLS A;  3IAM 2;  5DQY A; 
#chains in the Genus database with same CATH topology
 1Q4J A;  4N30 A;  2J9H A;  1V58 A;  3TOU A;  5D8I A;  5IMC A;  1G6W A;  3D6I A;  2YOI A;  3M0F A;  1Y25 A;  3LYK A;  2CVB A;  3DYR A;  5BRT A;  1H75 A;  4JZQ A;  2WCI A;  1EEJ A;  3HJP A;  2B7J A;  3IAS 2;  1ZYP A;  2H1B A;  1BED A;  3D21 A;  1A8L A;  3LGC A;  2OAC A;  3EU3 A;  4BVX A;  3GKK A;  4IJ3 A;  5DBQ A;  1GP1 A;  1DBY A;  4Z2T A;  3ZL5 A;  1X9S B;  13GS A;  4V2M A;  2HZF A;  2FA8 A;  3G7J A;  4MF5 A;  1U87 A;  5ABR A;  3FZA A;  2VD0 A;  4X1U A;  3C1S A;  2XHF A;  5A4W A;  1GSS A;  2H70 A;  3GTU A;  4K7O A;  2IWT A;  2CX4 A;  4MAB A;  4KE3 A;  4PGT A;  1Z6M A;  1EGR A;  5C04 A;  4MJC A;  1ERV A;  1Z7P A;  2A2P A;  2RUE A;  1ZYQ B;  2HSY A;  4IJI A;  4HDE A;  1V40 A;  1BAY A;  3GV1 A;  2NTO A;  4OWY A;  1GSY A;  2IPA A;  4EVM A;  2FUG 2;  2H1D A;  2LQO A;  2QGV A;  4FH8 A;  2KP1 A;  3CTF A;  4Q5Q A;  4O92 A;  3I6A A;  2PWJ A;  3EVI A;  1EGO A;  3EPT A;  1A0F A;  3KZQ A;  1PD2 1;  3DRN A;  5DCH A;  3MSZ A;  4D73 A;  2H76 A;  1M0U A;  4YAV A;  5FT3 A;  4L8E A;  3QCP A;  3ZRE A;  2QC7 A;  2C8U A;  4ZB8 A;  2JAD A;  4BWQ A;  1JZR A;  2R37 A;  1YZX A;  4EE0 A;  2P31 A;  4G0L A;  1GSU A;  5CNW A;  2FHE A;  3H79 A;  4N11 A;  1FW1 A;  3ZMK A;  3M1G A;  3QDN A;  4I2U A;  3IPZ A;  3UBL A;  2H75 A;  1OYJ A;  3GL3 A;  5FHI A;  2DKI A;  3VWV A;  3MYD A;  2HE3 A;  2NVL A;  3C71 A;  3EYT A;  4G10 A;  5EY6 A;  1ZMA A;  4J56 E;  2V1M A;  1MEK A;  4GWR A;  4ML6 A;  3TJF A;  3GA4 A;  2C4J A;  3VFI A;  1V98 A;  5J4U A;  4TRX A;  1ABA A;  4G2E A;  1BQ7 A;  2WFC A;  1MDJ A;  4BA7 A;  4MPG A;  4LMV A;  2MMO A;  1T1V A;  1M9B A;  3GSS A;  3D5J A;  4H86 A;  3LEF A;  1OKT A;  3RHC A;  3BD2 A;  1XWK A;  4EUY A;  2YNX A;  5AIX A;  1WRY A;  4PNG A;  1A2M A;  5IPG A;  4XHM A;  4K5R A;  1WMJ A;  3CSJ A;  1XVQ A;  3MNG A;  3KXO A;  1ZZY A;  3TOT A;  1PMT A;  1K0D A;  5KN3 A;  2E7P A;  4JR6 A;  5B6N A;  3LOR A;  1GL8 A;  2RLI A;  4PUF C;  3F4S A;  3TDG A;  3C1R A;  1EV4 A;  3ZIV A;  5A4U A;  1XVW A;  1OE7 A;  4HJM A;  4PUA A;  18GS A;  5F0G A;  3LSZ A;  2ALB A;  2YWO A;  1T8E B;  1X5E A;  2CZ2 A;  1N2A A;  1F37 A;  2GQL A;  2NDO A;  2HZE A;  4RI6 A;  3ZZX A;  2ZUP A;  1WPI A;  3I43 A;  2HFD A;  5F8B A;  1G6Y A;  3VUR A;  3GFK A;  2YWI A;  2C3T A;  3MAK A;  4HEA 2;  4NAX A;  4KX4 A;  5G1K A;  2HRF A;  1YY7 A;  1SD9 A;  1TP9 A;  3ME8 A;  5ECO B;  1ML6 A;  1SKS B;  3BBY A;  3HY2 A;  4XS4 A;  3IDV A;  2YAN A;  2IFQ B;  4WET A;  2DJ1 A;  4KGI A;  2H72 A;  1FB0 A;  4CY8 A;  4TR1 B;  2B5Y A;  4GXZ A;  1MTC A;  3VPT A;  4K2D A;  2L4C A;  2RUF A;  2H01 A;  2EIQ A;  2PBJ A;  4EIQ A;  3QD9 A;  5J9B A;  5EPF A;  1GRX A;  4CDO A;  4LLR A;  4IBP A;  3GIX A;  1JFU A;  1GTU A;  2YWN A;  2GSQ A;  4MA9 A;  3GYK A;  5KOW A;  1QMV A;  3SBC A;  5LD0 A;  1U88 A;  2O85 A;  3KGK A;  3HDC A;  2H6Y A;  5HQP A;  1GSE A;  1BG5 A;  2HT9 A;  1JZW A;  2CVK A;  5ECN B;  3PPU A;  5IO2 A;  4F82 A;  4CHS A;  3KJY A;  3MIX A;  1ERU A;  3HXS A;  1AQW A;  3U5R E;  1Z9H A;  5JCW A;  1DSB A;  2GDR A;  3PIN A;  2F8F A;  2LNT A;  4JE1 A;  5IO0 A;  1O8X A;  3KEB A;  17GS A;  3WT1 A;  1TU7 A;  3F4T A;  1YQ1 A;  3E3E A;  5CRW A;  3M9K A;  1PX7 A;  2H73 A;  3ZVJ D;  2GT6 A;  1QQ2 A;  4K8M A;  3TRX A;  1VF4 A;  3GUS A;  2OBK A;  1TJD A;  3L4N A;  2N5F A;  1ZYE A;  2R0G A;  3GX0 A;  4GSS A;  5D9V A;  1TW9 A;  2AHE A;  3RPP A;  1AAZ A;  4QQ7 A;  3APO A;  4L5L A;  3EE2 A;  2WDU A;  4ZB9 A;  2R4V A;  14GS A;  4ML1 A;  4ZL7 A;  2LV3 A;  3RPN A;  2ZNM A;  3E9J B;  2I4A A;  3VWU A;  3QAW A;  3GKN A;  5C00 A;  1GSD A;  4TVE A;  4HQZ A;  3FR9 A;  5DAK B;  4TXV A;  2HRA A;  5E4W A;  1AQX A;  1S3A A;  1RQM A;  1NHY A;  4L5O A;  2K9F A;  3CRU A;  2EIO A;  1OVN A;  4POM A;  1XOB A;  2I1U A;  2YP6 A;  2DBC A;  1X5C A;  1XWB A;  4MDC A;  8GSS A;  4OMV A;  2XBQ A;  1NSW A;  1O8W A;  1EV9 A;  3KTB A;  2GT5 A;  3TB2 A;  4GLT A;  2B3S A;  3UAR A;  4YKG A;  1SU9 A;  2FY6 A;  4WBR D;  3KD0 A;  1A2J A;  2V41 A;  5EL8 A;  3UIW A;  3WT2 A;  4TKY A;  4WEY A;  1EEM A;  2CV4 A;  3FYG A;  4LL1 B;  5GAN D;  3D4T A;  3GRX A;  2I3Y A;  2M72 A;  2GGT A;  3FMW A;  3LJR A;  1FVJ A;  2R0P A;  1OC8 A;  1SKR B;  2WUL A;  1TU8 A;  3F4R A;  2YN1 A;  1GTB A;  2YJ7 A;  1XW5 A;  3FR6 A;  3P2A A;  2YV9 A;  1TRW A;  2QSI A;  4KF9 A;  2LRN A;  5ID2 B;  2K18 A;  1HNA A;  4O7H A;  2VCX A;  1ACV A;  3QFA C;  1T4Y A;  2H0H A;  4IP6 A;  1PL1 A;  2LEG A;  1EOG A;  3D22 A;  2PMT A;  1V9W A;  3I9V 2;  4I6X A;  2DJ3 A;  4V2N A;  3IBH A;  4KCA A;  1EZK A;  4HS1 A;  1TRU A;  5GZZ B;  1U6T A;  3P8W A;  3CTG A;  5DJL A;  4EIP A;  1KNG A;  1TI1 A;  3GHA A;  1MDI A;  4ILF A;  5GAP D;  1YF0 A;  2C3N A;  2FWF A;  3M3M A;  1PRX A;  2MZC A;  3VWX A;  1VF2 A;  4IW9 A;  5G2Z A;  1OC3 A;  2VD1 A;  3GUR A;  1M7T A;  3GH9 A;  2AYT A;  3LWA A;  3FY7 A;  1VF1 A;  2PPT A;  2X64 A;  4BVX B;  2R0C A;  3BCI A;  3G7I A;  4MLY A;  1SJZ A;  3ERW A;  5ECS A;  5JWR B;  2PN8 A;  4I97 A;  3RAZ A;  3ZLP A;  3TJJ A;  1K0O A;  2VUP A;  4POB A;  2PER A;  4BL7 B;  3A3T A;  3UMA A;  4JED A;  2KUC A;  2F9S A;  10GS A;  1XW6 A;  2GSS A;  2FWH A;  5D93 A;  5JWO B;  2O89 A;  4NHZ A;  5IPH A;  1G7E A;  1THO A;  2NPB A;  2H19 A;  5HR2 A;  4OFN A;  5D96 A;  1BJX A;  3N5O A;  3UJ1 A;  1VGL A;  1VF3 A;  1H4O A;  4PQH A;  2HSH A;  3EMX A;  4EDZ A;  3L78 A;  4K1F A;  3AY8 A;  5DCG A;  5F06 A;  5ECH B;  3GNJ A;  1AXD A;  1FO5 A;  4F0C A;  1GSQ A;  3Q19 A;  4KSM A;  4ECJ A;  2JZT A;  3UEM A;  1E6B A;  4YQU A;  4PTS A;  1OC9 A;  3O6T A;  2VAF A;  3I69 A;  1OE8 A;  1TRV A;  2O8V B;  4D73 B;  4J57 E;  1GUL A;  4HZ2 A;  4IEL A;  5ECL B;  5H5Q A;  1GH2 A;  1TK5 B;  1PQN A;  4G19 A;  2GZY A;  4WKW A;  1Z3E A;  1F3B A;  3KMN A;  3LFL A;  1UN2 A;  3KMO A;  3P90 A;  2CQ9 A;  2JL4 A;  4ZIL A;  4ISD A;  5EVO A;  2DIZ A;  3F3Q A;  2MMN A;  3F9U A;  1WWJ A;  3PGT A;  3IRA A;  5CRD A;  4X0X A;  2V32 A;  4MMM A;  3NOF A;  1G7O A;  4GF0 A;  4POK A;  2VCQ A;  2OKA A;  2OAD A;  4K0G A;  2F8A A;  1ZL9 A;  2WB9 A;  1GUK A;  2H1A A;  2GST A;  4ZBB A;  1J08 A;  1PX6 A;  4ZXG A;  3DEX A;  1JLW A;  5ECR B;  2GZP A;  1O73 A;  1LBK A;  2DJ0 A;  3FHK A;  5H5S A;  1T7P B;  3Q74 A;  4ECB A;  2AUV A;  4O5R A;  1LJR A;  4KND A;  2LJA A;  4MZW A;  3CXG A;  1FVK A;  1NW2 A;  4A5P A;  4BVY A;  4IGJ A;  2H6X A;  5HFI A;  5F07 A;  3KIJ A;  5AN1 A;  1S3C A;  1XBS A;  4LL4 B;  3ZIT A;  2JZS A;  3J7Y k;  1PGT A;  2MMA A;  3HJO A;  4KAE A;  3VWW A;  3H93 A;  5KN1 A;  3R3E A;  3LQ7 A;  1TTZ A;  4MZC A;  2X8G A;  3HZ8 A;  2CAQ A;  5DQS A;  1GLQ A;  2PU9 C;  3DVW A;  3ISO A;  1QXH A;  4AJ6 A;  2FD3 A;  3EIN A;  3F3R A;  3QPM A;  5HR1 A;  4MH2 A;  4BIK A;  2G2Q A;  3IXR A;  1U3I A;  1URM A;  2DIY A;  2HZE B;  4O32 A;  2PGT A;  2MMZ A;  1SJI A;  1OKD A;  4WBJ A;  1K0A A;  3L0H A;  1O85 A;  2C3Q A;  2KHP A;  1FG4 A;  3ZFL A;  2DC5 A;  1ZOF A;  5IIZ A;  4F9Z A;  5AGY A;  5CYY A;  1R26 A;  2QA1 A;  4EF0 A;  2VM1 A;  5IMA A;  1JHB A;  4L0U A;  1HYU A;  4USS A;  3ZVJ A;  1A0R P;  3H8Q A;  3W8J A;  5IQY A;  3LXT A;  1QK8 A;  3FEU A;  3ERG A;  2I81 A;  2CA8 A;  3W8S A;  1SK2 A;  2R3X A;  3FKF A;  4AF2 A;  4J2F A;  2L4Q A;  2VL9 A;  2MBS A;  2CVD A;  5G30 A;  1J0F A;  3FW2 A;  1HNB A;  1EP7 A;  5IMZ A;  1AW9 A;  2XC2 A;  2HYX A;  2YPM A;  4ACS A;  2WS2 A;  4OD7 A;  2X8H A;  5G1L A;  2C0F A;  2XPD A;  3QOU A;  1RW1 A;  3TGZ A;  1PN0 A;  4YQV A;  4FYC A;  1SKW B;  5GSS A;  1I5G A;  2JAC A;  3TJG A;  3K8N A;  4IKH A;  4KCE A;  6GSX A;  5D9X A;  3HJM A;  4ID0 A;  1MD3 A;  4HJ2 A;  2J23 A;  3CSH A;  16GS A;  2YCD A;  2AB6 A;  2PVO C;  3DD3 A;  1USB A;  5HFK A;  4QL9 A;  3GH6 A;  2K8S A;  4ECC A;  5BMU A;  4GRF A;  1TKD B;  2FNO A;  5KN2 A;  4NPB A;  5DDL A;  1SYR A;  5AIS A;  2XBI A;  3LG6 A;  4WF4 A;  4IVF A;  1O81 A;  2E0Q A;  4YH2 A;  2RM5 A;  3ZIJ A;  2HSM A;  20GS A;  4YAP A;  1K0M A;  4IP1 A;  4NV2 A;  3DVX A;  4X4J A;  5DAL A;  1ERT A;  3P7X A;  3ERF A;  1AIU A;  4DSS A;  1GNW A;  1N8J A;  3HYP A;  3L9V A;  4OFT A;  2OA7 A;  2FCH A;  2IFQ A;  2VL3 A;  1R5A A;  3A5W A;  3HVN A;  1GSF A;  4I5Q A;  4KB3 A;  1GWC A;  2ES7 A;  2GS3 A;  4HOJ A;  3DIE A;  4TR0 A;  4EL1 A;  1VRS D;  4TR1 A;  3O76 A;  1T3B A;  1XIY A;  3E0U A;  4EXJ A;  1TI3 A;  4EKZ A;  3TKQ A;  1PSQ A;  2H6Z A;  3WGD A;  1R4W A;  3QFB C;  1V57 A;  3HVX A;  4FYU A;  4KDY A;  12GS A;  2REM A;  3FZ5 A;  4GTU A;  1XWG A;  3MDK A;  5B7C A;  3D4M A;  3RDW A;  3FR3 A;  2WGR A;  3LXZ A;  1ON4 A;  5DJM A;  1M9A A;  3TRQ A;  3EWL A;  2R5G A;  5B8B A;  1YF1 A;  4KDU A;  2YV7 A;  4V1A p;  3C7M A;  4O5Q A;  5G5F A;  3F6F A;  3IHG A;  4MCU A;  2IME A;  1K3L A;  3LW9 A;  3HD5 A;  5CO3 A;  2L59 A;  2IN3 A;  4AGS A;  3G7Y A;  3TKS E;  1XOA A;  2HRK A;  4HUA A;  4ULX A;  2V6O A;  3CMI A;  2OJL A;  3F6D A;  1K3Y A;  1X0R A;  4WF5 A;  2MYG A;  2O7K A;  2GQK A;  4CW9 A;  4HU9 A;  2CAI A;  4NXI A;  4PNF A;  4WR5 A;  3G9B A;  4LA1 A;  1IYI A;  2C0E A;  4O5U A;  1G0T A;  1A2L A;  3GKX A;  3FZ4 A;  4OCE A;  3A2X A;  4V1A g;  5KN0 A;  2VLV A;  3NIV A;  5A4V A;  4XS6 A;  5ECQ B;  4LMW A;  2ON7 A;  2HRN A;  2CT6 A;  1AQV A;  5KEJ A;  1ZGN A;  1R5P A;  3IK9 A;  3GL5 A;  3APS A;  5IOX A;  5ECM B;  2A4H A;  1LU4 A;  2FLS A;  2OE1 A;  3D0Z A;  2P5R A;  4POL A;  4K7I A;  4MJE A;  3J7Y b;  6GSV A;  4MNN A;  1YKC A;  5DAK A;  1HQO A;  3IR4 A;  4QL7 A;  4HQS A;  3N9J A;  1GLP A;  1YDK A;  3L9S A;  2BTO T;  3PR8 A;  3BOA A;  3CQF A;  1W89 A;  2FWE A;  1IYH A;  1XFL A;  4KDX A;  1FHE A;  1V2A A;  1WOU A;  4PQ1 A;  1F9M A;  3CBU A;  3VLN A;  3HKR A;  1T00 A;  2GSR A;  1SK1 A;  2IJY A;  4V2L A;  1YEX A;  2OBI A;  4BPY A;  2AV4 A;  3QR6 A;  2WZ9 A;  2PVQ A;  2IMD A;  2PUK C;  4X43 A;  1C72 A;  1MDK A;  4ZB6 A;  2VM2 A;  1ILO A;  5L71 A;  3ZTL A;  4KSO A;  3EUR A;  4PUR A;  1U3A A;  4GCI A;  1YEP A;  1B8X A;  1E2Y A;  3KP8 A;  5CRE A;  6GSS A;  3F63 A;  5IMD A;  5D9W A;  5IOW A;  1O6J A;  4GQC A;  4ZL9 A;  2LST A;  3A2V A;  3H1N A;  1KTE A;  3GKM A;  3GST A;  2H74 A;  2VL2 A;  3EU4 A;  5ECP B;  1WIK A;  1XW9 A;  1JZD A;  5ID2 A;  2F51 A;  5J5N A;  5D73 A;  4I2T A;  1J9B A;  2LJR A;  3TKR A;  3V1W A;  2CX3 A;  5B6M A;  2VLU A;  2TRX A;  1K0C A;  5F05 A;  3UVH A;  3IHQ A;  1O7U A;  3TKS C;  1OC9 B;  1RK4 A;  4FIW A;  4K7N A;  4XCS A;  4EDY A;  3GTU B;  3W6G A;  2LRT A;  4HU7 A;  3IV4 A;  2FWG A;  4PX1 A;  1M3I A;  3QMX A;  4DSQ A;  3TCO A;  3KCM A;  3TKS A;  5HR0 A;  4TXO A;  2YZH A;  1X9W B;  3Q6O A;  4MJB A;  1FOV A;  1W4V A;  4KW6 A;  3HVV A;  3VPQ A;  4AJ7 A;  5J3R A;  3TUE A;  5IMV A;  1A8Y A;  1ST9 A;  1S3R A;  1SL0 B;  1SL1 B;  2OE3 A;  5CP1 A;  4TR4 A;  1Z5Y E;  2KLX A;  1B48 A;  1JZO A;  3PH9 A;  2Z9S A;  2X4A A;  3FRC A;  4F2I A;  3M8N A;  1XWC A;  4BL7 A;  4FYB A;  1FOH A;  1DE2 A;  3UOM A;  3IC8 A;  4K9Z A;  2WJU A;  4OO5 A;  2LUS A;  4P3Y B;  1PKW A;  1BYE A;  2QA2 A;  4KA0 A;  4BVY B;  1SYX A;  4TN8 A;  3VI7 A;  3EC3 A;  3ME7 A;  1K0N A;  5CAX A;  1SL2 B;  3M9J A;  3TKP A;  1ERW A;  4KH7 A;  2D2Z A;  3DKS A;  4CY6 A;  1GUH A;  2UZ8 A;  4NWY A;  2VLT A;  1XPV A;  5ECI B;  7GSS A;  4N10 A;  2DLX A;  1X5D A;  2WRT A;  4Z7X A;  3IA1 A;  4L0W A;  3R2Q A;  9GSS A;  4Q5F A;  4MP4 A;  4HSC X;  4I8B A;  1KBN A;  3QAV A;  1GTI A;  1TRS A;  2R2J A;  1A23 A;  1A24 A;  4ZIJ A;  2HI7 A;  6GSY A;  1B9X C;  2K6V A;  2N5B A;  1M2B A;  4MPF A;  3UL3 A;  1R7H A;  4Q5N A;  2DJ2 A;  4ZL8 A;  2KOK A;  2A2S A;  1GUM A;  2VCV A;  1BX9 A;  2BJX A;  1X9M B;  3US3 A;  4F03 A;  2H1G A;  4GSN A;  1GNE A;  4MH3 A;  3IC4 A;  2LS5 A;  3HZ4 A;  4MF7 A;  3CRT A;  3GX8 A;  2L6C A;  1PFO A;  4Z2U A;  5ELG A;  4K6X A;  1GTA A;  2HXK A;  2IMI A;  1CQG A;  3DML A;  5G31 A;  4IQA A;  4IN0 A;  1DUG A;  5ENU A;  5JCU A;  4TR3 A;  4HI7 A;  5FWG A;  2M46 A;  3ZML A;  2E2M A;  4IQ1 A;  2A4V A;  2VO4 A;  1TDI A;  1FB6 A;  5D9T A;  1OAZ A;  2VCW A;  3O3T A;  1B9Y C;  2DJJ A;  2MBT A;  2IL3 A;  3FZ9 A;  2ON5 A;  1TOF A;  4XS4 B;  3F8U A;  3DWV A;  1XG8 A;  4K2X A;  4E8H A;  5IM9 A;  1PKZ A;  2KP2 A;  3QAG A;  4PQI A;  3TRP A;  2C0G A;  2JSZ A;  4WXT A;  2EIR A;  6GSU A;  1UA5 A;  2H8L A;  5E59 A;  2R6K A;  3OR5 A;  4XS1 A;  4PXO A;  2DMM A;  4FQU A;  4ZBA A;  4Z2R A;  2LTK A;  2VOC A;  2OE0 A;  1B4Q A;  3KTL A;  2L5L A;  3SWL A;  3UVT A;  5B8A A;  2BMX A;  3IOS A;  1M99 A;  2LNS A;  2DJK A;  4KUN A;  2HNL A;  3CYN A;  3NZN A;  1I9D A;  5A5K A;  4K5S A;  1DE1 A;  1PA3 A;  1PN9 A;  5DAL B;  1F3A A;  3ZFB A;  4Q5R A;  4DSS B;  4YKF A;  5HFG A;  4TW5 A;  4K0N A;  2A2R A;  1UVZ A;  3WGE A;  2VCZ A;  2RII A;  2O87 A;  3A2W A;  4RUV A;  4N0Z A;  1AC1 A;  2B1K A;  3HVS A;  4DSR A;  4ECI A;  2GVP A;  2LQQ A;  1TXX A;  1EWX A;  1M3J A;  2L5O A;  2AAW A;  5H5R A;  4JRR A;  3UBK A;  4BWS A;  2I9H A;  2E2G A;  1WP0 A;  2H71 A;  2TRC P;  4WR4 A;  3JCM L;  3DXB A;  1SD8 A;  2LJK A;  4FO5 A;  5DVB A;  4GQF A;  2JSY A;  4OCF A;  3TJB A;  3KM6 A;  5COH A;  2ZCT A;  3IE3 A;  5LNK e;  4NHW A;  1Q98 A;  5IMF A;  3ZYW A;  2X49 A;  4N0V A;  1K0B A;  2GQM A;  6GST A;  2VIM A;  1JLV A;  3EMP A;  2P0G A;  4TOP A;  2K8V A;  4XIH A;  2IMK A;  3H4K A;  3U6V A;  19GS A;  2L6D A;  1TK8 B;  6GSW A;  4JBB A;  1EP8 A;  2C80 A;  2GLR A;  2XPE A;  2B5X A;  4DVC A;  1F2E A;  3GMF A;  2M80 A;  4XRD A;  1Y6E A;  2QKE A;  3TJK A;  4MK3 A;  1AUC A;  3HCZ A;  2NBS A;  1M2A A;  5G5E A;  4IHU A;  1KEB A;  2RM6 A;  2GTU A;  4EC0 A;  3LYP A;  1UC7 A;  22GS A;  2H0G A;  3VK9 A;  3ZRD A;  3WGX A;  4EO3 A;  1EOH A;  2YJH A;  4RQX A;  5ECK B;  2B1L A;  3C8E A;  3Q18 A;  2P5Q A;  3F0I A;  5JCG A;  2AJQ B;  5J41 A;  2DKH A;  5JWQ B;  4OO4 A;  3A5I A;  1S3D A;  1HNC A;  2IIY A;  5CRG A;  5HR3 A;  2IMF A;  2FA4 A;  4OFM A;  4HZ4 A;  2B7K A;  3RHB A;  3HA9 A;  5INY A;  3FK8 A;  3MWH A;  4F0B A;  5GST A;  1MD4 A;  3ED3 A;  3KP9 A;  1WJK A;  1F6M C;  1NM3 A;  1HD2 A;  1M2D A;  1XWA A;  3IK7 A;  1PL2 A;  2C0D A;  5AIV A;  5LCZ A;  4XTS A;  2CZ3 A;  3L9U A;  4NMU A;  1SJ6 A;  4RQR A;  2B6M A;  3DGQ A;  4JR4 A;  2TIR A;  3VI5 A;  4MF6 A;  2GZZ A;  3BCK A;  3APQ A;  1THX A;  3RBT A;  2LRC A;  5KOX A;  1Z7R A;  4JU5 A;  4DEJ A;  3C73 A;  1XCC A;  1NHO A;  5CRH A;  1QFN A;  4MJA A;  1Z6N A;  2H66 A;  1T4Z A;  4IS0 A;  1YJ6 A;  2X99 A;  1XZO A;  3KH9 A;  2L57 A;  2X8C A;  2LKU A;  1B4P A;  1WE0 A;  5ELA A;  4E8E A;  5J9C A;  2DSA A;  4ZBD A;  2YWM A;  3WD6 A;  2JU5 A;  2VL2 C;  2V2G A;  4MZB A;  1CQH A;  2N5A A;  2DML A;  3CSI A;  3BJ5 A;  3UAP A;  1QUW A;  4RI7 A;  1SEN A;  1YKA A;  2H0I A;  1TK0 B;  2YZU A;  4TXO B;  2G0F A;  4AJ8 A;  1FAA A;  2EC4 A;  2FGX A;  4G0K A;  3WYW A;  4ICY A;  2VCT A;  4NV5 A;  1SK0 A;  2C1Y A;  3S9F A;  4XRA A;  4G9H A;  4YQM A;  1ZYN A;  1XXU A;  1K3O A;  3HHV A;  11GS A;  1ZCP A;  2JZR A;  2B5E A;  4GST A;  3KH7 A;  1QGV A;  2F3M A;  2H30 A;  3GN3 A;  2V6K A;  2HLS A;  3IAM 2;  5DQY A;  4G0I A; 
#chains in the Genus database with same CATH homology
 1Q4J A;  4N30 A;  2J9H A;  1V58 A;  3TOU A;  5D8I A;  5IMC A;  1G6W A;  3D6I A;  2YOI A;  3M0F A;  1Y25 A;  3LYK A;  2CVB A;  3DYR A;  5BRT A;  1H75 A;  4JZQ A;  2WCI A;  1EEJ A;  3HJP A;  2B7J A;  3IAS 2;  1ZYP A;  2H1B A;  1BED A;  3D21 A;  1A8L A;  3LGC A;  2OAC A;  3EU3 A;  4BVX A;  3GKK A;  4IJ3 A;  5DBQ A;  1GP1 A;  1DBY A;  4Z2T A;  3ZL5 A;  1X9S B;  13GS A;  4V2M A;  2HZF A;  2FA8 A;  3G7J A;  4MF5 A;  1U87 A;  5ABR A;  3FZA A;  2VD0 A;  4X1U A;  3C1S A;  2XHF A;  5A4W A;  1GSS A;  2H70 A;  3GTU A;  4K7O A;  2IWT A;  2CX4 A;  4MAB A;  4KE3 A;  4PGT A;  1Z6M A;  1EGR A;  5C04 A;  4MJC A;  1ERV A;  1Z7P A;  2A2P A;  2RUE A;  1ZYQ B;  2HSY A;  4IJI A;  4HDE A;  1V40 A;  1BAY A;  3GV1 A;  2NTO A;  4OWY A;  1GSY A;  2IPA A;  4EVM A;  2FUG 2;  2H1D A;  2LQO A;  2QGV A;  4FH8 A;  2KP1 A;  3CTF A;  4Q5Q A;  4O92 A;  3I6A A;  2PWJ A;  3EVI A;  1EGO A;  3EPT A;  1A0F A;  3KZQ A;  1PD2 1;  3DRN A;  5DCH A;  3MSZ A;  4D73 A;  2H76 A;  1M0U A;  4YAV A;  5FT3 A;  4L8E A;  3QCP A;  3ZRE A;  2QC7 A;  2C8U A;  4ZB8 A;  2JAD A;  4BWQ A;  1JZR A;  2R37 A;  1YZX A;  4EE0 A;  2P31 A;  4G0L A;  1GSU A;  5CNW A;  2FHE A;  3H79 A;  4N11 A;  1FW1 A;  3ZMK A;  3M1G A;  3QDN A;  4I2U A;  3IPZ A;  3UBL A;  2H75 A;  1OYJ A;  3GL3 A;  5FHI A;  2DKI A;  3VWV A;  3MYD A;  2HE3 A;  2NVL A;  3C71 A;  3EYT A;  4G10 A;  5EY6 A;  1ZMA A;  4J56 E;  2V1M A;  1MEK A;  4GWR A;  4ML6 A;  3TJF A;  3GA4 A;  2C4J A;  3VFI A;  1V98 A;  5J4U A;  4TRX A;  1ABA A;  4G2E A;  1BQ7 A;  2WFC A;  1MDJ A;  4BA7 A;  4MPG A;  4LMV A;  2MMO A;  1T1V A;  1M9B A;  3GSS A;  3D5J A;  4H86 A;  3LEF A;  1OKT A;  3RHC A;  3BD2 A;  1XWK A;  4EUY A;  2YNX A;  5AIX A;  1WRY A;  4PNG A;  1A2M A;  5IPG A;  4XHM A;  4K5R A;  1WMJ A;  3CSJ A;  1XVQ A;  3MNG A;  3KXO A;  1ZZY A;  3TOT A;  1PMT A;  1K0D A;  5KN3 A;  2E7P A;  4JR6 A;  5B6N A;  3LOR A;  1GL8 A;  2RLI A;  4PUF C;  3F4S A;  3TDG A;  3C1R A;  1EV4 A;  3ZIV A;  5A4U A;  1XVW A;  1OE7 A;  4HJM A;  4PUA A;  18GS A;  5F0G A;  3LSZ A;  2ALB A;  2YWO A;  1T8E B;  1X5E A;  2CZ2 A;  1N2A A;  1F37 A;  2GQL A;  2NDO A;  2HZE A;  4RI6 A;  3ZZX A;  2ZUP A;  1WPI A;  3I43 A;  2HFD A;  5F8B A;  1G6Y A;  3VUR A;  3GFK A;  2YWI A;  2C3T A;  3MAK A;  4HEA 2;  4NAX A;  4KX4 A;  5G1K A;  2HRF A;  1YY7 A;  1SD9 A;  1TP9 A;  3ME8 A;  5ECO B;  1ML6 A;  1SKS B;  3BBY A;  3HY2 A;  4XS4 A;  3IDV A;  2YAN A;  2IFQ B;  4WET A;  2DJ1 A;  4KGI A;  2H72 A;  1FB0 A;  4CY8 A;  4TR1 B;  2B5Y A;  4GXZ A;  1MTC A;  3VPT A;  4K2D A;  2L4C A;  2RUF A;  2H01 A;  2EIQ A;  2PBJ A;  4EIQ A;  3QD9 A;  5J9B A;  5EPF A;  1GRX A;  4CDO A;  4LLR A;  4IBP A;  3GIX A;  1JFU A;  1GTU A;  2YWN A;  2GSQ A;  4MA9 A;  3GYK A;  5KOW A;  1QMV A;  3SBC A;  5LD0 A;  1U88 A;  2O85 A;  3KGK A;  3HDC A;  2H6Y A;  5HQP A;  1GSE A;  1BG5 A;  2HT9 A;  1JZW A;  2CVK A;  5ECN B;  3PPU A;  5IO2 A;  4F82 A;  4CHS A;  3KJY A;  3MIX A;  1ERU A;  3HXS A;  1AQW A;  3U5R E;  1Z9H A;  5JCW A;  1DSB A;  2GDR A;  3PIN A;  2F8F A;  2LNT A;  4JE1 A;  5IO0 A;  1O8X A;  3KEB A;  17GS A;  3WT1 A;  1TU7 A;  3F4T A;  1YQ1 A;  3E3E A;  5CRW A;  3M9K A;  1PX7 A;  2H73 A;  3ZVJ D;  2GT6 A;  1QQ2 A;  4K8M A;  3TRX A;  1VF4 A;  3GUS A;  2OBK A;  1TJD A;  3L4N A;  2N5F A;  1ZYE A;  2R0G A;  3GX0 A;  4GSS A;  5D9V A;  1TW9 A;  2AHE A;  3RPP A;  1AAZ A;  4QQ7 A;  3APO A;  4L5L A;  3EE2 A;  2WDU A;  4ZB9 A;  2R4V A;  14GS A;  4ML1 A;  4ZL7 A;  2LV3 A;  3RPN A;  2ZNM A;  3E9J B;  2I4A A;  3VWU A;  3QAW A;  3GKN A;  5C00 A;  1GSD A;  4TVE A;  4HQZ A;  3FR9 A;  5DAK B;  4TXV A;  2HRA A;  5E4W A;  1AQX A;  1S3A A;  1RQM A;  1NHY A;  4L5O A;  2K9F A;  3CRU A;  2EIO A;  1OVN A;  4POM A;  1XOB A;  2I1U A;  2YP6 A;  2DBC A;  1X5C A;  1XWB A;  4MDC A;  8GSS A;  4OMV A;  2XBQ A;  1NSW A;  1O8W A;  1EV9 A;  3KTB A;  2GT5 A;  3TB2 A;  4GLT A;  2B3S A;  3UAR A;  4YKG A;  1SU9 A;  2FY6 A;  4WBR D;  3KD0 A;  1A2J A;  2V41 A;  5EL8 A;  3UIW A;  3WT2 A;  4TKY A;  4WEY A;  1EEM A;  2CV4 A;  3FYG A;  4LL1 B;  5GAN D;  3D4T A;  3GRX A;  2I3Y A;  2M72 A;  2GGT A;  3FMW A;  3LJR A;  1FVJ A;  2R0P A;  1OC8 A;  1SKR B;  2WUL A;  1TU8 A;  3F4R A;  2YN1 A;  1GTB A;  2YJ7 A;  1XW5 A;  3FR6 A;  3P2A A;  2YV9 A;  1TRW A;  2QSI A;  4KF9 A;  2LRN A;  5ID2 B;  2K18 A;  1HNA A;  4O7H A;  2VCX A;  1ACV A;  3QFA C;  1T4Y A;  2H0H A;  4IP6 A;  1PL1 A;  2LEG A;  1EOG A;  3D22 A;  2PMT A;  1V9W A;  3I9V 2;  4I6X A;  2DJ3 A;  4V2N A;  3IBH A;  4KCA A;  1EZK A;  4HS1 A;  1TRU A;  5GZZ B;  1U6T A;  3P8W A;  3CTG A;  5DJL A;  4EIP A;  1KNG A;  1TI1 A;  3GHA A;  1MDI A;  4ILF A;  5GAP D;  1YF0 A;  2C3N A;  2FWF A;  3M3M A;  1PRX A;  2MZC A;  3VWX A;  1VF2 A;  4IW9 A;  5G2Z A;  1OC3 A;  2VD1 A;  3GUR A;  1M7T A;  3GH9 A;  2AYT A;  3LWA A;  3FY7 A;  1VF1 A;  2PPT A;  2X64 A;  4BVX B;  2R0C A;  3BCI A;  3G7I A;  4MLY A;  1SJZ A;  3ERW A;  5ECS A;  5JWR B;  2PN8 A;  4I97 A;  3RAZ A;  3ZLP A;  3TJJ A;  1K0O A;  2VUP A;  4POB A;  2PER A;  4BL7 B;  3A3T A;  3UMA A;  4JED A;  2KUC A;  2F9S A;  10GS A;  1XW6 A;  2GSS A;  2FWH A;  5D93 A;  5JWO B;  2O89 A;  4NHZ A;  5IPH A;  1G7E A;  1THO A;  2NPB A;  2H19 A;  5HR2 A;  4OFN A;  5D96 A;  1BJX A;  3N5O A;  3UJ1 A;  1VGL A;  1VF3 A;  1H4O A;  4PQH A;  2HSH A;  3EMX A;  4EDZ A;  3L78 A;  4K1F A;  3AY8 A;  5DCG A;  5F06 A;  5ECH B;  3GNJ A;  1AXD A;  1FO5 A;  4F0C A;  1GSQ A;  3Q19 A;  4KSM A;  4ECJ A;  2JZT A;  3UEM A;  1E6B A;  4YQU A;  4PTS A;  1OC9 A;  3O6T A;  2VAF A;  3I69 A;  1OE8 A;  1TRV A;  2O8V B;  4D73 B;  4J57 E;  1GUL A;  4HZ2 A;  4IEL A;  5ECL B;  5H5Q A;  1GH2 A;  1TK5 B;  1PQN A;  4G19 A;  2GZY A;  4WKW A;  1Z3E A;  1F3B A;  3KMN A;  3LFL A;  1UN2 A;  3KMO A;  3P90 A;  2CQ9 A;  2JL4 A;  4ZIL A;  4ISD A;  5EVO A;  2DIZ A;  3F3Q A;  2MMN A;  3F9U A;  1WWJ A;  3PGT A;  3IRA A;  5CRD A;  4X0X A;  2V32 A;  4MMM A;  3NOF A;  1G7O A;  4GF0 A;  4POK A;  2VCQ A;  2OKA A;  2OAD A;  4K0G A;  2F8A A;  1ZL9 A;  2WB9 A;  1GUK A;  2H1A A;  2GST A;  4ZBB A;  1J08 A;  1PX6 A;  4ZXG A;  3DEX A;  1JLW A;  5ECR B;  2GZP A;  1O73 A;  1LBK A;  2DJ0 A;  3FHK A;  5H5S A;  1T7P B;  3Q74 A;  4ECB A;  2AUV A;  4O5R A;  1LJR A;  4KND A;  2LJA A;  4MZW A;  3CXG A;  1FVK A;  1NW2 A;  4A5P A;  4BVY A;  4IGJ A;  2H6X A;  5HFI A;  5F07 A;  3KIJ A;  5AN1 A;  1S3C A;  1XBS A;  4LL4 B;  3ZIT A;  2JZS A;  3J7Y k;  1PGT A;  2MMA A;  3HJO A;  4KAE A;  3VWW A;  3H93 A;  5KN1 A;  3R3E A;  3LQ7 A;  1TTZ A;  4MZC A;  2X8G A;  3HZ8 A;  2CAQ A;  5DQS A;  1GLQ A;  2PU9 C;  3DVW A;  3ISO A;  1QXH A;  4AJ6 A;  2FD3 A;  3EIN A;  3F3R A;  3QPM A;  5HR1 A;  4MH2 A;  2G2Q A;  3IXR A;  1U3I A;  1URM A;  2DIY A;  2HZE B;  4O32 A;  2PGT A;  2MMZ A;  1SJI A;  1OKD A;  4WBJ A;  1K0A A;  3L0H A;  1O85 A;  2C3Q A;  2KHP A;  1FG4 A;  3ZFL A;  2DC5 A;  1ZOF A;  5IIZ A;  4F9Z A;  5AGY A;  5CYY A;  1R26 A;  2QA1 A;  4EF0 A;  2VM1 A;  5IMA A;  1JHB A;  4L0U A;  1HYU A;  4USS A;  3ZVJ A;  1A0R P;  3H8Q A;  3W8J A;  5IQY A;  3LXT A;  1QK8 A;  3FEU A;  3ERG A;  2I81 A;  2CA8 A;  3W8S A;  1SK2 A;  2R3X A;  3FKF A;  4AF2 A;  4J2F A;  2L4Q A;  2VL9 A;  2MBS A;  2CVD A;  5G30 A;  1J0F A;  3FW2 A;  1HNB A;  1EP7 A;  5IMZ A;  1AW9 A;  2XC2 A;  2HYX A;  2YPM A;  4ACS A;  2WS2 A;  4OD7 A;  2X8H A;  5G1L A;  2C0F A;  2XPD A;  3QOU A;  1RW1 A;  3TGZ A;  1PN0 A;  4YQV A;  4FYC A;  1SKW B;  5GSS A;  1I5G A;  2JAC A;  3TJG A;  3K8N A;  4IKH A;  4KCE A;  6GSX A;  5D9X A;  3HJM A;  4ID0 A;  1MD3 A;  4HJ2 A;  2J23 A;  3CSH A;  16GS A;  2YCD A;  2AB6 A;  2PVO C;  3DD3 A;  1USB A;  5HFK A;  4QL9 A;  3GH6 A;  2K8S A;  4ECC A;  5BMU A;  4GRF A;  1TKD B;  2FNO A;  5KN2 A;  4NPB A;  5DDL A;  1SYR A;  5AIS A;  2XBI A;  3LG6 A;  4WF4 A;  4IVF A;  1O81 A;  2E0Q A;  4YH2 A;  2RM5 A;  3ZIJ A;  2HSM A;  20GS A;  4YAP A;  1K0M A;  4IP1 A;  4NV2 A;  3DVX A;  4X4J A;  5DAL A;  1ERT A;  3P7X A;  3ERF A;  1AIU A;  4DSS A;  1GNW A;  1N8J A;  3HYP A;  3L9V A;  4OFT A;  2OA7 A;  2FCH A;  2IFQ A;  2VL3 A;  1R5A A;  3A5W A;  1GSF A;  4I5Q A;  4KB3 A;  1GWC A;  2ES7 A;  2GS3 A;  4HOJ A;  3DIE A;  4TR0 A;  4EL1 A;  1VRS D;  4TR1 A;  3O76 A;  1T3B A;  1XIY A;  3E0U A;  4EXJ A;  1TI3 A;  4EKZ A;  3TKQ A;  1PSQ A;  2H6Z A;  3WGD A;  1R4W A;  3QFB C;  1V57 A;  3HVX A;  4FYU A;  4KDY A;  12GS A;  2REM A;  3FZ5 A;  4GTU A;  1XWG A;  3MDK A;  5B7C A;  3D4M A;  3RDW A;  3FR3 A;  2WGR A;  3LXZ A;  1ON4 A;  5DJM A;  1M9A A;  3TRQ A;  3EWL A;  2R5G A;  5B8B A;  1YF1 A;  4KDU A;  2YV7 A;  4V1A p;  3C7M A;  4O5Q A;  5G5F A;  3F6F A;  3IHG A;  4MCU A;  2IME A;  1K3L A;  3LW9 A;  3HD5 A;  5CO3 A;  2L59 A;  2IN3 A;  4AGS A;  3G7Y A;  3TKS E;  1XOA A;  2HRK A;  4HUA A;  4ULX A;  2V6O A;  3CMI A;  2OJL A;  3F6D A;  1K3Y A;  1X0R A;  4WF5 A;  2MYG A;  2O7K A;  2GQK A;  4CW9 A;  4HU9 A;  2CAI A;  4NXI A;  4PNF A;  4WR5 A;  3G9B A;  4LA1 A;  1IYI A;  2C0E A;  4O5U A;  1G0T A;  1A2L A;  3GKX A;  3FZ4 A;  4OCE A;  3A2X A;  4V1A g;  5KN0 A;  2VLV A;  3NIV A;  5A4V A;  4XS6 A;  5ECQ B;  4LMW A;  2ON7 A;  2HRN A;  2CT6 A;  1AQV A;  5KEJ A;  1ZGN A;  1R5P A;  3IK9 A;  3GL5 A;  3APS A;  5IOX A;  5ECM B;  2A4H A;  1LU4 A;  2FLS A;  2OE1 A;  3D0Z A;  2P5R A;  4POL A;  4K7I A;  4MJE A;  3J7Y b;  6GSV A;  4MNN A;  1YKC A;  5DAK A;  1HQO A;  3IR4 A;  4QL7 A;  4HQS A;  3N9J A;  1GLP A;  1YDK A;  3L9S A;  2BTO T;  3PR8 A;  3BOA A;  1W89 A;  2FWE A;  1IYH A;  1XFL A;  4KDX A;  1FHE A;  1V2A A;  1WOU A;  4PQ1 A;  1F9M A;  3CBU A;  3VLN A;  3HKR A;  1T00 A;  2GSR A;  1SK1 A;  2IJY A;  4V2L A;  1YEX A;  2OBI A;  4BPY A;  2AV4 A;  3QR6 A;  2WZ9 A;  2PVQ A;  2IMD A;  2PUK C;  4X43 A;  1C72 A;  1MDK A;  4ZB6 A;  2VM2 A;  1ILO A;  5L71 A;  3ZTL A;  4KSO A;  3EUR A;  4PUR A;  1U3A A;  4GCI A;  1YEP A;  1B8X A;  1E2Y A;  3KP8 A;  5CRE A;  6GSS A;  3F63 A;  5IMD A;  5D9W A;  5IOW A;  1O6J A;  4GQC A;  4ZL9 A;  2LST A;  3A2V A;  3H1N A;  1KTE A;  3GKM A;  3GST A;  2H74 A;  2VL2 A;  3EU4 A;  5ECP B;  1WIK A;  1XW9 A;  1JZD A;  5ID2 A;  2F51 A;  5J5N A;  5D73 A;  4I2T A;  1J9B A;  2LJR A;  3TKR A;  3V1W A;  2CX3 A;  5B6M A;  2VLU A;  2TRX A;  1K0C A;  5F05 A;  3UVH A;  3IHQ A;  1O7U A;  3TKS C;  1OC9 B;  1RK4 A;  4FIW A;  4K7N A;  4XCS A;  4EDY A;  3GTU B;  3W6G A;  2LRT A;  4HU7 A;  3IV4 A;  2FWG A;  4PX1 A;  3QMX A;  4DSQ A;  3TCO A;  3KCM A;  3TKS A;  5HR0 A;  4TXO A;  2YZH A;  1X9W B;  3Q6O A;  4MJB A;  1FOV A;  1W4V A;  4KW6 A;  3HVV A;  3VPQ A;  4AJ7 A;  5J3R A;  3TUE A;  5IMV A;  1A8Y A;  1ST9 A;  1SL0 B;  1SL1 B;  2OE3 A;  5CP1 A;  4TR4 A;  1Z5Y E;  2KLX A;  1B48 A;  1JZO A;  3PH9 A;  2Z9S A;  2X4A A;  3FRC A;  4F2I A;  3M8N A;  1XWC A;  4BL7 A;  4FYB A;  1FOH A;  1DE2 A;  3UOM A;  3IC8 A;  4K9Z A;  2WJU A;  4OO5 A;  2LUS A;  4P3Y B;  1PKW A;  1BYE A;  2QA2 A;  4KA0 A;  4BVY B;  1SYX A;  4TN8 A;  3VI7 A;  3EC3 A;  3ME7 A;  1K0N A;  5CAX A;  1SL2 B;  3M9J A;  3TKP A;  1ERW A;  4KH7 A;  2D2Z A;  3DKS A;  4CY6 A;  1GUH A;  2UZ8 A;  4NWY A;  2VLT A;  1XPV A;  5ECI B;  7GSS A;  4N10 A;  2DLX A;  1X5D A;  2WRT A;  4Z7X A;  3IA1 A;  4L0W A;  3R2Q A;  9GSS A;  4Q5F A;  4MP4 A;  4I8B A;  1KBN A;  3QAV A;  1GTI A;  1TRS A;  2R2J A;  1A23 A;  1A24 A;  4ZIJ A;  2HI7 A;  6GSY A;  1B9X C;  2K6V A;  2N5B A;  1M2B A;  4MPF A;  3UL3 A;  1R7H A;  4Q5N A;  2DJ2 A;  4ZL8 A;  2KOK A;  2A2S A;  1GUM A;  2VCV A;  1BX9 A;  2BJX A;  1X9M B;  3US3 A;  4F03 A;  2H1G A;  4GSN A;  1GNE A;  4MH3 A;  3IC4 A;  2LS5 A;  3HZ4 A;  4MF7 A;  3CRT A;  3GX8 A;  2L6C A;  4Z2U A;  5ELG A;  4K6X A;  1GTA A;  2HXK A;  2IMI A;  1CQG A;  3DML A;  5G31 A;  4IQA A;  4IN0 A;  1DUG A;  5ENU A;  5JCU A;  4TR3 A;  4HI7 A;  5FWG A;  2M46 A;  3ZML A;  2E2M A;  4IQ1 A;  2A4V A;  2VO4 A;  1TDI A;  1FB6 A;  5D9T A;  1OAZ A;  2VCW A;  3O3T A;  1B9Y C;  2DJJ A;  2MBT A;  2IL3 A;  3FZ9 A;  2ON5 A;  1TOF A;  4XS4 B;  3F8U A;  3DWV A;  4K2X A;  4E8H A;  5IM9 A;  1PKZ A;  2KP2 A;  3QAG A;  4PQI A;  3TRP A;  2C0G A;  2JSZ A;  4WXT A;  2EIR A;  6GSU A;  1UA5 A;  2H8L A;  5E59 A;  2R6K A;  3OR5 A;  4XS1 A;  4PXO A;  2DMM A;  4FQU A;  4ZBA A;  4Z2R A;  2LTK A;  2VOC A;  2OE0 A;  1B4Q A;  3KTL A;  2L5L A;  3SWL A;  3UVT A;  5B8A A;  2BMX A;  3IOS A;  1M99 A;  2LNS A;  2DJK A;  4KUN A;  2HNL A;  3CYN A;  3NZN A;  1I9D A;  5A5K A;  4K5S A;  1DE1 A;  1PA3 A;  1PN9 A;  5DAL B;  1F3A A;  3ZFB A;  4Q5R A;  4DSS B;  4YKF A;  5HFG A;  4TW5 A;  4K0N A;  2A2R A;  1UVZ A;  3WGE A;  2VCZ A;  2RII A;  2O87 A;  3A2W A;  4RUV A;  4N0Z A;  1AC1 A;  2B1K A;  3HVS A;  4DSR A;  4ECI A;  2GVP A;  2LQQ A;  1TXX A;  1EWX A;  2L5O A;  2AAW A;  5H5R A;  4JRR A;  3UBK A;  4BWS A;  2I9H A;  2E2G A;  1WP0 A;  2H71 A;  2TRC P;  4WR4 A;  3JCM L;  3DXB A;  1SD8 A;  2LJK A;  4FO5 A;  5DVB A;  4GQF A;  2JSY A;  4OCF A;  3TJB A;  3KM6 A;  5COH A;  2ZCT A;  3IE3 A;  5LNK e;  4NHW A;  1Q98 A;  5IMF A;  3ZYW A;  2X49 A;  4N0V A;  1K0B A;  2GQM A;  6GST A;  2VIM A;  1JLV A;  3EMP A;  2P0G A;  4TOP A;  2K8V A;  4XIH A;  2IMK A;  3H4K A;  3U6V A;  19GS A;  2L6D A;  1TK8 B;  6GSW A;  4JBB A;  1EP8 A;  2C80 A;  2GLR A;  2XPE A;  2B5X A;  4DVC A;  1F2E A;  3GMF A;  2M80 A;  4XRD A;  1Y6E A;  2QKE A;  3TJK A;  4MK3 A;  1AUC A;  3HCZ A;  2NBS A;  1M2A A;  5G5E A;  4IHU A;  1KEB A;  2RM6 A;  2GTU A;  4EC0 A;  3LYP A;  1UC7 A;  22GS A;  2H0G A;  3VK9 A;  3ZRD A;  3WGX A;  4EO3 A;  1EOH A;  2YJH A;  4RQX A;  5ECK B;  2B1L A;  3C8E A;  3Q18 A;  2P5Q A;  3F0I A;  5JCG A;  2AJQ B;  5J41 A;  2DKH A;  5JWQ B;  4OO4 A;  3A5I A;  1S3D A;  1HNC A;  2IIY A;  5CRG A;  5HR3 A;  2IMF A;  2FA4 A;  4OFM A;  4HZ4 A;  2B7K A;  3RHB A;  3HA9 A;  5INY A;  3FK8 A;  3MWH A;  4F0B A;  5GST A;  1MD4 A;  3ED3 A;  3KP9 A;  1WJK A;  1F6M C;  1NM3 A;  1HD2 A;  1M2D A;  1XWA A;  3IK7 A;  1PL2 A;  2C0D A;  5AIV A;  5LCZ A;  4XTS A;  2CZ3 A;  3L9U A;  4NMU A;  1SJ6 A;  4RQR A;  2B6M A;  3DGQ A;  4JR4 A;  2TIR A;  3VI5 A;  4MF6 A;  2GZZ A;  3BCK A;  3APQ A;  1THX A;  3RBT A;  2LRC A;  5KOX A;  1Z7R A;  4JU5 A;  4DEJ A;  3C73 A;  1XCC A;  1NHO A;  5CRH A;  1QFN A;  4MJA A;  1Z6N A;  2H66 A;  1T4Z A;  4IS0 A;  1YJ6 A;  2X99 A;  1XZO A;  3KH9 A;  2L57 A;  2X8C A;  2LKU A;  1B4P A;  1WE0 A;  5ELA A;  4E8E A;  5J9C A;  2DSA A;  4ZBD A;  2YWM A;  3WD6 A;  2JU5 A;  2VL2 C;  2V2G A;  4MZB A;  1CQH A;  2N5A A;  2DML A;  3CSI A;  3BJ5 A;  3UAP A;  1QUW A;  4RI7 A;  1SEN A;  1YKA A;  2H0I A;  1TK0 B;  2YZU A;  4TXO B;  2G0F A;  4AJ8 A;  1FAA A;  2EC4 A;  2FGX A;  4G0K A;  3WYW A;  4ICY A;  2VCT A;  4NV5 A;  1SK0 A;  2C1Y A;  3S9F A;  4XRA A;  4G9H A;  4YQM A;  1ZYN A;  1XXU A;  1K3O A;  3HHV A;  11GS A;  1ZCP A;  2JZR A;  2B5E A;  4GST A;  3KH7 A;  1QGV A;  2F3M A;  2H30 A;  3GN3 A;  2V6K A;  2HLS A;  3IAM 2;  5DQY A;  4G0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...