2YB7A

Cbm62 in complex with 6-alpha-d-galactosyl-mannotriose
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
140
structure length
140
Chain Sequence
SYPKLTGTVIGTQGSWNNIGNTIHKAFDGDLNTFFDGPTANGCWLGLDFGEGVRNVITQIKFCPRSGYEQRMIGGIFQGANKEDFSDAVTLFTITSLPGSGTLTSVDVDNPTGFRYVRYLSPDGSNGNIAELQFFGTPAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CARBOHYDRATE BINDING FAMILY 6
publication title A Novel, Noncatalytic Carbohydrate-Binding Module Displays Specificity for Galactose-Containing Polysaccharides Through Calcium-Mediated Oligomerization.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Sugar binding protein
total genus 33
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2yb7A00
4OYUA 4MGSA 4QDRA 5DN2A 2V4VA 4LHSA 2WO2A 3WF1A 4BK5A 3K46A 3VDBA 3ACHA 5G04L 3W5MA 3GXUA 2BERA 3WF3A 2Y64A 2QQKA 2VZRA 2Y8KA 3THDA 1XNAA 1GMMA 2VZ3A 2W92A 4DXSA 2VMCA 2LS6A 3T0BA 5DPNA 3HJRA 4XURA 1NKGA 2J1EA 5EJ1B 2WN3A 3LEIA 2VOTA 3LPGA 1BHGA 3WF4A 1XC6A 4OUEA 1ULPA 2EIDA 3IDAA 3NRUA 1JZ8A 4XUQA 4ZXEA 3LPFA 4M4PA 4MGQA 3LEGA 3DYOA 1UYZA 2BGOA 5C70A 2JD9A 1DYOA 1O8PA 4XUOA 1GNYA 1OT5A 2YFUA 3SEEA 1PX3A 2OKXA 3VDAA 4CUBA 2HLEA 1PX4A 2BGPA 5JXHA 1GOFA 2BBAA 3CZUA 3T0AA 2QQJA 3DYPA 2YG0A 2EIBA 4QX3A 3MV11 1DLCA 1H6YA 4CU8A 1K12A 3ACFA 5LA2A 1JZ7A 2ZXQA 4QX2A 3IIIA 1JYWA 4XVHA 4DXRA 4OZOA 2J1SA 3WNLA 3HEIA 3I2FA 5C71A 5IFPA 1I5PA 2VZQA 3DYMA 3OBAA 3GDBA 3T2QA 1F4AA 3EB7A 4KI5M 1KGYA 1UX7A 4DEQA 3HPNA 1L7RA 3A21A 3I2JA 3K4ZA 4P00B 1GOHA 3WF0A 3C7EA 3NJVA 2WBKA 2VMFA 1JU4A 2W5FA 4GZ9A 4QDSA 1J83A 1EUUA 1ULOA 4KMQA 3UETA 3MUZ1 1KEXA 4ZY9A 3I2HA 3C7GA 4QX1A 4W4ZA 4DXTA 2W1UA 1XPWA 1JZ5A 1JZ4A 2YC4A 1D7PM 1UY0A 4XUNA 1W9TA 4QX0A 2X10A 2X05A 4A4AA 3MUY1 5LA0A 3I3BA 3PUIA 2VL4A 4A42A 2HYXA 3LE0A 3P1IA 1F4HA 3T2PA 1T2XA 2B4KA 3C7FA 3NNGA 5JXGA 5DQ0A 1CIYA 1GUIA 2EIEA 2VQUA 2QQIA 2W47A 3WNOA 1W0NA 1YQ2A 2R7EB 2VO5A 2WZ8A 3U37A 3CMGA 2VZPA 3IAPA 2V5DA 3ETPA 5EIYB 2VM9A 3CZJA 1NX9A 4RYDA 3D3AA 3VD5A 4ARXA 4CU9A 4DUVA 2W91A 3EYPA 2VZOA 3OGRA 3I3EA 2W1QA 4A6OA 1JYXA 1UWWA 4JKMA 2KD7A 4KWUA 3P6BA 1EUTA 1RYYA 2ZEXA 4QB6A 3PUHA 3UESA 4A44A 4P08A 2YC2A 4A41A 3VD9A 2J7MA 3VDCA 1W9WA 2VQTA 3WNNA 3WEZA 3T08A 2RV9A 4IUGA 2W1SA 3ECQA 4HG6B 1WCQA 5EJZB 5F7UA 1CZSA 4QAWA 3MV01 1US2A 1SDDB 2B9VA 4A3ZA 4Z2AA 1JZ6A 3F2ZA 3WNPA 3I97A 1OF3A 5G05L 4AAXA 2VJXA 4CU6A 3I2IA 2L9LA 3FL7A 2VMEA 1SG3A 1HN1A 2Y6LA 3DECA 2WQ8A 2VZ1A 5B4NA 4W50A 3OGVA 3ACGA 4QDQA 4QPWA 3NJXA 5JUVA 4JKKA 2WO3A 1CZTA 2WYSA 1UMIA 2J1RA 2V72A 2J1VA 3CKHA 4UAPA 4DUWA 5I0DA 1UYYA 4ZZ5A 4LKSA 1K3IA 4UI9L 3WSOA 4D8MA 3JXSA 3VD4A 3K4DA 2VMDA 3SKVA 1UYXA 4PF1A 4LPLA 2YFZA 2QQNA 3BGAA 5LA1A 1W8NA 4TXWA 1JYNA 1UY4A 4QB1A 4DEVA 2VCBA 4JKLA 4QB2A 2E33A 2ZEYA 2JKXA 3WNMA 1GQPA 2Y6HA 2WDBA 4PQQA 3WQBA 3K75B 4CUCA 3MBWA 1IQDC 2ID4A 2WAOA 4JHZA 2J1UA 2W95A 2XOMA 4CU7A 3GM8A 5IFTA 2VCCA 3ACIA 3NQHA 1MPXA 3ABZA 2ZEZA 1NAEA 2E26A 3FN9A 2VR4A 1UXZA 1UXXX 1UY2A 2E32A 3C7OA 3OEAA 4ARYA 2J1AA 1OF4A 4RN5A 5IJRA 1O59A 3HNMA 2VTFA 4MOAA 5FUIA 2X09A 1PMJX 5J1XA 1OD3A 2DCJA 2WABA 4DUXA 3HNYM 2XHNA 1CX1A 2Z4FA 4GWJA 4W8JA 1JU3A 3SEPA 3I3DA 1GOGA 2VCAA 1JI6A 4BK4A 4AG4A 1JYVA 1DP0A 2W94A 2ZEWA 3OG2A 4YPJA 1LNSA 5HPOA 4A45A 1K42A 1K45A 4UOJA 3CIHA 1PMHX 2ORXA 3LQCA 5JR2A 3T2OA 3A23A 1NUKA 3ZM8A 3K77A 5IYYA 2QQOA 2VZSA 3E1F1 4JX0A 4BJ0A 3WF2A 2W3JA 2XONA 3I2KA 2W46A 4P02B 1XNTA 2W87A 2DCKA 3IAQA 2ORZA 5JXJA 1J84A 3MO4A 1GU3A 5HXMA 2Y6KA 1SHWB 1UY1A 2QQMA 2W9XA 1JZ2A 4BXSV 4GWIA 4ET7A 2QQLA 5LCWL 1O8SA 3UNPA 1TG7A 2VZUA 2JDAA 3CQOA 3T09A 2WUHA 5JMOA 2PQSA 3FHQA 1JZ3A 1UZ0A 2WZEA 1H6XA 5CZKA 2VZTA 4M4RA 3SKJE 1W9SA 2C26A 2JE8A 2DDUA 3OEBA 4XUTA 4E8CA 1TVGA 4E8DA 5A1AA 1P8JA 2W1WA 2CDOA 2J22A 3OB8A 5B4XA 5IHRA 1WKYA 3W5NA 2WAAA 2YB7A 4CUAA 4CVUA 1JHJA 4ZZ8A 3CDZB 4LQRA 2WO1A 3WNKA 3AC0A 1W99A 4FI9A 3IB3A 2Y6JA 1L7QA 4L0PA 4D0QA 1UMHA 2C4XA 3C7HA 2Y6GA 3I2GA 3HOBA 2E31A 2VZVA 3C8XA 4MADA 2RJ2A 3J7HA 1UY3A 3VD3A 1W8OA 2RVAA 5JXIA 3THCA 3T0DA 3A22A 3LEKA 3VD7A 5C7GA 1R64A 4MO3M 4XZUG 2C9KA 3BN6A 4PT6A 4XUPA 3A7QA 4TTGA 3OGSA 4OMDA 2CDPA 3FHAA 1CZVA 5CYYA 1US3A 3K4AA 4OMCA 2J1TA 2VC9A 2LW8A 3GGLA 3HNBM 3HN3A 2EICA 2QBXA 4P5YA 4BDVB 5DMYA 1OH4A 2WN2A 2XQXA 2BZDA
chains in the Genus database with same CATH superfamily
5F9TA 1JODA 1NQJA 1AXYA 2JE9A 1RUJ3 2WSUA 1QOOA 3PTYA 1AR61 3MW2A 4JTOA 3K46A 2H0VA 3KB5A 5EV7A 2YBPA 2H6CA 2XJRA 1TMF2 5EP9A 3RRDA 1YYNA 1KDMA 5K7PA 2HWE2 4QHZA 2D44A 4QD2A 3CF6E 4YVWA 5G04L 4XHBA 3SXWA 3HAGA 3W5MA 3WP6A 2AYHA 1NA1A 2FQPA 1YI9A 1VAKA 1QXPA 1VB2A 4KBZA 4LK7A 4NHKA 3RQ0A 5C3OA 1H1AA 2Y64A 5FZ0A 4GH4B 3DCQA 5C3RA 4XPVA 3THDA 1MZ5A 1XNAA 2ES3A 1V6IA 4MVTA 2XLAA 2VMCA 4QGMA 3WQ7A 5L7OC 4JDNA 3QCWA 1OA2A 3ORJA 1BYHA 1REEA 3HQUA 2GP5A 3POSA 5D1IA 5LBCA 2LM3A 3T0BA 3VBRA 4BB3A 5DPNA 1XE0A 1NKGA 5TSWA 3ROUA 3I3MA 3NNLA 1K5MB 4I02A 4BM8A 1ND2A 3OJBA 2VOTA 3E6BA 3OSDA 4GB33 4UFKA 3ME2A 4Q8LA 5LRSA 2B46X 1BHGA 5FPAA 2C6SA 3LFMA 5FO7B 1ALYA 3TEXA 3WF4A 1ULPA 5ABJA 3IDAA 4ATEA 5IK4A 1IOAA 3OBTA 1UU5A 4IE4A 3DKWA 3LEGA 2C5DA 2QFEA 2R1BA 1OVPA 4JGYB 5JLVA 1LEDA 2BGOA 2JXAA 5C70A 3CBNA 1EAH3 4WM8C 4K7JA 5FYHA 2OQ7A 3HBZA 4DRRA 1LOFA 3KSCA 4YM1A 1IQAA 5JZGA 3VBHA 5LASA 5CISA 1Z78A 1MS5A 5AFEA 4HZFA 2OKXA 2F4PA 3WG3A 1MS1A 2HLEA 4S2HA 2RE9A 1HDKA 1CVNA 5LATA 5JXHA 2B45X 3WR0A 1GOFA 3AKTA 3H9AA 3T0AA 4NHYA 3KQ4B 5F5QA 4N7IA 2F17A 1BVVA 3IBMA 3SMHA 1OOPB 4HK9A 3ZXKA 2E53A 4A2UA 1DGRN 1H6YA 2WL1A 3RFRA 3EBRA 3BKZA 4LO6B 1U12A 2JICA 2P3KA 2WT1A 4URAA 4LEJA 4OI4A 4QQHA 4EROA 2BQPA 4LR4A 3HWJA 4ZHNA 5L9BA 5E88A 3B9CA 3ACFA 5LA2A 2B7YA 5BNPC 1COV3 3IIIA 4OFGA 2P34A 2ZGSA 4TSVA 2X5IB 4FFIA 4N7UA 4OZOA 2BUKA 3V65A 4CTEA 4EZ4A 3PJYA 1FPN2 1I5PA 3DYMA 1W04A 1FATA 4CDQB 4CCOA 2WLQA 1XYOA 3GDBA 1FMD2 4S2GA 5KXDA 5K8SA 3ELNA 1RUI3 4NRPA 3EB7A 2W2IA 4Q1PA 2YUEA 2CWSA 1VMHA 2P4EA 4UBGA 4DEQA 2ZKLA 3VBOC 1NLRA 1ZBE1 5IK8A 3RWKX 2VMGA 3QOPA 2WNUC 3NAPB 1ULFA 5JVVA 5B2GB 1W6OB 3H1MA 3ITQA 1NE4A 5JAXA 4V2WA 1XE7A 3WHTA 5T52A 1EUUA 4KMQA 1OA4A 1R1ZA 3QLQA 4FPLA 4O61A 5J36A 2FDFA 1GSLA 2PTMA 4YRDA 3HT1A 5EYYA 2ZZJA 3C7GA 2R1DA 1YFUA 3H0OA 3AVSA 3R0RA 5KR7A 2NP0A 2W1UA 3OYWA 2VVDA 3IDEA 1XPWA 1GFF2 1JZ4A 1KFXL 4GH4C 1V6LA 3Q8CA 1Z7S3 3FHIB 2D6NA 1AR83 1VALA 2ZGLA 4XUNA 1W9TA 2UURA 4SLIA 4W6YA 5A1FA 4XIOA 2ZPXA 5C8CA 2ZGNA 3N9QA 5LA0A 1UOFA 2RDNA 2RM21 4HPKB 5FMOS 1S0IA 4LTAA 3N7JA 1UKGA 5DUXA 5T50A 2HWF3 3I54A 3O1PA 3P1IA 5EYXA 4CDWA 5GZGA 4RFRB 4XJ9A 1K5MC 1XE8A 2A6WA 2Y38A 1O4TA 1WUVA 1VAVA 2XWJB 4GXLA 3H7JA 4P9JA 1T2XA 4YG3A 3C7FA 2K9ZA 1DGWA 2PQQA 3NNGA 4XABA 1LKNA 3LA3A 4QWNA 1UZZA 5FWEA 5FBZA 1NOVA 2DTYA 2GU9A 5LY2A 3RJ2X 5DAVA 1OPMA 4XDOA 2O0OA 4JGYC 3WNOA 2QZ3A 2CAUA 4XFCA 2VO5A 4QPYA 1CAXB 1FX5A 2PA7A 3U37A 1QJX3 1VMJA 1VBA2 5E1RA 2CGOA 5DUWA 2VZPA 4C8DA 4YARA 1X8EA 2ZX3A 2OUJA 5T55A 1AYN3 3BIEA 3S7EA 1NX9A 4BQYA 4WM7B 4CP9B 5L9RA 3VD5A 4ARXA 2FBEA 1GWMA 1JS9A 2WNUA 1REFA 2W91A 3AZVA 4NPLA 4IDZA 3T30A 3RYKA 3EYPA 4IESA 2VZOA 1YHFA 3OGRA 4GMP1 5FYSA 3J8F1 5FZ6A 4MGKE 5CFDA 5LA1A 3FLRA 3SH3A 4XW3A 1OOPC 1JYXA 1KJRA 2VAUA 4BIFA 4K20A 1TME3 4FPCA 3KZ4C 1FOD2 4KWUA 1H1MA 4LO7A 2YDEA 1LGCA 1D4VB 1RYYA 1NLSA 3HMYA 3B00A 1IS5A 4QB6A 4CE8A 3UESA 2IXIA 3KWVA 4YZ1A 3GHMA 2X5IC 5AVAA 1HQWA 2AR6A 2ZHMA 3O1SA 4A41A 3VD9A 4GJYA 1J1TA 2CV6A 2DBNA 2J7MA 3JD72 4PQ9A 5FZEA 5IWFA 2ARCA 3VDCA 4CDQC 4DQAA 4F83A 2HWE3 1RUG1 1OKQA 3AP4A 1LOAA 4F7ZA 1WCKA 1S0GA 3WEZA 4DB5A 2GN7A 1GQHA 1R081 4MZUA 3MIHA 2EXIA 4IUGA 5CU1A 1WLDA 2W1SA 3PUAA 1OQ1A 4HG6B 4CEWB 4YZ2A 2HWC2 3FWEA 3GHNA 2A75A 3ZMOA 4E4SA 2PMWB 1AYM1 5F7UA 1WD3A 2VW2A 3OY8A 1VAMA 4AVTA 3MV01 4GAZA 3NAPC 3JB4C 3WDVA 1QJY3 3NO8A 1QGLA 1H9PA 5E8AA 1OH3A 3N36A 3U14A 2FCVA 2W0XA 2GNDA 1JZ6A 4FT8A 4BPZA 3MF6A 3F2ZA 4FP3A 4IEUA 5GZDA 4YSFA 5G05L 1W6NB 1ZZ9A 2XJPA 1XQNA 5A3WA 5LZ6A 3IDBB 5ACA1 4D6QA 4OCTA 1EPZA 3AVRA 2BEOA 2DBIA 2Q5TA 2WQ8A 1R1A2 1DBNA 5GZEA 3WP3A 4Y4RA 4QGLA 1W6PA 4OHZA 2UWCA 4W50A 4IEYA 3RZGA 4QHOA 2ZGTA 5FZ8A 4JKKA 2WO3A 5D2AA 2D3SA 5BYNA 2J1VA 1LJ7A 2PXJA 3PDQA 5FYUA 5I0DA 1Y7BA 1PK6C 4Q4Y3 3SH4A 3JXSA 2EVXA 3I8TA 4EYUA 3VD4A 3BUCA 2B39A 1SDWA 1IPKA 1ZBA1 4FPFA 3ZMNA 3H1WA 1Y3TA 4FCAA 1FI2A 3M7AA 1GQGA 1RC6A 4KBBA 4PF1A 2YHJA 5HCFA 4NAOA 5FPUA 2JDNA 4LOSA 1GICA 4ZONA 3H3LA 2EF6A 1EYBA 1S4CA 2D7FA 1VPHA 2R32A 4TXWA 2VD7A 5IVJA 2JX9A 1JYNA 4QB1A 4OZXA 1R093 3TB0A 4DEVA 4CDQA 3AKRA 1BLZA 5FJHA 1YJLA 1BVP1 3V56A 2VMHA 1W9FA 1GQPA 3KLSA 1BXHA 1I1EA 2Y6HA 5FZHA 2P5BA 2PAKA 3ZLIA 4CUCA 1FPN3 2ZMNA 1BQPA 2Z42A 4N9HA 1O5UA 1IKQA 1JUHA 1DIWA 2RMU2 4RR3B 4WM7C 5CIRA 1FMD3 5M0TA 1IQDC 1J1LA 2VPVA 3UL2A 2WA4A 1U5YA 2G19A 2XOMA 4HVRA 4K3UA 2H0BA 3GM8A 4XETA 4FOYA 5DAPA 5A6YA 3H8RA 3F95A 3LWCA 4XFAA 4CDXB 2G9ZA 2ZEZA 4QKDA 2GALA 1NAEA 5FK7A 4A7KA 1GZWA 2FDKA 4B7KA 3ZXAC 4KWJA 1BMV1 2ZS6B 4JQRA 5I8SA 3HIFA 4D7YA 1DQ1A 4E2QA 1UY2A 5FZIA 2XBO1 3RGBA 2UYAA 3AJZA 4O9EA 4OVEA 2AENA 2ZAHA 1OF4A 1VRH2 4QHBA 3NNMA 2WRAA 2VTFA 2V5YA 5F1RA 3AYAA 2BWAA 1N1TA 3L9JT 4QX8A 3SLIA 1PK6A 1PMJX 5J1XA 4CEWC 5FBJA 1PIV1 3KV5A 1EV12 2DCJA 4FOVA 5A70A 1GNHA 1RUE2 3H3ZA 2XHNA 1UQXA 3FLTA 2Z4FA 4GWJA 3O1VA 2DU0A 3MLLA 4WBBA 1QNWA 3RG0A 1RUNA 1H8TB 4RGGA 1U5ZA 2WO7A 2R072 2IXKA 3I3DA 4LBMA 5D8AB 1PGL2 3LIHA 3PMSA 2HYKA 3GJBA 1ZRIA 1WGPA 2QQWA 3AKSA 1DP0A 3R4SA 1AHSA 5APAA 1W6MB 4Q4V3 2XL7A 2AUYA 5HPOA 1K42A 3MF9A 3CIHA 5FWJA 1GP4A 1ZZ8A 1G9AA 1C5HA 4B29A 2CYFA 1TQ5A 4YFZA 2BFUL 1NE6A 2EXKA 3WW3A 4ASLA 1RUOA 5FYTA 2XJQA 2TUNA 3A23A 3D6EA 1X8MA 3PTRB 5H9QA 3T2OA 3ZM8A 4CP9A 2JDZA 2QQOA 4EE2A 4RA0A 3GALA 3ZXJA 1E57A 3ENRA 1OLQA 4LIVA 1JUIA 1UNBA 3ZSLA 1QNYA 1MZEA 2XONA 3N9NA 2VNOA 4TN7A 3KF5A 5EZWA 3VZKA 1CONA 1C1LA 1DCSA 2EIGA 3AB0A 3ZPOA 2VW0A 2HWD2 1RXGA 3FUQA 2G9FA 4PDWA 2Y60A 1UYPA 4NIDA 3OBRA 3MO4A 4PLNA 4YGCA 4TZDA 2VNGA 2DFBA 2QE3A 1SHWB 1UY1A 2Y6KA 3DXUA 3TN93 4IW3A 4PIXA 5A7OA 1JZ2A 1GR3A 1OA3A 1NXD1 4AFDA 1HN0A 3PNAA 1H8VA 4M3CB 4MGIE 4MXVA 1QMJA 1YJKA 1YIFA 1PHMA 5FJKA 1IS4A 5LCWL 2WLPA 1O8SA 3H8UA 4XBQA 4QX7A 3INAA 3T3YA 3W21A 3UNPA 3H8OA 1E5IA 4CEWA 3NNJA 4OQ9A 4V1PA 1AX1A 2D6PA 5JIAA 2I74A 5AVPA 4PBPA 3CQOA 4XF0A 2WUHA 1HRI1 2ZGQA 4RR3C 3R6SA 2MEV3 3POYA 5C9AA 3CJIA 4AR2A 4JGZA 1ZZBA 4NIIA 4FFHA 3HVDA 1RUJ1 2ZX2A 3CJXA 3DGTA 3RZLA 4XCBA 2A71A 2WZEA 5CZKA 2VZTA 3W58A 2HWC3 4CDXC 3VBSB 1L7LA 1E5HA 4UW5A 3SQOA 1JOJA 4COZA 5FY7A 4RQPB 4AAPA 5EFUA 3VHOA 2ZX4A 4E8DA 1XOYA 3O1MA 3VV1A 5JCTA 3MIDA 4UYBA 1GZ9A 2W1WA 5ANNA 5FZGA 5K4LA 1KRIA 2BNOA 3J7MA 3NKTA 4BMEA 5F37A 3SITA 1JHJA 1WA4A 2WO1A 3AC0A 5A7QA 1W99A 5GM0A 4HK8A 4L0PA 4D0QA 1UMHA 4HONA 2Y6GA 3HOBA 2E31A 4MADA 4GB31 2WNOA 3J7HA 1GP5A 1W8OA 2OZJA 2RVAA 1H8TC 3THCA 5IK5A 3Q8BA 3TBDA 1H4HA 5FYBA 5DUUA 3MEPA 4XTPA 5D8AC 2XHKA 5EXOA 3D82A 4YVWB 3MHZA 1S1AA 4HSLA 1D4M3 1NA1B 1UF2C 4XUPA 4CCMA 1WCUA 4TTGA 1EAH1 3VB9A 1NCQB 2RHPA 3FHAA 5CYYA 1F35A 1YO8A 2BP6A 1LESA 3K4AA 2J1TA 2WQZC 1OC1A 2W52A 3O1RA 1UAIA 2JIGA 3M3QA 1W3VA 2NPIA 2P1BA 3IIAA 3O5SA 5C3PA 3M2MA 1S0CA 3U75A 3VBRB 1OH4A 4EN0A 2YROA 4HT1T 4Y4YA 1LHOA 4RR3A 2DVDA 2OT7A 2TEPA 2AEYA 4MGSA 4Y5TA 5LBEA 4AHXA 4MGTA 3L2HA 3WCSA 5LRRA 1RVF3 2V4VA 3B01A 1ND2B 4LHSA 4Q0VA 3ZFFA 1Q5OA 2WO2A 4BK5A 2GC1A 1UMZA 3RMXA 4UW6A 3ACHA 1SZBA 2RMU3 4YLZA 5ABJB 1OLME 5FYCA 2ERFA 1H2NA 3WLUA 1COV1 1MR5A 5K0UA 2QQKA 1PZ8A 3THTA 4CXXA 1PGW2 2JENA 4XYXA 2VZRA 3RVHA 1GMMA 3ZYGA 2WR9A 4IEPA 4INDA 2FCTA 2Q8EA 4AVAA 4D3WA 4DXSA 1LCLA 1LHWA 3V0AB 4QPGC 2QNKA 1F8VA 2WS93 4K6BA 1RUI1 2ETEA 4J1WA 4XHXA 5F3IA 1ZRRA 4XMIA 3HJRA 4XURA 2F6BA 1X9PA 2R042 3L2YA 4Q2FA 2DVGA 5I0RA 3WDWA 1VRH3 3MLJA 3AZZA 1AR91 5DZGA 2VTXA 1UX6A 3OD0A 4JQTA 1JZ8A 3MW3A 1N3QA 1AJKA 4CPBD 1EV13 3LPFA 4M4PA 4MGQA 2Q0AA 2XVKA 1RUE3 1RITA 5FO8B 3VBSC 2FHRA 3WXPA 1W05A 4JAAA 5FZ7A 4XUOA 2HEYF 4U36A 1MVEA 4RQPC 1PM4A 2PAEA 5KHGA 2YFUA 2R073 1NZIA 3O0XA 4K8RB 4KQ7A 1I3HA 1YFWA 4CUBA 1RINA 4LMFA 4ZS2A 1IS3A 2OPWA 2ARXA 1JXNA 1Z7S1 2D6LX 4C1XA 1AR81 3UJQA 2BBAA 5DDJ3 4PLMA 2WWJA 1RUH1 1CPNA 3KCCA 5J96B 4I3GA 1LECA 3PIJA 4R9BA 5GLTA 5FZ4A 2ZMLA 1C4RA 1DLCA 2AACA 5FUNA 5JOYA 3WV6A 2HWF1 4CUGA 5HI0A 4IL7A 2QQVA 1UCXA 1W2OA 3BCWA 4LA2A 4LUMA 1JMUB 2AZ5A 1JYWA 1YFYA 4N8MA 1ENRA 4DRVA 3V0BA 5C8WA 4XQDA 4XQWA 5C71A 4NRMA 2ZGKA 1PM7A 1G7YA 4Z92B 1ULEA 1OQDA 4YVWC 3R4DB 4LKFA 4TWTA 3OCPA 1NA1C 1WCSA 3WINE 5A3UA 3OYWB 4LBQA 4NIGA 4COUA 1NCQC 4QPGA 1F4AA 3OPZA 2OUHA 1QJX1 2HWD3 1XJAA 1A78A 1HRV3 1KGYA 1UX7A 3ZFEC 4BHPA 1JOBA 2FDGA 2WNEA 4MV2A 1L7RA 1AYN1 1HIXA 4XJZA 5GZCA 5FDBA 5FPVA 1O3RA 3RI9A 3B93A 5IVYA 5C8CB 1G9CA 3K4ZA 1VBD2 4Y1VA 1DYPA 2LALA 4XC9A 2WBKA 2VMFA 2JDHA 1JU4A 4P14A 2W5FA 2ZHNA 2IZWA 4NWWA 5C33A 4CDWB 4I0BA 3BALA 1ULOA 4FP2A 3WD5A 1ND2C 4HETA 4DMIA 4DXRA 1JYIA 3W59A 3B94A 2PYTA 1TME1 3AMPA 2VECA 3O12A 2YBSA 2D6MA 3AZWA 3MICA 1VBC3 1UU4A 5F5CA 3RZKA 2I07B 4YGDA 1XBFA 1HKDA 1N1SA 2IFWA 2B42B 3ZOIA 4CXYA 2XJSA 5FRAA 3WVJA 4XFFA 2YC4A 1UZVA 5A32A 2VTXJ 1QOSA 2W68A 3SCGA 1PVC2 2HWE1 2X10A 2PHLA 3BTAA 3O7OA 4KL1A 4A4AA 4IEXA 3PUIA 5HCHA 3W20A 4EZHA 5SV5A 5A3TA 1SFYA 2PHTA 4A42A 1LOGA 1RUD2 1T6BX 1ZNPA 1ZZ7A 2HYXA 3LA7A 4YW3A 4R9DA 3LIGA 4R52A 1AR72 1LODA 4UT5A 3MIGA 1JYCA 5CFDB 2PHXA 2R6QA 3T2PA 1F15A 2BYVE 4QXHA 1MQTB 1QJY1 3GBGA 3K48A 2E7QA 3BVCA 1AL0G 3M3IA 4P9YA 3VHPA 2QQIA 4FPJA 1HXS3 2W47A 3N9MA 1ZA4A 3PVOA 4FPHA 3ILFA 5FP7A 3KV6A 4XXAA 4N43A 4WVVA 3ZX7A 2R7EB 1NCQA 3CMGA 2WFF2 2WT0A 2WYFA 1OPOA 5FZ3A 3ZSEA 2VXRA 2YC0A 2V5DA 4YM3A 3ZFEA 4META 2BGCA 2VM9A 4LA3A 5E16A 1S2EA 2SLIA 2XQRA 1GANA 3GNEA 4FFFA 2NMNA 4Z8BA 1Q8VA 2RS12 4CU9A 3WG2A 4XOGA 5FXWA 3K2OA 1W2AX 4JC1A 5FY4A 2W1QA 1MEC2 4H2AA 1PO13 4XFGA 4A6OA 2HKXA 4Q4Y1 2XJVA 3OY8B 1IZ3A 2VW1A 4NR1A 2KD7A 4I30A 3RZJA 3H7YA 1XNCA 4RHV2 3KCXA 4FXKB 4GULA 2Y6FA 1Q8OA 3PUHA 4KNCA 1V9U2 2NZ9A 2Q8DA 4Q4X2 2BFUS 4A44A 5FQ0A 2WJSA 2YC2A 2VOVA 3BPZA 4CCDA 3MZHA 2P37A 1R091 1A8DA 5HCAA 2BWCA 4HN0A 5CADA 1W6PB 2VQTA 4LLOA 4XILA 3WNXA 3V0AA 1KITA 1Q8QA 2KR2A 3T08A 5A3PA 1OFNA 1RHI2 3ECQA 4EWDA 5A3LA 1VBE3 2GNBA 3BTYA 4BE3A 3TEZA 3EMRA 1POV3 3I4IA 1FPN1 3NSTA 5A7WB 1CPMA 4IQPA 1CZSA 1HW5A 1LENA 2D3PA 1V70A 4NMIA 4QAWA 3LD8A 5I91A 5LY1A 4AVSA 5C8CC 1FMD1 1XU2A 1FNZA 2WZR2 4GJZA 2BVVA 1HLCA 1US2A 5AC92 4A3ZA 4DINB 4Q27A 4Z2AA 4CDWC 2E7TA 1NG0A 3WNPA 1ZRCA 3HN1A 4HFSA 2RS33 2VJXA 2JEMA 2L9LA 3I2IA 3FL7A 3OPTA 2RS53 3TRSB 3RSJA 2FMDA 2YU2A 1SCSA 5K9YA 4XFHA 1A34A 4CRQA 1SLIA 5B4NA 1ZZ6A 3MLKA 4XIKA 3OGVA 4AHWA 3ACGA 1LRHA 4RS5A 1HB4A 1I5ZA 3K3OA 3H42B 1J58A 4M3CE 1N3OA 1UD1A 1UMIA 2J1RA 2WYSA 2ZGRA 1J3PA 3O0WA 2QVSB 4UAPA 3LDBA 3UV9A 4LKSA 3ALQA 2ILMA 4NHXA 5H9SA 4D8MA 2V09A 5FLJA 1RJ8A 5LA9A 4EN6B 4MHRA 2ZAAA 1PO22 4Y22A 1VLNA 2PLV3 4IEZA 2VMDA 2BU9A 5JSRA 5C5UA 2Z79A 1UYXA 1OD5A 2NQYA 3OTFA 2OXBA 1W0OA 5CFDC 2Q4SA 2XR4A 3LGRA 1YQCA 3PURA 4ISRA 3ETQA 1QF3A 3VKOA 1MQTC 2UWBA 3BGAA 4XF1A 1GZWB 1W8NA 5EQUA 3DN7A 4IV1A 2LROA 3VBUA 2HBTA 3POJA 4MSVA 4OLLA 4OUSA 3JBG3 3UKVA 3I3QA 5FV3A 2VCBA 2D5HA 4XF9A 4I0WB 3AKQA 4Q4V1 4KG0A 4QB2A 1PNGA 1N47A 3E5XA 3KCYA 4FPEA 5IK7A 3U1XA 3UYJA 1XU1A 4LXLA 2D43A 4PQQA 3K75B 4N90A 3RZHA 4JHTA 3ZPYA 4YFWA 3FBYA 1LR5A 3N7KA 4AVVA 2P6HA 3GCXA 1OFSA 3FJSA 2WAOA 1PK6B 1QJEA 1RL3A 4JVAA 4XEZA 3AMNA 5IFTA 4ZXKA 4HOOA 3ACIA 3PVBB 1UO9A 1SBEA 1DQ2A 5LWBA 2WZPP 1UZWA 4XFBA 4YW4A 1BBT3 1ZBE2 5FOJB 1W8UA 1H4GA 1HB3A 1VBD3 2E26A 2D93A 4AI9A 1PZ9A 2CWMA 1AXKA 1S55A 2XMLA 1WMFA 2HWB1 5BXXA 4YGBA 1UL9A 5F2SA 5D21A 2VULA 1FYUA 3AZYA 4YW6A 1HJFA 4LBKA 3T1MA 4DY5A 2GSYA 3OEAA 1RMU3 4B7EA 1ND3A 4CCCA 4RN5A 4W6WA 3TN91 3FFQA 4R9AA 5GZFA 2GP3A 5CKNA 1DYKA 2GAUA 4ASKA 5FUIA 1OD3A 3N9OA 2ARAA 3HNYM 2A7AA 2BRTA 3KVAA 1CX1A 5ANQA 1OLRA 4FSJA 4LK6A 1PVC3 3I7DA 2MEV1 4Q29A 3UGGA 3PUQA 3SEPA 4GQ7A 2BTVC 5L36A 1MQTA 2LTNA 1YQ5A 2VCAA 3VZJA 4MG2A 2RG4A 1H9WA 1RUD3 2HWC1 4AG4A 5KWRA 3WDUA 3VGIA 2D40A 1JYVA 4Y5SA 4XXPA 4GD4A 4PDWB 2GMEA 1LNSA 1UN1A 4KG8A 4UOJA 5J09A 3I49A 1UOJA 3IKWA 3USSA 4CZSA 5IW0A 1TMF3 3TAYA 1PMHX 2ORXA 1XRUA 5JR2A 1YFXA 1NUKA 2WNVA 2X29A 4E27A 1UPSA 1JYTA 4XJUA 3KT1A 2Z69A 5LB6A 2QDRA 2K2SA 3RMYA 2WFF3 3UKTA 4BJ0A 1FT9A 4AFMA 3AL6A 3J4UH 3UKNA 1QEXA 3WF2A 3GBFA 2W3JA 2XKOA 1RTVA 5C9AB 3CJIB 3ST7A 2VVFA 4JGZB 1POQA 3I2KA 4KH9A 1NY71 1XNTA 2W87A 3B3QE 4WVZA 3S5QA 2RS13 4I2OA 4NIHA 2ZGUA 1HX6A 1CQ9A 4ORFA 3ACLA 4CP0A 4CSWA 4QX5A 5A33A 4BOWA 4M00A 1MEC3 1I6XA 1NZCA 3GBWA 4AEMA 4BWOA 3X29B 5FYZA 4IV3B 3ES4A 4XF3A 3BU0A 1M06G 2Q30A 2QQMA 1DZQA 2W9XA 1D4M1 1F5FA 3POIA 4NOTA 3ZYFA 1W2NA 5FXVA 1X33A 4GWIA 4XACA 3OUJA 5FOBB 1W90A 1TZOA 3KM5A 1HV1A 4QKBA 1V9U3 3TYJA 1LEMA 4Q4X3 4X6QB 2PN5A 4OULA 4NHMA 2ZBJA 3NV4A 1EY2A 2VZUA 2IFRA 2AH2A 3LEMA 1C3HA 3AL5A 3AYCA 5A7WA 3T09A 4LUKA 4QMAA 2YV8A 3WDYA 3FHQA 1IG3A 4QM8A 3WT3A 4G9SB 3WDTA 1RUG2 1W3XA 2QUOA 4DOUA 3BYWA 3ZYIB 1UPIA 3IPVA 1ZRFA 1UZ0A 1RVF1 3CNAA 1R082 1RHI3 3Q8AA 3GZUC 1SBFA 3ZIWA 1W9SA 4UF0B 2RMU1 2WZR3 2V4AA 3ZIXA 1YRZA 3D4KA 4GMP0 2JD4A 1GWKA 5AFBA 2Y0IA 1TVGA 5AC93 2BPA2 1S0EA 1W8HA 4LOTA 5LBFA 3KD4A 4FPYA 5GLWA 1P8JA 1YCIA 2Q1MA 3ES1A 3OB8A 3TWIA 1WKYA 3BU7A 4C0BA 3AMHA 2UWAA 3GCWA 5LW9A 1DGRA 1KFUL 5ACA2 3AP6A 3EJKA 4HXCA 2WS91 4F8AA 3S30A 4WZCA 5EPAA 2GNTA 2XLFA 3ZYHA 4CUAA 4ZU7A 4XCAA 1OSGA 5C6CA 4JZRA 1F2NA 4BQWA 2XLGA 2VOWA 2JB8A 4XBNA 1L7QA 3AFKA 4BZ4A 5DUVA 3NNFA 3WG1A 4M0HA 4S2FA 3P3NA 1VRH1 3C8XA 2RJ2A 3ZFFB 1UY3A 4YZ4A 5GLZA 3PUSA 3OBZA 3LEKA 2VUCA 4BQ3A 3BI3A 1S2KA 3ATGA 2YYOA 3TEYA 5JPMB 2W08A 1O3QA 4XZUG 1EV11 1LGNA 1PO23 5HV4A 1RUE1 2I2SA 3BN6A 2Z5WA 1QXJA 3EXUA 5KXBA 1XYPA 3A7QA 3OGSA 1ZBA2 4MGZE 5K0UB 2CDPA 5GLVA 4PDWC 1CZVA 1LOBA 1US3A 5FYIA 4OMCA 1PNFA 1G9BA 2R071 4NROA 2LW8A 4YWAA 5KXEA 2R0HA 3GGLA 4AOCA 1G6NA 2EICA 2G4IA 2ZKNA 4BDVB 2WINB 1SLBA 1YI7A 1YLLA 4IE0A 4XAAA 5FYVA 2WN2A 1YEWA 3VKMA 2IXCA 4OYUA 5DDJ1 1W28A 1VBB1 3VL9A 3O14A 3V64A 4I0AA 3KHBA 5CVRA 4Y1UA 5DN2A 4BQ5A 3LOIA 2MPFA 3PMEA 3WF1A 2BOIA 5C4WA 5KC5A 4LIUA 5C9AC 5FMDA 3CJIC 4BMBA 4JGZC 2Y26A 3NV1A 4D6RA 4YNIA 3JQXA 2BERA 2DYCA 1V6MA 4W65A 4NPMA 4BXFA 1PZ7A 2JG8A 4BLJA 2VNRA 5JDBA 2Y8KA 2UU8A 4IV3C 4S2DA 2VZ3A 3LDKA 4LT5A 1ZBE3 2XJTA 2PFWA 5JOWA 2JG9A 4V2VA 4R8HA 1GBGA 1W9YA 5I0TA 4ASMB 1BMV2 4X8NA 3N4MA 2DVFA 2HWD1 4LO5B 1HRV1 5DG1A 5HXVA 2XBO2 5EJ1B 3ZVXA 4B4RA 4U2AA 4RL7A 4PIZA 2ZGOA 1D0HA 1VBA3 3LPGA 4J25A 4NAMA 4OUEA 3NRUA 2P17A 4DNYA 4XUQA 3VBFC 4ZXEA 2ZJCA 2IXLA 1UYZA 1QQP2 3UJOA 3DXTA 2GC2A 4FPOB 4IEWA 4XTMA 1DYOA 4P9XA 5A7PA 4D69A 3V0BB 1O8PA 3CO2A 2XB6C 4YYOA 2CGPA 1GNYA 4NVPA 1VBC1 5LK5A 1OT5A 4AI3A 4YW5A 3SEEA 1PX3A 3MW4A 3QD6A 5FO9B 1RUC2 1PX4A 4K8FA 4LBQB 1FOD3 3VKNA 3ZXFA 3NKGA 4QPGB 1ASJ2 3OD4A 2WT2A 5FZDA 5CAZA 2DVBA 2QQJA 3DYPA 3FBMA 4N9IA 1CAUA 2YG0A 3ZDVA 3IZOA 2EIBA 4MYEA 4JDMA 3MV11 4QKFA 1ST8A 3JD73 1C8NA 1DF0A 4CU8A 4HKOA 4AK3A 5I8TA 3PJQA 3S57A 4IEQA 1K12A 1JZ7A 2ZA9A 2ZXQA 3ZFFC 3PIGA 4LE4A 1AL22 4AEDB 4RD7A 4XVHA 3DPRC 3WW2A 3WNLA 1ULCA 2YY1A 1GLHA 3HEIA 3I2FA 1BKZA 3LB9A 4L8QA 4SBVA 3U11A 2VZQA 4R4XA 4IV3A 1HXS1 3OBAA 2ARBA 3WW1A 1W2UA 4NIAA 5K0UC 1N1YA 2H6BA 5JI9A 5FLIA 1BEV2 4KI5M 1J3QA 4CEYA 4D7TA 5A32B 3ZXLA 2HBUA 4PBOA 4M3CF 3HPNA 2IVJA 5BNNC 5BNOA 3AP9A 4OI2A 1AUYA 3A21A 3E6CC 1ZREA 3O1UA 4H7MA 4AI8A 3NJZA 3I2JA 4P00B 1GOHA 3WF0A 3FZ3A 1R1A3 3QACA 4BA6A 2ZHLA 3BTXA 1CAVA 4OHWA 4PLOA 2LUWA 1PO11 4L97A 4QDSA 5CKMA 3A0KA 4EQVA 3URFA 3ZN5A 1FNYA 5KBFA 1KEXA 3M4FA 4GKYA 1ZZCA 4LBNA 4UF0A 1JOPA 1D0GA 1H30A 1HRI2 3KS7A 4P9IA 4QX1A 4W4ZA 1U5XA 3POFA 2HEWF 3N3HA 3DL3A 4E2GA 4QPIC 5I0UA 1QDCA 3BOPA 1JZ5A 4LKDA 2CU5A 4N43B 5FZCA 3WUDA 2Z2SB 2WC2A 2BBVA 3ZSMA 1TNFA 1UY0A 2ADDA 1QIQA 2XXZA 4QQLA 1H2LA 2VY0A 4ISQA 5FIXA 3BB6A 3WW4A 4QX0A 2X05A 3ZFEB 5IVVA 5JMCA 3LOBA 5KHIA 1HQLA 1RUF2 2ZX1A 4BLIA 3I3BA 4LHNA 5CNAA 3H50A 3KGLA 1VBE1 4Y26A 3U78A 3LE0A 1POV1 1DHKB 4UBHA 1F4HA 3C2UA 2ZGPA 5F3CA 4QQPA 5JPNB 1SQ4A 1GUIA 1LOCA 3PVEA 4IEVA 3CU7A 4QGNA 2XGXA 3DPRA 5DG2A 2QZ2A 1KXGA 2BDRA 2EIEA 2ZOEB 2GN3A 2OYZA 2VG9A 2RS31 2OW4A 4P9LA 3H8XA 3ZSJA 5FQ0B 1YQ2A 1DG6A 2RS51 4GB32 5IVEA 1E5SA 1W8WA 2D97A 4COVA 1Y9MA 4MHUA 3IAPA 2W39A 1C8M2 1N3PA 3WDXA 4XDPA 5BNNA 5DZFA 3E5QA 3VN4A 4RYDA 4J6GA 5CFCB 4DUVA 2OZ6A 4RGKA 1DFQA 1EAH2 1CAWB 3M1HA 4HSJA 3LKJA 3RDIA 4AGRA 3R05A 3AYDA 3ZYPA 1YWKA 4ATFA 5KXCA 1Q8SA 5BNQA 1GWLA 2FCUA 3J9SA 4L9BA 1QHDA 2PLV1 1BZWA 3PHMA 1G8WA 3MGUA 1QU0A 3WZ1A 5LBBA 3ZN6A 3ZKUA 5JIUA 1B09A 2QCSB 1O3SA 2X8KA 3AKPA 4UFJA 3VHRA 4AHZA 4IEOA 4AEDC 2R30A 1BJQA 2DUPA 2CL2A 4P08A 4QPIA 2JB4A 4AW7A 2G9GA 3AXEA 1QXRA 2VUJA 3JBG1 4N53A 1AX2A 2PHFA 1W9WA 3WNNA 1O5LA 4YVSB 4RS5B 3QH7A 4H14A 1COV2 2E51A 1BK1A 4L11A 2KXLA 3H1YA 5KHKA 2OX0A 3VDDA 1WLTA 2NN8A 5EJZB 5FMCA 1B35B 4XAEA 4HANA 3B02A 5J3UA 2VBDA 1DQ6A 1CGPA 2WWSA 4QXBA 1ODNA 1G9DA 4O65A 1SDDB 4Y22B 3ZFGC 3I97A 5FMBA 1BBT1 3E6DA 4CU6A 2P3YA 4EWEA 4IXLA 1UKRA 4NRQA 3VBUB 1AXZA 3LF7A 1VBD1 4IV1B 3O1TA 1SG3A 3AYEA 1SPPA 1AR92 1IS6A 2Y6LA 3JCIA 1MS0A 2VZ1A 2A3YA 1UZYA 4JTNA 5CKQA 1NLQA 1LHUA 4N43C 1RMU1 1YUDA 3NJXA 1QQP3 5C3QA 5JUVA 2WSVA 1CZTA 2YZ4A 5FR3A 3CKHA 2V72A 4UFHA 2K0GA 4ZZ5A 4LBOA 1K3IA 1DQ5A 1VJ2A 2A1XA 2WIIB 1ENSA 4UI9L 4LLFA 3BODA 5LEJA 1RUC3 5CBLA 1CR7A 2R062 4FQZA 4Y3OA 1ASJ3 1VB4A 3HR9A 2O14A 2YXSA 3S5AA 4AGGA 1Z7S2 1OXCA 1PVC1 1AR82 2YFZA 4LPLA 3WHUA 1RUH2 4AEDA 4COYA 1HB2A 1Z0HA 3WG4A 2PAMA 4LBJA 1OURA 5FXXA 1RUD1 1XNKA 1OUXA 1QJU2 2YU1A 1NCRA 1AVBA 2HWF2 4K9SA 4CXWA 4W6XA 1VR3A 3GYDA 5L9VA 2C0ZA 2HH9A 1QOTA 4YG6A 3RS6A 2E33A 4YW1A 5JOZA 1AL23 2JKXA 1ND3B 4FVVA 4PI2A 4CYDA 1DGLA 3WQBA 1TMF1 1ULGA 3VZLA 3WX5A 1QH6A 3MBWA 2UY9A 4ZU4A 5FY5A 3U4XA 3PU3A 5JOXA 4A6SA 4AL9A 2C24A 1VMFA 2ID4A 1ODMA 2QTWB 3A0NA 3AZXA 1MACA 3D0JA 1X7NA 3T4VA 5FY8A 5CFCC 5FZ1A 5LEKA 5J37A 2JDPA 1BEV3 2WFF1 3ILRA 2VCCA 4FOQA 3SH5A 4F3JA 1QJX2 5FZKA 3ZFGA 3NQHA 1MPXA 1DGWX 2VXJA 2RR12 4P5HA 3EO6A 3JB8A 4Z1VA 3UK9A 3FC0A 1RB8G 4AXOA 1AYN2 3QBQA 5FPBA 2MHFA 3OGGA 1ZA7A 3NJYA 1DZRA 1CJDA 2VR4A 1TE1B 2YBKA 4XQ4A 1MEC1 1UXZA 1UXXX 3U07A 5ERLA 3C7OA 4ARYA 3MPBA 2J1AA 1SMVA 4WVMA 5FZLA 5FYMA 4A3XA 1TME2 1MS3A 4R9CA 5T5OA 3TOJA 4YG0A 1O59A 3W9AA 4B3NA 3HNMA 4Q4W2 1FV2A 3AP7A 3SISA 1KJLA 1URXA 4YVSC 3P5BA 2X09A 4RS5C 5JI7A 1MS4A 2WNVB 4QKNA 1V9U1 1I9RA 2CAVA 4Q4X1 4DUXA 5A3NA 3NL1A 5ISLA 5FZMA 4EN9B 1B35C 4GA9A 4W8JA 2E7AA 5FZFA 2WQ4A 1JU3A 1NQDA 2ZZQA 1RUF3 2OPKA 2QQUA 1RHI1 4YM0A 3WQ0A 1JI6A 5A33B 5FZAA 4LBLA 5DAWA 4E9KA 2W94A 4DXZA 1UIKA 3B7MA 1GZCA 1WW5A 2VBPA 3POGA 2VH9A 1K45A 1ULDA 2WZR1 3AMQA 1WBFA 4IV1C 3VBUC 2JWPA 1PVXA 4NE9A 4FPGA 1VE0A 1BCXA 5F8PA 3VZNA 5AC91 3M3CA 1QJY2 1AR62 4AEKA 1SFPA 3RJRA 2RJKA 3GZAA 1Y9GA 2OQ6A 3LQCA 1HQNA 4URTA 1W8ZA 4CA9A 2JIJA 5IYYA 1W6QB 3LZZA 5CFCA 2VZSA 3E1F1 5IATA 5BV6A 2OIIA 3KT4A 4MXWB 3UGHA 1CAWA 1EP0A 3MDPA 1ZRDA 1C8M3 1JH5A 4Z82A 2W46A 4YM2A 3IPVB 5FLHA 2DCKA 3LCPA 1WMXA 1MS8A 4UFIA 3EQEA 4AQTA 4LHKA 1G9FA 2ORZA 2R043 1IGOA 1Y4WA 1OQEA 2IVIB 3Q8FA 4AEJA 1J84A 1GU3A 1S0DA 2ET7A 2WFPA 4Q4Y2 2YPDA 3K3NA 3WOGA 1PO21 4AF9A 5T54A 4BQ4A 3AMMA 4AFCA 5EWSA 5L73A 2RDRA 4P9WA 4KGQA 3D0SA 3POEA 3VBFA 3PLQA 4YVSA 4PCRA 1AF9A 2PELA 1ND3C 4PF5A 1TG7A 3U10A 4B8EA 2FZ2A 2UY8A 2AC1A 5JR7B 2B5HA 4QU2A 4COWA 1O91A 1B35A 2DCYA 2PQSA 5JWPA 1R092 1QJZA 4ZU5A 3IT8A 5FPZA 5FZBA 3LSDA 4LORA 1LAJA 4HKWA 4M4RA 2VUDA 1HB1A 4G3YC 2C26A 3O1OA 3ZSKA 5E6HA 1NXMA 2IUWA 2JE8A 5H9PA 1WLCA 2DDUA 2X53S 3OEBA 4QM9A 5DXDA 5FK8A 1J3RA 3MPPG 4XUTA 4E8CA 1H2KA 2Q8OA 5L7OA 3ZKYA 1S0JA 2WA3A 1MZ6A 2CDOA 2J22A 5FZOB 5B4XA 4B1LA 2CSGA 3W5NA 1ACCA 2VQ0A 2A5ZA 2DCTA 4DPNA 1LU2A 4CPBA 1AR93 1Q8PA 3DKQA 1VP6A 1O6UA 1LTEA 2WNVC 3FFZA 4BYYA 2JKBA 3IM0A 1AX0A 1X82A 3C7HA 3ILNA 4ITCA 4YZ3A 2ZHKA 3I2GA 1DDLA 2C9AA 4LKEA 1VBA1 3VD3A 3OUHA 4WM8A 2G1MA 2OA2A 5DABA 5C4WB 2YPJA 4HN1A 3NW4A 4ZKTB 2B8MA 1R64A 4MO3M 4JRLA 4FFGA 2R063 4Y20A 2C9KA 1A8MA 1Q56A 1XSRA 1WW7A 2JG8B 4OMDA 2BVBA 4BCUA 1DU3D 2XL9A 1RUH3 3N7LA 1SCRA 3HN3A 4C1WA 1JN2P 2P3IA 2B9UA 1FOD1 1W03A 2BNMA 2JG9B 4XF4A 3AX4A 4AZZA 2D6OX 1F31A 5DMYA 1QJU3 2AEZA 1Y43B 2BNNA 4QXKA 1WCQA 1RIRA 2XQXA 2BZDA 4MH0E 4PHZA 5E89A 4YZ5A 4CCLA 1V00A 4Q4V2 3CEWA 4QDRA 1YQ8A 4QU1A 5F2WA 1O4ZA 3EHKA 3VZOA 4AFBA 5BNPA 1DQ0A 2ZMKA 3JD71 4JV4A 3H3UA 3JUUA 3VDBA 5FY1A 5FPXA 3POWA 3SHRA 4DZGA 2GH2A 4Q0SA 1Y9QA 2A3WA 2XG3A 5FZ9A 4AFAA 2WWUA 3GXUA 3AM2A 4MLOA 1O7FA 3ZR6A 4CDUB 2DWRA 2RM22 4Y24A 3WF3A 2JECA 1ZM1A 4MGYE 3WUCA 1QJFA 1AR73 4WVWA 2GC3A 2RR13 4GWMA 1PMIA 2W92A 3VBOA 4FOWA 5GKAC 3GZTB 2LS6A 5CEHA 1KS4A 5DAQA 5FP8A 3DV8A 3T4HB 1KS5A 3P3PA 4CCJA 5F6LB 4BU2A 2JDYA 1XNBA 4YW7A 2HWB2 1SLCA 3ZXDA 2Q1FA 4KGGA 2J1EA 4Y5Z0 3WY6A 3LFIA 3NV3A 1CAUB 5EJ3A 4GIQA 2WN3A 3LEIA 1KDKA 3TN92 1NT0A 1R1A1 4Q4W3 1K5JA 1XC6A 4JRAA 1V0AA 2EIDA 2E9QA 2N7GA 3POBA 5FP9A 4K1YA 3HQRA 4XMAA 4MUVA 3UT0A 3DYOA 1IPJA 1D2QA 4L2NA 3ZN4A 4GH4A 2JD9A 4BH9A 1V6OA 1XB9A 2O1QA 3U4SA 4IE5A 3J8F2 3AK0A 3T2TA 4CP1A 2C1FA 2MEV2 2QJVA 2VUAA 1YNAA 3VDAA 3ON7A 2BGPA 2ZGMA 2VVEA 4HLTA 4RHV3 4CEYB 2P6CA 5HBAA 3BPSA 1OBNA 2XKPA 3CZUA 5BNOB 2WKKA 1K5MA 1W6QA 4FTEA 4KU8A 1ONAA 4QX3A 4MXWA 3S6PA 1AR63 1GYKA 4XBLA 4G4FA 2R0FA 2E63A 4A7YA 4IGOA 2EXJA 5I93A 1CAVB 2R16A 3LDRA 1MVQA 5FXZA 3OOXA 5A6XA 4JGYA 4QX2A 1PGSA 4OQ8A 2ZACA 3PVNA 2QDNA 5KC6A 2ET1A 5C4WC 4LO4B 2J1SA 3A4UA 3I2DA 2AGSA 1XNDA 5IFPA 2OVUA 1RJ7A 1AYM2 3VKLA 1ENQA 4FQ4A 2IXJA 3OUIA 4QQ2A 5IUQA 5C3SA 2Q1ZB 4AYUA 4GALA 3T2QA 1VIWB 4A7ZA 2JG8C 1NY72 4HBNA 5SV8A 1S2BA 4AQ2A 5A1LA 3C3VA 3MI8A 2CGNA 2NM1A 3ASIA 4LJHA 1WW4A 2DFCA 3DUIA 4KWKA 1DLLA 4IERA 4D6SA 4Y1XA 5H9RA 4EN8B 2JG9C 4RSUA 1UIJA 1XXNA 1OOPA 3IMNA 3FLPA 3OGJA 4Q0PA 3NMBA 4AQSA 2PHUA 3WCRA 1ZX5A 1D4M2 3C7EA 2YGLA 3I59B 2Y0OA 3NJVA 4Y33A 3ZDSA 1LHNA 3S0MA 4IE6A 3TNPB 3MIEA 4GZ9A 2Q8CA 1J83A 2CTVA 3UETA 3G7DA 3B5LB 3MUZ1 2GC0A 1QKQA 1SBDA 2X5IA 4ZY9A 3I2HA 4IETA 3OPWA 3DPRB 1GNZA 2QQPA 2VU9A 1E5RA 4DXTA 5T3NA 4CDUC 4I09A 1H0BA 1RVF2 3GZEA 1D7PM 2A6YA 5FZOA 1VRBA 1V6KA 5F6KA 1GZTA 1W06A 4CP2A 3FMGA 2KA3A 5BNNB 1PGL1 5FP4A 3FX3A 1SLTA 3MUY1 1WD4A 2JDMA 3NAPA 3KVBA 1WMEA 4CCEA 1QDOA 1CD3G 1WW6A 2VL4A 4XFIA 1W6OA 3AP5A 2XH6A 5F3GA 5IAVA 2FD8A 2NLRA 3RZZA 2Y33A 1MZFA 1W0PA 2B4KA 1JHNA 5A3MA 3R4UA 3G6JB 4UWDA 5DQ0A 1CIYA 5FY9A 2WS92 5JXGA 5CG9A 1CIWA 4XE9A 4CCNA 3I2OA 3JQWA 3HD8B 3WP5A 4C0HA 3AJYA 3ZN6B 1LGBA 4QXCA 2VQUA 4IE7A 3ZYBA 3RZMA 1O3TA 5I8YA 5LK7B 2FMYA 1A3KA 1W0NA 2GNMA 4K21A 3UGFA 3WQ1A 1L3JA 4QPIB 4D94A 4EV0A 3PL0A 1CJPA 1UOBA 2WZ8A 5HV0A 4Y1ZA 2A6ZA 3AFGA 4N53B 1YC61 2J42A 2DF7A 3OF1A 2PHRA 3ETPA 5EIYB 3KT7A 3CZJA 4NPRA 1QWRA 3WP4A 1OHFA 3ZXEA 4HPKA 1QQP1 3D3AA 5BPXA 4OHYA 4CEYC 1C5IA 5GJ6A 3JU9A 1STMA 2RDSA 4YW2A 2GH8A 1C57A 4RFT0 1IPSA 3SNMA 4TLFA 3VDDB 3I3EA 3D5OA 3LA2A 4LBQD 5BNOC 4X8PA 1JTZX 2XJUA 2DTWA 3IMMA 2ZCWA 1UWWA 1T6GC 1OLMA 1RUC1 4GKXA 3IWZA 4JKMA 4AI1A 4QT6A 3S7IA 3Q8EA 4XJAA 1W8TA 4JDOA 5A7NA 2EAKA 1ASJ1 2Y34A 3P6BA 2HEVF 4Q0UA 1EUTA 5FUPA 1IG0A 1CESA 1O4YA 2GDFA 2ZEXA 5DDJ2 1VBB2 1PIV2 4OHXA 4CDUA 2D6KA 1CAXA 2VE1A 3J26N 1S0BA 1LU1A 4GWNA 4AHYA 1SPPB 1ENXA 4Q1RA 1APNA 2D5FA 4BQ2A 2YMZA 2DUQA 2RV9A 4WM7A 5L19A 1TNRA 5IVFA 1AL21 2RM23 4LULA 3CLPA 3ZR5A 2JDKA 1V6JA 2DV9A 5FAXA 3AXDA 4NHLA 3VLBB 4O9GA 2EAAA 2VMIA 5JSPA 4Y1YA 2CNAA 4ES8A 1UU6A 4FTSA 1BEV1 2B9VA 2HWB3 2ZTNA 2JJ6A 2XWBB 2RDQA 1HRV2 2P3JA 3B69A 4HL0A 3MIFA 5J98B 1FXZA 1OF3A 1IKPA 4AAXA 5BY5A 3CL1A 4FXGB 1WCDJ 5F5IA 3LAGA 4OI1A 4B4QA 2LRPA 5A7SA 1MS9A 2VMEA 1Q43A 2UYBA 1HN1A 3DECA 3M70A 5GALA 2R49A 1NCRB 3NV2A 3TEWA 4DY3A 1S0FA 4NWVA 3K51A 1FAYA 1KQRA 4PIYA 3USUB 2PHWA 5FYYA 4AWDA 4QDQA 2DU1A 3E97A 4QPWA 1U5IA 1LB2A 2A73B 3DEMA 4DUWA 2VQAA 4GMP3 5CA6A 1UYYA 3J8F3 1HJGA 3VZMA 3RWNA 1F5JA 1VBC2 3WSOA 4AGVA 4Z2WA 1GKBA 1LOEA 4LE3A 2JDUA 3N7MA 4FPKA 3K4DA 4NJ4A 3SKVA 1H1IA 4UFLA 2GZWA 4HVOA 3ZFGB 3MFCA 2VGDA 1W6NA 2MNGA 3IN9A 2CHHA 1SEFA 2QQNA 2XVGA 3ZO0B 1RUF1 1A6CA 1AJOA 4E2SA 1QH7A 3HT2A 4KWLA 4WV8A 1UY4A 3NWKA 2CY6A 1RUG3 4H55A 5FKBA 3O0VA 3KHCA 1M4WA 2NYYA 4JKLA 3N9LA 4DO0A 2ZEYA 5DAXA 1R083 1RUJ2 2E6VA 4P9GA 3WNMA 1YIPA 4WVMB 2VBBA 3FUOA 4N53C 2WDBA 1Q3EA 4I3PA 4ONUA 4ES9A 1AYM3 1C28A 1WA6X 1BK0A 4EJRA 4E4DX 1CWPA 1HXS2 3KV4A 4JHZA 4BQXA 5FTTC 1J59A 2BOJA 2J1UA 1ZVFA 2W95A 3I59A 4CU7A 1DZTA 5CG8A 5C5TA 3VDDC 4AQ6A 1PGW1 1C8M1 4AE2A 3ABZA 4WZFA 5FMOL 1V6NA 4IGQA 4TLGA 4IGPA 5ACA3 1C1FA 4DS0A 3M3EA 4EWAA 3MYXA 3U0ZA 4ZS3A 3FN9A 4UW4A 2R041 4M0NA 2E32A 3ZYJB 5A6QA 2EALA 1PO12 4B4PA 3D8CA 4E4HA 4LO8A 3VUOA 2BV4A 5T5PA 4RGAA 2XUMA 5IJRA 2FDHA 4UXAA 1WWYA 4FAGA 1ZYBA 3HQXA 1OKOA 4AI0A 4MOAA 3KQRA 4PJYA 3ZYRA 4BIOA 3VHNA 2HJIA 2GMPA 4EN7B 2BJSA 2DURA 4Q0QA 2WABA 4HVQA 2D98A 2OS2A 1YQ6A 1ZBA3 4AI2A 2ENRA 5I0SA 5IT6A 4CDXA 5IAXA 3Q9OA 3CHXA 1SFNA 3BIWE 4Q8KA 1XYNA 1GOGA 1JW6A 1KD7A 2VCMA 4BK4A 1VBE2 1CN1A 1W8FA 2ZEWA 3OG2A 4YPJA 3VBHB 5JZGB 1XSQA 3N9PA 4A45A 4B1MA 4DIQA 3B9IA 2TBVA 1JBCA 3T1LA 5T5LA 2FDIA 3M8LA 3MFAA 1NCRC 4XJWA 2VOXA 5FY0A 3GF6A 4K40A 3RNSA 1RGSA 3IDCB 1G86A 3VBFB 3RPQA 2ADEA 3SCFA 3K77A 2RS32 3BTZA 2A3XA 2I45A 2EA7A 1GV9A 2SBAA 4M01A 3KGZA 4MX3A 4LNVA 1W2TA 4JX0A 2XUEA 1WBLA 3ZXGA 2RS52 1WMDA 4NO4A 1H8TA 2XVLA 2XDVA 4P02B 4C90A 5D8AA 4BISA 2IWGB 1OUSA 1OVSA 3RYRA 5FKCA 1REDA 1RUI2 5FFOC 1GP6A 3IAQA 2VOKA 5FP3A 2QKDA 2XBO3 1X9TA 1W6MA 3M3OA 1IHMA 2BW8A 4HKLA 5JXJA 1D2SA 4L99A 2F4LA 5HXMA 1NYWA 2R061 4HMZA 1POV0 4JCKA 4Z07A 4E4ZA 2V73A 4BXSV 3JZVA 5L7OB 2PLV2 2RJLA 1OI6A 2GMMA 3DF0A 5JSOA 2A70A 5KHJA 2YGMA 1EPWA 4ET7A 3E5UA 2K46A 1H2MA 2QQLA 4H3WA 3NVCA 1VBB3 4R4ZA 1PIV3 2IC1A 5F5AA 2NMOA 2TNFA 2A6VA 1WLWA 1UOGA 2JDAA 5FCCA 1QJU1 3JBG2 2VNVA 5JMOA 4FTBA 1LHVA 5J48A 4L92A 5KHHA 1HV0A 4LHLA 3GJAA 5DZEA 5HCBA 4XZPA 5IVCA 1JZ3A 1AZDA 2PHDA 4AVCA 1U0AA 1H6XA 4D7SA 1SLAA 3SKJE 4PI0A 3PU8A 1RXFA 4WM8B 4O7XA 1N1VA 3RYPA 4FAHA 4Q26A 5A3OA 4C91A 4J1XA 2O8OA 5FREA 5J7MA 4NUBA 1UW8A 2P2KA 3KV9A 4FO9A 4LITA 4Y20B 5F32A 2DVAA 5A80A 1CX4A 2EXHA 1DQ4A 1FV3A 3TNQA 4X6RB 4M3CA 5A1AA 1AR71 5T5JA 3VKFC 2RR11 1SLLA 5IHRA 3USUA 1QY4A 2WAAA 2YB7A 1BBT2 1F9KA 2DUOA 4QQOA 5F3EA 3VBRC 2XPJA 4CVUA 2A6XA 4YGEA 1X50A 3CDZB 4LQRA 3THPA 1W39A 3WNKA 4ZZ8A 5A6ZA 4I01A 4FI9A 5BUVA 2AREA 4XDQA 3IB3A 4BQ1A 2ZX0A 2Y6JA 3J7NA 4OI0A 2KM2A 2O8QA 2C4XA 2IXHA 4KU7A 4Q5OA 1RMU2 1YXWA 2VZVA 4NN0A 4CCKA 1TEIA 1WZXA 3QH6A 3VBSA 1SACA 3SCHA 4FBFA 5BNPB 3SC7X 5JXIA 3T0DA 4Q4W1 4UFMA 5ABJC 3A22A 2FDJA 2FZ1A 5GLUA 4UW3A 3VD7A 5EHDA 4RQPA 2ATFA 5C7GA 4TYSA 3KMHA 2RS11 4PT6A 4K1ZA 1X36A 3J7LA 5CB7A 2JE7A 2DCZA 4ZPIA 4DFSA 4OHVA 5FPLA 4H7LA 1LOFC 1OMIA 3LSEA 5IVBA 5JZGC 4XJ8A 3HBKA 3VBHC 3KF3A 3BOWA 3MIBA 4OUMA 5F39A 2VC9A 3VBOB 1LULA 2D3RA 3RI8A 3HNBM 3FE5A 2QBXA 4P5YA 4AVBA 2ZABA 3VL8A 2WNUB 3N35A 1HRI3 4RHV1 3APBA
chains in the Genus database with same CATH topology
4OYUA 4MGSA 4QDRA 5DN2A 2V4VA 4LHSA 2WO2A 3WF1A 4BK5A 3K46A 3VDBA 3ACHA 5G04L 3W5MA 3GXUA 2BERA 3WF3A 2Y64A 2QQKA 2VZRA 2Y8KA 3THDA 1XNAA 1GMMA 2VZ3A 2W92A 4DXSA 2VMCA 2LS6A 3T0BA 5DPNA 3HJRA 4XURA 1NKGA 2J1EA 5EJ1B 2WN3A 3LEIA 2VOTA 3LPGA 1BHGA 3WF4A 1XC6A 4OUEA 1ULPA 2EIDA 3IDAA 3NRUA 1JZ8A 4XUQA 4ZXEA 3LPFA 4M4PA 4MGQA 3LEGA 3DYOA 1UYZA 2BGOA 5C70A 2JD9A 1DYOA 1O8PA 4XUOA 1GNYA 1OT5A 2YFUA 3SEEA 1PX3A 2OKXA 3VDAA 4CUBA 2HLEA 1PX4A 2BGPA 5JXHA 1GOFA 2BBAA 3CZUA 3T0AA 2QQJA 3DYPA 2YG0A 2EIBA 4QX3A 3MV11 1DLCA 1H6YA 4CU8A 1K12A 3ACFA 5LA2A 1JZ7A 2ZXQA 4QX2A 3IIIA 1JYWA 4XVHA 4DXRA 4OZOA 2J1SA 3WNLA 3HEIA 3I2FA 5C71A 5IFPA 1I5PA 2VZQA 3DYMA 3OBAA 3GDBA 3T2QA 1F4AA 3EB7A 4KI5M 1KGYA 1UX7A 4DEQA 3HPNA 1L7RA 3A21A 3I2JA 3K4ZA 4P00B 1GOHA 3WF0A 3C7EA 3NJVA 2WBKA 2VMFA 1JU4A 2W5FA 4GZ9A 4QDSA 1J83A 1EUUA 1ULOA 4KMQA 3UETA 3MUZ1 1KEXA 4ZY9A 3I2HA 3C7GA 4QX1A 4W4ZA 4DXTA 2W1UA 1XPWA 1JZ5A 1JZ4A 2YC4A 1D7PM 1UY0A 4XUNA 1W9TA 4QX0A 2X10A 2X05A 4A4AA 3MUY1 5LA0A 3I3BA 3PUIA 2VL4A 4A42A 2HYXA 3LE0A 3P1IA 1F4HA 3T2PA 1T2XA 2B4KA 3C7FA 3NNGA 5JXGA 5DQ0A 1CIYA 1GUIA 2EIEA 2VQUA 2QQIA 2W47A 3WNOA 1W0NA 1YQ2A 2R7EB 2VO5A 2WZ8A 3U37A 3CMGA 2VZPA 3IAPA 2V5DA 3ETPA 5EIYB 2VM9A 3CZJA 1NX9A 4RYDA 3D3AA 3VD5A 4ARXA 4CU9A 4DUVA 2W91A 3EYPA 2VZOA 3OGRA 3I3EA 2W1QA 4A6OA 1JYXA 1UWWA 4JKMA 2KD7A 4KWUA 3P6BA 1EUTA 1RYYA 2ZEXA 4QB6A 3PUHA 3UESA 4A44A 4P08A 2YC2A 4A41A 3VD9A 2J7MA 3VDCA 1W9WA 2VQTA 3WNNA 3WEZA 3T08A 2RV9A 4IUGA 2W1SA 3ECQA 4HG6B 1WCQA 5EJZB 5F7UA 1CZSA 4QAWA 3MV01 1US2A 1SDDB 2B9VA 4A3ZA 4Z2AA 1JZ6A 3F2ZA 3WNPA 3I97A 1OF3A 5G05L 4AAXA 2VJXA 4CU6A 3I2IA 2L9LA 3FL7A 2VMEA 1SG3A 1HN1A 2Y6LA 3DECA 2WQ8A 2VZ1A 5B4NA 4W50A 3OGVA 3ACGA 4QDQA 4QPWA 3NJXA 5JUVA 4JKKA 2WO3A 1CZTA 2WYSA 1UMIA 2J1RA 2V72A 2J1VA 3CKHA 4UAPA 4DUWA 5I0DA 1UYYA 4ZZ5A 4LKSA 1K3IA 4UI9L 3WSOA 4D8MA 3JXSA 3VD4A 3K4DA 2VMDA 3SKVA 1UYXA 4PF1A 4LPLA 2YFZA 2QQNA 3BGAA 5LA1A 1W8NA 4TXWA 1JYNA 1UY4A 4QB1A 4DEVA 2VCBA 4JKLA 4QB2A 2E33A 2ZEYA 2JKXA 3WNMA 1GQPA 2Y6HA 2WDBA 4PQQA 3WQBA 3K75B 4CUCA 3MBWA 1IQDC 2ID4A 2WAOA 4JHZA 2J1UA 2W95A 2XOMA 4CU7A 3GM8A 5IFTA 2VCCA 3ACIA 3NQHA 1MPXA 3ABZA 2ZEZA 1NAEA 2E26A 3FN9A 2VR4A 1UXZA 1UXXX 1UY2A 2E32A 3C7OA 3OEAA 4ARYA 2J1AA 1OF4A 4RN5A 5IJRA 1O59A 3HNMA 2VTFA 4MOAA 5FUIA 2X09A 1PMJX 5J1XA 1OD3A 2DCJA 2WABA 4DUXA 3HNYM 2XHNA 1CX1A 2Z4FA 4GWJA 4W8JA 1JU3A 3SEPA 3I3DA 1GOGA 2VCAA 1JI6A 4BK4A 4AG4A 1JYVA 1DP0A 2W94A 2ZEWA 3OG2A 4YPJA 1LNSA 5HPOA 4A45A 1K42A 1K45A 4UOJA 3CIHA 1PMHX 2ORXA 3LQCA 5JR2A 3T2OA 3A23A 1NUKA 3ZM8A 3K77A 5IYYA 2QQOA 2VZSA 3E1F1 4JX0A 4BJ0A 3WF2A 2W3JA 2XONA 3I2KA 2W46A 4P02B 1XNTA 2W87A 2DCKA 3IAQA 2ORZA 5JXJA 1J84A 3MO4A 1GU3A 5HXMA 2Y6KA 1SHWB 1UY1A 2QQMA 2W9XA 1JZ2A 4BXSV 4GWIA 4ET7A 2QQLA 5LCWL 1O8SA 3UNPA 1TG7A 2VZUA 2JDAA 3CQOA 3T09A 2WUHA 5JMOA 2PQSA 3FHQA 1JZ3A 1UZ0A 2WZEA 1H6XA 5CZKA 2VZTA 4M4RA 3SKJE 1W9SA 2C26A 2JE8A 2DDUA 3OEBA 4XUTA 4E8CA 1TVGA 4E8DA 5A1AA 1P8JA 2W1WA 2CDOA 2J22A 3OB8A 5B4XA 5IHRA 1WKYA 3W5NA 2WAAA 2YB7A 4CUAA 4CVUA 1JHJA 4ZZ8A 3CDZB 4LQRA 2WO1A 3WNKA 3AC0A 1W99A 4FI9A 3IB3A 2Y6JA 1L7QA 4L0PA 4D0QA 1UMHA 2C4XA 3C7HA 2Y6GA 3I2GA 3HOBA 2E31A 2VZVA 3C8XA 4MADA 2RJ2A 3J7HA 1UY3A 3VD3A 1W8OA 2RVAA 5JXIA 3THCA 3T0DA 3A22A 3LEKA 3VD7A 5C7GA 1R64A 4MO3M 4XZUG 2C9KA 3BN6A 4PT6A 4XUPA 3A7QA 4TTGA 3OGSA 4OMDA 2CDPA 3FHAA 1CZVA 5CYYA 1US3A 3K4AA 4OMCA 2J1TA 2VC9A 2LW8A 3GGLA 3HNBM 3HN3A 2EICA 2QBXA 4P5YA 4BDVB 5DMYA 1OH4A 2WN2A 2XQXA 2BZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OYU A;  4MGS A;  4QDR A;  5DN2 A;  2V4V A;  4LHS A;  2WO2 A;  3WF1 A;  4BK5 A;  3K46 A;  3VDB A;  3ACH A;  5G04 L;  3W5M A;  3GXU A;  2BER A;  3WF3 A;  2Y64 A;  2QQK A;  2VZR A;  2Y8K A;  3THD A;  1XNA A;  1GMM A;  2VZ3 A;  2W92 A;  4DXS A;  2VMC A;  2LS6 A;  3T0B A;  5DPN A;  3HJR A;  4XUR A;  1NKG A;  2J1E A;  5EJ1 B;  2WN3 A;  3LEI A;  2VOT A;  3LPG A;  1BHG A;  3WF4 A;  1XC6 A;  4OUE A;  1ULP A;  2EID A;  3IDA A;  3NRU A;  1JZ8 A;  4XUQ A;  4ZXE A;  3LPF A;  4M4P A;  4MGQ A;  3LEG A;  3DYO A;  1UYZ A;  2BGO A;  5C70 A;  2JD9 A;  1DYO A;  1O8P A;  4XUO A;  1GNY A;  1OT5 A;  2YFU A;  3SEE A;  1PX3 A;  2OKX A;  3VDA A;  4CUB A;  2HLE A;  1PX4 A;  2BGP A;  5JXH A;  1GOF A;  2BBA A;  3CZU A;  3T0A A;  2QQJ A;  3DYP A;  2YG0 A;  2EIB A;  4QX3 A;  3MV1 1;  1DLC A;  1H6Y A;  4CU8 A;  1K12 A;  3ACF A;  5LA2 A;  1JZ7 A;  2ZXQ A;  4QX2 A;  3III A;  1JYW A;  4XVH A;  4DXR A;  4OZO A;  2J1S A;  3WNL A;  3HEI A;  3I2F A;  5C71 A;  5IFP A;  1I5P A;  2VZQ A;  3DYM A;  3OBA A;  3GDB A;  3T2Q A;  1F4A A;  3EB7 A;  4KI5 M;  1KGY A;  1UX7 A;  4DEQ A;  3HPN A;  1L7R A;  3A21 A;  3I2J A;  3K4Z A;  4P00 B;  1GOH A;  3WF0 A;  3C7E A;  3NJV A;  2WBK A;  2VMF A;  1JU4 A;  2W5F A;  4GZ9 A;  4QDS A;  1J83 A;  1EUU A;  1ULO A;  4KMQ A;  3UET A;  3MUZ 1;  1KEX A;  4ZY9 A;  3I2H A;  3C7G A;  4QX1 A;  4W4Z A;  4DXT A;  2W1U A;  1XPW A;  1JZ5 A;  1JZ4 A;  2YC4 A;  1D7P M;  1UY0 A;  4XUN A;  1W9T A;  4QX0 A;  2X10 A;  2X05 A;  4A4A A;  3MUY 1;  5LA0 A;  3I3B A;  3PUI A;  2VL4 A;  4A42 A;  2HYX A;  3LE0 A;  3P1I A;  1F4H A;  3T2P A;  1T2X A;  2B4K A;  3C7F A;  3NNG A;  5JXG A;  5DQ0 A;  1CIY A;  1GUI A;  2EIE A;  2VQU A;  2QQI A;  2W47 A;  3WNO A;  1W0N A;  1YQ2 A;  2R7E B;  2VO5 A;  2WZ8 A;  3U37 A;  3CMG A;  2VZP A;  3IAP A;  2V5D A;  3ETP A;  5EIY B;  2VM9 A;  3CZJ A;  1NX9 A;  4RYD A;  3D3A A;  3VD5 A;  4ARX A;  4CU9 A;  4DUV A;  2W91 A;  3EYP A;  2VZO A;  3OGR A;  3I3E A;  2W1Q A;  4A6O A;  1JYX A;  1UWW A;  4JKM A;  2KD7 A;  4KWU A;  3P6B A;  1EUT A;  1RYY A;  2ZEX A;  4QB6 A;  3PUH A;  3UES A;  4A44 A;  4P08 A;  2YC2 A;  4A41 A;  3VD9 A;  2J7M A;  3VDC A;  1W9W A;  2VQT A;  3WNN A;  3WEZ A;  3T08 A;  2RV9 A;  4IUG A;  2W1S A;  3ECQ A;  4HG6 B;  1WCQ A;  5EJZ B;  5F7U A;  1CZS A;  4QAW A;  3MV0 1;  1US2 A;  1SDD B;  2B9V A;  4A3Z A;  4Z2A A;  1JZ6 A;  3F2Z A;  3WNP A;  3I97 A;  1OF3 A;  5G05 L;  4AAX A;  2VJX A;  4CU6 A;  3I2I A;  2L9L A;  3FL7 A;  2VME A;  1SG3 A;  1HN1 A;  2Y6L A;  3DEC A;  2WQ8 A;  2VZ1 A;  5B4N A;  4W50 A;  3OGV A;  3ACG A;  4QDQ A;  4QPW A;  3NJX A;  5JUV A;  4JKK A;  2WO3 A;  1CZT A;  2WYS A;  1UMI A;  2J1R A;  2V72 A;  2J1V A;  3CKH A;  4UAP A;  4DUW A;  5I0D A;  1UYY A;  4ZZ5 A;  4LKS A;  1K3I A;  4UI9 L;  3WSO A;  4D8M A;  3JXS A;  3VD4 A;  3K4D A;  2VMD A;  3SKV A;  1UYX A;  4PF1 A;  4LPL A;  2YFZ A;  2QQN A;  3BGA A;  5LA1 A;  1W8N A;  4TXW A;  1JYN A;  1UY4 A;  4QB1 A;  4DEV A;  2VCB A;  4JKL A;  4QB2 A;  2E33 A;  2ZEY A;  2JKX A;  3WNM A;  1GQP A;  2Y6H A;  2WDB A;  4PQQ A;  3WQB A;  3K75 B;  4CUC A;  3MBW A;  1IQD C;  2ID4 A;  2WAO A;  4JHZ A;  2J1U A;  2W95 A;  2XOM A;  4CU7 A;  3GM8 A;  5IFT A;  2VCC A;  3ACI A;  3NQH A;  1MPX A;  3ABZ A;  2ZEZ A;  1NAE A;  2E26 A;  3FN9 A;  2VR4 A;  1UXZ A;  1UXX X;  1UY2 A;  2E32 A;  3C7O A;  3OEA A;  4ARY A;  2J1A A;  1OF4 A;  4RN5 A;  5IJR A;  1O59 A;  3HNM A;  2VTF A;  4MOA A;  5FUI A;  2X09 A;  1PMJ X;  5J1X A;  1OD3 A;  2DCJ A;  2WAB A;  4DUX A;  3HNY M;  2XHN A;  1CX1 A;  2Z4F A;  4GWJ A;  4W8J A;  1JU3 A;  3SEP A;  3I3D A;  1GOG A;  2VCA A;  1JI6 A;  4BK4 A;  4AG4 A;  1JYV A;  1DP0 A;  2W94 A;  2ZEW A;  3OG2 A;  4YPJ A;  1LNS A;  5HPO A;  4A45 A;  1K42 A;  1K45 A;  4UOJ A;  3CIH A;  1PMH X;  2ORX A;  3LQC A;  5JR2 A;  3T2O A;  3A23 A;  1NUK A;  3ZM8 A;  3K77 A;  5IYY A;  2QQO A;  2VZS A;  3E1F 1;  4JX0 A;  4BJ0 A;  3WF2 A;  2W3J A;  2XON A;  3I2K A;  2W46 A;  4P02 B;  1XNT A;  2W87 A;  2DCK A;  3IAQ A;  2ORZ A;  5JXJ A;  1J84 A;  3MO4 A;  1GU3 A;  5HXM A;  2Y6K A;  1SHW B;  1UY1 A;  2QQM A;  2W9X A;  1JZ2 A;  4BXS V;  4GWI A;  4ET7 A;  2QQL A;  5LCW L;  1O8S A;  3UNP A;  1TG7 A;  2VZU A;  2JDA A;  3CQO A;  3T09 A;  2WUH A;  5JMO A;  2PQS A;  3FHQ A;  1JZ3 A;  1UZ0 A;  2WZE A;  1H6X A;  5CZK A;  2VZT A;  4M4R A;  3SKJ E;  1W9S A;  2C26 A;  2JE8 A;  2DDU A;  3OEB A;  4XUT A;  4E8C A;  1TVG A;  4E8D A;  5A1A A;  1P8J A;  2W1W A;  2CDO A;  2J22 A;  3OB8 A;  5B4X A;  5IHR A;  1WKY A;  3W5N A;  2WAA A;  2YB7 A;  4CUA A;  4CVU A;  1JHJ A;  4ZZ8 A;  3CDZ B;  4LQR A;  2WO1 A;  3WNK A;  3AC0 A;  1W99 A;  4FI9 A;  3IB3 A;  2Y6J A;  1L7Q A;  4L0P A;  4D0Q A;  1UMH A;  2C4X A;  3C7H A;  2Y6G A;  3I2G A;  3HOB A;  2E31 A;  2VZV A;  3C8X A;  4MAD A;  2RJ2 A;  3J7H A;  1UY3 A;  3VD3 A;  1W8O A;  2RVA A;  5JXI A;  3THC A;  3T0D A;  3A22 A;  3LEK A;  3VD7 A;  5C7G A;  1R64 A;  4MO3 M;  4XZU G;  2C9K A;  3BN6 A;  4PT6 A;  4XUP A;  3A7Q A;  4TTG A;  3OGS A;  4OMD A;  2CDP A;  3FHA A;  1CZV A;  5CYY A;  1US3 A;  3K4A A;  4OMC A;  2J1T A;  2VC9 A;  2LW8 A;  3GGL A;  3HNB M;  3HN3 A;  2EIC A;  2QBX A;  4P5Y A;  4BDV B;  5DMY A;  1OH4 A;  2WN2 A;  2XQX A;  2BZD A; 
#chains in the Genus database with same CATH topology
 5F9T A;  1JOD A;  1NQJ A;  1AXY A;  2JE9 A;  1RUJ 3;  2WSU A;  1QOO A;  3PTY A;  1AR6 1;  3MW2 A;  4JTO A;  3K46 A;  2H0V A;  3KB5 A;  5EV7 A;  2YBP A;  2H6C A;  2XJR A;  1TMF 2;  5EP9 A;  3RRD A;  1YYN A;  1KDM A;  5K7P A;  2HWE 2;  4QHZ A;  2D44 A;  4QD2 A;  3CF6 E;  4YVW A;  5G04 L;  4XHB A;  3SXW A;  3HAG A;  3W5M A;  3WP6 A;  2AYH A;  1NA1 A;  2FQP A;  1YI9 A;  1VAK A;  1QXP A;  1VB2 A;  4KBZ A;  4LK7 A;  4NHK A;  3RQ0 A;  5C3O A;  1H1A A;  2Y64 A;  5FZ0 A;  4GH4 B;  3DCQ A;  5C3R A;  4XPV A;  3THD A;  1MZ5 A;  1XNA A;  2ES3 A;  1V6I A;  4MVT A;  2XLA A;  2VMC A;  4QGM A;  3WQ7 A;  5L7O C;  4JDN A;  3QCW A;  1OA2 A;  3ORJ A;  1BYH A;  1REE A;  3HQU A;  2GP5 A;  3POS A;  5D1I A;  5LBC A;  2LM3 A;  3T0B A;  3VBR A;  4BB3 A;  5DPN A;  1XE0 A;  1NKG A;  5TSW A;  3ROU A;  3I3M A;  3NNL A;  1K5M B;  4I02 A;  4BM8 A;  1ND2 A;  3OJB A;  2VOT A;  3E6B A;  3OSD A;  4GB3 3;  4UFK A;  3ME2 A;  4Q8L A;  5LRS A;  2B46 X;  1BHG A;  5FPA A;  2C6S A;  3LFM A;  5FO7 B;  1ALY A;  3TEX A;  3WF4 A;  1ULP A;  5ABJ A;  3IDA A;  4ATE A;  5IK4 A;  1IOA A;  3OBT A;  1UU5 A;  4IE4 A;  3DKW A;  3LEG A;  2C5D A;  2QFE A;  2R1B A;  1OVP A;  4JGY B;  5JLV A;  1LED A;  2BGO A;  2JXA A;  5C70 A;  3CBN A;  1EAH 3;  4WM8 C;  4K7J A;  5FYH A;  2OQ7 A;  3HBZ A;  4DRR A;  1LOF A;  3KSC A;  4YM1 A;  1IQA A;  5JZG A;  3VBH A;  5LAS A;  5CIS A;  1Z78 A;  1MS5 A;  5AFE A;  4HZF A;  2OKX A;  2F4P A;  3WG3 A;  1MS1 A;  2HLE A;  4S2H A;  2RE9 A;  1HDK A;  1CVN A;  5LAT A;  5JXH A;  2B45 X;  3WR0 A;  1GOF A;  3AKT A;  3H9A A;  3T0A A;  4NHY A;  3KQ4 B;  5F5Q A;  4N7I A;  2F17 A;  1BVV A;  3IBM A;  3SMH A;  1OOP B;  4HK9 A;  3ZXK A;  2E53 A;  4A2U A;  1DGR N;  1H6Y A;  2WL1 A;  3RFR A;  3EBR A;  3BKZ A;  4LO6 B;  1U12 A;  2JIC A;  2P3K A;  2WT1 A;  4URA A;  4LEJ A;  4OI4 A;  4QQH A;  4ERO A;  2BQP A;  4LR4 A;  3HWJ A;  4ZHN A;  5L9B A;  5E88 A;  3B9C A;  3ACF A;  5LA2 A;  2B7Y A;  5BNP C;  1COV 3;  3III A;  4OFG A;  2P34 A;  2ZGS A;  4TSV A;  2X5I B;  4FFI A;  4N7U A;  4OZO A;  2BUK A;  3V65 A;  4CTE A;  4EZ4 A;  3PJY A;  1FPN 2;  1I5P A;  3DYM A;  1W04 A;  1FAT A;  4CDQ B;  4CCO A;  2WLQ A;  1XYO A;  3GDB A;  1FMD 2;  4S2G A;  5KXD A;  5K8S A;  3ELN A;  1RUI 3;  4NRP A;  3EB7 A;  2W2I A;  4Q1P A;  2YUE A;  2CWS A;  1VMH A;  2P4E A;  4UBG A;  4DEQ A;  2ZKL A;  3VBO C;  1NLR A;  1ZBE 1;  5IK8 A;  3RWK X;  2VMG A;  3QOP A;  2WNU C;  3NAP B;  1ULF A;  5JVV A;  5B2G B;  1W6O B;  3H1M A;  3ITQ A;  1NE4 A;  5JAX A;  4V2W A;  1XE7 A;  3WHT A;  5T52 A;  1EUU A;  4KMQ A;  1OA4 A;  1R1Z A;  3QLQ A;  4FPL A;  4O61 A;  5J36 A;  2FDF A;  1GSL A;  2PTM A;  4YRD A;  3HT1 A;  5EYY A;  2ZZJ A;  3C7G A;  2R1D A;  1YFU A;  3H0O A;  3AVS A;  3R0R A;  5KR7 A;  2NP0 A;  2W1U A;  3OYW A;  2VVD A;  3IDE A;  1XPW A;  1GFF 2;  1JZ4 A;  1KFX L;  4GH4 C;  1V6L A;  3Q8C A;  1Z7S 3;  3FHI B;  2D6N A;  1AR8 3;  1VAL A;  2ZGL A;  4XUN A;  1W9T A;  2UUR A;  4SLI A;  4W6Y A;  5A1F A;  4XIO A;  2ZPX A;  5C8C A;  2ZGN A;  3N9Q A;  5LA0 A;  1UOF A;  2RDN A;  2RM2 1;  4HPK B;  5FMO S;  1S0I A;  4LTA A;  3N7J A;  1UKG A;  5DUX A;  5T50 A;  2HWF 3;  3I54 A;  3O1P A;  3P1I A;  5EYX A;  4CDW A;  5GZG A;  4RFR B;  4XJ9 A;  1K5M C;  1XE8 A;  2A6W A;  2Y38 A;  1O4T A;  1WUV A;  1VAV A;  2XWJ B;  4GXL A;  3H7J A;  4P9J A;  1T2X A;  4YG3 A;  3C7F A;  2K9Z A;  1DGW A;  2PQQ A;  3NNG A;  4XAB A;  1LKN A;  3LA3 A;  4QWN A;  1UZZ A;  5FWE A;  5FBZ A;  1NOV A;  2DTY A;  2GU9 A;  5LY2 A;  3RJ2 X;  5DAV A;  1OPM A;  4XDO A;  2O0O A;  4JGY C;  3WNO A;  2QZ3 A;  2CAU A;  4XFC A;  2VO5 A;  4QPY A;  1CAX B;  1FX5 A;  2PA7 A;  3U37 A;  1QJX 3;  1VMJ A;  1VBA 2;  5E1R A;  2CGO A;  5DUW A;  2VZP A;  4C8D A;  4YAR A;  1X8E A;  2ZX3 A;  2OUJ A;  5T55 A;  1AYN 3;  3BIE A;  3S7E A;  1NX9 A;  4BQY A;  4WM7 B;  4CP9 B;  5L9R A;  3VD5 A;  4ARX A;  2FBE A;  1GWM A;  1JS9 A;  2WNU A;  1REF A;  2W91 A;  3AZV A;  4NPL A;  4IDZ A;  3T30 A;  3RYK A;  3EYP A;  4IES A;  2VZO A;  1YHF A;  3OGR A;  4GMP 1;  5FYS A;  3J8F 1;  5FZ6 A;  4MGK E;  5CFD A;  5LA1 A;  3FLR A;  3SH3 A;  4XW3 A;  1OOP C;  1JYX A;  1KJR A;  2VAU A;  4BIF A;  4K20 A;  1TME 3;  4FPC A;  3KZ4 C;  1FOD 2;  4KWU A;  1H1M A;  4LO7 A;  2YDE A;  1LGC A;  1D4V B;  1RYY A;  1NLS A;  3HMY A;  3B00 A;  1IS5 A;  4QB6 A;  4CE8 A;  3UES A;  2IXI A;  3KWV A;  4YZ1 A;  3GHM A;  2X5I C;  5AVA A;  1HQW A;  2AR6 A;  2ZHM A;  3O1S A;  4A41 A;  3VD9 A;  4GJY A;  1J1T A;  2CV6 A;  2DBN A;  2J7M A;  3JD7 2;  4PQ9 A;  5FZE A;  5IWF A;  2ARC A;  3VDC A;  4CDQ C;  4DQA A;  4F83 A;  2HWE 3;  1RUG 1;  1OKQ A;  3AP4 A;  1LOA A;  4F7Z A;  1WCK A;  1S0G A;  3WEZ A;  4DB5 A;  2GN7 A;  1GQH A;  1R08 1;  4MZU A;  3MIH A;  2EXI A;  4IUG A;  5CU1 A;  1WLD A;  2W1S A;  3PUA A;  1OQ1 A;  4HG6 B;  4CEW B;  4YZ2 A;  2HWC 2;  3FWE A;  3GHN A;  2A75 A;  3ZMO A;  4E4S A;  2PMW B;  1AYM 1;  5F7U A;  1WD3 A;  2VW2 A;  3OY8 A;  1VAM A;  4AVT A;  3MV0 1;  4GAZ A;  3NAP C;  3JB4 C;  3WDV A;  1QJY 3;  3NO8 A;  1QGL A;  1H9P A;  5E8A A;  1OH3 A;  3N36 A;  3U14 A;  2FCV A;  2W0X A;  2GND A;  1JZ6 A;  4FT8 A;  4BPZ A;  3MF6 A;  3F2Z A;  4FP3 A;  4IEU A;  5GZD A;  4YSF A;  5G05 L;  1W6N B;  1ZZ9 A;  2XJP A;  1XQN A;  5A3W A;  5LZ6 A;  3IDB B;  5ACA 1;  4D6Q A;  4OCT A;  1EPZ A;  3AVR A;  2BEO A;  2DBI A;  2Q5T A;  2WQ8 A;  1R1A 2;  1DBN A;  5GZE A;  3WP3 A;  4Y4R A;  4QGL A;  1W6P A;  4OHZ A;  2UWC A;  4W50 A;  4IEY A;  3RZG A;  4QHO A;  2ZGT A;  5FZ8 A;  4JKK A;  2WO3 A;  5D2A A;  2D3S A;  5BYN A;  2J1V A;  1LJ7 A;  2PXJ A;  3PDQ A;  5FYU A;  5I0D A;  1Y7B A;  1PK6 C;  4Q4Y 3;  3SH4 A;  3JXS A;  2EVX A;  3I8T A;  4EYU A;  3VD4 A;  3BUC A;  2B39 A;  1SDW A;  1IPK A;  1ZBA 1;  4FPF A;  3ZMN A;  3H1W A;  1Y3T A;  4FCA A;  1FI2 A;  3M7A A;  1GQG A;  1RC6 A;  4KBB A;  4PF1 A;  2YHJ A;  5HCF A;  4NAO A;  5FPU A;  2JDN A;  4LOS A;  1GIC A;  4ZON A;  3H3L A;  2EF6 A;  1EYB A;  1S4C A;  2D7F A;  1VPH A;  2R32 A;  4TXW A;  2VD7 A;  5IVJ A;  2JX9 A;  1JYN A;  4QB1 A;  4OZX A;  1R09 3;  3TB0 A;  4DEV A;  4CDQ A;  3AKR A;  1BLZ A;  5FJH A;  1YJL A;  1BVP 1;  3V56 A;  2VMH A;  1W9F A;  1GQP A;  3KLS A;  1BXH A;  1I1E A;  2Y6H A;  5FZH A;  2P5B A;  2PAK A;  3ZLI A;  4CUC A;  1FPN 3;  2ZMN A;  1BQP A;  2Z42 A;  4N9H A;  1O5U A;  1IKQ A;  1JUH A;  1DIW A;  2RMU 2;  4RR3 B;  4WM7 C;  5CIR A;  1FMD 3;  5M0T A;  1IQD C;  1J1L A;  2VPV A;  3UL2 A;  2WA4 A;  1U5Y A;  2G19 A;  2XOM A;  4HVR A;  4K3U A;  2H0B A;  3GM8 A;  4XET A;  4FOY A;  5DAP A;  5A6Y A;  3H8R A;  3F95 A;  3LWC A;  4XFA A;  4CDX B;  2G9Z A;  2ZEZ A;  4QKD A;  2GAL A;  1NAE A;  5FK7 A;  4A7K A;  1GZW A;  2FDK A;  4B7K A;  3ZXA C;  4KWJ A;  1BMV 1;  2ZS6 B;  4JQR A;  5I8S A;  3HIF A;  4D7Y A;  1DQ1 A;  4E2Q A;  1UY2 A;  5FZI A;  2XBO 1;  3RGB A;  2UYA A;  3AJZ A;  4O9E A;  4OVE A;  2AEN A;  2ZAH A;  1OF4 A;  1VRH 2;  4QHB A;  3NNM A;  2WRA A;  2VTF A;  2V5Y A;  5F1R A;  3AYA A;  2BWA A;  1N1T A;  3L9J T;  4QX8 A;  3SLI A;  1PK6 A;  1PMJ X;  5J1X A;  4CEW C;  5FBJ A;  1PIV 1;  3KV5 A;  1EV1 2;  2DCJ A;  4FOV A;  5A70 A;  1GNH A;  1RUE 2;  3H3Z A;  2XHN A;  1UQX A;  3FLT A;  2Z4F A;  4GWJ A;  3O1V A;  2DU0 A;  3MLL A;  4WBB A;  1QNW A;  3RG0 A;  1RUN A;  1H8T B;  4RGG A;  1U5Z A;  2WO7 A;  2R07 2;  2IXK A;  3I3D A;  4LBM A;  5D8A B;  1PGL 2;  3LIH A;  3PMS A;  2HYK A;  3GJB A;  1ZRI A;  1WGP A;  2QQW A;  3AKS A;  1DP0 A;  3R4S A;  1AHS A;  5APA A;  1W6M B;  4Q4V 3;  2XL7 A;  2AUY A;  5HPO A;  1K42 A;  3MF9 A;  3CIH A;  5FWJ A;  1GP4 A;  1ZZ8 A;  1G9A A;  1C5H A;  4B29 A;  2CYF A;  1TQ5 A;  4YFZ A;  2BFU L;  1NE6 A;  2EXK A;  3WW3 A;  4ASL A;  1RUO A;  5FYT A;  2XJQ A;  2TUN A;  3A23 A;  3D6E A;  1X8M A;  3PTR B;  5H9Q A;  3T2O A;  3ZM8 A;  4CP9 A;  2JDZ A;  2QQO A;  4EE2 A;  4RA0 A;  3GAL A;  3ZXJ A;  1E57 A;  3ENR A;  1OLQ A;  4LIV A;  1JUI A;  1UNB A;  3ZSL A;  1QNY A;  1MZE A;  2XON A;  3N9N A;  2VNO A;  4TN7 A;  3KF5 A;  5EZW A;  3VZK A;  1CON A;  1C1L A;  1DCS A;  2EIG A;  3AB0 A;  3ZPO A;  2VW0 A;  2HWD 2;  1RXG A;  3FUQ A;  2G9F A;  4PDW A;  2Y60 A;  1UYP A;  4NID A;  3OBR A;  3MO4 A;  4PLN A;  4YGC A;  4TZD A;  2VNG A;  2DFB A;  2QE3 A;  1SHW B;  1UY1 A;  2Y6K A;  3DXU A;  3TN9 3;  4IW3 A;  4PIX A;  5A7O A;  1JZ2 A;  1GR3 A;  1OA3 A;  1NXD 1;  4AFD A;  1HN0 A;  3PNA A;  1H8V A;  4M3C B;  4MGI E;  4MXV A;  1QMJ A;  1YJK A;  1YIF A;  1PHM A;  5FJK A;  1IS4 A;  5LCW L;  2WLP A;  1O8S A;  3H8U A;  4XBQ A;  4QX7 A;  3INA A;  3T3Y A;  3W21 A;  3UNP A;  3H8O A;  1E5I A;  4CEW A;  3NNJ A;  4OQ9 A;  4V1P A;  1AX1 A;  2D6P A;  5JIA A;  2I74 A;  5AVP A;  4PBP A;  3CQO A;  4XF0 A;  2WUH A;  1HRI 1;  2ZGQ A;  4RR3 C;  3R6S A;  2MEV 3;  3POY A;  5C9A A;  3CJI A;  4AR2 A;  4JGZ A;  1ZZB A;  4NII A;  4FFH A;  3HVD A;  1RUJ 1;  2ZX2 A;  3CJX A;  3DGT A;  3RZL A;  4XCB A;  2A71 A;  2WZE A;  5CZK A;  2VZT A;  3W58 A;  2HWC 3;  4CDX C;  3VBS B;  1L7L A;  1E5H A;  4UW5 A;  3SQO A;  1JOJ A;  4COZ A;  5FY7 A;  4RQP B;  4AAP A;  5EFU A;  3VHO A;  2ZX4 A;  4E8D A;  1XOY A;  3O1M A;  3VV1 A;  5JCT A;  3MID A;  4UYB A;  1GZ9 A;  2W1W A;  5ANN A;  5FZG A;  5K4L A;  1KRI A;  2BNO A;  3J7M A;  3NKT A;  4BME A;  5F37 A;  3SIT A;  1JHJ A;  1WA4 A;  2WO1 A;  3AC0 A;  5A7Q A;  1W99 A;  5GM0 A;  4HK8 A;  4L0P A;  4D0Q A;  1UMH A;  4HON A;  2Y6G A;  3HOB A;  2E31 A;  4MAD A;  4GB3 1;  2WNO A;  3J7H A;  1GP5 A;  1W8O A;  2OZJ A;  2RVA A;  1H8T C;  3THC A;  5IK5 A;  3Q8B A;  3TBD A;  1H4H A;  5FYB A;  5DUU A;  3MEP A;  4XTP A;  5D8A C;  2XHK A;  5EXO A;  3D82 A;  4YVW B;  3MHZ A;  1S1A A;  4HSL A;  1D4M 3;  1NA1 B;  1UF2 C;  4XUP A;  4CCM A;  1WCU A;  4TTG A;  1EAH 1;  3VB9 A;  1NCQ B;  2RHP A;  3FHA A;  5CYY A;  1F35 A;  1YO8 A;  2BP6 A;  1LES A;  3K4A A;  2J1T A;  2WQZ C;  1OC1 A;  2W52 A;  3O1R A;  1UAI A;  2JIG A;  3M3Q A;  1W3V A;  2NPI A;  2P1B A;  3IIA A;  3O5S A;  5C3P A;  3M2M A;  1S0C A;  3U75 A;  3VBR B;  1OH4 A;  4EN0 A;  2YRO A;  4HT1 T;  4Y4Y A;  1LHO A;  4RR3 A;  2DVD A;  2OT7 A;  2TEP A;  2AEY A;  4MGS A;  4Y5T A;  5LBE A;  4AHX A;  4MGT A;  3L2H A;  3WCS A;  5LRR A;  1RVF 3;  2V4V A;  3B01 A;  1ND2 B;  4LHS A;  4Q0V A;  3ZFF A;  1Q5O A;  2WO2 A;  4BK5 A;  2GC1 A;  1UMZ A;  3RMX A;  4UW6 A;  3ACH A;  1SZB A;  2RMU 3;  4YLZ A;  5ABJ B;  1OLM E;  5FYC A;  2ERF A;  1H2N A;  3WLU A;  1COV 1;  1MR5 A;  5K0U A;  2QQK A;  1PZ8 A;  3THT A;  4CXX A;  1PGW 2;  2JEN A;  4XYX A;  2VZR A;  3RVH A;  1GMM A;  3ZYG A;  2WR9 A;  4IEP A;  4IND A;  2FCT A;  2Q8E A;  4AVA A;  4D3W A;  4DXS A;  1LCL A;  1LHW A;  3V0A B;  4QPG C;  2QNK A;  1F8V A;  2WS9 3;  4K6B A;  1RUI 1;  2ETE A;  4J1W A;  4XHX A;  5F3I A;  1ZRR A;  4XMI A;  3HJR A;  4XUR A;  2F6B A;  1X9P A;  2R04 2;  3L2Y A;  4Q2F A;  2DVG A;  5I0R A;  3WDW A;  1VRH 3;  3MLJ A;  3AZZ A;  1AR9 1;  5DZG A;  2VTX A;  1UX6 A;  3OD0 A;  4JQT A;  1JZ8 A;  3MW3 A;  1N3Q A;  1AJK A;  4CPB D;  1EV1 3;  3LPF A;  4M4P A;  4MGQ A;  2Q0A A;  2XVK A;  1RUE 3;  1RIT A;  5FO8 B;  3VBS C;  2FHR A;  3WXP A;  1W05 A;  4JAA A;  5FZ7 A;  4XUO A;  2HEY F;  4U36 A;  1MVE A;  4RQP C;  1PM4 A;  2PAE A;  5KHG A;  2YFU A;  2R07 3;  1NZI A;  3O0X A;  4K8R B;  4KQ7 A;  1I3H A;  1YFW A;  4CUB A;  1RIN A;  4LMF A;  4ZS2 A;  1IS3 A;  2OPW A;  2ARX A;  1JXN A;  1Z7S 1;  2D6L X;  4C1X A;  1AR8 1;  3UJQ A;  2BBA A;  5DDJ 3;  4PLM A;  2WWJ A;  1RUH 1;  1CPN A;  3KCC A;  5J96 B;  4I3G A;  1LEC A;  3PIJ A;  4R9B A;  5GLT A;  5FZ4 A;  2ZML A;  1C4R A;  1DLC A;  2AAC A;  5FUN A;  5JOY A;  3WV6 A;  2HWF 1;  4CUG A;  5HI0 A;  4IL7 A;  2QQV A;  1UCX A;  1W2O A;  3BCW A;  4LA2 A;  4LUM A;  1JMU B;  2AZ5 A;  1JYW A;  1YFY A;  4N8M A;  1ENR A;  4DRV A;  3V0B A;  5C8W A;  4XQD A;  4XQW A;  5C71 A;  4NRM A;  2ZGK A;  1PM7 A;  1G7Y A;  4Z92 B;  1ULE A;  1OQD A;  4YVW C;  3R4D B;  4LKF A;  4TWT A;  3OCP A;  1NA1 C;  1WCS A;  3WIN E;  5A3U A;  3OYW B;  4LBQ A;  4NIG A;  4COU A;  1NCQ C;  4QPG A;  1F4A A;  3OPZ A;  2OUH A;  1QJX 1;  2HWD 3;  1XJA A;  1A78 A;  1HRV 3;  1KGY A;  1UX7 A;  3ZFE C;  4BHP A;  1JOB A;  2FDG A;  2WNE A;  4MV2 A;  1L7R A;  1AYN 1;  1HIX A;  4XJZ A;  5GZC A;  5FDB A;  5FPV A;  1O3R A;  3RI9 A;  3B93 A;  5IVY A;  5C8C B;  1G9C A;  3K4Z A;  1VBD 2;  4Y1V A;  1DYP A;  2LAL A;  4XC9 A;  2WBK A;  2VMF A;  2JDH A;  1JU4 A;  4P14 A;  2W5F A;  2ZHN A;  2IZW A;  4NWW A;  5C33 A;  4CDW B;  4I0B A;  3BAL A;  1ULO A;  4FP2 A;  3WD5 A;  1ND2 C;  4HET A;  4DMI A;  4DXR A;  1JYI A;  3W59 A;  3B94 A;  2PYT A;  1TME 1;  3AMP A;  2VEC A;  3O12 A;  2YBS A;  2D6M A;  3AZW A;  3MIC A;  1VBC 3;  1UU4 A;  5F5C A;  3RZK A;  2I07 B;  4YGD A;  1XBF A;  1HKD A;  1N1S A;  2IFW A;  2B42 B;  3ZOI A;  4CXY A;  2XJS A;  5FRA A;  3WVJ A;  4XFF A;  2YC4 A;  1UZV A;  5A32 A;  2VTX J;  1QOS A;  2W68 A;  3SCG A;  1PVC 2;  2HWE 1;  2X10 A;  2PHL A;  3BTA A;  3O7O A;  4KL1 A;  4A4A A;  4IEX A;  3PUI A;  5HCH A;  3W20 A;  4EZH A;  5SV5 A;  5A3T A;  1SFY A;  2PHT A;  4A42 A;  1LOG A;  1RUD 2;  1T6B X;  1ZNP A;  1ZZ7 A;  2HYX A;  3LA7 A;  4YW3 A;  4R9D A;  3LIG A;  4R52 A;  1AR7 2;  1LOD A;  4UT5 A;  3MIG A;  1JYC A;  5CFD B;  2PHX A;  2R6Q A;  3T2P A;  1F15 A;  2BYV E;  4QXH A;  1MQT B;  1QJY 1;  3GBG A;  3K48 A;  2E7Q A;  3BVC A;  1AL0 G;  3M3I A;  4P9Y A;  3VHP A;  2QQI A;  4FPJ A;  1HXS 3;  2W47 A;  3N9M A;  1ZA4 A;  3PVO A;  4FPH A;  3ILF A;  5FP7 A;  3KV6 A;  4XXA A;  4N43 A;  4WVV A;  3ZX7 A;  2R7E B;  1NCQ A;  3CMG A;  2WFF 2;  2WT0 A;  2WYF A;  1OPO A;  5FZ3 A;  3ZSE A;  2VXR A;  2YC0 A;  2V5D A;  4YM3 A;  3ZFE A;  4MET A;  2BGC A;  2VM9 A;  4LA3 A;  5E16 A;  1S2E A;  2SLI A;  2XQR A;  1GAN A;  3GNE A;  4FFF A;  2NMN A;  4Z8B A;  1Q8V A;  2RS1 2;  4CU9 A;  3WG2 A;  4XOG A;  5FXW A;  3K2O A;  1W2A X;  4JC1 A;  5FY4 A;  2W1Q A;  1MEC 2;  4H2A A;  1PO1 3;  4XFG A;  4A6O A;  2HKX A;  4Q4Y 1;  2XJV A;  3OY8 B;  1IZ3 A;  2VW1 A;  4NR1 A;  2KD7 A;  4I30 A;  3RZJ A;  3H7Y A;  1XNC A;  4RHV 2;  3KCX A;  4FXK B;  4GUL A;  2Y6F A;  1Q8O A;  3PUH A;  4KNC A;  1V9U 2;  2NZ9 A;  2Q8D A;  4Q4X 2;  2BFU S;  4A44 A;  5FQ0 A;  2WJS A;  2YC2 A;  2VOV A;  3BPZ A;  4CCD A;  3MZH A;  2P37 A;  1R09 1;  1A8D A;  5HCA A;  2BWC A;  4HN0 A;  5CAD A;  1W6P B;  2VQT A;  4LLO A;  4XIL A;  3WNX A;  3V0A A;  1KIT A;  1Q8Q A;  2KR2 A;  3T08 A;  5A3P A;  1OFN A;  1RHI 2;  3ECQ A;  4EWD A;  5A3L A;  1VBE 3;  2GNB A;  3BTY A;  4BE3 A;  3TEZ A;  3EMR A;  1POV 3;  3I4I A;  1FPN 1;  3NST A;  5A7W B;  1CPM A;  4IQP A;  1CZS A;  1HW5 A;  1LEN A;  2D3P A;  1V70 A;  4NMI A;  4QAW A;  3LD8 A;  5I91 A;  5LY1 A;  4AVS A;  5C8C C;  1FMD 1;  1XU2 A;  1FNZ A;  2WZR 2;  4GJZ A;  2BVV A;  1HLC A;  1US2 A;  5AC9 2;  4A3Z A;  4DIN B;  4Q27 A;  4Z2A A;  4CDW C;  2E7T A;  1NG0 A;  3WNP A;  1ZRC A;  3HN1 A;  4HFS A;  2RS3 3;  2VJX A;  2JEM A;  2L9L A;  3I2I A;  3FL7 A;  3OPT A;  2RS5 3;  3TRS B;  3RSJ A;  2FMD A;  2YU2 A;  1SCS A;  5K9Y A;  4XFH A;  1A34 A;  4CRQ A;  1SLI A;  5B4N A;  1ZZ6 A;  3MLK A;  4XIK A;  3OGV A;  4AHW A;  3ACG A;  1LRH A;  4RS5 A;  1HB4 A;  1I5Z A;  3K3O A;  3H42 B;  1J58 A;  4M3C E;  1N3O A;  1UD1 A;  1UMI A;  2J1R A;  2WYS A;  2ZGR A;  1J3P A;  3O0W A;  2QVS B;  4UAP A;  3LDB A;  3UV9 A;  4LKS A;  3ALQ A;  2ILM A;  4NHX A;  5H9S A;  4D8M A;  2V09 A;  5FLJ A;  1RJ8 A;  5LA9 A;  4EN6 B;  4MHR A;  2ZAA A;  1PO2 2;  4Y22 A;  1VLN A;  2PLV 3;  4IEZ A;  2VMD A;  2BU9 A;  5JSR A;  5C5U A;  2Z79 A;  1UYX A;  1OD5 A;  2NQY A;  3OTF A;  2OXB A;  1W0O A;  5CFD C;  2Q4S A;  2XR4 A;  3LGR A;  1YQC A;  3PUR A;  4ISR A;  3ETQ A;  1QF3 A;  3VKO A;  1MQT C;  2UWB A;  3BGA A;  4XF1 A;  1GZW B;  1W8N A;  5EQU A;  3DN7 A;  4IV1 A;  2LRO A;  3VBU A;  2HBT A;  3POJ A;  4MSV A;  4OLL A;  4OUS A;  3JBG 3;  3UKV A;  3I3Q A;  5FV3 A;  2VCB A;  2D5H A;  4XF9 A;  4I0W B;  3AKQ A;  4Q4V 1;  4KG0 A;  4QB2 A;  1PNG A;  1N47 A;  3E5X A;  3KCY A;  4FPE A;  5IK7 A;  3U1X A;  3UYJ A;  1XU1 A;  4LXL A;  2D43 A;  4PQQ A;  3K75 B;  4N90 A;  3RZH A;  4JHT A;  3ZPY A;  4YFW A;  3FBY A;  1LR5 A;  3N7K A;  4AVV A;  2P6H A;  3GCX A;  1OFS A;  3FJS A;  2WAO A;  1PK6 B;  1QJE A;  1RL3 A;  4JVA A;  4XEZ A;  3AMN A;  5IFT A;  4ZXK A;  4HOO A;  3ACI A;  3PVB B;  1UO9 A;  1SBE A;  1DQ2 A;  5LWB A;  2WZP P;  1UZW A;  4XFB A;  4YW4 A;  1BBT 3;  1ZBE 2;  5FOJ B;  1W8U A;  1H4G A;  1HB3 A;  1VBD 3;  2E26 A;  2D93 A;  4AI9 A;  1PZ9 A;  2CWM A;  1AXK A;  1S55 A;  2XML A;  1WMF A;  2HWB 1;  5BXX A;  4YGB A;  1UL9 A;  5F2S A;  5D21 A;  2VUL A;  1FYU A;  3AZY A;  4YW6 A;  1HJF A;  4LBK A;  3T1M A;  4DY5 A;  2GSY A;  3OEA A;  1RMU 3;  4B7E A;  1ND3 A;  4CCC A;  4RN5 A;  4W6W A;  3TN9 1;  3FFQ A;  4R9A A;  5GZF A;  2GP3 A;  5CKN A;  1DYK A;  2GAU A;  4ASK A;  5FUI A;  1OD3 A;  3N9O A;  2ARA A;  3HNY M;  2A7A A;  2BRT A;  3KVA A;  1CX1 A;  5ANQ A;  1OLR A;  4FSJ A;  4LK6 A;  1PVC 3;  3I7D A;  2MEV 1;  4Q29 A;  3UGG A;  3PUQ A;  3SEP A;  4GQ7 A;  2BTV C;  5L36 A;  1MQT A;  2LTN A;  1YQ5 A;  2VCA A;  3VZJ A;  4MG2 A;  2RG4 A;  1H9W A;  1RUD 3;  2HWC 1;  4AG4 A;  5KWR A;  3WDU A;  3VGI A;  2D40 A;  1JYV A;  4Y5S A;  4XXP A;  4GD4 A;  4PDW B;  2GME A;  1LNS A;  1UN1 A;  4KG8 A;  4UOJ A;  5J09 A;  3I49 A;  1UOJ A;  3IKW A;  3USS A;  4CZS A;  5IW0 A;  1TMF 3;  3TAY A;  1PMH X;  2ORX A;  1XRU A;  5JR2 A;  1YFX A;  1NUK A;  2WNV A;  2X29 A;  4E27 A;  1UPS A;  1JYT A;  4XJU A;  3KT1 A;  2Z69 A;  5LB6 A;  2QDR A;  2K2S A;  3RMY A;  2WFF 3;  3UKT A;  4BJ0 A;  1FT9 A;  4AFM A;  3AL6 A;  3J4U H;  3UKN A;  1QEX A;  3WF2 A;  3GBF A;  2W3J A;  2XKO A;  1RTV A;  5C9A B;  3CJI B;  3ST7 A;  2VVF A;  4JGZ B;  1POQ A;  3I2K A;  4KH9 A;  1NY7 1;  1XNT A;  2W87 A;  3B3Q E;  4WVZ A;  3S5Q A;  2RS1 3;  4I2O A;  4NIH A;  2ZGU A;  1HX6 A;  1CQ9 A;  4ORF A;  3ACL A;  4CP0 A;  4CSW A;  4QX5 A;  5A33 A;  4BOW A;  4M00 A;  1MEC 3;  1I6X A;  1NZC A;  3GBW A;  4AEM A;  4BWO A;  3X29 B;  5FYZ A;  4IV3 B;  3ES4 A;  4XF3 A;  3BU0 A;  1M06 G;  2Q30 A;  2QQM A;  1DZQ A;  2W9X A;  1D4M 1;  1F5F A;  3POI A;  4NOT A;  3ZYF A;  1W2N A;  5FXV A;  1X33 A;  4GWI A;  4XAC A;  3OUJ A;  5FOB B;  1W90 A;  1TZO A;  3KM5 A;  1HV1 A;  4QKB A;  1V9U 3;  3TYJ A;  1LEM A;  4Q4X 3;  4X6Q B;  2PN5 A;  4OUL A;  4NHM A;  2ZBJ A;  3NV4 A;  1EY2 A;  2VZU A;  2IFR A;  2AH2 A;  3LEM A;  1C3H A;  3AL5 A;  3AYC A;  5A7W A;  3T09 A;  4LUK A;  4QMA A;  2YV8 A;  3WDY A;  3FHQ A;  1IG3 A;  4QM8 A;  3WT3 A;  4G9S B;  3WDT A;  1RUG 2;  1W3X A;  2QUO A;  4DOU A;  3BYW A;  3ZYI B;  1UPI A;  3IPV A;  1ZRF A;  1UZ0 A;  1RVF 1;  3CNA A;  1R08 2;  1RHI 3;  3Q8A A;  3GZU C;  1SBF A;  3ZIW A;  1W9S A;  4UF0 B;  2RMU 1;  2WZR 3;  2V4A A;  3ZIX A;  1YRZ A;  3D4K A;  4GMP 0;  2JD4 A;  1GWK A;  5AFB A;  2Y0I A;  1TVG A;  5AC9 3;  2BPA 2;  1S0E A;  1W8H A;  4LOT A;  5LBF A;  3KD4 A;  4FPY A;  5GLW A;  1P8J A;  1YCI A;  2Q1M A;  3ES1 A;  3OB8 A;  3TWI A;  1WKY A;  3BU7 A;  4C0B A;  3AMH A;  2UWA A;  3GCW A;  5LW9 A;  1DGR A;  1KFU L;  5ACA 2;  3AP6 A;  3EJK A;  4HXC A;  2WS9 1;  4F8A A;  3S30 A;  4WZC A;  5EPA A;  2GNT A;  2XLF A;  3ZYH A;  4CUA A;  4ZU7 A;  4XCA A;  1OSG A;  5C6C A;  4JZR A;  1F2N A;  4BQW A;  2XLG A;  2VOW A;  2JB8 A;  4XBN A;  1L7Q A;  3AFK A;  4BZ4 A;  5DUV A;  3NNF A;  3WG1 A;  4M0H A;  4S2F A;  3P3N A;  1VRH 1;  3C8X A;  2RJ2 A;  3ZFF B;  1UY3 A;  4YZ4 A;  5GLZ A;  3PUS A;  3OBZ A;  3LEK A;  2VUC A;  4BQ3 A;  3BI3 A;  1S2K A;  3ATG A;  2YYO A;  3TEY A;  5JPM B;  2W08 A;  1O3Q A;  4XZU G;  1EV1 1;  1LGN A;  1PO2 3;  5HV4 A;  1RUE 1;  2I2S A;  3BN6 A;  2Z5W A;  1QXJ A;  3EXU A;  5KXB A;  1XYP A;  3A7Q A;  3OGS A;  1ZBA 2;  4MGZ E;  5K0U B;  2CDP A;  5GLV A;  4PDW C;  1CZV A;  1LOB A;  1US3 A;  5FYI A;  4OMC A;  1PNF A;  1G9B A;  2R07 1;  4NRO A;  2LW8 A;  4YWA A;  5KXE A;  2R0H A;  3GGL A;  4AOC A;  1G6N A;  2EIC A;  2G4I A;  2ZKN A;  4BDV B;  2WIN B;  1SLB A;  1YI7 A;  1YLL A;  4IE0 A;  4XAA A;  5FYV A;  2WN2 A;  1YEW A;  3VKM A;  2IXC A;  4OYU A;  5DDJ 1;  1W28 A;  1VBB 1;  3VL9 A;  3O14 A;  3V64 A;  4I0A A;  3KHB A;  5CVR A;  4Y1U A;  5DN2 A;  4BQ5 A;  3LOI A;  2MPF A;  3PME A;  3WF1 A;  2BOI A;  5C4W A;  5KC5 A;  4LIU A;  5C9A C;  5FMD A;  3CJI C;  4BMB A;  4JGZ C;  2Y26 A;  3NV1 A;  4D6R A;  4YNI A;  3JQX A;  2BER A;  2DYC A;  1V6M A;  4W65 A;  4NPM A;  4BXF A;  1PZ7 A;  2JG8 A;  4BLJ A;  2VNR A;  5JDB A;  2Y8K A;  2UU8 A;  4IV3 C;  4S2D A;  2VZ3 A;  3LDK A;  4LT5 A;  1ZBE 3;  2XJT A;  2PFW A;  5JOW A;  2JG9 A;  4V2V A;  4R8H A;  1GBG A;  1W9Y A;  5I0T A;  4ASM B;  1BMV 2;  4X8N A;  3N4M A;  2DVF A;  2HWD 1;  4LO5 B;  1HRV 1;  5DG1 A;  5HXV A;  2XBO 2;  5EJ1 B;  3ZVX A;  4B4R A;  4U2A A;  4RL7 A;  4PIZ A;  2ZGO A;  1D0H A;  1VBA 3;  3LPG A;  4J25 A;  4NAM A;  4OUE A;  3NRU A;  2P17 A;  4DNY A;  4XUQ A;  3VBF C;  4ZXE A;  2ZJC A;  2IXL A;  1UYZ A;  1QQP 2;  3UJO A;  3DXT A;  2GC2 A;  4FPO B;  4IEW A;  4XTM A;  1DYO A;  4P9X A;  5A7P A;  4D69 A;  3V0B B;  1O8P A;  3CO2 A;  2XB6 C;  4YYO A;  2CGP A;  1GNY A;  4NVP A;  1VBC 1;  5LK5 A;  1OT5 A;  4AI3 A;  4YW5 A;  3SEE A;  1PX3 A;  3MW4 A;  3QD6 A;  5FO9 B;  1RUC 2;  1PX4 A;  4K8F A;  4LBQ B;  1FOD 3;  3VKN A;  3ZXF A;  3NKG A;  4QPG B;  1ASJ 2;  3OD4 A;  2WT2 A;  5FZD A;  5CAZ A;  2DVB A;  2QQJ A;  3DYP A;  3FBM A;  4N9I A;  1CAU A;  2YG0 A;  3ZDV A;  3IZO A;  2EIB A;  4MYE A;  4JDM A;  3MV1 1;  4QKF A;  1ST8 A;  3JD7 3;  1C8N A;  1DF0 A;  4CU8 A;  4HKO A;  4AK3 A;  5I8T A;  3PJQ A;  3S57 A;  4IEQ A;  1K12 A;  1JZ7 A;  2ZA9 A;  2ZXQ A;  3ZFF C;  3PIG A;  4LE4 A;  1AL2 2;  4AED B;  4RD7 A;  4XVH A;  3DPR C;  3WW2 A;  3WNL A;  1ULC A;  2YY1 A;  1GLH A;  3HEI A;  3I2F A;  1BKZ A;  3LB9 A;  4L8Q A;  4SBV A;  3U11 A;  2VZQ A;  4R4X A;  4IV3 A;  1HXS 1;  3OBA A;  2ARB A;  3WW1 A;  1W2U A;  4NIA A;  5K0U C;  1N1Y A;  2H6B A;  5JI9 A;  5FLI A;  1BEV 2;  4KI5 M;  1J3Q A;  4CEY A;  4D7T A;  5A32 B;  3ZXL A;  2HBU A;  4PBO A;  4M3C F;  3HPN A;  2IVJ A;  5BNN C;  5BNO A;  3AP9 A;  4OI2 A;  1AUY A;  3A21 A;  3E6C C;  1ZRE A;  3O1U A;  4H7M A;  4AI8 A;  3NJZ A;  3I2J A;  4P00 B;  1GOH A;  3WF0 A;  3FZ3 A;  1R1A 3;  3QAC A;  4BA6 A;  2ZHL A;  3BTX A;  1CAV A;  4OHW A;  4PLO A;  2LUW A;  1PO1 1;  4L97 A;  4QDS A;  5CKM A;  3A0K A;  4EQV A;  3URF A;  3ZN5 A;  1FNY A;  5KBF A;  1KEX A;  3M4F A;  4GKY A;  1ZZC A;  4LBN A;  4UF0 A;  1JOP A;  1D0G A;  1H30 A;  1HRI 2;  3KS7 A;  4P9I A;  4QX1 A;  4W4Z A;  1U5X A;  3POF A;  2HEW F;  3N3H A;  3DL3 A;  4E2G A;  4QPI C;  5I0U A;  1QDC A;  3BOP A;  1JZ5 A;  4LKD A;  2CU5 A;  4N43 B;  5FZC A;  3WUD A;  2Z2S B;  2WC2 A;  2BBV A;  3ZSM A;  1TNF A;  1UY0 A;  2ADD A;  1QIQ A;  2XXZ A;  4QQL A;  1H2L A;  2VY0 A;  4ISQ A;  5FIX A;  3BB6 A;  3WW4 A;  4QX0 A;  2X05 A;  3ZFE B;  5IVV A;  5JMC A;  3LOB A;  5KHI A;  1HQL A;  1RUF 2;  2ZX1 A;  4BLI A;  3I3B A;  4LHN A;  5CNA A;  3H50 A;  3KGL A;  1VBE 1;  4Y26 A;  3U78 A;  3LE0 A;  1POV 1;  1DHK B;  4UBH A;  1F4H A;  3C2U A;  2ZGP A;  5F3C A;  4QQP A;  5JPN B;  1SQ4 A;  1GUI A;  1LOC A;  3PVE A;  4IEV A;  3CU7 A;  4QGN A;  2XGX A;  3DPR A;  5DG2 A;  2QZ2 A;  1KXG A;  2BDR A;  2EIE A;  2ZOE B;  2GN3 A;  2OYZ A;  2VG9 A;  2RS3 1;  2OW4 A;  4P9L A;  3H8X A;  3ZSJ A;  5FQ0 B;  1YQ2 A;  1DG6 A;  2RS5 1;  4GB3 2;  5IVE A;  1E5S A;  1W8W A;  2D97 A;  4COV A;  1Y9M A;  4MHU A;  3IAP A;  2W39 A;  1C8M 2;  1N3P A;  3WDX A;  4XDP A;  5BNN A;  5DZF A;  3E5Q A;  3VN4 A;  4RYD A;  4J6G A;  5CFC B;  4DUV A;  2OZ6 A;  4RGK A;  1DFQ A;  1EAH 2;  1CAW B;  3M1H A;  4HSJ A;  3LKJ A;  3RDI A;  4AGR A;  3R05 A;  3AYD A;  3ZYP A;  1YWK A;  4ATF A;  5KXC A;  1Q8S A;  5BNQ A;  1GWL A;  2FCU A;  3J9S A;  4L9B A;  1QHD A;  2PLV 1;  1BZW A;  3PHM A;  1G8W A;  3MGU A;  1QU0 A;  3WZ1 A;  5LBB A;  3ZN6 A;  3ZKU A;  5JIU A;  1B09 A;  2QCS B;  1O3S A;  2X8K A;  3AKP A;  4UFJ A;  3VHR A;  4AHZ A;  4IEO A;  4AED C;  2R30 A;  1BJQ A;  2DUP A;  2CL2 A;  4P08 A;  4QPI A;  2JB4 A;  4AW7 A;  2G9G A;  3AXE A;  1QXR A;  2VUJ A;  3JBG 1;  4N53 A;  1AX2 A;  2PHF A;  1W9W A;  3WNN A;  1O5L A;  4YVS B;  4RS5 B;  3QH7 A;  4H14 A;  1COV 2;  2E51 A;  1BK1 A;  4L11 A;  2KXL A;  3H1Y A;  5KHK A;  2OX0 A;  3VDD A;  1WLT A;  2NN8 A;  5EJZ B;  5FMC A;  1B35 B;  4XAE A;  4HAN A;  3B02 A;  5J3U A;  2VBD A;  1DQ6 A;  1CGP A;  2WWS A;  4QXB A;  1ODN A;  1G9D A;  4O65 A;  1SDD B;  4Y22 B;  3ZFG C;  3I97 A;  5FMB A;  1BBT 1;  3E6D A;  4CU6 A;  2P3Y A;  4EWE A;  4IXL A;  1UKR A;  4NRQ A;  3VBU B;  1AXZ A;  3LF7 A;  1VBD 1;  4IV1 B;  3O1T A;  1SG3 A;  3AYE A;  1SPP A;  1AR9 2;  1IS6 A;  2Y6L A;  3JCI A;  1MS0 A;  2VZ1 A;  2A3Y A;  1UZY A;  4JTN A;  5CKQ A;  1NLQ A;  1LHU A;  4N43 C;  1RMU 1;  1YUD A;  3NJX A;  1QQP 3;  5C3Q A;  5JUV A;  2WSV A;  1CZT A;  2YZ4 A;  5FR3 A;  3CKH A;  2V72 A;  4UFH A;  2K0G A;  4ZZ5 A;  4LBO A;  1K3I A;  1DQ5 A;  1VJ2 A;  2A1X A;  2WII B;  1ENS A;  4UI9 L;  4LLF A;  3BOD A;  5LEJ A;  1RUC 3;  5CBL A;  1CR7 A;  2R06 2;  4FQZ A;  4Y3O A;  1ASJ 3;  1VB4 A;  3HR9 A;  2O14 A;  2YXS A;  3S5A A;  4AGG A;  1Z7S 2;  1OXC A;  1PVC 1;  1AR8 2;  2YFZ A;  4LPL A;  3WHU A;  1RUH 2;  4AED A;  4COY A;  1HB2 A;  1Z0H A;  3WG4 A;  2PAM A;  4LBJ A;  1OUR A;  5FXX A;  1RUD 1;  1XNK A;  1OUX A;  1QJU 2;  2YU1 A;  1NCR A;  1AVB A;  2HWF 2;  4K9S A;  4CXW A;  4W6X A;  1VR3 A;  3GYD A;  5L9V A;  2C0Z A;  2HH9 A;  1QOT A;  4YG6 A;  3RS6 A;  2E33 A;  4YW1 A;  5JOZ A;  1AL2 3;  2JKX A;  1ND3 B;  4FVV A;  4PI2 A;  4CYD A;  1DGL A;  3WQB A;  1TMF 1;  1ULG A;  3VZL A;  3WX5 A;  1QH6 A;  3MBW A;  2UY9 A;  4ZU4 A;  5FY5 A;  3U4X A;  3PU3 A;  5JOX A;  4A6S A;  4AL9 A;  2C24 A;  1VMF A;  2ID4 A;  1ODM A;  2QTW B;  3A0N A;  3AZX A;  1MAC A;  3D0J A;  1X7N A;  3T4V A;  5FY8 A;  5CFC C;  5FZ1 A;  5LEK A;  5J37 A;  2JDP A;  1BEV 3;  2WFF 1;  3ILR A;  2VCC A;  4FOQ A;  3SH5 A;  4F3J A;  1QJX 2;  5FZK A;  3ZFG A;  3NQH A;  1MPX A;  1DGW X;  2VXJ A;  2RR1 2;  4P5H A;  3EO6 A;  3JB8 A;  4Z1V A;  3UK9 A;  3FC0 A;  1RB8 G;  4AXO A;  1AYN 2;  3QBQ A;  5FPB A;  2MHF A;  3OGG A;  1ZA7 A;  3NJY A;  1DZR A;  1CJD A;  2VR4 A;  1TE1 B;  2YBK A;  4XQ4 A;  1MEC 1;  1UXZ A;  1UXX X;  3U07 A;  5ERL A;  3C7O A;  4ARY A;  3MPB A;  2J1A A;  1SMV A;  4WVM A;  5FZL A;  5FYM A;  4A3X A;  1TME 2;  1MS3 A;  4R9C A;  5T5O A;  3TOJ A;  4YG0 A;  1O59 A;  3W9A A;  4B3N A;  3HNM A;  4Q4W 2;  1FV2 A;  3AP7 A;  3SIS A;  1KJL A;  1URX A;  4YVS C;  3P5B A;  2X09 A;  4RS5 C;  5JI7 A;  1MS4 A;  2WNV B;  4QKN A;  1V9U 1;  1I9R A;  2CAV A;  4Q4X 1;  4DUX A;  5A3N A;  3NL1 A;  5ISL A;  5FZM A;  4EN9 B;  1B35 C;  4GA9 A;  4W8J A;  2E7A A;  5FZF A;  2WQ4 A;  1JU3 A;  1NQD A;  2ZZQ A;  1RUF 3;  2OPK A;  2QQU A;  1RHI 1;  4YM0 A;  3WQ0 A;  1JI6 A;  5A33 B;  5FZA A;  4LBL A;  5DAW A;  4E9K A;  2W94 A;  4DXZ A;  1UIK A;  3B7M A;  1GZC A;  1WW5 A;  2VBP A;  3POG A;  2VH9 A;  1K45 A;  1ULD A;  2WZR 1;  3AMQ A;  1WBF A;  4IV1 C;  3VBU C;  2JWP A;  1PVX A;  4NE9 A;  4FPG A;  1VE0 A;  1BCX A;  5F8P A;  3VZN A;  5AC9 1;  3M3C A;  1QJY 2;  1AR6 2;  4AEK A;  1SFP A;  3RJR A;  2RJK A;  3GZA A;  1Y9G A;  2OQ6 A;  3LQC A;  1HQN A;  4URT A;  1W8Z A;  4CA9 A;  2JIJ A;  5IYY A;  1W6Q B;  3LZZ A;  5CFC A;  2VZS A;  3E1F 1;  5IAT A;  5BV6 A;  2OII A;  3KT4 A;  4MXW B;  3UGH A;  1CAW A;  1EP0 A;  3MDP A;  1ZRD A;  1C8M 3;  1JH5 A;  4Z82 A;  2W46 A;  4YM2 A;  3IPV B;  5FLH A;  2DCK A;  3LCP A;  1WMX A;  1MS8 A;  4UFI A;  3EQE A;  4AQT A;  4LHK A;  1G9F A;  2ORZ A;  2R04 3;  1IGO A;  1Y4W A;  1OQE A;  2IVI B;  3Q8F A;  4AEJ A;  1J84 A;  1GU3 A;  1S0D A;  2ET7 A;  2WFP A;  4Q4Y 2;  2YPD A;  3K3N A;  3WOG A;  1PO2 1;  4AF9 A;  5T54 A;  4BQ4 A;  3AMM A;  4AFC A;  5EWS A;  5L73 A;  2RDR A;  4P9W A;  4KGQ A;  3D0S A;  3POE A;  3VBF A;  3PLQ A;  4YVS A;  4PCR A;  1AF9 A;  2PEL A;  1ND3 C;  4PF5 A;  1TG7 A;  3U10 A;  4B8E A;  2FZ2 A;  2UY8 A;  2AC1 A;  5JR7 B;  2B5H A;  4QU2 A;  4COW A;  1O91 A;  1B35 A;  2DCY A;  2PQS A;  5JWP A;  1R09 2;  1QJZ A;  4ZU5 A;  3IT8 A;  5FPZ A;  5FZB A;  3LSD A;  4LOR A;  1LAJ A;  4HKW A;  4M4R A;  2VUD A;  1HB1 A;  4G3Y C;  2C26 A;  3O1O A;  3ZSK A;  5E6H A;  1NXM A;  2IUW A;  2JE8 A;  5H9P A;  1WLC A;  2DDU A;  2X53 S;  3OEB A;  4QM9 A;  5DXD A;  5FK8 A;  1J3R A;  3MPP G;  4XUT A;  4E8C A;  1H2K A;  2Q8O A;  5L7O A;  3ZKY A;  1S0J A;  2WA3 A;  1MZ6 A;  2CDO A;  2J22 A;  5FZO B;  5B4X A;  4B1L A;  2CSG A;  3W5N A;  1ACC A;  2VQ0 A;  2A5Z A;  2DCT A;  4DPN A;  1LU2 A;  4CPB A;  1AR9 3;  1Q8P A;  3DKQ A;  1VP6 A;  1O6U A;  1LTE A;  2WNV C;  3FFZ A;  4BYY A;  2JKB A;  3IM0 A;  1AX0 A;  1X82 A;  3C7H A;  3ILN A;  4ITC A;  4YZ3 A;  2ZHK A;  3I2G A;  1DDL A;  2C9A A;  4LKE A;  1VBA 1;  3VD3 A;  3OUH A;  4WM8 A;  2G1M A;  2OA2 A;  5DAB A;  5C4W B;  2YPJ A;  4HN1 A;  3NW4 A;  4ZKT B;  2B8M A;  1R64 A;  4MO3 M;  4JRL A;  4FFG A;  2R06 3;  4Y20 A;  2C9K A;  1A8M A;  1Q56 A;  1XSR A;  1WW7 A;  2JG8 B;  4OMD A;  2BVB A;  4BCU A;  1DU3 D;  2XL9 A;  1RUH 3;  3N7L A;  1SCR A;  3HN3 A;  4C1W A;  1JN2 P;  2P3I A;  2B9U A;  1FOD 1;  1W03 A;  2BNM A;  2JG9 B;  4XF4 A;  3AX4 A;  4AZZ A;  2D6O X;  1F31 A;  5DMY A;  1QJU 3;  2AEZ A;  1Y43 B;  2BNN A;  4QXK A;  1WCQ A;  1RIR A;  2XQX A;  2BZD A;  4MH0 E;  4PHZ A;  5E89 A;  4YZ5 A;  4CCL A;  1V00 A;  4Q4V 2;  3CEW A;  4QDR A;  1YQ8 A;  4QU1 A;  5F2W A;  1O4Z A;  3EHK A;  3VZO A;  4AFB A;  5BNP A;  1DQ0 A;  2ZMK A;  3JD7 1;  4JV4 A;  3H3U A;  3JUU A;  3VDB A;  5FY1 A;  5FPX A;  3POW A;  3SHR A;  4DZG A;  2GH2 A;  4Q0S A;  1Y9Q A;  2A3W A;  2XG3 A;  5FZ9 A;  4AFA A;  2WWU A;  3GXU A;  3AM2 A;  4MLO A;  1O7F A;  3ZR6 A;  4CDU B;  2DWR A;  2RM2 2;  4Y24 A;  3WF3 A;  2JEC A;  1ZM1 A;  4MGY E;  3WUC A;  1QJF A;  1AR7 3;  4WVW A;  2GC3 A;  2RR1 3;  4GWM A;  1PMI A;  2W92 A;  3VBO A;  4FOW A;  5GKA C;  3GZT B;  2LS6 A;  5CEH A;  1KS4 A;  5DAQ A;  5FP8 A;  3DV8 A;  3T4H B;  1KS5 A;  3P3P A;  4CCJ A;  5F6L B;  4BU2 A;  2JDY A;  1XNB A;  4YW7 A;  2HWB 2;  1SLC A;  3ZXD A;  2Q1F A;  4KGG A;  2J1E A;  4Y5Z 0;  3WY6 A;  3LFI A;  3NV3 A;  1CAU B;  5EJ3 A;  4GIQ A;  2WN3 A;  3LEI A;  1KDK A;  3TN9 2;  1NT0 A;  1R1A 1;  4Q4W 3;  1K5J A;  1XC6 A;  4JRA A;  1V0A A;  2EID A;  2E9Q A;  2N7G A;  3POB A;  5FP9 A;  4K1Y A;  3HQR A;  4XMA A;  4MUV A;  3UT0 A;  3DYO A;  1IPJ A;  1D2Q A;  4L2N A;  3ZN4 A;  4GH4 A;  2JD9 A;  4BH9 A;  1V6O A;  1XB9 A;  2O1Q A;  3U4S A;  4IE5 A;  3J8F 2;  3AK0 A;  3T2T A;  4CP1 A;  2C1F A;  2MEV 2;  2QJV A;  2VUA A;  1YNA A;  3VDA A;  3ON7 A;  2BGP A;  2ZGM A;  2VVE A;  4HLT A;  4RHV 3;  4CEY B;  2P6C A;  5HBA A;  3BPS A;  1OBN A;  2XKP A;  3CZU A;  5BNO B;  2WKK A;  1K5M A;  1W6Q A;  4FTE A;  4KU8 A;  1ONA A;  4QX3 A;  4MXW A;  3S6P A;  1AR6 3;  1GYK A;  4XBL A;  4G4F A;  2R0F A;  2E63 A;  4A7Y A;  4IGO A;  2EXJ A;  5I93 A;  1CAV B;  2R16 A;  3LDR A;  1MVQ A;  5FXZ A;  3OOX A;  5A6X A;  4JGY A;  4QX2 A;  1PGS A;  4OQ8 A;  2ZAC A;  3PVN A;  2QDN A;  5KC6 A;  2ET1 A;  5C4W C;  4LO4 B;  2J1S A;  3A4U A;  3I2D A;  2AGS A;  1XND A;  5IFP A;  2OVU A;  1RJ7 A;  1AYM 2;  3VKL A;  1ENQ A;  4FQ4 A;  2IXJ A;  3OUI A;  4QQ2 A;  5IUQ A;  5C3S A;  2Q1Z B;  4AYU A;  4GAL A;  3T2Q A;  1VIW B;  4A7Z A;  2JG8 C;  1NY7 2;  4HBN A;  5SV8 A;  1S2B A;  4AQ2 A;  5A1L A;  3C3V A;  3MI8 A;  2CGN A;  2NM1 A;  3ASI A;  4LJH A;  1WW4 A;  2DFC A;  3DUI A;  4KWK A;  1DLL A;  4IER A;  4D6S A;  4Y1X A;  5H9R A;  4EN8 B;  2JG9 C;  4RSU A;  1UIJ A;  1XXN A;  1OOP A;  3IMN A;  3FLP A;  3OGJ A;  4Q0P A;  3NMB A;  4AQS A;  2PHU A;  3WCR A;  1ZX5 A;  1D4M 2;  3C7E A;  2YGL A;  3I59 B;  2Y0O A;  3NJV A;  4Y33 A;  3ZDS A;  1LHN A;  3S0M A;  4IE6 A;  3TNP B;  3MIE A;  4GZ9 A;  2Q8C A;  1J83 A;  2CTV A;  3UET A;  3G7D A;  3B5L B;  3MUZ 1;  2GC0 A;  1QKQ A;  1SBD A;  2X5I A;  4ZY9 A;  3I2H A;  4IET A;  3OPW A;  3DPR B;  1GNZ A;  2QQP A;  2VU9 A;  1E5R A;  4DXT A;  5T3N A;  4CDU C;  4I09 A;  1H0B A;  1RVF 2;  3GZE A;  1D7P M;  2A6Y A;  5FZO A;  1VRB A;  1V6K A;  5F6K A;  1GZT A;  1W06 A;  4CP2 A;  3FMG A;  2KA3 A;  5BNN B;  1PGL 1;  5FP4 A;  3FX3 A;  1SLT A;  3MUY 1;  1WD4 A;  2JDM A;  3NAP A;  3KVB A;  1WME A;  4CCE A;  1QDO A;  1CD3 G;  1WW6 A;  2VL4 A;  4XFI A;  1W6O A;  3AP5 A;  2XH6 A;  5F3G A;  5IAV A;  2FD8 A;  2NLR A;  3RZZ A;  2Y33 A;  1MZF A;  1W0P A;  2B4K A;  1JHN A;  5A3M A;  3R4U A;  3G6J B;  4UWD A;  5DQ0 A;  1CIY A;  5FY9 A;  2WS9 2;  5JXG A;  5CG9 A;  1CIW A;  4XE9 A;  4CCN A;  3I2O A;  3JQW A;  3HD8 B;  3WP5 A;  4C0H A;  3AJY A;  3ZN6 B;  1LGB A;  4QXC A;  2VQU A;  4IE7 A;  3ZYB A;  3RZM A;  1O3T A;  5I8Y A;  5LK7 B;  2FMY A;  1A3K A;  1W0N A;  2GNM A;  4K21 A;  3UGF A;  3WQ1 A;  1L3J A;  4QPI B;  4D94 A;  4EV0 A;  3PL0 A;  1CJP A;  1UOB A;  2WZ8 A;  5HV0 A;  4Y1Z A;  2A6Z A;  3AFG A;  4N53 B;  1YC6 1;  2J42 A;  2DF7 A;  3OF1 A;  2PHR A;  3ETP A;  5EIY B;  3KT7 A;  3CZJ A;  4NPR A;  1QWR A;  3WP4 A;  1OHF A;  3ZXE A;  4HPK A;  1QQP 1;  3D3A A;  5BPX A;  4OHY A;  4CEY C;  1C5I A;  5GJ6 A;  3JU9 A;  1STM A;  2RDS A;  4YW2 A;  2GH8 A;  1C57 A;  4RFT 0;  1IPS A;  3SNM A;  4TLF A;  3VDD B;  3I3E A;  3D5O A;  3LA2 A;  4LBQ D;  5BNO C;  4X8P A;  1JTZ X;  2XJU A;  2DTW A;  3IMM A;  2ZCW A;  1UWW A;  1T6G C;  1OLM A;  1RUC 1;  4GKX A;  3IWZ A;  4JKM A;  4AI1 A;  4QT6 A;  3S7I A;  3Q8E A;  4XJA A;  1W8T A;  4JDO A;  5A7N A;  2EAK A;  1ASJ 1;  2Y34 A;  3P6B A;  2HEV F;  4Q0U A;  1EUT A;  5FUP A;  1IG0 A;  1CES A;  1O4Y A;  2GDF A;  2ZEX A;  5DDJ 2;  1VBB 2;  1PIV 2;  4OHX A;  4CDU A;  2D6K A;  1CAX A;  2VE1 A;  3J26 N;  1S0B A;  1LU1 A;  4GWN A;  4AHY A;  1SPP B;  1ENX A;  4Q1R A;  1APN A;  2D5F A;  4BQ2 A;  2YMZ A;  2DUQ A;  2RV9 A;  4WM7 A;  5L19 A;  1TNR A;  5IVF A;  1AL2 1;  2RM2 3;  4LUL A;  3CLP A;  3ZR5 A;  2JDK A;  1V6J A;  2DV9 A;  5FAX A;  3AXD A;  4NHL A;  3VLB B;  4O9G A;  2EAA A;  2VMI A;  5JSP A;  4Y1Y A;  2CNA A;  4ES8 A;  1UU6 A;  4FTS A;  1BEV 1;  2B9V A;  2HWB 3;  2ZTN A;  2JJ6 A;  2XWB B;  2RDQ A;  1HRV 2;  2P3J A;  3B69 A;  4HL0 A;  3MIF A;  5J98 B;  1FXZ A;  1OF3 A;  1IKP A;  4AAX A;  5BY5 A;  3CL1 A;  4FXG B;  1WCD J;  5F5I A;  3LAG A;  4OI1 A;  4B4Q A;  2LRP A;  5A7S A;  1MS9 A;  2VME A;  1Q43 A;  2UYB A;  1HN1 A;  3DEC A;  3M70 A;  5GAL A;  2R49 A;  1NCR B;  3NV2 A;  3TEW A;  4DY3 A;  1S0F A;  4NWV A;  3K51 A;  1FAY A;  1KQR A;  4PIY A;  3USU B;  2PHW A;  5FYY A;  4AWD A;  4QDQ A;  2DU1 A;  3E97 A;  4QPW A;  1U5I A;  1LB2 A;  2A73 B;  3DEM A;  4DUW A;  2VQA A;  4GMP 3;  5CA6 A;  1UYY A;  3J8F 3;  1HJG A;  3VZM A;  3RWN A;  1F5J A;  1VBC 2;  3WSO A;  4AGV A;  4Z2W A;  1GKB A;  1LOE A;  4LE3 A;  2JDU A;  3N7M A;  4FPK A;  3K4D A;  4NJ4 A;  3SKV A;  1H1I A;  4UFL A;  2GZW A;  4HVO A;  3ZFG B;  3MFC A;  2VGD A;  1W6N A;  2MNG A;  3IN9 A;  2CHH A;  1SEF A;  2QQN A;  2XVG A;  3ZO0 B;  1RUF 1;  1A6C A;  1AJO A;  4E2S A;  1QH7 A;  3HT2 A;  4KWL A;  4WV8 A;  1UY4 A;  3NWK A;  2CY6 A;  1RUG 3;  4H55 A;  5FKB A;  3O0V A;  3KHC A;  1M4W A;  2NYY A;  4JKL A;  3N9L A;  4DO0 A;  2ZEY A;  5DAX A;  1R08 3;  1RUJ 2;  2E6V A;  4P9G A;  3WNM A;  1YIP A;  4WVM B;  2VBB A;  3FUO A;  4N53 C;  2WDB A;  1Q3E A;  4I3P A;  4ONU A;  4ES9 A;  1AYM 3;  1C28 A;  1WA6 X;  1BK0 A;  4EJR A;  4E4D X;  1CWP A;  1HXS 2;  3KV4 A;  4JHZ A;  4BQX A;  5FTT C;  1J59 A;  2BOJ A;  2J1U A;  1ZVF A;  2W95 A;  3I59 A;  4CU7 A;  1DZT A;  5CG8 A;  5C5T A;  3VDD C;  4AQ6 A;  1PGW 1;  1C8M 1;  4AE2 A;  3ABZ A;  4WZF A;  5FMO L;  1V6N A;  4IGQ A;  4TLG A;  4IGP A;  5ACA 3;  1C1F A;  4DS0 A;  3M3E A;  4EWA A;  3MYX A;  3U0Z A;  4ZS3 A;  3FN9 A;  4UW4 A;  2R04 1;  4M0N A;  2E32 A;  3ZYJ B;  5A6Q A;  2EAL A;  1PO1 2;  4B4P A;  3D8C A;  4E4H A;  4LO8 A;  3VUO A;  2BV4 A;  5T5P A;  4RGA A;  2XUM A;  5IJR A;  2FDH A;  4UXA A;  1WWY A;  4FAG A;  1ZYB A;  3HQX A;  1OKO A;  4AI0 A;  4MOA A;  3KQR A;  4PJY A;  3ZYR A;  4BIO A;  3VHN A;  2HJI A;  2GMP A;  4EN7 B;  2BJS A;  2DUR A;  4Q0Q A;  2WAB A;  4HVQ A;  2D98 A;  2OS2 A;  1YQ6 A;  1ZBA 3;  4AI2 A;  2ENR A;  5I0S A;  5IT6 A;  4CDX A;  5IAX A;  3Q9O A;  3CHX A;  1SFN A;  3BIW E;  4Q8K A;  1XYN A;  1GOG A;  1JW6 A;  1KD7 A;  2VCM A;  4BK4 A;  1VBE 2;  1CN1 A;  1W8F A;  2ZEW A;  3OG2 A;  4YPJ A;  3VBH B;  5JZG B;  1XSQ A;  3N9P A;  4A45 A;  4B1M A;  4DIQ A;  3B9I A;  2TBV A;  1JBC A;  3T1L A;  5T5L A;  2FDI A;  3M8L A;  3MFA A;  1NCR C;  4XJW A;  2VOX A;  5FY0 A;  3GF6 A;  4K40 A;  3RNS A;  1RGS A;  3IDC B;  1G86 A;  3VBF B;  3RPQ A;  2ADE A;  3SCF A;  3K77 A;  2RS3 2;  3BTZ A;  2A3X A;  2I45 A;  2EA7 A;  1GV9 A;  2SBA A;  4M01 A;  3KGZ A;  4MX3 A;  4LNV A;  1W2T A;  4JX0 A;  2XUE A;  1WBL A;  3ZXG A;  2RS5 2;  1WMD A;  4NO4 A;  1H8T A;  2XVL A;  2XDV A;  4P02 B;  4C90 A;  5D8A A;  4BIS A;  2IWG B;  1OUS A;  1OVS A;  3RYR A;  5FKC A;  1RED A;  1RUI 2;  5FFO C;  1GP6 A;  3IAQ A;  2VOK A;  5FP3 A;  2QKD A;  2XBO 3;  1X9T A;  1W6M A;  3M3O A;  1IHM A;  2BW8 A;  4HKL A;  5JXJ A;  1D2S A;  4L99 A;  2F4L A;  5HXM A;  1NYW A;  2R06 1;  4HMZ A;  1POV 0;  4JCK A;  4Z07 A;  4E4Z A;  2V73 A;  4BXS V;  3JZV A;  5L7O B;  2PLV 2;  2RJL A;  1OI6 A;  2GMM A;  3DF0 A;  5JSO A;  2A70 A;  5KHJ A;  2YGM A;  1EPW A;  4ET7 A;  3E5U A;  2K46 A;  1H2M A;  2QQL A;  4H3W A;  3NVC A;  1VBB 3;  4R4Z A;  1PIV 3;  2IC1 A;  5F5A A;  2NMO A;  2TNF A;  2A6V A;  1WLW A;  1UOG A;  2JDA A;  5FCC A;  1QJU 1;  3JBG 2;  2VNV A;  5JMO A;  4FTB A;  1LHV A;  5J48 A;  4L92 A;  5KHH A;  1HV0 A;  4LHL A;  3GJA A;  5DZE A;  5HCB A;  4XZP A;  5IVC A;  1JZ3 A;  1AZD A;  2PHD A;  4AVC A;  1U0A A;  1H6X A;  4D7S A;  1SLA A;  3SKJ E;  4PI0 A;  3PU8 A;  1RXF A;  4WM8 B;  4O7X A;  1N1V A;  3RYP A;  4FAH A;  4Q26 A;  5A3O A;  4C91 A;  4J1X A;  2O8O A;  5FRE A;  5J7M A;  4NUB A;  1UW8 A;  2P2K A;  3KV9 A;  4FO9 A;  4LIT A;  4Y20 B;  5F32 A;  2DVA A;  5A80 A;  1CX4 A;  2EXH A;  1DQ4 A;  1FV3 A;  3TNQ A;  4X6R B;  4M3C A;  5A1A A;  1AR7 1;  5T5J A;  3VKF C;  2RR1 1;  1SLL A;  5IHR A;  3USU A;  1QY4 A;  2WAA A;  2YB7 A;  1BBT 2;  1F9K A;  2DUO A;  4QQO A;  5F3E A;  3VBR C;  2XPJ A;  4CVU A;  2A6X A;  4YGE A;  1X50 A;  3CDZ B;  4LQR A;  3THP A;  1W39 A;  3WNK A;  4ZZ8 A;  5A6Z A;  4I01 A;  4FI9 A;  5BUV A;  2ARE A;  4XDQ A;  3IB3 A;  4BQ1 A;  2ZX0 A;  2Y6J A;  3J7N A;  4OI0 A;  2KM2 A;  2O8Q A;  2C4X A;  2IXH A;  4KU7 A;  4Q5O A;  1RMU 2;  1YXW A;  2VZV A;  4NN0 A;  4CCK A;  1TEI A;  1WZX A;  3QH6 A;  3VBS A;  1SAC A;  3SCH A;  4FBF A;  5BNP B;  3SC7 X;  5JXI A;  3T0D A;  4Q4W 1;  4UFM A;  5ABJ C;  3A22 A;  2FDJ A;  2FZ1 A;  5GLU A;  4UW3 A;  3VD7 A;  5EHD A;  4RQP A;  2ATF A;  5C7G A;  4TYS A;  3KMH A;  2RS1 1;  4PT6 A;  4K1Z A;  1X36 A;  3J7L A;  5CB7 A;  2JE7 A;  2DCZ A;  4ZPI A;  4DFS A;  4OHV A;  5FPL A;  4H7L A;  1LOF C;  1OMI A;  3LSE A;  5IVB A;  5JZG C;  4XJ8 A;  3HBK A;  3VBH C;  3KF3 A;  3BOW A;  3MIB A;  4OUM A;  5F39 A;  2VC9 A;  3VBO B;  1LUL A;  2D3R A;  3RI8 A;  3HNB M;  3FE5 A;  2QBX A;  4P5Y A;  4AVB A;  2ZAB A;  3VL8 A;  2WNU B;  3N35 A;  1HRI 3;  4RHV 1;  3APB A; 
#chains in the Genus database with same CATH homology
 4OYU A;  4MGS A;  4QDR A;  5DN2 A;  2V4V A;  4LHS A;  2WO2 A;  3WF1 A;  4BK5 A;  3K46 A;  3VDB A;  3ACH A;  5G04 L;  3W5M A;  3GXU A;  2BER A;  3WF3 A;  2Y64 A;  2QQK A;  2VZR A;  2Y8K A;  3THD A;  1XNA A;  1GMM A;  2VZ3 A;  2W92 A;  4DXS A;  2VMC A;  2LS6 A;  3T0B A;  5DPN A;  3HJR A;  4XUR A;  1NKG A;  2J1E A;  5EJ1 B;  2WN3 A;  3LEI A;  2VOT A;  3LPG A;  1BHG A;  3WF4 A;  1XC6 A;  4OUE A;  1ULP A;  2EID A;  3IDA A;  3NRU A;  1JZ8 A;  4XUQ A;  4ZXE A;  3LPF A;  4M4P A;  4MGQ A;  3LEG A;  3DYO A;  1UYZ A;  2BGO A;  5C70 A;  2JD9 A;  1DYO A;  1O8P A;  4XUO A;  1GNY A;  1OT5 A;  2YFU A;  3SEE A;  1PX3 A;  2OKX A;  3VDA A;  4CUB A;  2HLE A;  1PX4 A;  2BGP A;  5JXH A;  1GOF A;  2BBA A;  3CZU A;  3T0A A;  2QQJ A;  3DYP A;  2YG0 A;  2EIB A;  4QX3 A;  3MV1 1;  1DLC A;  1H6Y A;  4CU8 A;  1K12 A;  3ACF A;  5LA2 A;  1JZ7 A;  2ZXQ A;  4QX2 A;  3III A;  1JYW A;  4XVH A;  4DXR A;  4OZO A;  2J1S A;  3WNL A;  3HEI A;  3I2F A;  5C71 A;  5IFP A;  1I5P A;  2VZQ A;  3DYM A;  3OBA A;  3GDB A;  3T2Q A;  1F4A A;  3EB7 A;  4KI5 M;  1KGY A;  1UX7 A;  4DEQ A;  3HPN A;  1L7R A;  3A21 A;  3I2J A;  3K4Z A;  4P00 B;  1GOH A;  3WF0 A;  3C7E A;  3NJV A;  2WBK A;  2VMF A;  1JU4 A;  2W5F A;  4GZ9 A;  4QDS A;  1J83 A;  1EUU A;  1ULO A;  4KMQ A;  3UET A;  3MUZ 1;  1KEX A;  4ZY9 A;  3I2H A;  3C7G A;  4QX1 A;  4W4Z A;  4DXT A;  2W1U A;  1XPW A;  1JZ5 A;  1JZ4 A;  2YC4 A;  1D7P M;  1UY0 A;  4XUN A;  1W9T A;  4QX0 A;  2X10 A;  2X05 A;  4A4A A;  3MUY 1;  5LA0 A;  3I3B A;  3PUI A;  2VL4 A;  4A42 A;  2HYX A;  3LE0 A;  3P1I A;  1F4H A;  3T2P A;  1T2X A;  2B4K A;  3C7F A;  3NNG A;  5JXG A;  5DQ0 A;  1CIY A;  1GUI A;  2EIE A;  2VQU A;  2QQI A;  2W47 A;  3WNO A;  1W0N A;  1YQ2 A;  2R7E B;  2VO5 A;  2WZ8 A;  3U37 A;  3CMG A;  2VZP A;  3IAP A;  2V5D A;  3ETP A;  5EIY B;  2VM9 A;  3CZJ A;  1NX9 A;  4RYD A;  3D3A A;  3VD5 A;  4ARX A;  4CU9 A;  4DUV A;  2W91 A;  3EYP A;  2VZO A;  3OGR A;  3I3E A;  2W1Q A;  4A6O A;  1JYX A;  1UWW A;  4JKM A;  2KD7 A;  4KWU A;  3P6B A;  1EUT A;  1RYY A;  2ZEX A;  4QB6 A;  3PUH A;  3UES A;  4A44 A;  4P08 A;  2YC2 A;  4A41 A;  3VD9 A;  2J7M A;  3VDC A;  1W9W A;  2VQT A;  3WNN A;  3WEZ A;  3T08 A;  2RV9 A;  4IUG A;  2W1S A;  3ECQ A;  4HG6 B;  1WCQ A;  5EJZ B;  5F7U A;  1CZS A;  4QAW A;  3MV0 1;  1US2 A;  1SDD B;  2B9V A;  4A3Z A;  4Z2A A;  1JZ6 A;  3F2Z A;  3WNP A;  3I97 A;  1OF3 A;  5G05 L;  4AAX A;  2VJX A;  4CU6 A;  3I2I A;  2L9L A;  3FL7 A;  2VME A;  1SG3 A;  1HN1 A;  2Y6L A;  3DEC A;  2WQ8 A;  2VZ1 A;  5B4N A;  4W50 A;  3OGV A;  3ACG A;  4QDQ A;  4QPW A;  3NJX A;  5JUV A;  4JKK A;  2WO3 A;  1CZT A;  2WYS A;  1UMI A;  2J1R A;  2V72 A;  2J1V A;  3CKH A;  4UAP A;  4DUW A;  5I0D A;  1UYY A;  4ZZ5 A;  4LKS A;  1K3I A;  4UI9 L;  3WSO A;  4D8M A;  3JXS A;  3VD4 A;  3K4D A;  2VMD A;  3SKV A;  1UYX A;  4PF1 A;  4LPL A;  2YFZ A;  2QQN A;  3BGA A;  5LA1 A;  1W8N A;  4TXW A;  1JYN A;  1UY4 A;  4QB1 A;  4DEV A;  2VCB A;  4JKL A;  4QB2 A;  2E33 A;  2ZEY A;  2JKX A;  3WNM A;  1GQP A;  2Y6H A;  2WDB A;  4PQQ A;  3WQB A;  3K75 B;  4CUC A;  3MBW A;  1IQD C;  2ID4 A;  2WAO A;  4JHZ A;  2J1U A;  2W95 A;  2XOM A;  4CU7 A;  3GM8 A;  5IFT A;  2VCC A;  3ACI A;  3NQH A;  1MPX A;  3ABZ A;  2ZEZ A;  1NAE A;  2E26 A;  3FN9 A;  2VR4 A;  1UXZ A;  1UXX X;  1UY2 A;  2E32 A;  3C7O A;  3OEA A;  4ARY A;  2J1A A;  1OF4 A;  4RN5 A;  5IJR A;  1O59 A;  3HNM A;  2VTF A;  4MOA A;  5FUI A;  2X09 A;  1PMJ X;  5J1X A;  1OD3 A;  2DCJ A;  2WAB A;  4DUX A;  3HNY M;  2XHN A;  1CX1 A;  2Z4F A;  4GWJ A;  4W8J A;  1JU3 A;  3SEP A;  3I3D A;  1GOG A;  2VCA A;  1JI6 A;  4BK4 A;  4AG4 A;  1JYV A;  1DP0 A;  2W94 A;  2ZEW A;  3OG2 A;  4YPJ A;  1LNS A;  5HPO A;  4A45 A;  1K42 A;  1K45 A;  4UOJ A;  3CIH A;  1PMH X;  2ORX A;  3LQC A;  5JR2 A;  3T2O A;  3A23 A;  1NUK A;  3ZM8 A;  3K77 A;  5IYY A;  2QQO A;  2VZS A;  3E1F 1;  4JX0 A;  4BJ0 A;  3WF2 A;  2W3J A;  2XON A;  3I2K A;  2W46 A;  4P02 B;  1XNT A;  2W87 A;  2DCK A;  3IAQ A;  2ORZ A;  5JXJ A;  1J84 A;  3MO4 A;  1GU3 A;  5HXM A;  2Y6K A;  1SHW B;  1UY1 A;  2QQM A;  2W9X A;  1JZ2 A;  4BXS V;  4GWI A;  4ET7 A;  2QQL A;  5LCW L;  1O8S A;  3UNP A;  1TG7 A;  2VZU A;  2JDA A;  3CQO A;  3T09 A;  2WUH A;  5JMO A;  2PQS A;  3FHQ A;  1JZ3 A;  1UZ0 A;  2WZE A;  1H6X A;  5CZK A;  2VZT A;  4M4R A;  3SKJ E;  1W9S A;  2C26 A;  2JE8 A;  2DDU A;  3OEB A;  4XUT A;  4E8C A;  1TVG A;  4E8D A;  5A1A A;  1P8J A;  2W1W A;  2CDO A;  2J22 A;  3OB8 A;  5B4X A;  5IHR A;  1WKY A;  3W5N A;  2WAA A;  2YB7 A;  4CUA A;  4CVU A;  1JHJ A;  4ZZ8 A;  3CDZ B;  4LQR A;  2WO1 A;  3WNK A;  3AC0 A;  1W99 A;  4FI9 A;  3IB3 A;  2Y6J A;  1L7Q A;  4L0P A;  4D0Q A;  1UMH A;  2C4X A;  3C7H A;  2Y6G A;  3I2G A;  3HOB A;  2E31 A;  2VZV A;  3C8X A;  4MAD A;  2RJ2 A;  3J7H A;  1UY3 A;  3VD3 A;  1W8O A;  2RVA A;  5JXI A;  3THC A;  3T0D A;  3A22 A;  3LEK A;  3VD7 A;  5C7G A;  1R64 A;  4MO3 M;  4XZU G;  2C9K A;  3BN6 A;  4PT6 A;  4XUP A;  3A7Q A;  4TTG A;  3OGS A;  4OMD A;  2CDP A;  3FHA A;  1CZV A;  5CYY A;  1US3 A;  3K4A A;  4OMC A;  2J1T A;  2VC9 A;  2LW8 A;  3GGL A;  3HNB M;  3HN3 A;  2EIC A;  2QBX A;  4P5Y A;  4BDV B;  5DMY A;  1OH4 A;  2WN2 A;  2XQX A;  2BZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...