2YB7A

Cbm62 in complex with 6-alpha-d-galactosyl-mannotriose
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
140
structure length
140
Chain Sequence
b'SYPKLTGTVIGTQGSWNNIGNTIHKAFDGDLNTFFDGPTANGCWLGLDFGEGVRNVITQIKFCPRSGYEQRMIGGIFQGANKEDFSDAVTLFTITSLPGSGTLTSVDVDNPTGFRYVRYLSPDGSNGNIAELQFFGTPAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CARBOHYDRATE BINDING FAMILY 6
publication title A Novel, Noncatalytic Carbohydrate-Binding Module Displays Specificity for Galactose-Containing Polysaccharides Through Calcium-Mediated Oligomerization.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Sugar binding protein
total genus 33
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2yb7A00
2WBKA 4PQQA 1PX3A 3I2GA 4ARXA 2W9XA 3SKJE 4CU7A 4KI5M 3GGLA 4QDSA 1EUUA 1JZ7A 3HNMA 3T08A 3WF0A 2WO2A 1O8PA 4PT6A 1J83A 4QB1A 5JMOA 3C7HA 5G04L 3K4DA 3T0AA 2W94A 3SEEA 3IAPA 1UY4A 3VD5A 2VZTA 4D0QA 4L0PA 2EIBA 2W87A 1SG3A 4CU8A 1UXXX 2V72A 4W8JA 2VZRA 1UYXA 2YFUA 4OUEA 2CDOA 1US2A 2R7EB 3ACFA 4DUWA 3WSOA 1P8JA 1UWWA 3LEIA 1UMIA 2VZOA 5JXHA 2QQKA 4OMDA 2E31A 1WCQA 4PF1A 1BHGA 3VDAA 2QQIA 2Y6KA 3PUHA 1UY0A 2WO3A 4CUBA 5CZKA 3GM8A 3VD3A 1GOFA 3LPGA 4P5YA 1JZ3A 1W9WA 1UY3A 1W9TA 2E32A 4OMCA 1I5PA 4QDQA 4ET7A 4ZZ8A 5IFPA 1YQ2A 1UYYA 5HXMA 2J1AA 1H6YA 3I2IA 3W5MA 2C9KA 1GNYA 1GOGA 3IIIA 3I3DA 2C26A 4KMQA 2B9VA 1DYOA 3EYPA 4D8MA 3VD4A 2VMDA 3WNKA 3UESA 4GWJA 2KD7A 4JX0A 5LA2A 4DEVA 2VZ3A 4P08A 3MUY1 1K45A 3FN9A 5DQ0A 3P6BA 2Z4FA 3HPNA 4XUNA 4P00B 2XHNA 1UX7A 3P1IA 1OF3A 2HLEA 3DECA 1TVGA 2BERA 3CZUA 5JXJA 3K4AA 3GDBA 1UXZA 3MO4A 2VZPA 2J1EA 4DXSA 4LKSA 3CMGA 2VC9A 3ACHA 3NJVA 3ETPA 3OGVA 5B4XA 2J1RA 3DYPA 3C7FA 4MOAA 1JZ2A 3ZM8A 5LA1A 2WN3A 3OG2A 4XZUG 1NAEA 2QQNA 3THDA 4JKLA 4XUOA 1J84A 1XPWA 4LPLA 1W0NA 2RV9A 1MPXA 4QX2A 4TTGA 3OGRA 1CZVA 1ULOA 3ACGA 3MV01 2W1SA 4GZ9A 4JHZA 4BK4A 1XC6A 4OYUA 1DLCA 1O8SA 3BN6A 2VM9A 3UNPA 2L9LA 3FL7A 3FHAA 2DDUA 3T2PA 4BDVB 2PQSA 5LCWL 2YFZA 3T0BA 2JKXA 4UI9L 5A1AA 4A44A 5IHRA 1NX9A 1H6XA 3I97A 2XONA 2VTFA 3I2FA 1NUKA 5C7GA 2W5FA 3EB7A 2LW8A 2Y64A 1OT5A 5G05L 1XNTA 1JYXA 3C8XA 3ECQA 2W3JA 4ZXEA 1O59A 4E8CA 3VDBA 3D3AA 3F2ZA 4QX1A 3T09A 3I3EA 1JYNA 3UETA 3VD9A 2VCBA 4DUXA 3LPFA 4FI9A 1SHWB 3WNNA 3CQOA 4AAXA 3OEBA 2CDPA 2J1VA 1JZ4A 2RJ2A 4MO3M 4QX3A 3HNBM 2YG0A 2DCJA 4LQRA 5DPNA 2ZEXA 4QX0A 2YC4A 2EIDA 1CZSA 4Z2AA 3HEIA 5HPOA 1OF4A 4XUPA 2J22A 5LA0A 3WF3A 3BGAA 1JYWA 5I0DA 4CVUA 1F4HA 3MV11 4ZY9A 2V4VA 4A45A 3E1F1 2HYXA 2YB7A 3MUZ1 4QDRA 5EIYB 4JKMA 2X09A 1GOHA 1W9SA 4P02B 4QB2A 4DUVA 4MGQA 1JU4A 2VR4A 5C71A 2XOMA 4BXSV 3AC0A 3ACIA 1PMHX 1OH4A 4ZZ5A 3WEZA 4MGSA 3WF1A 2V5DA 3CIHA 3A7QA 4YPJA 3W5NA 3WQBA 1ULPA 3VDCA 1T2XA 1K42A 3THCA 5JR2A 4JKKA 4KWUA 1UMHA 3ABZA 1L7RA 3HOBA 1L7QA 5IJRA 2VQUA 5FUIA 1K12A 3PUIA 5JXGA 2DCKA 1US3A 4DEQA 1PX4A 1HN1A 4M4RA 3C7GA 3HJRA 3K46A 2OKXA 3WF2A 4BJ0A 5F7UA 3IB3A 3WNOA 4RN5A 4UOJA 2E33A 2WAOA 1F4AA 4A6OA 2QQLA 1KGYA 5IYYA 4IUGA 3I2KA 4AG4A 1JZ5A 3CDZB 4GWIA 4DXTA 3IAQA 1CIYA 2C4XA 3VD7A 1UY1A 2WABA 4LHSA 3T2QA 1KEXA 1TG7A 3WF4A 5DMYA 2Y6LA 2J1TA 3SKVA 2VQTA 2VOTA 4HG6B 2J7MA 1EUTA 4DXRA 3NRUA 1GU3A 2YC2A 2W47A 3OB8A 1D7PM 2VL4A 3MBWA 3T2OA 5IFTA 2Y6HA 2VCAA 2W95A 1UZ0A 4BK5A 1R64A 5J1XA 3LE0A 1W8OA 2ZEZA 5C70A 2ZXQA 2W1QA 4M4PA 4CU9A 3LQCA 2WZEA 2VZSA 3LEGA 1CX1A 3OEAA 2ZEWA 2QBXA 1GUIA 2ORXA 4ARYA 1OD3A 1RYYA 2J1SA 5EJ1B 3A21A 3WNMA 4CU6A 2VMEA 1JHJA 2W46A 4XURA 1GQPA 5JXIA 2W1WA 3A22A 3K77A 2WUHA 1DP0A 2WO1A 3JXSA 2WN2A 2B4KA 4A4AA 2RVAA 1JZ6A 2Y6GA 2BGPA 3HN3A 3A23A 4A42A 3DYOA 3K4ZA 2BGOA 4A3ZA 3T0DA 2VJXA 2QQMA 5CYYA 3NNGA 3IDAA 1CZTA 2VMCA 3DYMA 2JD9A 2ID4A 2VMFA 1UYZA 2WAAA 3WNLA 5EJZB 3U37A 1UY2A 2X10A 3I2HA 1NKGA 3SEPA 4CUCA 3C7OA 2QQJA 1K3IA 2EICA 4UAPA 2Y6JA 4QB6A 2VZ1A 2JDAA 3GXUA 3I2JA 1SDDB 2LS6A 3I3BA 2BZDA 4QAWA 4MADA 5B4NA 3C7EA 3K75B 1IQDC 4XUQA 3OGSA 2X05A 1GMMA 4A41A 4TXWA 3NJXA 2WQ8A 2W92A 3J7HA 3LEKA 4RYDA 2XQXA 1W99A 4OZOA 1JU3A 1JI6A 4QPWA 1JZ8A 5JUVA 2WZ8A 1WKYA 2BBAA 2ORZA 4CUAA 1LNSA 2EIEA 4E8DA 4XVHA 2W1UA 2VZVA 2VZQA 2VZUA 5DN2A 3HNYM 3WNPA 2J1UA 2WDBA 1W8NA 4XUTA 2W91A 3OBAA 3FHQA 4W4ZA 1XNAA 2ZEYA 2Y8KA 1JYVA 2E26A 2QQOA 1PMJX 3CZJA 4W50A 2JE8A 2VO5A 2WYSA 2VCCA 3NQHA 3CKHA
chains in the Genus database with same CATH superfamily
1QH6A 2Y34A 2QJVA 3TBDA 2XGXA 1AL23 1LOGA 5FZLA 1UZYA 2EAKA 1V0AA 2P3IA 1NT0A 4LK6A 4QDSA 1JZ7A 2YY1A 4C90A 4BQXA 1MZ6A 1ND3A 2D5FA 3FFQA 5KHJA 4PT6A 5JZGA 1VALA 2OZ6A 1L3JA 4Y26A 2N7GA 5JMOA 4XBLA 2DUPA 1WA4A 2GMPA 1LEMA 2HBUA 3KD4A 4FTBA 1UN1A 1VBA2 2AENA 4XFFA 2YYOA 3JQWA 3VDDC 2EA7A 2Y0OA 2VZTA 3MPPG 4XBQA 2FD8A 1BK1A 4UW5A 1DZRA 4XETA 5T52A 2G1MA 1SG3A 1KQRA 2V72A 4RHV3 4BQWA 2ZHMA 4OFGA 2OXBA 4QWNA 1H9PA 2GC3A 3O1VA 1SMVA 2RG4A 2QFEA 3DPRC 5E88A 2X5IB 1C28A 2YFUA 2BVVA 3ZFGC 1EYBA 4H7MA 1US2A 2PXJA 2XBO2 4U36A 4P5HA 5FP3A 4DUWA 5DUWA 1ZREA 1IPJA 1V9U2 3OF1A 5FYBA 1IS4A 5FRAA 1NCQC 4PHZA 3M2MA 2OPWA 1POQA 1V6IA 3JD71 5FKCA 1YXWA 5A80A 2JG9C 1SLCA 1AR83 1KS4A 1UU6A 2GC0A 2F4PA 4OMDA 4XABA 2R042 5FZ7A 1BLZA 2E31A 1NA1C 2B46X 1JUHA 1GWKA 3RZZA 5LATA 2IFRA 4NIAA 1J58A 1KJLA 2Y6KA 2VU9A 4JGYC 4QPIC 4XTPA 4CUBA 4E2SA 4LBMA 1TZOA 1OA4A 4XE9A 2GNMA 3BODA 4M00A 1LJ7A 1WMFA 4MVTA 3RZMA 4XHBA 4RS5B 3BTZA 4IDZA 3JBG2 1GOFA 2SLIA 4N9HA 3AL5A 3PMSA 2ZHNA 1UY3A 1VRH3 2BFUS 2E32A 2HYKA 4QDQA 1E5HA 1NLSA 1M4WA 5BNPB 1Q5OA 4YVWB 3E5QA 4WM8B 5C8CB 1QQP2 1SFYA 4HPKB 5DAWA 5BNQA 3VHPA 5IFPA 2W08A 1YQ2A 5BV6A 3AB0A 1AYN3 3AP5A 3RWKX 4AF9A 2JIGA 4K20A 1H6YA 1PVC2 4BZ4A 3KHCA 3RZGA 2WNEA 4D3WA 1XNDA 1GQGA 4DOUA 1G7YA 5C3SA 3IIIA 4YW6A 4I01A 1LOCA 2F17A 4PBOA 3SC7X 2GNDA 4D6QA 1X8MA 4AAPA 1YI7A 2GNBA 1TNFA 3F95A 3UESA 2ADDA 2KD7A 2VCMA 4GWJA 3IT8A 4I02A 1YFXA 4LE3A 4PBPA 5HCFA 4A7ZA 3TOJA 4CDXC 3SQOA 4AEKA 2P6HA 2DWRA 3NSTA 1LU2A 2VECA 5A7SA 3VKMA 1PO21 5GLTA 3ZN4A 2RS13 2HBTA 2JIJA 5CFCB 4NIHA 1C5HA 3FN9A 5FY8A 5A7QA 4AQ6A 5KBFA 2Z4FA 2QQWA 1A78A 2NQYA 2OA2A 1ZM1A 1DGRN 2WZR2 1RJ8A 4QD2A 4URTA 1OF3A 1K5MA 1MS5A 1NY71 5FPAA 3VZNA 5GZEA 2BERA 3KF3A 3BPZA 1YUDA 4MV2A 4KG8A 5JXJA 5ISLA 4N43A 3K51A 3UKTA 4NPRA 4BQ5A 1N1VA 2VZPA 1SLTA 1IS3A 4YGDA 3RZKA 1GSLA 3IIAA 4CCKA 5LA9A 1VBD2 3CHXA 3CJIA 5BPXA 2ZCWA 1LAJA 1Z0HA 3DYPA 5A6QA 3C7FA 3U07A 3WUDA 5I91A 3IDEA 1JZ2A 1OMIA 4YM1A 2WNOA 2V09A 4GAZA 5M0TA 4MZUA 4AI0A 5IW0A 1TQ5A 2UWAA 3FLTA 3AM2A 1OUXA 4YM3A 4W6XA 4IV1B 1AUYA 2C24A 5IT6A 3THDA 1CJPA 2W52A 4XUOA 1BEV3 2VOKA 1J84A 4IEYA 1UIJA 1XPWA 2RV9A 2ZAHA 2A73B 2ZGQA 4J1WA 2XXZA 4UFIA 5AVPA 1VBC1 4NVPA 3K3OA 4QQPA 1U5XA 3QH7A 2PHXA 4S2GA 4XJ9A 3AKTA 2BWAA 1AXYA 4JTNA 1HLCA 4A6SA 1TMF2 2Z42A 3DF0A 5DZEA 4K9SA 3PJYA 4BDVB 3FHAA 4HKLA 2RS52 2BYVE 4Q0VA 5FYUA 3CU7A 1BQPA 1S1AA 1CVNA 2RS33 3KM5A 5IK7A 1A8MA 3AMMA 1FV2A 4CTEA 3D8CA 1OHFA 1SCSA 3J8F1 4BH9A 2ATFA 2B5HA 4XXPA 5A1AA 2XL9A 3KB5A 1X9PA 2XUMA 3AKPA 5HV4A 2ZTNA 1ALYA 5KXDA 1YO8A 3AP7A 3I2FA 1RHI3 3B5LB 3IM0A 3KV9A 5IAXA 1NUKA 5C7GA 1Y3TA 3S30A 2QDNA 3BCWA 4LO6B 1W8TA 1ZZ9A 4Y20A 2VD7A 5C9AA 1QJU1 1XNTA 2EAAA 2VVFA 4YG3A 3ZKYA 4UW3A 1MS0A 3BALA 2SBAA 3KGZA 3WP5A 3U4SA 3MF9A 2J42A 2OZJA 1BZWA 4Q1PA 5BXXA 3AZWA 2XBO1 4JVAA 2VVEA 1R1A3 4N53B 1YCIA 4JHTA 4LIUA 1V9U1 2OQ7A 2GC1A 3AFGA 4QX1A 2ZMKA 1SLIA 2ZAAA 3I3EA 4CDWB 4D69A 1IPSA 1CAWA 2ENRA 2UU8A 3KT1A 5FZHA 3UETA 5LRSA 2FDJA 2DU0A 4CZSA 1RVF3 2BTVC 3V65A 2VQAA 4FFGA 4Y1XA 2R041 4NIDA 1HDKA 1W2OA 1RUH3 4IXLA 5LRRA 2ZX1A 4UW4A 1J1LA 3ES4A 2J1VA 1BYHA 1R093 3ILRA 1E5RA 5FP8A 3OUHA 1AL22 2BDRA 3HNBM 3VKLA 3KV4A 3K48A 1OQEA 4PIYA 5F1RA 5LBFA 1QH7A 3ZXJA 5DPNA 5IVBA 3MIEA 1RB8G 3FMGA 3AL6A 1W8UA 4QX0A 1OXCA 1YQ5A 2PLV1 2YC4A 1DQ4A 1QNYA 2EIDA 4OULA 5GLUA 3I49A 4AHZA 1W04A 4XBNA 1OF4A 4YW2A 4AGRA 3I2DA 1ND3C 5JZGC 5D1IA 4LK7A 4CVUA 1VIWB 1QQP1 2CU5A 1I6XA 4H3WA 3MV11 4C1WA 4L99A 4RHV2 5HCAA 2XVGA 4N7IA 4DQAA 2YB7A 4NJ4A 3ZX7A 4LTAA 5FZ1A 2ZX3A 4A2UA 3NMBA 5DAXA 3GHNA 2Q30A 4YG6A 1GBGA 2X09A 4AW7A 1GOHA 5IVVA 4QB2A 2NLRA 4MGQA 3V56A 5EYYA 4AEDB 5LEJA 4PIZA 4H55A 3G7DA 1I5ZA 3MIBA 4NHLA 1PMHX 1F8VA 2ZGKA 5J09A 4C1XA 3RYPA 4BMEA 2XDVA 1ENRA 5A6YA 4CCCA 1AR82 2E7AA 4MGSA 5GALA 2BP6A 2WA3A 1AR63 2RHPA 4YPJA 4CDUB 2X29A 5KC5A 3PLQA 2A6ZA 2Y0IA 4WVVA 3VL8A 2VBPA 4CCNA 4F7ZA 4XFIA 2IZWA 2WZR1 2GN7A 4GB33 5FXWA 3VDCA 5C4WB 4JKKA 1K42A 4XFBA 5KR7A 3HOBA 5FZMA 5FP7A 4MXWB 5IJRA 4ES8A 1RUG3 1OVPA 5FUIA 3PUIA 4QXHA 4Y1ZA 3M8LA 4XMIA 1YLLA 4LITA 3S6PA 1HN1A 3WF2A 3C7GA 3OY8A 3O14A 3IB3A 1VRH2 4XOGA 4V1PA 4ZONA 3WNOA 1NLRA 2JDMA 1W6PA 1GNZA 4YGBA 3BIWE 1LOAA 4N90A 1W6OA 4A6OA 2QQLA 5FYIA 3OOXA 5IVFA 2P2KA 2WR9A 1LCLA 1FATA 2IUWA 2R063 1AYN2 1RUC1 2VPVA 3I2KA 5GM0A 1JZ5A 2WNUA 1HQNA 4CEYA 3O0VA 1ZA7A 3AZZA 4BOWA 1UOBA 3LEMA 5FMOS 2WABA 4LHSA 4COUA 5H9SA 1XBFA 4AI9A 2P37A 1JHNA 1O91A 2HWF3 1KEXA 1TG7A 3FZ3A 4ZXKA 3T2QA 5K0UB 2Y6LA 3P3PA 4HSLA 3U0ZA 1VBB1 2BV4A 2ET7A 4NHMA 5CAZA 2VQTA 1UL9A 1ZBE1 5A6ZA 5FTTC 3CF6E 2YU2A 3K2OA 2RS12 5K4LA 1TMF1 2D44A 1EUTA 2Z69A 3H8OA 5KWRA 2IXLA 4HOOA 2YC2A 4QKNA 3OB8A 3DCQA 1D7PM 4BQ1A 2WA4A 3T2OA 3POIA 4LO5B 3H7JA 3RZLA 2EVXA 4IGQA 1Y4WA 2VCAA 4HMZA 5DUXA 5GZDA 3VBSA 4FPYA 1DYKA 2VUAA 1V6NA 2UY8A 5A33B 3O1PA 5DUVA 4FPGA 1JODA 2ZXQA 4CCMA 2HWE3 4XAEA 4EROA 1PGW1 1K5MC 4I0BA 5CKNA 2OX0A 3O0XA 3NNJA 3LEGA 1KDKA 4N43C 1H8TB 1W3XA 2ZPXA 3J4UH 3OEAA 4AVBA 3GJAA 5E16A 2Q8CA 5CG9A 1QJFA 3VKOA 1GP5A 3NV2A 3CJIC 3I8TA 1VR3A 3L2YA 5A70A 1DG6A 4CU6A 1OPOA 2GP3A 3Q8EA 4NOTA 2W46A 4B3NA 3U4XA 1PM7A 4RFRB 2DTYA 4J25A 4M3CB 2O0OA 3A22A 2OIIA 2WUHA 1PZ9A 4YZ5A 3RRDA 2H6CA 2XJTA 1OA2A 1N3PA 2QVSB 3MIGA 4WV8A 5FPBA 2Y6GA 2BGPA 1H8VA 2IXHA 4AOCA 3AYDA 3N4MA 3DYOA 5CIRA 1BMV2 2BGOA 3T0DA 2YC0A 2VGDA 2HWD3 2DU1A 5AC93 1GYKA 3DYMA 2B42B 1IG0A 1IS6A 4FTSA 2CHHA 4IGOA 4FOYA 1HRV3 1W6QB 2QQVA 1AL21 1G8WA 2RS32 2ZX0A 4CDUC 3O1SA 2BRTA 5FXZA 1UY2A 3I2HA 3EQEA 1NKGA 2X53S 3N9OA 4IE6A 4LLFA 3ZMNA 4BPZA 2UURA 4CUCA 4Y5TA 4Z2WA 1LHUA 1D4VB 5EV7A 3VGIA 2FZ2A 2EICA 1DHKB 1RHI2 1RUE3 5FZ8A 2D6NA 2VBDA 1VB4A 1Q8SA 4UYBA 1UPIA 1WW5A 4RR3A 4AGGA 2O1QA 4R9CA 4RGAA 1XJAA 4LORA 4CP9A 3I2JA 5A7WA 3N7KA 5JIUA 1SZBA 2XG3A 2JG8B 1SCRA 4YFZA 3M4FA 4RHV1 1TME3 3NKGA 1CAVB 4EQVA 1AYM1 2TBVA 4YYOA 3VZOA 1XNKA 4XUQA 1GP6A 4Y22B 2R0FA 3E6CC 4K40A 4TXWA 5AVAA 5GLVA 3O1OA 1D0HA 1R1A2 2AR6A 5C9AC 3ZVXA 4CCJA 4W6YA 4LKEA 1VPHA 5A3PA 5FDBA 3ZSEA 3ZFFB 3O7OA 2D6PA 3DN7A 1CAXA 2XKPA 2XVKA 5T5LA 5KXEA 3M7AA 1ST8A 1W6NA 2WZ8A 3DGTA 1RVF2 3IN9A 3O12A 1AR81 4QHZA 2Q1FA 1WLWA 4SBVA 5F6LB 2VE1A 4PDWA 4R4XA 1RUH2 3LA7A 4JGZA 3AMHA 2ZACA 2OYZA 1R092 3OD4A 4CUAA 2QDRA 3U11A 4E8DA 2K46A 2W1UA 2ERFA 1Z78A 3RJ2X 3BKZA 5DN2A 3C3VA 2IC1A 2I07B 2WDBA 2ZX2A 3WHUA 4B4RA 4C0HA 2CWMA 1W8NA 2DUQA 3KS7A 3JUUA 3E5UA 4DY5A 4QXBA 1XNAA 5JI7A 3WQ7A 1GZWB 1W8ZA 2YDEA 3H3LA 3OCPA 2UY9A 1IG3A 2ZEYA 1QY4A 4HN1A 1AYN1 5LBBA 1JYVA 3R05A 4O9EA 1H8TC 4PLOA 1RUNA 1MQTB 1NOVA 2LUWA 3HD8B 5C3RA 2WYSA 3GCXA 2Y33A 3NQHA 1W2TA 3WX5A 4Y4RA 4FXGB 2VUJA 2WBKA 4PQQA 2FDIA 2BNOA 4CA9A 4IE7A 2AACA 4KI5M 3WDYA 2B45X 5GZGA 3BTAA 2Q8DA 4Q4X3 2RS11 1DQ0A 2HEVF 4LBKA 4YRDA 2MNGA 2XQRA 3ZN6B 4QB1A 3VBRB 4C91A 1LHWA 1AR62 3Q9OA 3H8XA 3N9NA 1W9FA 4META 1CAUB 4K6BA 3K4DA 4UF0B 1QNWA 4WVWA 4JRAA 4HK9A 4YW4A 3T0AA 2JICA 4GB32 2WWSA 1NCRA 2ETEA 3Q8AA 4COZA 2NYYA 1IQAA 5LBEA 4D0QA 1RUG2 1GANA 5K9YA 4C8DA 2XJVA 4FOQA 3KSCA 4XF3A 1BXHA 2HWB3 1RUI3 3ZYBA 4CU8A 4Q1RA 4U2AA 2VZRA 4E2QA 2ADEA 1FOD3 3HAGA 5IVCA 3ZFEB 3A0KA 3ACFA 5T55A 3APBA 2R062 5FZOB 2ES3A 5FYHA 2WWUA 4Y24A 1O5LA 2VZOA 5IAVA 2BFUL 1LGCA 2I74A 5FY4A 5FJHA 2WJSA 1POV3 5GKAC 1QXPA 1BEV1 2HWF2 3WUCA 5HI0A 1HW5A 1MZ5A 2CGNA 1WCQA 1GZTA 1S0EA 4K8FA 5BY5A 5KXCA 1O7FA 1S2BA 4J6GA 2RJLA 2WNUC 4CEYC 2A7AA 2TNFA 3MLKA 1V6JA 2DTWA 1WCSA 3PUHA 1UY0A 2A1XA 1BMV1 3B9IA 2JJ6A 1EV13 2JDZA 2P3JA 2Q0AA 2KXLA 2DVAA 2R6QA 5A3NA 3GM8A 2CAVA 1LOFA 2X5IA 1UAIA 1ULDA 5CKQA 3UGGA 4AI2A 3H50A 2LALA 1G9AA 2RS31 4OUSA 1ZNPA 2BUKA 1LKNA 4BIFA 4E9KA 1D4M1 1KFUL 2QCSB 1PMIA 4K3UA 3WCRA 3TYJA 3N7JA 1FPN3 4RA0A 5FYYA 3SCGA 2VMHA 5HXMA 2HWE2 4IEWA 1LRHA 3VBHB 1RHI1 1WCDJ 2C9KA 3H1WA 4M01A 3FBYA 5FP9A 5SV8A 1X9TA 3VBSC 2B9VA 4NWVA 2YBSA 1OFSA 4QKFA 3ZXEA 3Q8BA 2Q4SA 2WWJA 2ZGTA 3MIFA 1RITA 2CNAA 5FMCA 4A7KA 5FO8B 1WA6X 1NYWA 2XJQA 4E4ZA 5JOZA 4JX0A 1MS1A 5FO7B 1AF9A 5L73A 4CP0A 3DKQA 5FZ0A 3MDPA 2NMOA 2YROA 5FLJA 5JVVA 4RS5A 2PHTA 4GH4B 3WP6A 2WS93 1H0BA 5IWFA 1O3SA 5JSOA 3J26N 5DQ0A 1R1A1 3HT1A 4AI1A 3P6BA 1PO13 1QMJA 3HPNA 1LR5A 3QACA 4P00B 5BNPA 3AXDA 2VNVA 4YVWA 4WM8A 5FP4A 5FY7A 4CE8A 1DQ2A 4HPKA 4N7UA 5C8CA 4IERA 4OLLA 1ZRCA 1BBT3 2HLEA 2KR2A 1RVF1 1KXGA 3RWNA 4BQ2A 1LOEA 3K4AA 3GDBA 2HWD2 1HJGA 3MO4A 1RUH1 5AC92 1QDCA 4LKSA 3NJVA 2VC9A 4UFKA 1HRV2 1S0DA 3VBRC 3ETPA 3OGVA 5B4XA 2J1RA 3ZR6A 3P3NA 2RM23 2AH2A 4MOAA 3LD8A 1S55A 1PIV3 1CGPA 5F6KA 4QKBA 3WNXA 5LA1A 5JMCA 3LDKA 1QXRA 3OGJA 2HKXA 5FYCA 3HVDA 1RUE2 4CP1A 3OG2A 5CFCA 4XZUG 5ANNA 2IWGB 3POSA 3RYKA 4ATEA 2EF6A 2O8OA 3IPVB 4LPLA 4JZRA 1SLBA 4Q2FA 1MPXA 3NNFA 2Q1MA 5T5PA 4QX2A 3OGRA 3ZFEC 1TME2 2EXIA 4KNCA 4QM8A 2G9FA 4RR3C 4EYUA 5CEHA 4GZ9A 1FI2A 1AHSA 2WLPA 3WCSA 5CFDB 2E9QA 2R071 3AVSA 4R52A 3AXEA 3UV9A 1DLCA 4B4PA 2PYTA 5E6HA 4FPCA 1J59A 3UNPA 2VBBA 1C5IA 3FL7A 3TNPB 2DDUA 1WW6A 1R083 5A3OA 4OI0A 4NRPA 4QU1A 5FYMA 1EP0A 2YFZA 4Q4Y3 3UJQA 4AFAA 2JKXA 3FUOA 4FFIA 4UI9L 5FZBA 5F5CA 3LA3A 5JIAA 1Y9QA 2VW0A 1XOYA 2D6KA 4GA9A 5IHRA 1NX9A 2BQPA 4EN8B 3GALA 4QPYA 1AR61 1ONAA 3E6BA 3HWJA 3WP3A 1ZZ6A 2YU1A 4XJ8A 4GB31 2GP5A 2NN8A 5DDJ3 1AX2A 2CL2A 3BOWA 1XYNA 3LB9A 2LW8A 4PDWC 2Q8OA 2E7QA 4FCAA 1OI6A 1SFPA 4JGZC 2JWPA 5FZFA 1JOJA 3SH3A 1JYXA 4LBNA 4NMIA 2WFPA 3PU3A 2WRAA 1OD5A 1CX4A 1O59A 5GJ6A 1JYCA 3D3AA 1PGL2 1YEWA 4XILA 4IGPA 4AVCA 2R061 2VTXA 1U0AA 2OQ6A 3IMNA 3T09A 1PZ7A 1FX5A 3FLRA 1VAKA 1JYNA 3VL9A 3D82A 4WM7B 3ZSLA 2EXHA 4PCRA 3JB8A 1UMZA 1SHWB 3MF6A 5FMBA 2X8KA 4AAXA 2HWF1 2ZGUA 1AXKA 1WMEA 1XYOA 2D3SA 2CDPA 4QQLA 4GH4C 2ZKNA 1WWYA 4MGZE 4MO3M 4Y33A 2YG0A 4JQRA 3ZIWA 2ZGLA 4AVAA 4Q4X2 1RUJ3 2CWSA 5LY2A 3RPQA 1HXS3 5LW9A 4UXAA 3HQXA 3LOIA 5HPOA 4XUPA 4N53A 5A32B 1STMA 5LA0A 3BGAA 2QNKA 1MVQA 4LT5A 4GD4A 4CDWA 2BGCA 3PIJA 5LASA 2WFF3 2HWB2 1DU3D 1RUI2 1FNZA 1EY2A 2HWE1 1HB2A 3L9JT 4YZ4A 4DMIA 2C6SA 1JXNA 2GN3A 1DYPA 3MUZ1 2R16A 4DS0A 1NCRC 3BPSA 4IE5A 1FOD2 3AZYA 1LECA 5EIYB 3IDBB 2HWC1 4Y1UA 5F3GA 4OHVA 4D7YA 1W9SA 5L9RA 2UWBA 4FFHA 1F5FA 2FBEA 2VR4A 5GLWA 5C71A 5ACA1 4XJZA 5DXDA 2PMWB 3UKVA 4AE2A 1PVXA 3JZVA 4NRMA 3IWZA 4NUBA 4FQZA 1DGWA 1OH4A 4ZZ5A 3WEZA 5EFUA 3T30A 2ZZJA 2HEYF 3MI8A 1C8M3 1BKZA 4CCOA 5FZEA 3T1LA 4TYSA 5CFDC 1PHMA 3POGA 1ULPA 1AZDA 1T2XA 3THCA 4DY3A 5JR2A 4S2HA 4KWUA 1UMHA 3ABZA 5FMOL 1L7QA 2YHJA 2VQUA 1EV12 2WNVB 3VN4A 1K12A 5JXGA 4DINB 2H0BA 1CPMA 1ZRDA 4ZKTB 4XJAA 2ARBA 1SACA 5AC91 5BNOB 3PTRB 4UBGA 5DAQA 3K46A 3USUB 4FP2A 1HRV1 2YUEA 3ZYJB 1Y7BA 3KZ4C 4RFT0 4QKDA 2PELA 1KGYA 4IUGA 1LOFC 1FPN2 3PL0A 5CVRA 4AG4A 2X5IC 3CDZB 5FZDA 1H2NA 3OSDA 4QX8A 4XQWA 1CIYA 1UO9A 4CDUA 4AQSA 3CNAA 2B9UA 3RJRA 5FFOC 5K8SA 5FOJB 3GCWA 5C4WA 2PAEA 4INDA 3BVCA 1A34A 1ULCA 3D6EA 4AVVA 1TME1 3OUIA 4MXWA 3WG3A 3LOBA 2GAUA 4ES9A 4GQ7A 4DEVA 3H8RA 1RUD3 4EN7B 2GNTA 2WS92 4MG2A 3NRUA 1GU3A 2P6CA 4UBHA 5EP9A 5JAXA 3AKQA 2XJRA 2WYFA 5CB7A 1BJQA 4X8NA 1VAVA 1PO12 2B7YA 2QQPA 1CD3G 4E2GA 2P17A 4Q5OA 1VBA1 2RR13 1UZ0A 4RS5C 1BBT2 5FY1A 1SLAA 4XMAA 3VKNA 3NV3A 4KG0A 1W8OA 4QXKA 1JTZX 1WW4A 4JTOA 4RSUA 3OBTA 4M4PA 5E8AA 5BNPC 5HCHA 1SBFA 4YVWC 4WM8C 5C8CC 4YSFA 1WCKA 2WZEA 2D97A 4MHRA 4D94A 2DURA 4ZS2A 1SBDA 1F2NA 2RM22 1IHMA 1DIWA 3AFKA 3EBRA 4P9XA 4P9GA 4ITCA 4PLMA 4JQTA 3R4SA 1PIV2 2ZMLA 4EJRA 4MGTA 1HRI2 1FNYA 1GUIA 1GZ9A 2ORXA 2B8MA 4GKYA 1O3TA 1W8WA 1HX6A 2J1SA 1W6MB 3OGGA 4XURA 5JXIA 2W1WA 1PGL1 3IZOA 1HKDA 3MFAA 4BYYA 4K21A 4ASMB 1LB2A 5CFCC 1XE8A 1RMU3 4A4AA 2RVAA 1JZ6A 1W39A 2GZWA 2ZHKA 3NL1A 5D2AA 5A33A 3A23A 4A42A 3VBFB 1J1TA 3MW4A 3I7DA 1B09A 1UIKA 3AYAA 1NE6A 4MUVA 2XJPA 3IDAA 4M0HA 1CZTA 2VMCA 3JBG1 4Q27A 4QGLA 4OHYA 2D93A 3SITA 1R082 1CPNA 1SPPB 4XQ4A 3VZKA 1QJEA 3IKWA 5CU1A 1H8TA 1VJ2A 5TSWA 4Q4Y2 2WAAA 4XTMA 3WNLA 2V5YA 2XUEA 3RFRA 4YLZA 4QGNA 1GNHA 1YHFA 4G4FA 3I2OA 1WLDA 4PI2A 1PVC1 4IEXA 2WNVC 4CPBD 2Y6JA 4GJYA 4AK3A 4M3CA 5LK7B 2JDAA 1XRUA 2PHWA 4IW3A 5DDJ2 1KD7A 5BNOC 3GXUA 1PNFA 4XIKA 4IV1C 4LBQB 3POEA 3I3BA 3ON7A 5T5JA 1E5IA 2HWB1 1RUI1 1OKQA 3NV4A 4OHXA 5FJKA 2OW4A 5T50A 3WINE 4BLJA 3K75B 4GXLA 1MS8A 3ASIA 2F6BA 1FOD1 5F3EA 3HQRA 3OGSA 4COWA 5AFEA 2CV6A 3PJQA 3CLPA 1Z7S3 3WP4A 5FPUA 3NJXA 1W6QA 4BA6A 1ULFA 3J7HA 2Z2SB 2A6WA 2XJSA 4XF9A 3NWKA 1W99A 5FIXA 4ZU4A 2H6BA 4XXAA 3N9PA 4QPWA 4FPJA 1ULGA 1K5JA 3MICA 3G6JB 4HT1T 4MXVA 3WDXA 1WZXA 5IATA 2WKKA 4OI1A 3BTYA 1LOBA 1OLME 4YVSB 2IVIB 4IV3B 1RJ7A 3M3CA 3I59B 4DRRA 3LSEA 4V2VA 2CTVA 1LNSA 1VBD1 2VUDA 3ZDSA 2JG8A 3FBMA 3VBOB 2VZVA 3AZVA 1RUJ2 5FY0A 1CAVA 1HXS2 2YBPA 3DXUA 2DVFA 2J1UA 4I30A 1RL3A 2JX9A 4Y22A 2VULA 3TN93 4LKDA 1WD3A 3MYXA 3C2UA 5AFBA 4AQTA 4XDPA 2IVJA 3GBWA 2RDSA 4WZCA 4HXCA 3ZFFA 2G9ZA 5A3WA 1QJZA 2BEOA 2UWCA 3OJBA 4B4QA 5FO9B 3ME2A 2BNMA 3LF7A 4DB5A 2WFF2 4FOWA 1YQ8A 1PMJX 4WVMB 2JE8A 1PZ8A 4N53C 3BYWA 2PA7A 5FYZA 3DUIA 2O8QA 4XF1A 4L2NA 2B39A 4TLGA 4XQDA 4CDWC 1Y43B 3WDWA 3B93A 2D3RA 1PX3A 1XXNA 4ATFA 5JDBA 1GWLA 4LLOA 3SKJE 3ZXDA 4OHZA 4CU7A 2RS51 1MR5A 2JXAA 3GGLA 1EUUA 5KHHA 5C33A 3HNMA 1QWRA 3T08A 5ABJB 1DDLA 2WO2A 1O8PA 4DFSA 3O1UA 1Q56A 1BVVA 4CSWA 2WS91 3FWEA 1J83A 3IBMA 3LFIA 1C8M2 4RQPB 3U14A 4AGVA 4CEWB 2GC2A 1NQJA 2XWBB 4P14A 4AHYA 1PO11 1X8EA 4K1ZA 1GWMA 2W94A 1OSGA 1XE0A 3SEEA 5A7PA 1GZWA 3IAPA 4YWAA 1BBT1 3MGUA 3VD5A 1QEXA 2AGSA 1GV9A 1ODMA 2DCZA 3R4UA 4CXYA 4L0PA 2W87A 1YIFA 3NVCA 3X29B 1YQ6A 2DCYA 1UXXX 5GLZA 1MQTA 4AVTA 4W8JA 4ASKA 5F39A 3V0BB 1G9FA 1LULA 3SCFA 1PK6B 2ZKLA 4LE4A 3R6SA 3GF6A 2WLQA 3T4VA 3OUJA 2RM21 1HB3A 3MPBA 4Q4V3 1JOPA 1PIV1 1WCUA 4UFHA 3THTA 3AMQA 2VOVA 3VHRA 5FPXA 1P8JA 4TSVA 2P34A 2ZABA 2CSGA 5F2SA 3AP9A 1UMIA 4HZFA 5JSRA 3VBRA 4D7TA 4AEDC 2Y26A 3RMXA 3TEZA 5JXHA 1QXJA 4Y5Z0 1X82A 2ARXA 5FY5A 5FXXA 1CAUA 4UF0A 4LBQD 4FBFA 3M3IA 1DBNA 4PF1A 1BHGA 2QQIA 3ILFA 4EWAA 4SLIA 3WOGA 1WLCA 3RVHA 3NV1A 4OI4A 4TWTA 5E1RA 2WO3A 3CEWA 3Q8FA 4FPHA 2P4EA 4CCLA 5H9RA 1RUD2 1G9BA 2PHFA 3POWA 5CZKA 1Q8OA 5C4WC 3I3MA 3FHIB 2BOJA 4P5YA 3ZFEA 4OMCA 1GQHA 4ET7A 2RR12 4Q4Y1 3T3YA 1DFQA 1PGSA 4BWOA 3PU8A 5FZOA 4ZZ8A 2XL7A 3GJBA 5LY1A 1O5UA 3VBUB 5FY9A 2TEPA 1UYYA 1W28A 3VBOC 4NAMA 4XCAA 3FE5A 3I2IA 1EAH3 1OVSA 2LTNA 1GNYA 3PVNA 2FCTA 2DVGA 1GOGA 3J9SA 4FFFA 4QQ2A 3I3DA 5KC6A 2ZMNA 4KMQA 5I8YA 3U10A 1MS4A 1DYOA 5DDJ1 1ENXA 1W2UA 3HQUA 4FPOB 3N9LA 4P9JA 1UQXA 1V6LA 4I0AA 3BOPA 3H3UA 4P9IA 1HV0A 1VBC3 3WG1A 3WW4A 2MEV3 2WSVA 1G9DA 4XFCA 4QU2A 4YG0A 1AX1A 2XVLA 4XCBA 2BNNA 3JU9A 3MUY1 5K0UC 3LKJA 4L97A 3OTFA 1K45A 3THPA 4NE9A 3AX4A 4IEPA 4XUNA 1DGLA 3E5XA 5F3IA 5FUNA 5J98B 1RXGA 5FLIA 5J96B 3V64A 1RMU2 2VOXA 5ERLA 3ZYFA 4KWKA 3FC0A 3DECA 4ZU7A 2TUNA 1D2QA 2EALA 3WY6A 3DV8A 4GWMA 3QD6A 5J37A 2A6VA 3QOPA 3VBHA 2ET1A 2XKOA 4Q8KA 1GZCA 4S2FA 4DXSA 3P5BA 5IVEA 3ACHA 4RQPC 1U5YA 3ZIXA 5A3LA 4L9BA 1CR7A 1UZWA 1VRH1 4R9AA 4O7XA 2FQPA 4DO0A 1H1MA 3OPZA 2DVBA 4LKFA 1QJU3 3H0OA 2XLFA 1UKGA 4LO8A 5FZGA 3USSA 2EXKA 4D7SA 2ZGSA 1DZQA 5DZFA 1XU2A 1ZZCA 3LAGA 2JDNA 4CDQB 1Y9GA 4GH4A 1N3OA 1SDWA 4YW7A 2FDKA 1NAEA 2QQNA 4RGGA 2R30A 3O1TA 1XNCA 4CCEA 2JDYA 2IXIA 3WW1A 2P5BA 1S0GA 2E53A 3NKTA 4TTGA 1CZVA 4GJZA 1OOPB 1ULOA 4XHXA 3ITQA 3KT7A 1UZZA 2XH6A 1SBEA 4P9YA 1T6BX 3ZN5A 4BK4A 1CN1A 3K3NA 5L7OB 4OYUA 1ZYBA 5EWSA 4AFDA 1O8SA 3NJYA 1Z7S2 1QHDA 2VM9A 4GIQA 1CONA 4D6RA 1S2EA 1NXD1 3WV6A 5C5UA 2AEZA 4KGQA 2DBNA 3S57A 3QLQA 3UGFA 1W8FA 1DQ1A 2CGOA 5DAVA 5LCWL 1E5SA 2CY6A 5L9VA 3T0BA 4BLIA 5A1FA 4YW5A 1UU5A 5FZ4A 4A44A 3JQXA 4CRQA 4AWDA 2PLV3 1C8M1 1PM4A 1H6XA 1QJX3 3B9CA 3ELNA 3I97A 2XONA 2QZ2A 2YZ4A 2VTFA 1MEC3 1S0IA 3GZAA 1QF3A 3H8UA 3IPVA 4ISQA 3W9AA 1W3VA 1BK0A 2F4LA 3N3HA 5KXBA 2QZ3A 2D6MA 1CESA 2Y64A 5JR7B 1UYPA 3O1RA 5G05L 5F3CA 3C8XA 5CFDA 3ECQA 3ALQA 1CIWA 1JYTA 2YGMA 3TN92 2JG8C 1AR93 4LO4B 4QX5A 4ZXEA 4E4DX 1XQNA 4WVZA 2OVUA 1NXMA 4XPVA 4AFCA 4E8CA 2K9ZA 2A71A 1MS9A 1BCXA 4Y1VA 5LB6A 5FWJA 1COV3 2KA3A 3BTXA 4DXZA 4LOTA 2GH8A 5ANQA 3D0SA 1H4HA 2YGLA 3VD9A 4GALA 2WINB 1G6NA 2GU9A 1A6CA 1JMUB 1WBLA 1ZZ7A 2JDHA 2VCBA 1KS5A 2VNGA 3LPFA 3OPWA 4LHLA 3WNNA 3ZFFC 3CQOA 3KT4A 3OBZA 4Q4W3 3OD0A 1MZEA 1NZIA 1W06A 1TEIA 3B00A 3POYA 4MYEA 1JZ4A 3KCCA 3S7IA 4XYXA 1RGSA 1YFYA 2KM2A 3B7MA 2RJ2A 5EXOA 4JV4A 1VRBA 2D40A 4HK8A 1A8DA 1V6OA 4H14A 4AEMA 2VTXJ 1L7LA 2ZEXA 4O9GA 3VDDB 1UW8A 2GSYA 2R1BA 3GNEA 1CZSA 1MVEA 4LMFA 2W0XA 5FBZA 4FP3A 5H9QA 4B7EA 3N7MA 2J22A 1RTVA 2OS2A 2RR11 5BNNB 2YV8A 5JOXA 3IDCB 4W65A 5D8AB 2RMU3 3M3QA 3ZYRA 4EN0A 1RUC3 1F4HA 2C0ZA 3A0NA 3DPRB 3SCHA 4WM7A 4A45A 3ZFGB 4AEJA 1UOFA 1S0CA 3HT2A 1NZCA 1W9YA 1V00A 4MGYE 3ZPOA 1W03A 4QDRA 3AJYA 1VMFA 3RS6A 3WW3A 1IPKA 1NCQB 5FOBB 3H1MA 3JCIA 4JKMA 3RYRA 3CBNA 4Q4V2 1UX6A 4DUVA 4URAA 2JG9B 1MQTC 5GZCA 1VBB3 2XOMA 5LZ6A 2ZJCA 4R4ZA 3AC0A 4XF4A 5LWBA 1ZBE3 5HV0A 3TAYA 3GZTB 1ZX5A 2VG9A 1NA1B 1IS5A 2BPA2 4XW3A 2NZ9A 4HBNA 3WF1A 1W2AX 2PFWA 3TEWA 1OKOA 4JGYB 3WQBA 1F35A 1LODA 1O4YA 4QPIB 5A32A 2VMIA 2D43A 3R0RA 1NY72 1HN0A 1R091 2AC1A 3GBGA 1RMU1 4KL1A 1NE4A 5C3QA 1L7RA 4M0NA 3ZSKA 2VOWA 1Q8QA 5LEKA 1LHOA 1HRI3 1WGPA 2K0GA 1PX4A 1WMXA 3J7MA 3HJRA 2WT0A 3OBRA 4M4RA 4NAOA 4BHPA 5F7UA 3TEYA 3AKSA 4F83A 4CP2A 5T3NA 4RN5A 4UOJA 4COVA 2E33A 2WAOA 3ZYPA 4IESA 5IYYA 2E7TA 2W39A 2WT1A 3EJKA 2I45A 2XMLA 1JN2P 1UU4A 4Q0UA 5FYVA 2QE3A 1F31A 4YGCA 4DXTA 5FR3A 1EAH2 4LBLA 3TEXA 3WDTA 2WC2A 5T54A 4D6SA 4CDXB 2JECA 5IVYA 5F32A 1HQWA 4LUKA 1FAYA 4G3YC 4DIQA 1Q43A 2ZZQA 3PVOA 4UFLA 1HB1A 3WVJA 4CPBA 1VBC2 3FFZA 4UWDA 2MEV2 1DGWX 2QQUA 3FX3A 4Q0QA 4QX7A 2JE7A 1AR73 4XDOA 3SKVA 4AZZA 5BYNA 5C6CA 3VKFC 2WNVA 4HG6B 2RE9A 4OI2A 4QPGB 1ASJ3 3KVAA 4DXRA 1AXZA 4HKOA 5BNOA 1Z7S1 3FUQA 2W47A 2EXJA 3USUA 3ZDVA 2VL4A 4IV1A 5FK8A 3VLBB 5JLVA 4UW6A 5IFTA 4COYA 2Y6HA 2W95A 4BK5A 3J8F2 4LOSA 5J1XA 5IVJA 5IK4A 3LE0A 1FV3A 1OQ1A 1C3HA 3KVBA 1RUG1 2R0HA 1VB2A 2PHLA 5FZCA 5C70A 3WG2A 2LROA 2C9AA 2P1BA 1C1FA 4CU9A 5FZKA 3LQCA 5F9TA 1OA3A 2DFCA 2Q5TA 2RJKA 4YW1A 1URXA 2AYHA 1LGNA 3R4DB 4DRVA 4E4HA 1CX1A 4L11A 1OLMA 1U5ZA 2ZHLA 1I9RA 1WBFA 3LZZA 4HVOA 1B35B 1QJU2 4IEUA 1GR3A 2GH2A 5LBCA 2ZEWA 5FQ0B 3T4HB 4E4SA 5BNNC 1AYM3 5F2WA 3W21A 5L19A 3M3OA 4P9LA 5D8AC 4ARYA 2JD4A 3M3EA 4AXOA 1N1SA 1OD3A 1RYYA 5EJ1B 1JOBA 3A21A 3CL1A 3MHZA 5EPAA 3NNMA 4BMBA 3TN91 1JHJA 3N36A 3ACLA 3D4KA 3OYWB 1ZBA3 3NAPB 2GMEA 3VZLA 1DGRA 3AP6A 3K77A 4N9IA 5DAPA 3RGBA 3PVEA 3PVBB 3UJOA 3ZXAC 3LFMA 1BVP1 5J48A 3HBZA 4IE0A 4EZHA 3JXSA 1DLLA 2WN2A 2B4KA 3ZYGA 3V0AB 1S4CA 4YGEA 3RG0A 4Y4YA 3K4ZA 2Q8EA 2MPFA 4GMP3 2AZ5A 3MFCA 3NNGA 4Q26A 1UOJA 2FMDA 4HN0A 1DCSA 1T6GC 2JD9A 4BISA 1KITA 3ZXLA 1UYZA 4WZFA 5CG8A 3U37A 1V6MA 1OC1A 5A3TA 4OQ9A 2X10A 3VV1A 2PLV2 1QJX2 3C7OA 1W6MA 5JWPA 1MEC2 2UYBA 1H2MA 5A7OA 3TNQA 3WQ0A 1APNA 1XNBA 3PNAA 1QOOA 4JDNA 3RNSA 3ZLIA 1GLHA 2VZ1A 4K1YA 4L92A 3S5AA 2ARAA 1JS9A 1XB9A 2ZGRA 4B7KA 1DF0A 4Z1VA 2ZA9A 5FZ9A 4IETA 4HL0A 2IFWA 4MADA 4QAWA 4AFBA 3O1MA 3VBFA 1V70A 1UNBA 2Z5WA 2AEYA 3C7EA 4IE4A 2YPJA 1IQDC 3WDUA 4IEOA 5F37A 4HFSA 1G86A 1GMMA 1AR92 4A41A 3HN1A 3H42B 3QBQA 3UGHA 1KRIA 1O4TA 2YXSA 2GDFA 1SPPA 4Q4V1 3NJZA 2FDHA 3ZOIA 2FMYA 1YYNA 4AQ2A 2W92A 2FDGA 1X33A 1J3QA 1JUIA 1COV2 4DNYA 1Y9MA 5D21A 4BXFA 3FLPA 1WLTA 5FUPA 3LGRA 5JUVA 1JZ8A 1J3RA 2VH9A 1WKYA 5FZIA 5FKBA 1ND2B 3B01A 3MLJA 3PHMA 4MGIE 3SH5A 3TRSB 1QOTA 5JOWA 2HWD1 2G9GA 4Q4W2 1ZA4A 4QPGC 1ENSA 4AFMA 1DZTA 2ORZA 1X50A 2EIEA 5F8PA 1ZZ8A 3L2HA 4LBQA 1REDA 4AEDA 5J7MA 2VZQA 3LSDA 3HNYM 1ND3B 2VW2A 5JZGB 5KHGA 3N9MA 4RGKA 4ZU5A 1RUE1 3OBAA 4YM0A 4Z8BA 2WT2A 4B8EA 4FTEA 2JEMA 5FPZA 4LBJA 2D7FA 2R1DA 2RMU2 4QQHA 3HR9A 1RUC2 3KLSA 4AVSA 2H0VA 1POV0 5FK7A 4FQ4A 4W50A 3CZJA 1B35C 1EAH1 2PN5A 4KWLA 3KMHA 3ZSJA 1H2LA 3UT0A 1QKQA 2VCCA 4MGKE 3CKHA 1LEDA 4IV3A 4UFMA 4YVSA 3I59A 4JDOA 4LULA 2DYCA 4NR1A 4WM7C 3VZJA 4CCDA 2NP0A 1ACCA 3I2GA 1C57A 1VBB2 1HJFA 2MEV1 2W9XA 3WLUA 4ARXA 1RUOA 3VBOA 4HSJA 3NAPC 4XJWA 5FREA 1W05A 1ZBE2 1LTEA 3AJZA 5CISA 3QCWA 3WF0A 3SNMA 3DKWA 3SXWA 1C8NA 1SLLA 3ZYIB 2VY0A 2O14A 4IQPA 1IOAA 1S0FA 3C7HA 5HBAA 5G04L 2XPJA 3POFA 4X8PA 3SH4A 5EHDA 4O61A 4FT8A 1D4M3 2JKBA 3ZKUA 1UY4A 4FOVA 1M06G 2WSUA 2EIBA 3CJXA 1UD1A 4YW3A 1CJDA 4WVMA 2P3YA 1W0OA 1PGW2 1N47A 4I3GA 3U75A 1OBNA 4QT6A 1LENA 3NW4A 1I1EA 1XSRA 4XDQA 1YFUA 1UYXA 4OUEA 2CDOA 2LM3A 5FZ6A 2ILMA 2R7EB 3RSJA 1EPZA 3CO2A 5FV3A 4G9SB 3TB0A 3WSOA 5C3PA 5ABJA 1VE0A 3B69A 4HANA 1UWWA 3EHKA 3E6DA 3LEIA 4QMAA 2BWCA 3GYDA 4FVVA 4OZXA 2FCVA 4CEWA 1KDMA 4RQPA 1OURA 1N1YA 2A3WA 2QQKA 3VUOA 3ETQA 2E51A 4QXCA 4HLTA 3SMHA 3HMYA 2IXJA 2DCTA 2DV9A 5KHKA 4K8RB 1VBE3 4NHXA 1G9CA 4L8QA 4MLOA 1AR72 1YC61 3KF5A 4R9DA 3VDAA 3LA2A 4B29A 4XACA 5A1LA 1R1ZA 4GKXA 1H9WA 1IGOA 1YFWA 1FMD3 4UFJA 1ASJ2 3POJA 3KQRA 4Q4X1 1OQDA 5CNAA 3V0BA 2YBKA 4OUMA 3RMYA 4ZHNA 1H2KA 1PK6A 2E6VA 1RUF3 3VD3A 3ES1A 3LPGA 1ND2C 3KV6A 4EZ4A 1JZ3A 1W9WA 1CQ9A 1W9TA 1I5PA 4Z07A 3S5QA 3GZUC 4ONUA 5L36A 1YIPA 1QJY3 1K5MB 5J3UA 1S2KA 1YRZA 3I4IA 2ZGPA 1QJX1 3AYCA 1ZVFA 2J1AA 4KU7A 4AR2A 1Q3EA 1XU1A 4N43B 1LGBA 5FYTA 1MEC1 2VVDA 2BW8A 2A6YA 3W5MA 1CWPA 3PIGA 4KQ7A 2C26A 4LR4A 1D0GA 3CJIB 2XHKA 1VLNA 3EYPA 3H1YA 4QHBA 4D8MA 3VD4A 1DQ5A 3W20A 2VMDA 4PJYA 3WNKA 5A7NA 5CBLA 4HVRA 2Y38A 2PHRA 1AYM2 4PI0A 4BQ4A 5FZ3A 1UF2C 4JDMA 2R073 2NMNA 2VZ3A 1OPMA 2HJIA 4GWNA 4P08A 1AR91 3UKNA 4FPEA 3AYEA 1J3PA 4AHXA 1ZBA2 1POV1 1IKPA 3RZHA 3ATGA 3ZR5A 3LIHA 4ZS3A 2XWJB 4KBZA 1COV1 1O4ZA 2XHNA 4KU8A 4LUMA 1UX7A 4FAHA 3ZO0B 1F15A 1YNAA 4LO7A 3P1IA 4TLFA 2R49A 4EE2A 2IXCA 3VBUA 1TVGA 2DVDA 4YNIA 3CZUA 1XYPA 2D6LX 1W8HA 2VNRA 2HH9A 1EV11 1UXZA 3MIHA 3MW3A 3ZXKA 4Q8LA 4R9BA 4Q4W1 2NPIA 4KBBA 3PUAA 2J1EA 4X6QB 5DG2A 4P9WA 1HIXA 3CMGA 3UYJA 1ZRRA 4YZ1A 5FXVA 1LHNA 2I2SA 1HQLA 4OCTA 4XEZA 4JCKA 4LJHA 2Y6FA 3ZM8A 3WD5A 4BQ3A 5LA2A 1FPN1 4LNVA 3AMNA 1YI9A 4RL7A 2WN3A 3JD73 4LHKA 5F5IA 3ZMOA 4PQ9A 3AK0A 4XFHA 1A3KA 2VQ0A 3MEPA 5JCTA 5IUQA 4JKLA 4JRLA 3H7YA 2RMU1 1W0NA 5SV5A 3WDVA 4YARA 1UPSA 4OQ8A 1VMJA 4A3XA 4Y20B 4TN7A 1UOGA 4XIOA 1IKQA 3RDIA 4TZDA 3ACGA 3URFA 1VAMA 1FT9A 3MV01 5C9AB 3MZHA 2W1SA 1IZ3A 4S2DA 4JHZA 3S7EA 1XC6A 3LDBA 3BN6A 2PHUA 4MHUA 2CYFA 4M3CF 3H3ZA 4GMP0 2L9LA 3SHRA 3ST7A 5C5TA 3T2PA 2D98A 4PLNA 2PQSA 1HV1A 2ZGNA 3VBFC 4AHWA 3VB9A 1E57A 5I8TA 3ZSMA 1JH5A 4FPKA 4IEQA 4NROA 1CAWB 3WG4A 2VW1A 1U12A 4CDQA 2V4AA 4NHKA 4OVEA 3AKRA 4MH0E 4LXLA 5FPLA 1RINA 1JBCA 1LHVA 4FO9A 4MSVA 3T1MA 4HETA 5I0SA 1JYIA 3POBA 2FDFA 3BU0A 3KGLA 1LU1A 1REFA 4E27A 2ZGOA 4AYUA 2W5FA 5JOYA 1PNGA 2DUOA 1ULEA 1WMDA 3EB7A 1X36A 1OOPA 2G19A 2JB8A 3RI8A 1OT5A 2RDRA 1HRI1 1W0PA 5K7PA 3WT3A 2W2IA 5L7OA 2VXJA 4BE3A 3ZN6A 3ZYHA 3BI3A 3ENRA 1PO23 2W68A 1MZFA 2HWC3 2W3JA 4IL7A 2AREA 2OPKA 1SFNA 4BB3A 5L9BA 2PHDA 3VDBA 3F2ZA 4B1MA 5IK5A 3BU7A 5FAXA 5ACA3 2DFBA 1AX0A 4YZ3A 4XJUA 5EQUA 1MACA 3AP4A 2FCUA 5F5AA 4C0BA 3N9QA 1BEV2 1H30A 2ZOEB 1TE1B 4FI9A 4DUXA 1AJKA 3JB4C 5CADA 2D3PA 2PAMA 1VP6A 3OEBA 2GALA 4NRQA 1SEFA 4NPLA 2BJSA 2WQ4A 4YM2A 5BUVA 1AR71 1R081 2C1FA 4QX3A 1YWKA 2DCJA 3SLIA 4LQRA 4BU2A 4YVSC 4IV3C 1ASJ1 1D2SA 2QKDA 5I93A 1YJKA 5JPNB 1F9KA 3PTYA 4Z2AA 3HEIA 3A4UA 3VHOA 1AL0G 4F8AA 4Q0SA 1D4M2 4J1XA 3WF3A 1HB4A 1JYWA 5I0DA 3WXPA 4X6RB 3DXTA 1H1IA 4ZY9A 3GBFA 2V4VA 5T5OA 3N7LA 5CA6A 4NIIA 3PMEA 3E1F1 2HYXA 2V73A 2EIGA 3PDQA 4FXKB 4KGGA 4LA2A 2RDNA 4QQOA 5JPMB 4OHWA 3LIGA 3BUCA 4DZGA 2Y60A 3HIFA 3OY8B 1QGLA 3ZPYA 1N3QA 4P02B 3MW2A 1OH3A 1JU4A 1NG0A 1W6PB 4BXSV 1W6OB 3ACIA 1UZVA 5I0TA 1ZRIA 4UT5A 1ENQA 3J7LA 3KWVA 3N35A 1Q8VA 3J8F3 5I0RA 3VDDA 1C4RA 2WNUB 4CEYB 2V5DA 1GKBA 1ZBA1 2XR4A 3CIHA 5JSPA 4XAAA 3A7QA 5ABJC 4NPMA 3W5NA 3INAA 2VNOA 2WQZC 1VBE2 4BCUA 3ILNA 5BNNA 4KH9A 1RIRA 1VBA3 2P3KA 4QHOA 2JB4A 5D8AA 4CEWC 2PTMA 2XJUA 3O5SA 5KHIA 2CAUA 5EJ3A 2DBIA 3DPRA 3D0JA 2D6OX 1FMD2 4Y5SA 2OUHA 3ZFGA 4AI3A 4LIVA 4GMP1 1S0JA 1RUJ1 3GHMA 2DCKA 4IEZA 1US3A 1HXS1 2RDQA 1RUF2 4I09A 1NCQA 1TNRA 3B02A 4DEQA 5E89A 2OKXA 4BJ0A 3NO8A 1S0BA 4A7YA 2JG9A 2AUYA 3UK9A 3NNLA 2XBO3 1UKRA 3I3QA 4N8MA 1WUVA 1F4AA 1QJY2 1OUSA 3I54A 1V9U3 5C3OA 4Z82A 1PK6C 3VBSB 2A5ZA 2XLAA 4GWIA 1NA1A 4LHNA 4KWJA 2WFF1 3QH6A 1QU0A 4JC1A 1U5IA 1H4GA 2Z79A 3IAQA 3LCPA 4K7JA 4BIOA 2VAUA 3E97A 2C4XA 4FPFA 1UY1A 3VD7A 4JGYA 4QPIA 4ZPIA 1QOSA 5IK8A 1O6UA 1V6KA 4JAAA 2R043 3MLLA 5FMDA 2BVBA 3EXUA 4QGMA 2A3XA 2JDUA 3WF4A 5DMYA 5CKMA 4EV0A 3EO6A 3RI9A 1Q8PA 4HVQA 2J1TA 3VBHC 1QDOA 3H9AA 3M1HA 2VOTA 3T2TA 1OLQA 3O0WA 4FSJA 1XE7A 2A70A 2R072 3D5OA 1YJLA 2J7MA 3B94A 3KHBA 3OPTA 4LBOA 3S0MA 1O3RA 2D5HA 1GFF2 1YQCA 3JBG3 4IEVA 2WZPP 3WHTA 1XSQA 1GICA 3MBWA 4EN9B 4BQYA 4EWEA 3SISA 3KCYA 2VUCA 1R64A 1W90A 1QQP3 5DG1A 4YFWA 4M3CE 4Q29A 2E63A 4ORFA 5DABA 4Z92B 2ZEZA 1PVC3 2W1QA 4H7LA 2BBVA 4WBBA 2PAKA 1MS3A 2A75A 1VMHA 3DL3A 4CDXA 3VBUC 4CYDA 4BM8A 2QUOA 5FCCA 4RD7A 3B3QE 5B2GB 2QBXA 4NO4A 2WO7A 5K0UA 2BOIA 1NLQA 4QPGA 5FPVA 2WL1A 3VHNA 3JD72 4PF5A 3WNMA 4MX3A 3WW2A 2VMEA 1FYUA 2G4IA 3DEMA 1GQPA 5F5QA 5EZWA 3LWCA 2QTWB 4RR3B 4Y3OA 5C8WA 2DF7A 5I8SA 1DP0A 5FZAA 4XC9A 4CP9B 4LEJA 2WO1A 2WZR3 5A7WB 4CXWA 4XFAA 2BU9A 3HBKA 3HN3A 1KJRA 5A6XA 4NIGA 4A3ZA 2VJXA 2QQMA 1QIQA 1RUD1 5CYYA 3KCXA 4NWWA 5FYSA 2XB6C 3IMMA 1REEA 4LA3A 1I3HA 2ID4A 1VBD3 3W59A 3WZ1A 2VMFA 1ODNA 1B35A 5EJZB 5FQ0A 1KFXL 1CAXB 5HCBA 1O3QA 1JW6A 2ARCA 3ROUA 1W6NB 3MIDA 1X7NA 3SEPA 1DQ6A 4V2WA 3LDRA 1ZZBA 2QQJA 3FJSA 1K3IA 4PDWB 4I2OA 3OYWA 4UAPA 2Q1ZB 5H9PA 4HKWA 3NAPA 4JGZB 4QB6A 2K2SA 1SQ4A 2MHFA 3GZEA 2XLGA 4CDQC 4XF0A 2A6XA 1SDDB 3WR0A 1LESA 4ASLA 2LS6A 5JI9A 3V0AA 2BZDA 4QM9A 5EYXA 5HXVA 2R32A 4Y1YA 5DUUA 3VZMA 4FAGA 4I0WB 5FBJA 5B4NA 3KQ4B 1N1TA 1PO22 3AMPA 3M70A 2HWC2 2X05A 1TMF3 2JE9A 2FZ1A 1OFNA 3KV5A 2JENA 1ZRFA 1GP4A 1OOPC 4EN6B 2WQ8A 4CUGA 4YZ2A 4F3JA 5FLHA 3LEKA 2ZX4A 4CXXA 4FPLA 2RS53 4RYDA 4W6WA 4B1LA 5ACA2 2YPDA 3AVRA 2XQXA 2ZS6B 1AJOA 5L7OC 3BIEA 2C5DA 4I3PA 2HEWF 4OZOA 1JU3A 1JI6A 2NM1A 1OLRA 2GMMA 5GZFA 3U1XA 5A3MA 2VXRA 4NHYA 4R8HA 2WIIB 3PUQA 2ZGMA 5I0UA 5LK5A 4AI8A 4AL9A 1F5JA 2BBAA 2JDKA 1UCXA 3J7NA 3ZXGA 2UYAA 3ZXFA 1VBE1 3ORJA 4XFGA 1W2NA 3RZJA 1EPWA 4EWDA 2ZBJA 3EMRA 4XZPA 4XVHA 4ISRA 3BB6A 3RQ0A 2LRPA 3Q8CA 1FMD1 1H1AA 3UL2A 1RXFA 4GULA 2VZUA 3PURA 1WD4A 2OUJA 4H2AA 1C1LA 4Q0PA 3WNPA 1FXZA 2YMZA 1NQDA 1RUF1 2OT7A 4NN0A 2W91A 4XUTA 3TWIA 3U78A 5J36A 3W58A 2VMGA 3FHQA 1WW7A 4W4ZA 2A3YA 4PIXA 2PQQA 4O65A 2IXKA 3WQ1A 1AVBA 1QJY1 1NCRB 4HONA 3PUSA 5APAA 4DPNA 5A3UA 2Y8KA 5FWEA 2CGPA 2E26A 2QQOA 2FHRA 5DZGA 1ND2A 3AZXA 2JDPA 1RC6A 2VO5A 2VZSA
chains in the Genus database with same CATH topology
2WBKA 4PQQA 1PX3A 3I2GA 4ARXA 2W9XA 3SKJE 4CU7A 4KI5M 3GGLA 4QDSA 1EUUA 1JZ7A 3HNMA 3T08A 3WF0A 2WO2A 1O8PA 4PT6A 1J83A 4QB1A 5JMOA 3C7HA 5G04L 3K4DA 3T0AA 2W94A 3SEEA 3IAPA 1UY4A 3VD5A 2VZTA 4D0QA 4L0PA 2EIBA 2W87A 1SG3A 4CU8A 1UXXX 2V72A 4W8JA 2VZRA 1UYXA 2YFUA 4OUEA 2CDOA 1US2A 2R7EB 3ACFA 4DUWA 3WSOA 1P8JA 1UWWA 3LEIA 1UMIA 2VZOA 5JXHA 2QQKA 4OMDA 2E31A 1WCQA 4PF1A 1BHGA 3VDAA 2QQIA 2Y6KA 3PUHA 1UY0A 2WO3A 4CUBA 5CZKA 3GM8A 3VD3A 1GOFA 3LPGA 4P5YA 1JZ3A 1W9WA 1UY3A 1W9TA 2E32A 4OMCA 1I5PA 4QDQA 4ET7A 4ZZ8A 5IFPA 1YQ2A 1UYYA 5HXMA 2J1AA 1H6YA 3I2IA 3W5MA 2C9KA 1GNYA 1GOGA 3IIIA 3I3DA 2C26A 4KMQA 2B9VA 1DYOA 3EYPA 4D8MA 3VD4A 2VMDA 3WNKA 3UESA 4GWJA 2KD7A 4JX0A 5LA2A 4DEVA 2VZ3A 4P08A 3MUY1 1K45A 3FN9A 5DQ0A 3P6BA 2Z4FA 3HPNA 4XUNA 4P00B 2XHNA 1UX7A 3P1IA 1OF3A 2HLEA 3DECA 1TVGA 2BERA 3CZUA 5JXJA 3K4AA 3GDBA 1UXZA 3MO4A 2VZPA 2J1EA 4DXSA 4LKSA 3CMGA 2VC9A 3ACHA 3NJVA 3ETPA 3OGVA 5B4XA 2J1RA 3DYPA 3C7FA 4MOAA 1JZ2A 3ZM8A 5LA1A 2WN3A 3OG2A 4XZUG 1NAEA 2QQNA 3THDA 4JKLA 4XUOA 1J84A 1XPWA 4LPLA 1W0NA 2RV9A 1MPXA 4QX2A 4TTGA 3OGRA 1CZVA 1ULOA 3ACGA 3MV01 2W1SA 4GZ9A 4JHZA 4BK4A 1XC6A 4OYUA 1DLCA 1O8SA 3BN6A 2VM9A 3UNPA 2L9LA 3FL7A 3FHAA 2DDUA 3T2PA 4BDVB 2PQSA 5LCWL 2YFZA 3T0BA 2JKXA 4UI9L 5A1AA 4A44A 5IHRA 1NX9A 1H6XA 3I97A 2XONA 2VTFA 3I2FA 1NUKA 5C7GA 2W5FA 3EB7A 2LW8A 2Y64A 1OT5A 5G05L 1XNTA 1JYXA 3C8XA 3ECQA 2W3JA 4ZXEA 1O59A 4E8CA 3VDBA 3D3AA 3F2ZA 4QX1A 3T09A 3I3EA 1JYNA 3UETA 3VD9A 2VCBA 4DUXA 3LPFA 4FI9A 1SHWB 3WNNA 3CQOA 4AAXA 3OEBA 2CDPA 2J1VA 1JZ4A 2RJ2A 4MO3M 4QX3A 3HNBM 2YG0A 2DCJA 4LQRA 5DPNA 2ZEXA 4QX0A 2YC4A 2EIDA 1CZSA 4Z2AA 3HEIA 5HPOA 1OF4A 4XUPA 2J22A 5LA0A 3WF3A 3BGAA 1JYWA 5I0DA 4CVUA 1F4HA 3MV11 4ZY9A 2V4VA 4A45A 3E1F1 2HYXA 2YB7A 3MUZ1 4QDRA 5EIYB 4JKMA 2X09A 1GOHA 1W9SA 4P02B 4QB2A 4DUVA 4MGQA 1JU4A 2VR4A 5C71A 2XOMA 4BXSV 3AC0A 3ACIA 1PMHX 1OH4A 4ZZ5A 3WEZA 4MGSA 3WF1A 2V5DA 3CIHA 3A7QA 4YPJA 3W5NA 3WQBA 1ULPA 3VDCA 1T2XA 1K42A 3THCA 5JR2A 4JKKA 4KWUA 1UMHA 3ABZA 1L7RA 3HOBA 1L7QA 5IJRA 2VQUA 5FUIA 1K12A 3PUIA 5JXGA 2DCKA 1US3A 4DEQA 1PX4A 1HN1A 4M4RA 3C7GA 3HJRA 3K46A 2OKXA 3WF2A 4BJ0A 5F7UA 3IB3A 3WNOA 4RN5A 4UOJA 2E33A 2WAOA 1F4AA 4A6OA 2QQLA 1KGYA 5IYYA 4IUGA 3I2KA 4AG4A 1JZ5A 3CDZB 4GWIA 4DXTA 3IAQA 1CIYA 2C4XA 3VD7A 1UY1A 2WABA 4LHSA 3T2QA 1KEXA 1TG7A 3WF4A 5DMYA 2Y6LA 2J1TA 3SKVA 2VQTA 2VOTA 4HG6B 2J7MA 1EUTA 4DXRA 3NRUA 1GU3A 2YC2A 2W47A 3OB8A 1D7PM 2VL4A 3MBWA 3T2OA 5IFTA 2Y6HA 2VCAA 2W95A 1UZ0A 4BK5A 1R64A 5J1XA 3LE0A 1W8OA 2ZEZA 5C70A 2ZXQA 2W1QA 4M4PA 4CU9A 3LQCA 2WZEA 2VZSA 3LEGA 1CX1A 3OEAA 2ZEWA 2QBXA 1GUIA 2ORXA 4ARYA 1OD3A 1RYYA 2J1SA 5EJ1B 3A21A 3WNMA 4CU6A 2VMEA 1JHJA 2W46A 4XURA 1GQPA 5JXIA 2W1WA 3A22A 3K77A 2WUHA 1DP0A 2WO1A 3JXSA 2WN2A 2B4KA 4A4AA 2RVAA 1JZ6A 2Y6GA 2BGPA 3HN3A 3A23A 4A42A 3DYOA 3K4ZA 2BGOA 4A3ZA 3T0DA 2VJXA 2QQMA 5CYYA 3NNGA 3IDAA 1CZTA 2VMCA 3DYMA 2JD9A 2ID4A 2VMFA 1UYZA 2WAAA 3WNLA 5EJZB 3U37A 1UY2A 2X10A 3I2HA 1NKGA 3SEPA 4CUCA 3C7OA 2QQJA 1K3IA 2EICA 4UAPA 2Y6JA 4QB6A 2VZ1A 2JDAA 3GXUA 3I2JA 1SDDB 2LS6A 3I3BA 2BZDA 4QAWA 4MADA 5B4NA 3C7EA 3K75B 1IQDC 4XUQA 3OGSA 2X05A 1GMMA 4A41A 4TXWA 3NJXA 2WQ8A 2W92A 3J7HA 3LEKA 4RYDA 2XQXA 1W99A 4OZOA 1JU3A 1JI6A 4QPWA 1JZ8A 5JUVA 2WZ8A 1WKYA 2BBAA 2ORZA 4CUAA 1LNSA 2EIEA 4E8DA 4XVHA 2W1UA 2VZVA 2VZQA 2VZUA 5DN2A 3HNYM 3WNPA 2J1UA 2WDBA 1W8NA 4XUTA 2W91A 3OBAA 3FHQA 4W4ZA 1XNAA 2ZEYA 2Y8KA 1JYVA 2E26A 2QQOA 1PMJX 3CZJA 4W50A 2JE8A 2VO5A 2WYSA 2VCCA 3NQHA 3CKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WBK A;  4PQQ A;  1PX3 A;  3I2G A;  4ARX A;  2W9X A;  3SKJ E;  4CU7 A;  4KI5 M;  3GGL A;  4QDS A;  1EUU A;  1JZ7 A;  3HNM A;  3T08 A;  3WF0 A;  2WO2 A;  1O8P A;  4PT6 A;  1J83 A;  4QB1 A;  5JMO A;  3C7H A;  5G04 L;  3K4D A;  3T0A A;  2W94 A;  3SEE A;  3IAP A;  1UY4 A;  3VD5 A;  2VZT A;  4D0Q A;  4L0P A;  2EIB A;  2W87 A;  1SG3 A;  4CU8 A;  1UXX X;  2V72 A;  4W8J A;  2VZR A;  1UYX A;  2YFU A;  4OUE A;  2CDO A;  1US2 A;  2R7E B;  3ACF A;  4DUW A;  3WSO A;  1P8J A;  1UWW A;  3LEI A;  1UMI A;  2VZO A;  5JXH A;  2QQK A;  4OMD A;  2E31 A;  1WCQ A;  4PF1 A;  1BHG A;  3VDA A;  2QQI A;  2Y6K A;  3PUH A;  1UY0 A;  2WO3 A;  4CUB A;  5CZK A;  3GM8 A;  3VD3 A;  1GOF A;  3LPG A;  4P5Y A;  1JZ3 A;  1W9W A;  1UY3 A;  1W9T A;  2E32 A;  4OMC A;  1I5P A;  4QDQ A;  4ET7 A;  4ZZ8 A;  5IFP A;  1YQ2 A;  1UYY A;  5HXM A;  2J1A A;  1H6Y A;  3I2I A;  3W5M A;  2C9K A;  1GNY A;  1GOG A;  3III A;  3I3D A;  2C26 A;  4KMQ A;  2B9V A;  1DYO A;  3EYP A;  4D8M A;  3VD4 A;  2VMD A;  3WNK A;  3UES A;  4GWJ A;  2KD7 A;  4JX0 A;  5LA2 A;  4DEV A;  2VZ3 A;  4P08 A;  3MUY 1;  1K45 A;  3FN9 A;  5DQ0 A;  3P6B A;  2Z4F A;  3HPN A;  4XUN A;  4P00 B;  2XHN A;  1UX7 A;  3P1I A;  1OF3 A;  2HLE A;  3DEC A;  1TVG A;  2BER A;  3CZU A;  5JXJ A;  3K4A A;  3GDB A;  1UXZ A;  3MO4 A;  2VZP A;  2J1E A;  4DXS A;  4LKS A;  3CMG A;  2VC9 A;  3ACH A;  3NJV A;  3ETP A;  3OGV A;  5B4X A;  2J1R A;  3DYP A;  3C7F A;  4MOA A;  1JZ2 A;  3ZM8 A;  5LA1 A;  2WN3 A;  3OG2 A;  4XZU G;  1NAE A;  2QQN A;  3THD A;  4JKL A;  4XUO A;  1J84 A;  1XPW A;  4LPL A;  1W0N A;  2RV9 A;  1MPX A;  4QX2 A;  4TTG A;  3OGR A;  1CZV A;  1ULO A;  3ACG A;  3MV0 1;  2W1S A;  4GZ9 A;  4JHZ A;  4BK4 A;  1XC6 A;  4OYU A;  1DLC A;  1O8S A;  3BN6 A;  2VM9 A;  3UNP A;  2L9L A;  3FL7 A;  3FHA A;  2DDU A;  3T2P A;  4BDV B;  2PQS A;  5LCW L;  2YFZ A;  3T0B A;  2JKX A;  4UI9 L;  5A1A A;  4A44 A;  5IHR A;  1NX9 A;  1H6X A;  3I97 A;  2XON A;  2VTF A;  3I2F A;  1NUK A;  5C7G A;  2W5F A;  3EB7 A;  2LW8 A;  2Y64 A;  1OT5 A;  5G05 L;  1XNT A;  1JYX A;  3C8X A;  3ECQ A;  2W3J A;  4ZXE A;  1O59 A;  4E8C A;  3VDB A;  3D3A A;  3F2Z A;  4QX1 A;  3T09 A;  3I3E A;  1JYN A;  3UET A;  3VD9 A;  2VCB A;  4DUX A;  3LPF A;  4FI9 A;  1SHW B;  3WNN A;  3CQO A;  4AAX A;  3OEB A;  2CDP A;  2J1V A;  1JZ4 A;  2RJ2 A;  4MO3 M;  4QX3 A;  3HNB M;  2YG0 A;  2DCJ A;  4LQR A;  5DPN A;  2ZEX A;  4QX0 A;  2YC4 A;  2EID A;  1CZS A;  4Z2A A;  3HEI A;  5HPO A;  1OF4 A;  4XUP A;  2J22 A;  5LA0 A;  3WF3 A;  3BGA A;  1JYW A;  5I0D A;  4CVU A;  1F4H A;  3MV1 1;  4ZY9 A;  2V4V A;  4A45 A;  3E1F 1;  2HYX A;  2YB7 A;  3MUZ 1;  4QDR A;  5EIY B;  4JKM A;  2X09 A;  1GOH A;  1W9S A;  4P02 B;  4QB2 A;  4DUV A;  4MGQ A;  1JU4 A;  2VR4 A;  5C71 A;  2XOM A;  4BXS V;  3AC0 A;  3ACI A;  1PMH X;  1OH4 A;  4ZZ5 A;  3WEZ A;  4MGS A;  3WF1 A;  2V5D A;  3CIH A;  3A7Q A;  4YPJ A;  3W5N A;  3WQB A;  1ULP A;  3VDC A;  1T2X A;  1K42 A;  3THC A;  5JR2 A;  4JKK A;  4KWU A;  1UMH A;  3ABZ A;  1L7R A;  3HOB A;  1L7Q A;  5IJR A;  2VQU A;  5FUI A;  1K12 A;  3PUI A;  5JXG A;  2DCK A;  1US3 A;  4DEQ A;  1PX4 A;  1HN1 A;  4M4R A;  3C7G A;  3HJR A;  3K46 A;  2OKX A;  3WF2 A;  4BJ0 A;  5F7U A;  3IB3 A;  3WNO A;  4RN5 A;  4UOJ A;  2E33 A;  2WAO A;  1F4A A;  4A6O A;  2QQL A;  1KGY A;  5IYY A;  4IUG A;  3I2K A;  4AG4 A;  1JZ5 A;  3CDZ B;  4GWI A;  4DXT A;  3IAQ A;  1CIY A;  2C4X A;  3VD7 A;  1UY1 A;  2WAB A;  4LHS A;  3T2Q A;  1KEX A;  1TG7 A;  3WF4 A;  5DMY A;  2Y6L A;  2J1T A;  3SKV A;  2VQT A;  2VOT A;  4HG6 B;  2J7M A;  1EUT A;  4DXR A;  3NRU A;  1GU3 A;  2YC2 A;  2W47 A;  3OB8 A;  1D7P M;  2VL4 A;  3MBW A;  3T2O A;  5IFT A;  2Y6H A;  2VCA A;  2W95 A;  1UZ0 A;  4BK5 A;  1R64 A;  5J1X A;  3LE0 A;  1W8O A;  2ZEZ A;  5C70 A;  2ZXQ A;  2W1Q A;  4M4P A;  4CU9 A;  3LQC A;  2WZE A;  2VZS A;  3LEG A;  1CX1 A;  3OEA A;  2ZEW A;  2QBX A;  1GUI A;  2ORX A;  4ARY A;  1OD3 A;  1RYY A;  2J1S A;  5EJ1 B;  3A21 A;  3WNM A;  4CU6 A;  2VME A;  1JHJ A;  2W46 A;  4XUR A;  1GQP A;  5JXI A;  2W1W A;  3A22 A;  3K77 A;  2WUH A;  1DP0 A;  2WO1 A;  3JXS A;  2WN2 A;  2B4K A;  4A4A A;  2RVA A;  1JZ6 A;  2Y6G A;  2BGP A;  3HN3 A;  3A23 A;  4A42 A;  3DYO A;  3K4Z A;  2BGO A;  4A3Z A;  3T0D A;  2VJX A;  2QQM A;  5CYY A;  3NNG A;  3IDA A;  1CZT A;  2VMC A;  3DYM A;  2JD9 A;  2ID4 A;  2VMF A;  1UYZ A;  2WAA A;  3WNL A;  5EJZ B;  3U37 A;  1UY2 A;  2X10 A;  3I2H A;  1NKG A;  3SEP A;  4CUC A;  3C7O A;  2QQJ A;  1K3I A;  2EIC A;  4UAP A;  2Y6J A;  4QB6 A;  2VZ1 A;  2JDA A;  3GXU A;  3I2J A;  1SDD B;  2LS6 A;  3I3B A;  2BZD A;  4QAW A;  4MAD A;  5B4N A;  3C7E A;  3K75 B;  1IQD C;  4XUQ A;  3OGS A;  2X05 A;  1GMM A;  4A41 A;  4TXW A;  3NJX A;  2WQ8 A;  2W92 A;  3J7H A;  3LEK A;  4RYD A;  2XQX A;  1W99 A;  4OZO A;  1JU3 A;  1JI6 A;  4QPW A;  1JZ8 A;  5JUV A;  2WZ8 A;  1WKY A;  2BBA A;  2ORZ A;  4CUA A;  1LNS A;  2EIE A;  4E8D A;  4XVH A;  2W1U A;  2VZV A;  2VZQ A;  2VZU A;  5DN2 A;  3HNY M;  3WNP A;  2J1U A;  2WDB A;  1W8N A;  4XUT A;  2W91 A;  3OBA A;  3FHQ A;  4W4Z A;  1XNA A;  2ZEY A;  2Y8K A;  1JYV A;  2E26 A;  2QQO A;  1PMJ X;  3CZJ A;  4W50 A;  2JE8 A;  2VO5 A;  2WYS A;  2VCC A;  3NQH A;  3CKH A; 
#chains in the Genus database with same CATH topology
 1QH6 A;  2Y34 A;  2QJV A;  3TBD A;  2XGX A;  1AL2 3;  1LOG A;  5FZL A;  1UZY A;  2EAK A;  1V0A A;  2P3I A;  1NT0 A;  4LK6 A;  4QDS A;  1JZ7 A;  2YY1 A;  4C90 A;  4BQX A;  1MZ6 A;  1ND3 A;  2D5F A;  3FFQ A;  5KHJ A;  4PT6 A;  5JZG A;  1VAL A;  2OZ6 A;  1L3J A;  4Y26 A;  2N7G A;  5JMO A;  4XBL A;  2DUP A;  1WA4 A;  2GMP A;  1LEM A;  2HBU A;  3KD4 A;  4FTB A;  1UN1 A;  1VBA 2;  2AEN A;  4XFF A;  2YYO A;  3JQW A;  3VDD C;  2EA7 A;  2Y0O A;  2VZT A;  3MPP G;  4XBQ A;  2FD8 A;  1BK1 A;  4UW5 A;  1DZR A;  4XET A;  5T52 A;  2G1M A;  1SG3 A;  1KQR A;  2V72 A;  4RHV 3;  4BQW A;  2ZHM A;  4OFG A;  2OXB A;  4QWN A;  1H9P A;  2GC3 A;  3O1V A;  1SMV A;  2RG4 A;  2QFE A;  3DPR C;  5E88 A;  2X5I B;  1C28 A;  2YFU A;  2BVV A;  3ZFG C;  1EYB A;  4H7M A;  1US2 A;  2PXJ A;  2XBO 2;  4U36 A;  4P5H A;  5FP3 A;  4DUW A;  5DUW A;  1ZRE A;  1IPJ A;  1V9U 2;  3OF1 A;  5FYB A;  1IS4 A;  5FRA A;  1NCQ C;  4PHZ A;  3M2M A;  2OPW A;  1POQ A;  1V6I A;  3JD7 1;  5FKC A;  1YXW A;  5A80 A;  2JG9 C;  1SLC A;  1AR8 3;  1KS4 A;  1UU6 A;  2GC0 A;  2F4P A;  4OMD A;  4XAB A;  2R04 2;  5FZ7 A;  1BLZ A;  2E31 A;  1NA1 C;  2B46 X;  1JUH A;  1GWK A;  3RZZ A;  5LAT A;  2IFR A;  4NIA A;  1J58 A;  1KJL A;  2Y6K A;  2VU9 A;  4JGY C;  4QPI C;  4XTP A;  4CUB A;  4E2S A;  4LBM A;  1TZO A;  1OA4 A;  4XE9 A;  2GNM A;  3BOD A;  4M00 A;  1LJ7 A;  1WMF A;  4MVT A;  3RZM A;  4XHB A;  4RS5 B;  3BTZ A;  4IDZ A;  3JBG 2;  1GOF A;  2SLI A;  4N9H A;  3AL5 A;  3PMS A;  2ZHN A;  1UY3 A;  1VRH 3;  2BFU S;  2E32 A;  2HYK A;  4QDQ A;  1E5H A;  1NLS A;  1M4W A;  5BNP B;  1Q5O A;  4YVW B;  3E5Q A;  4WM8 B;  5C8C B;  1QQP 2;  1SFY A;  4HPK B;  5DAW A;  5BNQ A;  3VHP A;  5IFP A;  2W08 A;  1YQ2 A;  5BV6 A;  3AB0 A;  1AYN 3;  3AP5 A;  3RWK X;  4AF9 A;  2JIG A;  4K20 A;  1H6Y A;  1PVC 2;  4BZ4 A;  3KHC A;  3RZG A;  2WNE A;  4D3W A;  1XND A;  1GQG A;  4DOU A;  1G7Y A;  5C3S A;  3III A;  4YW6 A;  4I01 A;  1LOC A;  2F17 A;  4PBO A;  3SC7 X;  2GND A;  4D6Q A;  1X8M A;  4AAP A;  1YI7 A;  2GNB A;  1TNF A;  3F95 A;  3UES A;  2ADD A;  2KD7 A;  2VCM A;  4GWJ A;  3IT8 A;  4I02 A;  1YFX A;  4LE3 A;  4PBP A;  5HCF A;  4A7Z A;  3TOJ A;  4CDX C;  3SQO A;  4AEK A;  2P6H A;  2DWR A;  3NST A;  1LU2 A;  2VEC A;  5A7S A;  3VKM A;  1PO2 1;  5GLT A;  3ZN4 A;  2RS1 3;  2HBT A;  2JIJ A;  5CFC B;  4NIH A;  1C5H A;  3FN9 A;  5FY8 A;  5A7Q A;  4AQ6 A;  5KBF A;  2Z4F A;  2QQW A;  1A78 A;  2NQY A;  2OA2 A;  1ZM1 A;  1DGR N;  2WZR 2;  1RJ8 A;  4QD2 A;  4URT A;  1OF3 A;  1K5M A;  1MS5 A;  1NY7 1;  5FPA A;  3VZN A;  5GZE A;  2BER A;  3KF3 A;  3BPZ A;  1YUD A;  4MV2 A;  4KG8 A;  5JXJ A;  5ISL A;  4N43 A;  3K51 A;  3UKT A;  4NPR A;  4BQ5 A;  1N1V A;  2VZP A;  1SLT A;  1IS3 A;  4YGD A;  3RZK A;  1GSL A;  3IIA A;  4CCK A;  5LA9 A;  1VBD 2;  3CHX A;  3CJI A;  5BPX A;  2ZCW A;  1LAJ A;  1Z0H A;  3DYP A;  5A6Q A;  3C7F A;  3U07 A;  3WUD A;  5I91 A;  3IDE A;  1JZ2 A;  1OMI A;  4YM1 A;  2WNO A;  2V09 A;  4GAZ A;  5M0T A;  4MZU A;  4AI0 A;  5IW0 A;  1TQ5 A;  2UWA A;  3FLT A;  3AM2 A;  1OUX A;  4YM3 A;  4W6X A;  4IV1 B;  1AUY A;  2C24 A;  5IT6 A;  3THD A;  1CJP A;  2W52 A;  4XUO A;  1BEV 3;  2VOK A;  1J84 A;  4IEY A;  1UIJ A;  1XPW A;  2RV9 A;  2ZAH A;  2A73 B;  2ZGQ A;  4J1W A;  2XXZ A;  4UFI A;  5AVP A;  1VBC 1;  4NVP A;  3K3O A;  4QQP A;  1U5X A;  3QH7 A;  2PHX A;  4S2G A;  4XJ9 A;  3AKT A;  2BWA A;  1AXY A;  4JTN A;  1HLC A;  4A6S A;  1TMF 2;  2Z42 A;  3DF0 A;  5DZE A;  4K9S A;  3PJY A;  4BDV B;  3FHA A;  4HKL A;  2RS5 2;  2BYV E;  4Q0V A;  5FYU A;  3CU7 A;  1BQP A;  1S1A A;  1CVN A;  2RS3 3;  3KM5 A;  5IK7 A;  1A8M A;  3AMM A;  1FV2 A;  4CTE A;  3D8C A;  1OHF A;  1SCS A;  3J8F 1;  4BH9 A;  2ATF A;  2B5H A;  4XXP A;  5A1A A;  2XL9 A;  3KB5 A;  1X9P A;  2XUM A;  3AKP A;  5HV4 A;  2ZTN A;  1ALY A;  5KXD A;  1YO8 A;  3AP7 A;  3I2F A;  1RHI 3;  3B5L B;  3IM0 A;  3KV9 A;  5IAX A;  1NUK A;  5C7G A;  1Y3T A;  3S30 A;  2QDN A;  3BCW A;  4LO6 B;  1W8T A;  1ZZ9 A;  4Y20 A;  2VD7 A;  5C9A A;  1QJU 1;  1XNT A;  2EAA A;  2VVF A;  4YG3 A;  3ZKY A;  4UW3 A;  1MS0 A;  3BAL A;  2SBA A;  3KGZ A;  3WP5 A;  3U4S A;  3MF9 A;  2J42 A;  2OZJ A;  1BZW A;  4Q1P A;  5BXX A;  3AZW A;  2XBO 1;  4JVA A;  2VVE A;  1R1A 3;  4N53 B;  1YCI A;  4JHT A;  4LIU A;  1V9U 1;  2OQ7 A;  2GC1 A;  3AFG A;  4QX1 A;  2ZMK A;  1SLI A;  2ZAA A;  3I3E A;  4CDW B;  4D69 A;  1IPS A;  1CAW A;  2ENR A;  2UU8 A;  3KT1 A;  5FZH A;  3UET A;  5LRS A;  2FDJ A;  2DU0 A;  4CZS A;  1RVF 3;  2BTV C;  3V65 A;  2VQA A;  4FFG A;  4Y1X A;  2R04 1;  4NID A;  1HDK A;  1W2O A;  1RUH 3;  4IXL A;  5LRR A;  2ZX1 A;  4UW4 A;  1J1L A;  3ES4 A;  2J1V A;  1BYH A;  1R09 3;  3ILR A;  1E5R A;  5FP8 A;  3OUH A;  1AL2 2;  2BDR A;  3HNB M;  3VKL A;  3KV4 A;  3K48 A;  1OQE A;  4PIY A;  5F1R A;  5LBF A;  1QH7 A;  3ZXJ A;  5DPN A;  5IVB A;  3MIE A;  1RB8 G;  3FMG A;  3AL6 A;  1W8U A;  4QX0 A;  1OXC A;  1YQ5 A;  2PLV 1;  2YC4 A;  1DQ4 A;  1QNY A;  2EID A;  4OUL A;  5GLU A;  3I49 A;  4AHZ A;  1W04 A;  4XBN A;  1OF4 A;  4YW2 A;  4AGR A;  3I2D A;  1ND3 C;  5JZG C;  5D1I A;  4LK7 A;  4CVU A;  1VIW B;  1QQP 1;  2CU5 A;  1I6X A;  4H3W A;  3MV1 1;  4C1W A;  4L99 A;  4RHV 2;  5HCA A;  2XVG A;  4N7I A;  4DQA A;  2YB7 A;  4NJ4 A;  3ZX7 A;  4LTA A;  5FZ1 A;  2ZX3 A;  4A2U A;  3NMB A;  5DAX A;  3GHN A;  2Q30 A;  4YG6 A;  1GBG A;  2X09 A;  4AW7 A;  1GOH A;  5IVV A;  4QB2 A;  2NLR A;  4MGQ A;  3V56 A;  5EYY A;  4AED B;  5LEJ A;  4PIZ A;  4H55 A;  3G7D A;  1I5Z A;  3MIB A;  4NHL A;  1PMH X;  1F8V A;  2ZGK A;  5J09 A;  4C1X A;  3RYP A;  4BME A;  2XDV A;  1ENR A;  5A6Y A;  4CCC A;  1AR8 2;  2E7A A;  4MGS A;  5GAL A;  2BP6 A;  2WA3 A;  1AR6 3;  2RHP A;  4YPJ A;  4CDU B;  2X29 A;  5KC5 A;  3PLQ A;  2A6Z A;  2Y0I A;  4WVV A;  3VL8 A;  2VBP A;  4CCN A;  4F7Z A;  4XFI A;  2IZW A;  2WZR 1;  2GN7 A;  4GB3 3;  5FXW A;  3VDC A;  5C4W B;  4JKK A;  1K42 A;  4XFB A;  5KR7 A;  3HOB A;  5FZM A;  5FP7 A;  4MXW B;  5IJR A;  4ES8 A;  1RUG 3;  1OVP A;  5FUI A;  3PUI A;  4QXH A;  4Y1Z A;  3M8L A;  4XMI A;  1YLL A;  4LIT A;  3S6P A;  1HN1 A;  3WF2 A;  3C7G A;  3OY8 A;  3O14 A;  3IB3 A;  1VRH 2;  4XOG A;  4V1P A;  4ZON A;  3WNO A;  1NLR A;  2JDM A;  1W6P A;  1GNZ A;  4YGB A;  3BIW E;  1LOA A;  4N90 A;  1W6O A;  4A6O A;  2QQL A;  5FYI A;  3OOX A;  5IVF A;  2P2K A;  2WR9 A;  1LCL A;  1FAT A;  2IUW A;  2R06 3;  1AYN 2;  1RUC 1;  2VPV A;  3I2K A;  5GM0 A;  1JZ5 A;  2WNU A;  1HQN A;  4CEY A;  3O0V A;  1ZA7 A;  3AZZ A;  4BOW A;  1UOB A;  3LEM A;  5FMO S;  2WAB A;  4LHS A;  4COU A;  5H9S A;  1XBF A;  4AI9 A;  2P37 A;  1JHN A;  1O91 A;  2HWF 3;  1KEX A;  1TG7 A;  3FZ3 A;  4ZXK A;  3T2Q A;  5K0U B;  2Y6L A;  3P3P A;  4HSL A;  3U0Z A;  1VBB 1;  2BV4 A;  2ET7 A;  4NHM A;  5CAZ A;  2VQT A;  1UL9 A;  1ZBE 1;  5A6Z A;  5FTT C;  3CF6 E;  2YU2 A;  3K2O A;  2RS1 2;  5K4L A;  1TMF 1;  2D44 A;  1EUT A;  2Z69 A;  3H8O A;  5KWR A;  2IXL A;  4HOO A;  2YC2 A;  4QKN A;  3OB8 A;  3DCQ A;  1D7P M;  4BQ1 A;  2WA4 A;  3T2O A;  3POI A;  4LO5 B;  3H7J A;  3RZL A;  2EVX A;  4IGQ A;  1Y4W A;  2VCA A;  4HMZ A;  5DUX A;  5GZD A;  3VBS A;  4FPY A;  1DYK A;  2VUA A;  1V6N A;  2UY8 A;  5A33 B;  3O1P A;  5DUV A;  4FPG A;  1JOD A;  2ZXQ A;  4CCM A;  2HWE 3;  4XAE A;  4ERO A;  1PGW 1;  1K5M C;  4I0B A;  5CKN A;  2OX0 A;  3O0X A;  3NNJ A;  3LEG A;  1KDK A;  4N43 C;  1H8T B;  1W3X A;  2ZPX A;  3J4U H;  3OEA A;  4AVB A;  3GJA A;  5E16 A;  2Q8C A;  5CG9 A;  1QJF A;  3VKO A;  1GP5 A;  3NV2 A;  3CJI C;  3I8T A;  1VR3 A;  3L2Y A;  5A70 A;  1DG6 A;  4CU6 A;  1OPO A;  2GP3 A;  3Q8E A;  4NOT A;  2W46 A;  4B3N A;  3U4X A;  1PM7 A;  4RFR B;  2DTY A;  4J25 A;  4M3C B;  2O0O A;  3A22 A;  2OII A;  2WUH A;  1PZ9 A;  4YZ5 A;  3RRD A;  2H6C A;  2XJT A;  1OA2 A;  1N3P A;  2QVS B;  3MIG A;  4WV8 A;  5FPB A;  2Y6G A;  2BGP A;  1H8V A;  2IXH A;  4AOC A;  3AYD A;  3N4M A;  3DYO A;  5CIR A;  1BMV 2;  2BGO A;  3T0D A;  2YC0 A;  2VGD A;  2HWD 3;  2DU1 A;  5AC9 3;  1GYK A;  3DYM A;  2B42 B;  1IG0 A;  1IS6 A;  4FTS A;  2CHH A;  4IGO A;  4FOY A;  1HRV 3;  1W6Q B;  2QQV A;  1AL2 1;  1G8W A;  2RS3 2;  2ZX0 A;  4CDU C;  3O1S A;  2BRT A;  5FXZ A;  1UY2 A;  3I2H A;  3EQE A;  1NKG A;  2X53 S;  3N9O A;  4IE6 A;  4LLF A;  3ZMN A;  4BPZ A;  2UUR A;  4CUC A;  4Y5T A;  4Z2W A;  1LHU A;  1D4V B;  5EV7 A;  3VGI A;  2FZ2 A;  2EIC A;  1DHK B;  1RHI 2;  1RUE 3;  5FZ8 A;  2D6N A;  2VBD A;  1VB4 A;  1Q8S A;  4UYB A;  1UPI A;  1WW5 A;  4RR3 A;  4AGG A;  2O1Q A;  4R9C A;  4RGA A;  1XJA A;  4LOR A;  4CP9 A;  3I2J A;  5A7W A;  3N7K A;  5JIU A;  1SZB A;  2XG3 A;  2JG8 B;  1SCR A;  4YFZ A;  3M4F A;  4RHV 1;  1TME 3;  3NKG A;  1CAV B;  4EQV A;  1AYM 1;  2TBV A;  4YYO A;  3VZO A;  1XNK A;  4XUQ A;  1GP6 A;  4Y22 B;  2R0F A;  3E6C C;  4K40 A;  4TXW A;  5AVA A;  5GLV A;  3O1O A;  1D0H A;  1R1A 2;  2AR6 A;  5C9A C;  3ZVX A;  4CCJ A;  4W6Y A;  4LKE A;  1VPH A;  5A3P A;  5FDB A;  3ZSE A;  3ZFF B;  3O7O A;  2D6P A;  3DN7 A;  1CAX A;  2XKP A;  2XVK A;  5T5L A;  5KXE A;  3M7A A;  1ST8 A;  1W6N A;  2WZ8 A;  3DGT A;  1RVF 2;  3IN9 A;  3O12 A;  1AR8 1;  4QHZ A;  2Q1F A;  1WLW A;  4SBV A;  5F6L B;  2VE1 A;  4PDW A;  4R4X A;  1RUH 2;  3LA7 A;  4JGZ A;  3AMH A;  2ZAC A;  2OYZ A;  1R09 2;  3OD4 A;  4CUA A;  2QDR A;  3U11 A;  4E8D A;  2K46 A;  2W1U A;  2ERF A;  1Z78 A;  3RJ2 X;  3BKZ A;  5DN2 A;  3C3V A;  2IC1 A;  2I07 B;  2WDB A;  2ZX2 A;  3WHU A;  4B4R A;  4C0H A;  2CWM A;  1W8N A;  2DUQ A;  3KS7 A;  3JUU A;  3E5U A;  4DY5 A;  4QXB A;  1XNA A;  5JI7 A;  3WQ7 A;  1GZW B;  1W8Z A;  2YDE A;  3H3L A;  3OCP A;  2UY9 A;  1IG3 A;  2ZEY A;  1QY4 A;  4HN1 A;  1AYN 1;  5LBB A;  1JYV A;  3R05 A;  4O9E A;  1H8T C;  4PLO A;  1RUN A;  1MQT B;  1NOV A;  2LUW A;  3HD8 B;  5C3R A;  2WYS A;  3GCX A;  2Y33 A;  3NQH A;  1W2T A;  3WX5 A;  4Y4R A;  4FXG B;  2VUJ A;  2WBK A;  4PQQ A;  2FDI A;  2BNO A;  4CA9 A;  4IE7 A;  2AAC A;  4KI5 M;  3WDY A;  2B45 X;  5GZG A;  3BTA A;  2Q8D A;  4Q4X 3;  2RS1 1;  1DQ0 A;  2HEV F;  4LBK A;  4YRD A;  2MNG A;  2XQR A;  3ZN6 B;  4QB1 A;  3VBR B;  4C91 A;  1LHW A;  1AR6 2;  3Q9O A;  3H8X A;  3N9N A;  1W9F A;  4MET A;  1CAU B;  4K6B A;  3K4D A;  4UF0 B;  1QNW A;  4WVW A;  4JRA A;  4HK9 A;  4YW4 A;  3T0A A;  2JIC A;  4GB3 2;  2WWS A;  1NCR A;  2ETE A;  3Q8A A;  4COZ A;  2NYY A;  1IQA A;  5LBE A;  4D0Q A;  1RUG 2;  1GAN A;  5K9Y A;  4C8D A;  2XJV A;  4FOQ A;  3KSC A;  4XF3 A;  1BXH A;  2HWB 3;  1RUI 3;  3ZYB A;  4CU8 A;  4Q1R A;  4U2A A;  2VZR A;  4E2Q A;  2ADE A;  1FOD 3;  3HAG A;  5IVC A;  3ZFE B;  3A0K A;  3ACF A;  5T55 A;  3APB A;  2R06 2;  5FZO B;  2ES3 A;  5FYH A;  2WWU A;  4Y24 A;  1O5L A;  2VZO A;  5IAV A;  2BFU L;  1LGC A;  2I74 A;  5FY4 A;  5FJH A;  2WJS A;  1POV 3;  5GKA C;  1QXP A;  1BEV 1;  2HWF 2;  3WUC A;  5HI0 A;  1HW5 A;  1MZ5 A;  2CGN A;  1WCQ A;  1GZT A;  1S0E A;  4K8F A;  5BY5 A;  5KXC A;  1O7F A;  1S2B A;  4J6G A;  2RJL A;  2WNU C;  4CEY C;  2A7A A;  2TNF A;  3MLK A;  1V6J A;  2DTW A;  1WCS A;  3PUH A;  1UY0 A;  2A1X A;  1BMV 1;  3B9I A;  2JJ6 A;  1EV1 3;  2JDZ A;  2P3J A;  2Q0A A;  2KXL A;  2DVA A;  2R6Q A;  5A3N A;  3GM8 A;  2CAV A;  1LOF A;  2X5I A;  1UAI A;  1ULD A;  5CKQ A;  3UGG A;  4AI2 A;  3H50 A;  2LAL A;  1G9A A;  2RS3 1;  4OUS A;  1ZNP A;  2BUK A;  1LKN A;  4BIF A;  4E9K A;  1D4M 1;  1KFU L;  2QCS B;  1PMI A;  4K3U A;  3WCR A;  3TYJ A;  3N7J A;  1FPN 3;  4RA0 A;  5FYY A;  3SCG A;  2VMH A;  5HXM A;  2HWE 2;  4IEW A;  1LRH A;  3VBH B;  1RHI 1;  1WCD J;  2C9K A;  3H1W A;  4M01 A;  3FBY A;  5FP9 A;  5SV8 A;  1X9T A;  3VBS C;  2B9V A;  4NWV A;  2YBS A;  1OFS A;  4QKF A;  3ZXE A;  3Q8B A;  2Q4S A;  2WWJ A;  2ZGT A;  3MIF A;  1RIT A;  2CNA A;  5FMC A;  4A7K A;  5FO8 B;  1WA6 X;  1NYW A;  2XJQ A;  4E4Z A;  5JOZ A;  4JX0 A;  1MS1 A;  5FO7 B;  1AF9 A;  5L73 A;  4CP0 A;  3DKQ A;  5FZ0 A;  3MDP A;  2NMO A;  2YRO A;  5FLJ A;  5JVV A;  4RS5 A;  2PHT A;  4GH4 B;  3WP6 A;  2WS9 3;  1H0B A;  5IWF A;  1O3S A;  5JSO A;  3J26 N;  5DQ0 A;  1R1A 1;  3HT1 A;  4AI1 A;  3P6B A;  1PO1 3;  1QMJ A;  3HPN A;  1LR5 A;  3QAC A;  4P00 B;  5BNP A;  3AXD A;  2VNV A;  4YVW A;  4WM8 A;  5FP4 A;  5FY7 A;  4CE8 A;  1DQ2 A;  4HPK A;  4N7U A;  5C8C A;  4IER A;  4OLL A;  1ZRC A;  1BBT 3;  2HLE A;  2KR2 A;  1RVF 1;  1KXG A;  3RWN A;  4BQ2 A;  1LOE A;  3K4A A;  3GDB A;  2HWD 2;  1HJG A;  3MO4 A;  1RUH 1;  5AC9 2;  1QDC A;  4LKS A;  3NJV A;  2VC9 A;  4UFK A;  1HRV 2;  1S0D A;  3VBR C;  3ETP A;  3OGV A;  5B4X A;  2J1R A;  3ZR6 A;  3P3N A;  2RM2 3;  2AH2 A;  4MOA A;  3LD8 A;  1S55 A;  1PIV 3;  1CGP A;  5F6K A;  4QKB A;  3WNX A;  5LA1 A;  5JMC A;  3LDK A;  1QXR A;  3OGJ A;  2HKX A;  5FYC A;  3HVD A;  1RUE 2;  4CP1 A;  3OG2 A;  5CFC A;  4XZU G;  5ANN A;  2IWG B;  3POS A;  3RYK A;  4ATE A;  2EF6 A;  2O8O A;  3IPV B;  4LPL A;  4JZR A;  1SLB A;  4Q2F A;  1MPX A;  3NNF A;  2Q1M A;  5T5P A;  4QX2 A;  3OGR A;  3ZFE C;  1TME 2;  2EXI A;  4KNC A;  4QM8 A;  2G9F A;  4RR3 C;  4EYU A;  5CEH A;  4GZ9 A;  1FI2 A;  1AHS A;  2WLP A;  3WCS A;  5CFD B;  2E9Q A;  2R07 1;  3AVS A;  4R52 A;  3AXE A;  3UV9 A;  1DLC A;  4B4P A;  2PYT A;  5E6H A;  4FPC A;  1J59 A;  3UNP A;  2VBB A;  1C5I A;  3FL7 A;  3TNP B;  2DDU A;  1WW6 A;  1R08 3;  5A3O A;  4OI0 A;  4NRP A;  4QU1 A;  5FYM A;  1EP0 A;  2YFZ A;  4Q4Y 3;  3UJQ A;  4AFA A;  2JKX A;  3FUO A;  4FFI A;  4UI9 L;  5FZB A;  5F5C A;  3LA3 A;  5JIA A;  1Y9Q A;  2VW0 A;  1XOY A;  2D6K A;  4GA9 A;  5IHR A;  1NX9 A;  2BQP A;  4EN8 B;  3GAL A;  4QPY A;  1AR6 1;  1ONA A;  3E6B A;  3HWJ A;  3WP3 A;  1ZZ6 A;  2YU1 A;  4XJ8 A;  4GB3 1;  2GP5 A;  2NN8 A;  5DDJ 3;  1AX2 A;  2CL2 A;  3BOW A;  1XYN A;  3LB9 A;  2LW8 A;  4PDW C;  2Q8O A;  2E7Q A;  4FCA A;  1OI6 A;  1SFP A;  4JGZ C;  2JWP A;  5FZF A;  1JOJ A;  3SH3 A;  1JYX A;  4LBN A;  4NMI A;  2WFP A;  3PU3 A;  2WRA A;  1OD5 A;  1CX4 A;  1O59 A;  5GJ6 A;  1JYC A;  3D3A A;  1PGL 2;  1YEW A;  4XIL A;  4IGP A;  4AVC A;  2R06 1;  2VTX A;  1U0A A;  2OQ6 A;  3IMN A;  3T09 A;  1PZ7 A;  1FX5 A;  3FLR A;  1VAK A;  1JYN A;  3VL9 A;  3D82 A;  4WM7 B;  3ZSL A;  2EXH A;  4PCR A;  3JB8 A;  1UMZ A;  1SHW B;  3MF6 A;  5FMB A;  2X8K A;  4AAX A;  2HWF 1;  2ZGU A;  1AXK A;  1WME A;  1XYO A;  2D3S A;  2CDP A;  4QQL A;  4GH4 C;  2ZKN A;  1WWY A;  4MGZ E;  4MO3 M;  4Y33 A;  2YG0 A;  4JQR A;  3ZIW A;  2ZGL A;  4AVA A;  4Q4X 2;  1RUJ 3;  2CWS A;  5LY2 A;  3RPQ A;  1HXS 3;  5LW9 A;  4UXA A;  3HQX A;  3LOI A;  5HPO A;  4XUP A;  4N53 A;  5A32 B;  1STM A;  5LA0 A;  3BGA A;  2QNK A;  1MVQ A;  4LT5 A;  4GD4 A;  4CDW A;  2BGC A;  3PIJ A;  5LAS A;  2WFF 3;  2HWB 2;  1DU3 D;  1RUI 2;  1FNZ A;  1EY2 A;  2HWE 1;  1HB2 A;  3L9J T;  4YZ4 A;  4DMI A;  2C6S A;  1JXN A;  2GN3 A;  1DYP A;  3MUZ 1;  2R16 A;  4DS0 A;  1NCR C;  3BPS A;  4IE5 A;  1FOD 2;  3AZY A;  1LEC A;  5EIY B;  3IDB B;  2HWC 1;  4Y1U A;  5F3G A;  4OHV A;  4D7Y A;  1W9S A;  5L9R A;  2UWB A;  4FFH A;  1F5F A;  2FBE A;  2VR4 A;  5GLW A;  5C71 A;  5ACA 1;  4XJZ A;  5DXD A;  2PMW B;  3UKV A;  4AE2 A;  1PVX A;  3JZV A;  4NRM A;  3IWZ A;  4NUB A;  4FQZ A;  1DGW A;  1OH4 A;  4ZZ5 A;  3WEZ A;  5EFU A;  3T30 A;  2ZZJ A;  2HEY F;  3MI8 A;  1C8M 3;  1BKZ A;  4CCO A;  5FZE A;  3T1L A;  4TYS A;  5CFD C;  1PHM A;  3POG A;  1ULP A;  1AZD A;  1T2X A;  3THC A;  4DY3 A;  5JR2 A;  4S2H A;  4KWU A;  1UMH A;  3ABZ A;  5FMO L;  1L7Q A;  2YHJ A;  2VQU A;  1EV1 2;  2WNV B;  3VN4 A;  1K12 A;  5JXG A;  4DIN B;  2H0B A;  1CPM A;  1ZRD A;  4ZKT B;  4XJA A;  2ARB A;  1SAC A;  5AC9 1;  5BNO B;  3PTR B;  4UBG A;  5DAQ A;  3K46 A;  3USU B;  4FP2 A;  1HRV 1;  2YUE A;  3ZYJ B;  1Y7B A;  3KZ4 C;  4RFT 0;  4QKD A;  2PEL A;  1KGY A;  4IUG A;  1LOF C;  1FPN 2;  3PL0 A;  5CVR A;  4AG4 A;  2X5I C;  3CDZ B;  5FZD A;  1H2N A;  3OSD A;  4QX8 A;  4XQW A;  1CIY A;  1UO9 A;  4CDU A;  4AQS A;  3CNA A;  2B9U A;  3RJR A;  5FFO C;  5K8S A;  5FOJ B;  3GCW A;  5C4W A;  2PAE A;  4IND A;  3BVC A;  1A34 A;  1ULC A;  3D6E A;  4AVV A;  1TME 1;  3OUI A;  4MXW A;  3WG3 A;  3LOB A;  2GAU A;  4ES9 A;  4GQ7 A;  4DEV A;  3H8R A;  1RUD 3;  4EN7 B;  2GNT A;  2WS9 2;  4MG2 A;  3NRU A;  1GU3 A;  2P6C A;  4UBH A;  5EP9 A;  5JAX A;  3AKQ A;  2XJR A;  2WYF A;  5CB7 A;  1BJQ A;  4X8N A;  1VAV A;  1PO1 2;  2B7Y A;  2QQP A;  1CD3 G;  4E2G A;  2P17 A;  4Q5O A;  1VBA 1;  2RR1 3;  1UZ0 A;  4RS5 C;  1BBT 2;  5FY1 A;  1SLA A;  4XMA A;  3VKN A;  3NV3 A;  4KG0 A;  1W8O A;  4QXK A;  1JTZ X;  1WW4 A;  4JTO A;  4RSU A;  3OBT A;  4M4P A;  5E8A A;  5BNP C;  5HCH A;  1SBF A;  4YVW C;  4WM8 C;  5C8C C;  4YSF A;  1WCK A;  2WZE A;  2D97 A;  4MHR A;  4D94 A;  2DUR A;  4ZS2 A;  1SBD A;  1F2N A;  2RM2 2;  1IHM A;  1DIW A;  3AFK A;  3EBR A;  4P9X A;  4P9G A;  4ITC A;  4PLM A;  4JQT A;  3R4S A;  1PIV 2;  2ZML A;  4EJR A;  4MGT A;  1HRI 2;  1FNY A;  1GUI A;  1GZ9 A;  2ORX A;  2B8M A;  4GKY A;  1O3T A;  1W8W A;  1HX6 A;  2J1S A;  1W6M B;  3OGG A;  4XUR A;  5JXI A;  2W1W A;  1PGL 1;  3IZO A;  1HKD A;  3MFA A;  4BYY A;  4K21 A;  4ASM B;  1LB2 A;  5CFC C;  1XE8 A;  1RMU 3;  4A4A A;  2RVA A;  1JZ6 A;  1W39 A;  2GZW A;  2ZHK A;  3NL1 A;  5D2A A;  5A33 A;  3A23 A;  4A42 A;  3VBF B;  1J1T A;  3MW4 A;  3I7D A;  1B09 A;  1UIK A;  3AYA A;  1NE6 A;  4MUV A;  2XJP A;  3IDA A;  4M0H A;  1CZT A;  2VMC A;  3JBG 1;  4Q27 A;  4QGL A;  4OHY A;  2D93 A;  3SIT A;  1R08 2;  1CPN A;  1SPP B;  4XQ4 A;  3VZK A;  1QJE A;  3IKW A;  5CU1 A;  1H8T A;  1VJ2 A;  5TSW A;  4Q4Y 2;  2WAA A;  4XTM A;  3WNL A;  2V5Y A;  2XUE A;  3RFR A;  4YLZ A;  4QGN A;  1GNH A;  1YHF A;  4G4F A;  3I2O A;  1WLD A;  4PI2 A;  1PVC 1;  4IEX A;  2WNV C;  4CPB D;  2Y6J A;  4GJY A;  4AK3 A;  4M3C A;  5LK7 B;  2JDA A;  1XRU A;  2PHW A;  4IW3 A;  5DDJ 2;  1KD7 A;  5BNO C;  3GXU A;  1PNF A;  4XIK A;  4IV1 C;  4LBQ B;  3POE A;  3I3B A;  3ON7 A;  5T5J A;  1E5I A;  2HWB 1;  1RUI 1;  1OKQ A;  3NV4 A;  4OHX A;  5FJK A;  2OW4 A;  5T50 A;  3WIN E;  4BLJ A;  3K75 B;  4GXL A;  1MS8 A;  3ASI A;  2F6B A;  1FOD 1;  5F3E A;  3HQR A;  3OGS A;  4COW A;  5AFE A;  2CV6 A;  3PJQ A;  3CLP A;  1Z7S 3;  3WP4 A;  5FPU A;  3NJX A;  1W6Q A;  4BA6 A;  1ULF A;  3J7H A;  2Z2S B;  2A6W A;  2XJS A;  4XF9 A;  3NWK A;  1W99 A;  5FIX A;  4ZU4 A;  2H6B A;  4XXA A;  3N9P A;  4QPW A;  4FPJ A;  1ULG A;  1K5J A;  3MIC A;  3G6J B;  4HT1 T;  4MXV A;  3WDX A;  1WZX A;  5IAT A;  2WKK A;  4OI1 A;  3BTY A;  1LOB A;  1OLM E;  4YVS B;  2IVI B;  4IV3 B;  1RJ7 A;  3M3C A;  3I59 B;  4DRR A;  3LSE A;  4V2V A;  2CTV A;  1LNS A;  1VBD 1;  2VUD A;  3ZDS A;  2JG8 A;  3FBM A;  3VBO B;  2VZV A;  3AZV A;  1RUJ 2;  5FY0 A;  1CAV A;  1HXS 2;  2YBP A;  3DXU A;  2DVF A;  2J1U A;  4I30 A;  1RL3 A;  2JX9 A;  4Y22 A;  2VUL A;  3TN9 3;  4LKD A;  1WD3 A;  3MYX A;  3C2U A;  5AFB A;  4AQT A;  4XDP A;  2IVJ A;  3GBW A;  2RDS A;  4WZC A;  4HXC A;  3ZFF A;  2G9Z A;  5A3W A;  1QJZ A;  2BEO A;  2UWC A;  3OJB A;  4B4Q A;  5FO9 B;  3ME2 A;  2BNM A;  3LF7 A;  4DB5 A;  2WFF 2;  4FOW A;  1YQ8 A;  1PMJ X;  4WVM B;  2JE8 A;  1PZ8 A;  4N53 C;  3BYW A;  2PA7 A;  5FYZ A;  3DUI A;  2O8Q A;  4XF1 A;  4L2N A;  2B39 A;  4TLG A;  4XQD A;  4CDW C;  1Y43 B;  3WDW A;  3B93 A;  2D3R A;  1PX3 A;  1XXN A;  4ATF A;  5JDB A;  1GWL A;  4LLO A;  3SKJ E;  3ZXD A;  4OHZ A;  4CU7 A;  2RS5 1;  1MR5 A;  2JXA A;  3GGL A;  1EUU A;  5KHH A;  5C33 A;  3HNM A;  1QWR A;  3T08 A;  5ABJ B;  1DDL A;  2WO2 A;  1O8P A;  4DFS A;  3O1U A;  1Q56 A;  1BVV A;  4CSW A;  2WS9 1;  3FWE A;  1J83 A;  3IBM A;  3LFI A;  1C8M 2;  4RQP B;  3U14 A;  4AGV A;  4CEW B;  2GC2 A;  1NQJ A;  2XWB B;  4P14 A;  4AHY A;  1PO1 1;  1X8E A;  4K1Z A;  1GWM A;  2W94 A;  1OSG A;  1XE0 A;  3SEE A;  5A7P A;  1GZW A;  3IAP A;  4YWA A;  1BBT 1;  3MGU A;  3VD5 A;  1QEX A;  2AGS A;  1GV9 A;  1ODM A;  2DCZ A;  3R4U A;  4CXY A;  4L0P A;  2W87 A;  1YIF A;  3NVC A;  3X29 B;  1YQ6 A;  2DCY A;  1UXX X;  5GLZ A;  1MQT A;  4AVT A;  4W8J A;  4ASK A;  5F39 A;  3V0B B;  1G9F A;  1LUL A;  3SCF A;  1PK6 B;  2ZKL A;  4LE4 A;  3R6S A;  3GF6 A;  2WLQ A;  3T4V A;  3OUJ A;  2RM2 1;  1HB3 A;  3MPB A;  4Q4V 3;  1JOP A;  1PIV 1;  1WCU A;  4UFH A;  3THT A;  3AMQ A;  2VOV A;  3VHR A;  5FPX A;  1P8J A;  4TSV A;  2P34 A;  2ZAB A;  2CSG A;  5F2S A;  3AP9 A;  1UMI A;  4HZF A;  5JSR A;  3VBR A;  4D7T A;  4AED C;  2Y26 A;  3RMX A;  3TEZ A;  5JXH A;  1QXJ A;  4Y5Z 0;  1X82 A;  2ARX A;  5FY5 A;  5FXX A;  1CAU A;  4UF0 A;  4LBQ D;  4FBF A;  3M3I A;  1DBN A;  4PF1 A;  1BHG A;  2QQI A;  3ILF A;  4EWA A;  4SLI A;  3WOG A;  1WLC A;  3RVH A;  3NV1 A;  4OI4 A;  4TWT A;  5E1R A;  2WO3 A;  3CEW A;  3Q8F A;  4FPH A;  2P4E A;  4CCL A;  5H9R A;  1RUD 2;  1G9B A;  2PHF A;  3POW A;  5CZK A;  1Q8O A;  5C4W C;  3I3M A;  3FHI B;  2BOJ A;  4P5Y A;  3ZFE A;  4OMC A;  1GQH A;  4ET7 A;  2RR1 2;  4Q4Y 1;  3T3Y A;  1DFQ A;  1PGS A;  4BWO A;  3PU8 A;  5FZO A;  4ZZ8 A;  2XL7 A;  3GJB A;  5LY1 A;  1O5U A;  3VBU B;  5FY9 A;  2TEP A;  1UYY A;  1W28 A;  3VBO C;  4NAM A;  4XCA A;  3FE5 A;  3I2I A;  1EAH 3;  1OVS A;  2LTN A;  1GNY A;  3PVN A;  2FCT A;  2DVG A;  1GOG A;  3J9S A;  4FFF A;  4QQ2 A;  3I3D A;  5KC6 A;  2ZMN A;  4KMQ A;  5I8Y A;  3U10 A;  1MS4 A;  1DYO A;  5DDJ 1;  1ENX A;  1W2U A;  3HQU A;  4FPO B;  3N9L A;  4P9J A;  1UQX A;  1V6L A;  4I0A A;  3BOP A;  3H3U A;  4P9I A;  1HV0 A;  1VBC 3;  3WG1 A;  3WW4 A;  2MEV 3;  2WSV A;  1G9D A;  4XFC A;  4QU2 A;  4YG0 A;  1AX1 A;  2XVL A;  4XCB A;  2BNN A;  3JU9 A;  3MUY 1;  5K0U C;  3LKJ A;  4L97 A;  3OTF A;  1K45 A;  3THP A;  4NE9 A;  3AX4 A;  4IEP A;  4XUN A;  1DGL A;  3E5X A;  5F3I A;  5FUN A;  5J98 B;  1RXG A;  5FLI A;  5J96 B;  3V64 A;  1RMU 2;  2VOX A;  5ERL A;  3ZYF A;  4KWK A;  3FC0 A;  3DEC A;  4ZU7 A;  2TUN A;  1D2Q A;  2EAL A;  3WY6 A;  3DV8 A;  4GWM A;  3QD6 A;  5J37 A;  2A6V A;  3QOP A;  3VBH A;  2ET1 A;  2XKO A;  4Q8K A;  1GZC A;  4S2F A;  4DXS A;  3P5B A;  5IVE A;  3ACH A;  4RQP C;  1U5Y A;  3ZIX A;  5A3L A;  4L9B A;  1CR7 A;  1UZW A;  1VRH 1;  4R9A A;  4O7X A;  2FQP A;  4DO0 A;  1H1M A;  3OPZ A;  2DVB A;  4LKF A;  1QJU 3;  3H0O A;  2XLF A;  1UKG A;  4LO8 A;  5FZG A;  3USS A;  2EXK A;  4D7S A;  2ZGS A;  1DZQ A;  5DZF A;  1XU2 A;  1ZZC A;  3LAG A;  2JDN A;  4CDQ B;  1Y9G A;  4GH4 A;  1N3O A;  1SDW A;  4YW7 A;  2FDK A;  1NAE A;  2QQN A;  4RGG A;  2R30 A;  3O1T A;  1XNC A;  4CCE A;  2JDY A;  2IXI A;  3WW1 A;  2P5B A;  1S0G A;  2E53 A;  3NKT A;  4TTG A;  1CZV A;  4GJZ A;  1OOP B;  1ULO A;  4XHX A;  3ITQ A;  3KT7 A;  1UZZ A;  2XH6 A;  1SBE A;  4P9Y A;  1T6B X;  3ZN5 A;  4BK4 A;  1CN1 A;  3K3N A;  5L7O B;  4OYU A;  1ZYB A;  5EWS A;  4AFD A;  1O8S A;  3NJY A;  1Z7S 2;  1QHD A;  2VM9 A;  4GIQ A;  1CON A;  4D6R A;  1S2E A;  1NXD 1;  3WV6 A;  5C5U A;  2AEZ A;  4KGQ A;  2DBN A;  3S57 A;  3QLQ A;  3UGF A;  1W8F A;  1DQ1 A;  2CGO A;  5DAV A;  5LCW L;  1E5S A;  2CY6 A;  5L9V A;  3T0B A;  4BLI A;  5A1F A;  4YW5 A;  1UU5 A;  5FZ4 A;  4A44 A;  3JQX A;  4CRQ A;  4AWD A;  2PLV 3;  1C8M 1;  1PM4 A;  1H6X A;  1QJX 3;  3B9C A;  3ELN A;  3I97 A;  2XON A;  2QZ2 A;  2YZ4 A;  2VTF A;  1MEC 3;  1S0I A;  3GZA A;  1QF3 A;  3H8U A;  3IPV A;  4ISQ A;  3W9A A;  1W3V A;  1BK0 A;  2F4L A;  3N3H A;  5KXB A;  2QZ3 A;  2D6M A;  1CES A;  2Y64 A;  5JR7 B;  1UYP A;  3O1R A;  5G05 L;  5F3C A;  3C8X A;  5CFD A;  3ECQ A;  3ALQ A;  1CIW A;  1JYT A;  2YGM A;  3TN9 2;  2JG8 C;  1AR9 3;  4LO4 B;  4QX5 A;  4ZXE A;  4E4D X;  1XQN A;  4WVZ A;  2OVU A;  1NXM A;  4XPV A;  4AFC A;  4E8C A;  2K9Z A;  2A71 A;  1MS9 A;  1BCX A;  4Y1V A;  5LB6 A;  5FWJ A;  1COV 3;  2KA3 A;  3BTX A;  4DXZ A;  4LOT A;  2GH8 A;  5ANQ A;  3D0S A;  1H4H A;  2YGL A;  3VD9 A;  4GAL A;  2WIN B;  1G6N A;  2GU9 A;  1A6C A;  1JMU B;  1WBL A;  1ZZ7 A;  2JDH A;  2VCB A;  1KS5 A;  2VNG A;  3LPF A;  3OPW A;  4LHL A;  3WNN A;  3ZFF C;  3CQO A;  3KT4 A;  3OBZ A;  4Q4W 3;  3OD0 A;  1MZE A;  1NZI A;  1W06 A;  1TEI A;  3B00 A;  3POY A;  4MYE A;  1JZ4 A;  3KCC A;  3S7I A;  4XYX A;  1RGS A;  1YFY A;  2KM2 A;  3B7M A;  2RJ2 A;  5EXO A;  4JV4 A;  1VRB A;  2D40 A;  4HK8 A;  1A8D A;  1V6O A;  4H14 A;  4AEM A;  2VTX J;  1L7L A;  2ZEX A;  4O9G A;  3VDD B;  1UW8 A;  2GSY A;  2R1B A;  3GNE A;  1CZS A;  1MVE A;  4LMF A;  2W0X A;  5FBZ A;  4FP3 A;  5H9Q A;  4B7E A;  3N7M A;  2J22 A;  1RTV A;  2OS2 A;  2RR1 1;  5BNN B;  2YV8 A;  5JOX A;  3IDC B;  4W65 A;  5D8A B;  2RMU 3;  3M3Q A;  3ZYR A;  4EN0 A;  1RUC 3;  1F4H A;  2C0Z A;  3A0N A;  3DPR B;  3SCH A;  4WM7 A;  4A45 A;  3ZFG B;  4AEJ A;  1UOF A;  1S0C A;  3HT2 A;  1NZC A;  1W9Y A;  1V00 A;  4MGY E;  3ZPO A;  1W03 A;  4QDR A;  3AJY A;  1VMF A;  3RS6 A;  3WW3 A;  1IPK A;  1NCQ B;  5FOB B;  3H1M A;  3JCI A;  4JKM A;  3RYR A;  3CBN A;  4Q4V 2;  1UX6 A;  4DUV A;  4URA A;  2JG9 B;  1MQT C;  5GZC A;  1VBB 3;  2XOM A;  5LZ6 A;  2ZJC A;  4R4Z A;  3AC0 A;  4XF4 A;  5LWB A;  1ZBE 3;  5HV0 A;  3TAY A;  3GZT B;  1ZX5 A;  2VG9 A;  1NA1 B;  1IS5 A;  2BPA 2;  4XW3 A;  2NZ9 A;  4HBN A;  3WF1 A;  1W2A X;  2PFW A;  3TEW A;  1OKO A;  4JGY B;  3WQB A;  1F35 A;  1LOD A;  1O4Y A;  4QPI B;  5A32 A;  2VMI A;  2D43 A;  3R0R A;  1NY7 2;  1HN0 A;  1R09 1;  2AC1 A;  3GBG A;  1RMU 1;  4KL1 A;  1NE4 A;  5C3Q A;  1L7R A;  4M0N A;  3ZSK A;  2VOW A;  1Q8Q A;  5LEK A;  1LHO A;  1HRI 3;  1WGP A;  2K0G A;  1PX4 A;  1WMX A;  3J7M A;  3HJR A;  2WT0 A;  3OBR A;  4M4R A;  4NAO A;  4BHP A;  5F7U A;  3TEY A;  3AKS A;  4F83 A;  4CP2 A;  5T3N A;  4RN5 A;  4UOJ A;  4COV A;  2E33 A;  2WAO A;  3ZYP A;  4IES A;  5IYY A;  2E7T A;  2W39 A;  2WT1 A;  3EJK A;  2I45 A;  2XML A;  1JN2 P;  1UU4 A;  4Q0U A;  5FYV A;  2QE3 A;  1F31 A;  4YGC A;  4DXT A;  5FR3 A;  1EAH 2;  4LBL A;  3TEX A;  3WDT A;  2WC2 A;  5T54 A;  4D6S A;  4CDX B;  2JEC A;  5IVY A;  5F32 A;  1HQW A;  4LUK A;  1FAY A;  4G3Y C;  4DIQ A;  1Q43 A;  2ZZQ A;  3PVO A;  4UFL A;  1HB1 A;  3WVJ A;  4CPB A;  1VBC 2;  3FFZ A;  4UWD A;  2MEV 2;  1DGW X;  2QQU A;  3FX3 A;  4Q0Q A;  4QX7 A;  2JE7 A;  1AR7 3;  4XDO A;  3SKV A;  4AZZ A;  5BYN A;  5C6C A;  3VKF C;  2WNV A;  4HG6 B;  2RE9 A;  4OI2 A;  4QPG B;  1ASJ 3;  3KVA A;  4DXR A;  1AXZ A;  4HKO A;  5BNO A;  1Z7S 1;  3FUQ A;  2W47 A;  2EXJ A;  3USU A;  3ZDV A;  2VL4 A;  4IV1 A;  5FK8 A;  3VLB B;  5JLV A;  4UW6 A;  5IFT A;  4COY A;  2Y6H A;  2W95 A;  4BK5 A;  3J8F 2;  4LOS A;  5J1X A;  5IVJ A;  5IK4 A;  3LE0 A;  1FV3 A;  1OQ1 A;  1C3H A;  3KVB A;  1RUG 1;  2R0H A;  1VB2 A;  2PHL A;  5FZC A;  5C70 A;  3WG2 A;  2LRO A;  2C9A A;  2P1B A;  1C1F A;  4CU9 A;  5FZK A;  3LQC A;  5F9T A;  1OA3 A;  2DFC A;  2Q5T A;  2RJK A;  4YW1 A;  1URX A;  2AYH A;  1LGN A;  3R4D B;  4DRV A;  4E4H A;  1CX1 A;  4L11 A;  1OLM A;  1U5Z A;  2ZHL A;  1I9R A;  1WBF A;  3LZZ A;  4HVO A;  1B35 B;  1QJU 2;  4IEU A;  1GR3 A;  2GH2 A;  5LBC A;  2ZEW A;  5FQ0 B;  3T4H B;  4E4S A;  5BNN C;  1AYM 3;  5F2W A;  3W21 A;  5L19 A;  3M3O A;  4P9L A;  5D8A C;  4ARY A;  2JD4 A;  3M3E A;  4AXO A;  1N1S A;  1OD3 A;  1RYY A;  5EJ1 B;  1JOB A;  3A21 A;  3CL1 A;  3MHZ A;  5EPA A;  3NNM A;  4BMB A;  3TN9 1;  1JHJ A;  3N36 A;  3ACL A;  3D4K A;  3OYW B;  1ZBA 3;  3NAP B;  2GME A;  3VZL A;  1DGR A;  3AP6 A;  3K77 A;  4N9I A;  5DAP A;  3RGB A;  3PVE A;  3PVB B;  3UJO A;  3ZXA C;  3LFM A;  1BVP 1;  5J48 A;  3HBZ A;  4IE0 A;  4EZH A;  3JXS A;  1DLL A;  2WN2 A;  2B4K A;  3ZYG A;  3V0A B;  1S4C A;  4YGE A;  3RG0 A;  4Y4Y A;  3K4Z A;  2Q8E A;  2MPF A;  4GMP 3;  2AZ5 A;  3MFC A;  3NNG A;  4Q26 A;  1UOJ A;  2FMD A;  4HN0 A;  1DCS A;  1T6G C;  2JD9 A;  4BIS A;  1KIT A;  3ZXL A;  1UYZ A;  4WZF A;  5CG8 A;  3U37 A;  1V6M A;  1OC1 A;  5A3T A;  4OQ9 A;  2X10 A;  3VV1 A;  2PLV 2;  1QJX 2;  3C7O A;  1W6M A;  5JWP A;  1MEC 2;  2UYB A;  1H2M A;  5A7O A;  3TNQ A;  3WQ0 A;  1APN A;  1XNB A;  3PNA A;  1QOO A;  4JDN A;  3RNS A;  3ZLI A;  1GLH A;  2VZ1 A;  4K1Y A;  4L92 A;  3S5A A;  2ARA A;  1JS9 A;  1XB9 A;  2ZGR A;  4B7K A;  1DF0 A;  4Z1V A;  2ZA9 A;  5FZ9 A;  4IET A;  4HL0 A;  2IFW A;  4MAD A;  4QAW A;  4AFB A;  3O1M A;  3VBF A;  1V70 A;  1UNB A;  2Z5W A;  2AEY A;  3C7E A;  4IE4 A;  2YPJ A;  1IQD C;  3WDU A;  4IEO A;  5F37 A;  4HFS A;  1G86 A;  1GMM A;  1AR9 2;  4A41 A;  3HN1 A;  3H42 B;  3QBQ A;  3UGH A;  1KRI A;  1O4T A;  2YXS A;  2GDF A;  1SPP A;  4Q4V 1;  3NJZ A;  2FDH A;  3ZOI A;  2FMY A;  1YYN A;  4AQ2 A;  2W92 A;  2FDG A;  1X33 A;  1J3Q A;  1JUI A;  1COV 2;  4DNY A;  1Y9M A;  5D21 A;  4BXF A;  3FLP A;  1WLT A;  5FUP A;  3LGR A;  5JUV A;  1JZ8 A;  1J3R A;  2VH9 A;  1WKY A;  5FZI A;  5FKB A;  1ND2 B;  3B01 A;  3MLJ A;  3PHM A;  4MGI E;  3SH5 A;  3TRS B;  1QOT A;  5JOW A;  2HWD 1;  2G9G A;  4Q4W 2;  1ZA4 A;  4QPG C;  1ENS A;  4AFM A;  1DZT A;  2ORZ A;  1X50 A;  2EIE A;  5F8P A;  1ZZ8 A;  3L2H A;  4LBQ A;  1RED A;  4AED A;  5J7M A;  2VZQ A;  3LSD A;  3HNY M;  1ND3 B;  2VW2 A;  5JZG B;  5KHG A;  3N9M A;  4RGK A;  4ZU5 A;  1RUE 1;  3OBA A;  4YM0 A;  4Z8B A;  2WT2 A;  4B8E A;  4FTE A;  2JEM A;  5FPZ A;  4LBJ A;  2D7F A;  2R1D A;  2RMU 2;  4QQH A;  3HR9 A;  1RUC 2;  3KLS A;  4AVS A;  2H0V A;  1POV 0;  5FK7 A;  4FQ4 A;  4W50 A;  3CZJ A;  1B35 C;  1EAH 1;  2PN5 A;  4KWL A;  3KMH A;  3ZSJ A;  1H2L A;  3UT0 A;  1QKQ A;  2VCC A;  4MGK E;  3CKH A;  1LED A;  4IV3 A;  4UFM A;  4YVS A;  3I59 A;  4JDO A;  4LUL A;  2DYC A;  4NR1 A;  4WM7 C;  3VZJ A;  4CCD A;  2NP0 A;  1ACC A;  3I2G A;  1C57 A;  1VBB 2;  1HJF A;  2MEV 1;  2W9X A;  3WLU A;  4ARX A;  1RUO A;  3VBO A;  4HSJ A;  3NAP C;  4XJW A;  5FRE A;  1W05 A;  1ZBE 2;  1LTE A;  3AJZ A;  5CIS A;  3QCW A;  3WF0 A;  3SNM A;  3DKW A;  3SXW A;  1C8N A;  1SLL A;  3ZYI B;  2VY0 A;  2O14 A;  4IQP A;  1IOA A;  1S0F A;  3C7H A;  5HBA A;  5G04 L;  2XPJ A;  3POF A;  4X8P A;  3SH4 A;  5EHD A;  4O61 A;  4FT8 A;  1D4M 3;  2JKB A;  3ZKU A;  1UY4 A;  4FOV A;  1M06 G;  2WSU A;  2EIB A;  3CJX A;  1UD1 A;  4YW3 A;  1CJD A;  4WVM A;  2P3Y A;  1W0O A;  1PGW 2;  1N47 A;  4I3G A;  3U75 A;  1OBN A;  4QT6 A;  1LEN A;  3NW4 A;  1I1E A;  1XSR A;  4XDQ A;  1YFU A;  1UYX A;  4OUE A;  2CDO A;  2LM3 A;  5FZ6 A;  2ILM A;  2R7E B;  3RSJ A;  1EPZ A;  3CO2 A;  5FV3 A;  4G9S B;  3TB0 A;  3WSO A;  5C3P A;  5ABJ A;  1VE0 A;  3B69 A;  4HAN A;  1UWW A;  3EHK A;  3E6D A;  3LEI A;  4QMA A;  2BWC A;  3GYD A;  4FVV A;  4OZX A;  2FCV A;  4CEW A;  1KDM A;  4RQP A;  1OUR A;  1N1Y A;  2A3W A;  2QQK A;  3VUO A;  3ETQ A;  2E51 A;  4QXC A;  4HLT A;  3SMH A;  3HMY A;  2IXJ A;  2DCT A;  2DV9 A;  5KHK A;  4K8R B;  1VBE 3;  4NHX A;  1G9C A;  4L8Q A;  4MLO A;  1AR7 2;  1YC6 1;  3KF5 A;  4R9D A;  3VDA A;  3LA2 A;  4B29 A;  4XAC A;  5A1L A;  1R1Z A;  4GKX A;  1H9W A;  1IGO A;  1YFW A;  1FMD 3;  4UFJ A;  1ASJ 2;  3POJ A;  3KQR A;  4Q4X 1;  1OQD A;  5CNA A;  3V0B A;  2YBK A;  4OUM A;  3RMY A;  4ZHN A;  1H2K A;  1PK6 A;  2E6V A;  1RUF 3;  3VD3 A;  3ES1 A;  3LPG A;  1ND2 C;  3KV6 A;  4EZ4 A;  1JZ3 A;  1W9W A;  1CQ9 A;  1W9T A;  1I5P A;  4Z07 A;  3S5Q A;  3GZU C;  4ONU A;  5L36 A;  1YIP A;  1QJY 3;  1K5M B;  5J3U A;  1S2K A;  1YRZ A;  3I4I A;  2ZGP A;  1QJX 1;  3AYC A;  1ZVF A;  2J1A A;  4KU7 A;  4AR2 A;  1Q3E A;  1XU1 A;  4N43 B;  1LGB A;  5FYT A;  1MEC 1;  2VVD A;  2BW8 A;  2A6Y A;  3W5M A;  1CWP A;  3PIG A;  4KQ7 A;  2C26 A;  4LR4 A;  1D0G A;  3CJI B;  2XHK A;  1VLN A;  3EYP A;  3H1Y A;  4QHB A;  4D8M A;  3VD4 A;  1DQ5 A;  3W20 A;  2VMD A;  4PJY A;  3WNK A;  5A7N A;  5CBL A;  4HVR A;  2Y38 A;  2PHR A;  1AYM 2;  4PI0 A;  4BQ4 A;  5FZ3 A;  1UF2 C;  4JDM A;  2R07 3;  2NMN A;  2VZ3 A;  1OPM A;  2HJI A;  4GWN A;  4P08 A;  1AR9 1;  3UKN A;  4FPE A;  3AYE A;  1J3P A;  4AHX A;  1ZBA 2;  1POV 1;  1IKP A;  3RZH A;  3ATG A;  3ZR5 A;  3LIH A;  4ZS3 A;  2XWJ B;  4KBZ A;  1COV 1;  1O4Z A;  2XHN A;  4KU8 A;  4LUM A;  1UX7 A;  4FAH A;  3ZO0 B;  1F15 A;  1YNA A;  4LO7 A;  3P1I A;  4TLF A;  2R49 A;  4EE2 A;  2IXC A;  3VBU A;  1TVG A;  2DVD A;  4YNI A;  3CZU A;  1XYP A;  2D6L X;  1W8H A;  2VNR A;  2HH9 A;  1EV1 1;  1UXZ A;  3MIH A;  3MW3 A;  3ZXK A;  4Q8L A;  4R9B A;  4Q4W 1;  2NPI A;  4KBB A;  3PUA A;  2J1E A;  4X6Q B;  5DG2 A;  4P9W A;  1HIX A;  3CMG A;  3UYJ A;  1ZRR A;  4YZ1 A;  5FXV A;  1LHN A;  2I2S A;  1HQL A;  4OCT A;  4XEZ A;  4JCK A;  4LJH A;  2Y6F A;  3ZM8 A;  3WD5 A;  4BQ3 A;  5LA2 A;  1FPN 1;  4LNV A;  3AMN A;  1YI9 A;  4RL7 A;  2WN3 A;  3JD7 3;  4LHK A;  5F5I A;  3ZMO A;  4PQ9 A;  3AK0 A;  4XFH A;  1A3K A;  2VQ0 A;  3MEP A;  5JCT A;  5IUQ A;  4JKL A;  4JRL A;  3H7Y A;  2RMU 1;  1W0N A;  5SV5 A;  3WDV A;  4YAR A;  1UPS A;  4OQ8 A;  1VMJ A;  4A3X A;  4Y20 B;  4TN7 A;  1UOG A;  4XIO A;  1IKQ A;  3RDI A;  4TZD A;  3ACG A;  3URF A;  1VAM A;  1FT9 A;  3MV0 1;  5C9A B;  3MZH A;  2W1S A;  1IZ3 A;  4S2D A;  4JHZ A;  3S7E A;  1XC6 A;  3LDB A;  3BN6 A;  2PHU A;  4MHU A;  2CYF A;  4M3C F;  3H3Z A;  4GMP 0;  2L9L A;  3SHR A;  3ST7 A;  5C5T A;  3T2P A;  2D98 A;  4PLN A;  2PQS A;  1HV1 A;  2ZGN A;  3VBF C;  4AHW A;  3VB9 A;  1E57 A;  5I8T A;  3ZSM A;  1JH5 A;  4FPK A;  4IEQ A;  4NRO A;  1CAW B;  3WG4 A;  2VW1 A;  1U12 A;  4CDQ A;  2V4A A;  4NHK A;  4OVE A;  3AKR A;  4MH0 E;  4LXL A;  5FPL A;  1RIN A;  1JBC A;  1LHV A;  4FO9 A;  4MSV A;  3T1M A;  4HET A;  5I0S A;  1JYI A;  3POB A;  2FDF A;  3BU0 A;  3KGL A;  1LU1 A;  1REF A;  4E27 A;  2ZGO A;  4AYU A;  2W5F A;  5JOY A;  1PNG A;  2DUO A;  1ULE A;  1WMD A;  3EB7 A;  1X36 A;  1OOP A;  2G19 A;  2JB8 A;  3RI8 A;  1OT5 A;  2RDR A;  1HRI 1;  1W0P A;  5K7P A;  3WT3 A;  2W2I A;  5L7O A;  2VXJ A;  4BE3 A;  3ZN6 A;  3ZYH A;  3BI3 A;  3ENR A;  1PO2 3;  2W68 A;  1MZF A;  2HWC 3;  2W3J A;  4IL7 A;  2ARE A;  2OPK A;  1SFN A;  4BB3 A;  5L9B A;  2PHD A;  3VDB A;  3F2Z A;  4B1M A;  5IK5 A;  3BU7 A;  5FAX A;  5ACA 3;  2DFB A;  1AX0 A;  4YZ3 A;  4XJU A;  5EQU A;  1MAC A;  3AP4 A;  2FCU A;  5F5A A;  4C0B A;  3N9Q A;  1BEV 2;  1H30 A;  2ZOE B;  1TE1 B;  4FI9 A;  4DUX A;  1AJK A;  3JB4 C;  5CAD A;  2D3P A;  2PAM A;  1VP6 A;  3OEB A;  2GAL A;  4NRQ A;  1SEF A;  4NPL A;  2BJS A;  2WQ4 A;  4YM2 A;  5BUV A;  1AR7 1;  1R08 1;  2C1F A;  4QX3 A;  1YWK A;  2DCJ A;  3SLI A;  4LQR A;  4BU2 A;  4YVS C;  4IV3 C;  1ASJ 1;  1D2S A;  2QKD A;  5I93 A;  1YJK A;  5JPN B;  1F9K A;  3PTY A;  4Z2A A;  3HEI A;  3A4U A;  3VHO A;  1AL0 G;  4F8A A;  4Q0S A;  1D4M 2;  4J1X A;  3WF3 A;  1HB4 A;  1JYW A;  5I0D A;  3WXP A;  4X6R B;  3DXT A;  1H1I A;  4ZY9 A;  3GBF A;  2V4V A;  5T5O A;  3N7L A;  5CA6 A;  4NII A;  3PME A;  3E1F 1;  2HYX A;  2V73 A;  2EIG A;  3PDQ A;  4FXK B;  4KGG A;  4LA2 A;  2RDN A;  4QQO A;  5JPM B;  4OHW A;  3LIG A;  3BUC A;  4DZG A;  2Y60 A;  3HIF A;  3OY8 B;  1QGL A;  3ZPY A;  1N3Q A;  4P02 B;  3MW2 A;  1OH3 A;  1JU4 A;  1NG0 A;  1W6P B;  4BXS V;  1W6O B;  3ACI A;  1UZV A;  5I0T A;  1ZRI A;  4UT5 A;  1ENQ A;  3J7L A;  3KWV A;  3N35 A;  1Q8V A;  3J8F 3;  5I0R A;  3VDD A;  1C4R A;  2WNU B;  4CEY B;  2V5D A;  1GKB A;  1ZBA 1;  2XR4 A;  3CIH A;  5JSP A;  4XAA A;  3A7Q A;  5ABJ C;  4NPM A;  3W5N A;  3INA A;  2VNO A;  2WQZ C;  1VBE 2;  4BCU A;  3ILN A;  5BNN A;  4KH9 A;  1RIR A;  1VBA 3;  2P3K A;  4QHO A;  2JB4 A;  5D8A A;  4CEW C;  2PTM A;  2XJU A;  3O5S A;  5KHI A;  2CAU A;  5EJ3 A;  2DBI A;  3DPR A;  3D0J A;  2D6O X;  1FMD 2;  4Y5S A;  2OUH A;  3ZFG A;  4AI3 A;  4LIV A;  4GMP 1;  1S0J A;  1RUJ 1;  3GHM A;  2DCK A;  4IEZ A;  1US3 A;  1HXS 1;  2RDQ A;  1RUF 2;  4I09 A;  1NCQ A;  1TNR A;  3B02 A;  4DEQ A;  5E89 A;  2OKX A;  4BJ0 A;  3NO8 A;  1S0B A;  4A7Y A;  2JG9 A;  2AUY A;  3UK9 A;  3NNL A;  2XBO 3;  1UKR A;  3I3Q A;  4N8M A;  1WUV A;  1F4A A;  1QJY 2;  1OUS A;  3I54 A;  1V9U 3;  5C3O A;  4Z82 A;  1PK6 C;  3VBS B;  2A5Z A;  2XLA A;  4GWI A;  1NA1 A;  4LHN A;  4KWJ A;  2WFF 1;  3QH6 A;  1QU0 A;  4JC1 A;  1U5I A;  1H4G A;  2Z79 A;  3IAQ A;  3LCP A;  4K7J A;  4BIO A;  2VAU A;  3E97 A;  2C4X A;  4FPF A;  1UY1 A;  3VD7 A;  4JGY A;  4QPI A;  4ZPI A;  1QOS A;  5IK8 A;  1O6U A;  1V6K A;  4JAA A;  2R04 3;  3MLL A;  5FMD A;  2BVB A;  3EXU A;  4QGM A;  2A3X A;  2JDU A;  3WF4 A;  5DMY A;  5CKM A;  4EV0 A;  3EO6 A;  3RI9 A;  1Q8P A;  4HVQ A;  2J1T A;  3VBH C;  1QDO A;  3H9A A;  3M1H A;  2VOT A;  3T2T A;  1OLQ A;  3O0W A;  4FSJ A;  1XE7 A;  2A70 A;  2R07 2;  3D5O A;  1YJL A;  2J7M A;  3B94 A;  3KHB A;  3OPT A;  4LBO A;  3S0M A;  1O3R A;  2D5H A;  1GFF 2;  1YQC A;  3JBG 3;  4IEV A;  2WZP P;  3WHT A;  1XSQ A;  1GIC A;  3MBW A;  4EN9 B;  4BQY A;  4EWE A;  3SIS A;  3KCY A;  2VUC A;  1R64 A;  1W90 A;  1QQP 3;  5DG1 A;  4YFW A;  4M3C E;  4Q29 A;  2E63 A;  4ORF A;  5DAB A;  4Z92 B;  2ZEZ A;  1PVC 3;  2W1Q A;  4H7L A;  2BBV A;  4WBB A;  2PAK A;  1MS3 A;  2A75 A;  1VMH A;  3DL3 A;  4CDX A;  3VBU C;  4CYD A;  4BM8 A;  2QUO A;  5FCC A;  4RD7 A;  3B3Q E;  5B2G B;  2QBX A;  4NO4 A;  2WO7 A;  5K0U A;  2BOI A;  1NLQ A;  4QPG A;  5FPV A;  2WL1 A;  3VHN A;  3JD7 2;  4PF5 A;  3WNM A;  4MX3 A;  3WW2 A;  2VME A;  1FYU A;  2G4I A;  3DEM A;  1GQP A;  5F5Q A;  5EZW A;  3LWC A;  2QTW B;  4RR3 B;  4Y3O A;  5C8W A;  2DF7 A;  5I8S A;  1DP0 A;  5FZA A;  4XC9 A;  4CP9 B;  4LEJ A;  2WO1 A;  2WZR 3;  5A7W B;  4CXW A;  4XFA A;  2BU9 A;  3HBK A;  3HN3 A;  1KJR A;  5A6X A;  4NIG A;  4A3Z A;  2VJX A;  2QQM A;  1QIQ A;  1RUD 1;  5CYY A;  3KCX A;  4NWW A;  5FYS A;  2XB6 C;  3IMM A;  1REE A;  4LA3 A;  1I3H A;  2ID4 A;  1VBD 3;  3W59 A;  3WZ1 A;  2VMF A;  1ODN A;  1B35 A;  5EJZ B;  5FQ0 A;  1KFX L;  1CAX B;  5HCB A;  1O3Q A;  1JW6 A;  2ARC A;  3ROU A;  1W6N B;  3MID A;  1X7N A;  3SEP A;  1DQ6 A;  4V2W A;  3LDR A;  1ZZB A;  2QQJ A;  3FJS A;  1K3I A;  4PDW B;  4I2O A;  3OYW A;  4UAP A;  2Q1Z B;  5H9P A;  4HKW A;  3NAP A;  4JGZ B;  4QB6 A;  2K2S A;  1SQ4 A;  2MHF A;  3GZE A;  2XLG A;  4CDQ C;  4XF0 A;  2A6X A;  1SDD B;  3WR0 A;  1LES A;  4ASL A;  2LS6 A;  5JI9 A;  3V0A A;  2BZD A;  4QM9 A;  5EYX A;  5HXV A;  2R32 A;  4Y1Y A;  5DUU A;  3VZM A;  4FAG A;  4I0W B;  5FBJ A;  5B4N A;  3KQ4 B;  1N1T A;  1PO2 2;  3AMP A;  3M70 A;  2HWC 2;  2X05 A;  1TMF 3;  2JE9 A;  2FZ1 A;  1OFN A;  3KV5 A;  2JEN A;  1ZRF A;  1GP4 A;  1OOP C;  4EN6 B;  2WQ8 A;  4CUG A;  4YZ2 A;  4F3J A;  5FLH A;  3LEK A;  2ZX4 A;  4CXX A;  4FPL A;  2RS5 3;  4RYD A;  4W6W A;  4B1L A;  5ACA 2;  2YPD A;  3AVR A;  2XQX A;  2ZS6 B;  1AJO A;  5L7O C;  3BIE A;  2C5D A;  4I3P A;  2HEW F;  4OZO A;  1JU3 A;  1JI6 A;  2NM1 A;  1OLR A;  2GMM A;  5GZF A;  3U1X A;  5A3M A;  2VXR A;  4NHY A;  4R8H A;  2WII B;  3PUQ A;  2ZGM A;  5I0U A;  5LK5 A;  4AI8 A;  4AL9 A;  1F5J A;  2BBA A;  2JDK A;  1UCX A;  3J7N A;  3ZXG A;  2UYA A;  3ZXF A;  1VBE 1;  3ORJ A;  4XFG A;  1W2N A;  3RZJ A;  1EPW A;  4EWD A;  2ZBJ A;  3EMR A;  4XZP A;  4XVH A;  4ISR A;  3BB6 A;  3RQ0 A;  2LRP A;  3Q8C A;  1FMD 1;  1H1A A;  3UL2 A;  1RXF A;  4GUL A;  2VZU A;  3PUR A;  1WD4 A;  2OUJ A;  4H2A A;  1C1L A;  4Q0P A;  3WNP A;  1FXZ A;  2YMZ A;  1NQD A;  1RUF 1;  2OT7 A;  4NN0 A;  2W91 A;  4XUT A;  3TWI A;  3U78 A;  5J36 A;  3W58 A;  2VMG A;  3FHQ A;  1WW7 A;  4W4Z A;  2A3Y A;  4PIX A;  2PQQ A;  4O65 A;  2IXK A;  3WQ1 A;  1AVB A;  1QJY 1;  1NCR B;  4HON A;  3PUS A;  5APA A;  4DPN A;  5A3U A;  2Y8K A;  5FWE A;  2CGP A;  2E26 A;  2QQO A;  2FHR A;  5DZG A;  1ND2 A;  3AZX A;  2JDP A;  1RC6 A;  2VO5 A;  2VZS A; 
#chains in the Genus database with same CATH homology
 2WBK A;  4PQQ A;  1PX3 A;  3I2G A;  4ARX A;  2W9X A;  3SKJ E;  4CU7 A;  4KI5 M;  3GGL A;  4QDS A;  1EUU A;  1JZ7 A;  3HNM A;  3T08 A;  3WF0 A;  2WO2 A;  1O8P A;  4PT6 A;  1J83 A;  4QB1 A;  5JMO A;  3C7H A;  5G04 L;  3K4D A;  3T0A A;  2W94 A;  3SEE A;  3IAP A;  1UY4 A;  3VD5 A;  2VZT A;  4D0Q A;  4L0P A;  2EIB A;  2W87 A;  1SG3 A;  4CU8 A;  1UXX X;  2V72 A;  4W8J A;  2VZR A;  1UYX A;  2YFU A;  4OUE A;  2CDO A;  1US2 A;  2R7E B;  3ACF A;  4DUW A;  3WSO A;  1P8J A;  1UWW A;  3LEI A;  1UMI A;  2VZO A;  5JXH A;  2QQK A;  4OMD A;  2E31 A;  1WCQ A;  4PF1 A;  1BHG A;  3VDA A;  2QQI A;  2Y6K A;  3PUH A;  1UY0 A;  2WO3 A;  4CUB A;  5CZK A;  3GM8 A;  3VD3 A;  1GOF A;  3LPG A;  4P5Y A;  1JZ3 A;  1W9W A;  1UY3 A;  1W9T A;  2E32 A;  4OMC A;  1I5P A;  4QDQ A;  4ET7 A;  4ZZ8 A;  5IFP A;  1YQ2 A;  1UYY A;  5HXM A;  2J1A A;  1H6Y A;  3I2I A;  3W5M A;  2C9K A;  1GNY A;  1GOG A;  3III A;  3I3D A;  2C26 A;  4KMQ A;  2B9V A;  1DYO A;  3EYP A;  4D8M A;  3VD4 A;  2VMD A;  3WNK A;  3UES A;  4GWJ A;  2KD7 A;  4JX0 A;  5LA2 A;  4DEV A;  2VZ3 A;  4P08 A;  3MUY 1;  1K45 A;  3FN9 A;  5DQ0 A;  3P6B A;  2Z4F A;  3HPN A;  4XUN A;  4P00 B;  2XHN A;  1UX7 A;  3P1I A;  1OF3 A;  2HLE A;  3DEC A;  1TVG A;  2BER A;  3CZU A;  5JXJ A;  3K4A A;  3GDB A;  1UXZ A;  3MO4 A;  2VZP A;  2J1E A;  4DXS A;  4LKS A;  3CMG A;  2VC9 A;  3ACH A;  3NJV A;  3ETP A;  3OGV A;  5B4X A;  2J1R A;  3DYP A;  3C7F A;  4MOA A;  1JZ2 A;  3ZM8 A;  5LA1 A;  2WN3 A;  3OG2 A;  4XZU G;  1NAE A;  2QQN A;  3THD A;  4JKL A;  4XUO A;  1J84 A;  1XPW A;  4LPL A;  1W0N A;  2RV9 A;  1MPX A;  4QX2 A;  4TTG A;  3OGR A;  1CZV A;  1ULO A;  3ACG A;  3MV0 1;  2W1S A;  4GZ9 A;  4JHZ A;  4BK4 A;  1XC6 A;  4OYU A;  1DLC A;  1O8S A;  3BN6 A;  2VM9 A;  3UNP A;  2L9L A;  3FL7 A;  3FHA A;  2DDU A;  3T2P A;  4BDV B;  2PQS A;  5LCW L;  2YFZ A;  3T0B A;  2JKX A;  4UI9 L;  5A1A A;  4A44 A;  5IHR A;  1NX9 A;  1H6X A;  3I97 A;  2XON A;  2VTF A;  3I2F A;  1NUK A;  5C7G A;  2W5F A;  3EB7 A;  2LW8 A;  2Y64 A;  1OT5 A;  5G05 L;  1XNT A;  1JYX A;  3C8X A;  3ECQ A;  2W3J A;  4ZXE A;  1O59 A;  4E8C A;  3VDB A;  3D3A A;  3F2Z A;  4QX1 A;  3T09 A;  3I3E A;  1JYN A;  3UET A;  3VD9 A;  2VCB A;  4DUX A;  3LPF A;  4FI9 A;  1SHW B;  3WNN A;  3CQO A;  4AAX A;  3OEB A;  2CDP A;  2J1V A;  1JZ4 A;  2RJ2 A;  4MO3 M;  4QX3 A;  3HNB M;  2YG0 A;  2DCJ A;  4LQR A;  5DPN A;  2ZEX A;  4QX0 A;  2YC4 A;  2EID A;  1CZS A;  4Z2A A;  3HEI A;  5HPO A;  1OF4 A;  4XUP A;  2J22 A;  5LA0 A;  3WF3 A;  3BGA A;  1JYW A;  5I0D A;  4CVU A;  1F4H A;  3MV1 1;  4ZY9 A;  2V4V A;  4A45 A;  3E1F 1;  2HYX A;  2YB7 A;  3MUZ 1;  4QDR A;  5EIY B;  4JKM A;  2X09 A;  1GOH A;  1W9S A;  4P02 B;  4QB2 A;  4DUV A;  4MGQ A;  1JU4 A;  2VR4 A;  5C71 A;  2XOM A;  4BXS V;  3AC0 A;  3ACI A;  1PMH X;  1OH4 A;  4ZZ5 A;  3WEZ A;  4MGS A;  3WF1 A;  2V5D A;  3CIH A;  3A7Q A;  4YPJ A;  3W5N A;  3WQB A;  1ULP A;  3VDC A;  1T2X A;  1K42 A;  3THC A;  5JR2 A;  4JKK A;  4KWU A;  1UMH A;  3ABZ A;  1L7R A;  3HOB A;  1L7Q A;  5IJR A;  2VQU A;  5FUI A;  1K12 A;  3PUI A;  5JXG A;  2DCK A;  1US3 A;  4DEQ A;  1PX4 A;  1HN1 A;  4M4R A;  3C7G A;  3HJR A;  3K46 A;  2OKX A;  3WF2 A;  4BJ0 A;  5F7U A;  3IB3 A;  3WNO A;  4RN5 A;  4UOJ A;  2E33 A;  2WAO A;  1F4A A;  4A6O A;  2QQL A;  1KGY A;  5IYY A;  4IUG A;  3I2K A;  4AG4 A;  1JZ5 A;  3CDZ B;  4GWI A;  4DXT A;  3IAQ A;  1CIY A;  2C4X A;  3VD7 A;  1UY1 A;  2WAB A;  4LHS A;  3T2Q A;  1KEX A;  1TG7 A;  3WF4 A;  5DMY A;  2Y6L A;  2J1T A;  3SKV A;  2VQT A;  2VOT A;  4HG6 B;  2J7M A;  1EUT A;  4DXR A;  3NRU A;  1GU3 A;  2YC2 A;  2W47 A;  3OB8 A;  1D7P M;  2VL4 A;  3MBW A;  3T2O A;  5IFT A;  2Y6H A;  2VCA A;  2W95 A;  1UZ0 A;  4BK5 A;  1R64 A;  5J1X A;  3LE0 A;  1W8O A;  2ZEZ A;  5C70 A;  2ZXQ A;  2W1Q A;  4M4P A;  4CU9 A;  3LQC A;  2WZE A;  2VZS A;  3LEG A;  1CX1 A;  3OEA A;  2ZEW A;  2QBX A;  1GUI A;  2ORX A;  4ARY A;  1OD3 A;  1RYY A;  2J1S A;  5EJ1 B;  3A21 A;  3WNM A;  4CU6 A;  2VME A;  1JHJ A;  2W46 A;  4XUR A;  1GQP A;  5JXI A;  2W1W A;  3A22 A;  3K77 A;  2WUH A;  1DP0 A;  2WO1 A;  3JXS A;  2WN2 A;  2B4K A;  4A4A A;  2RVA A;  1JZ6 A;  2Y6G A;  2BGP A;  3HN3 A;  3A23 A;  4A42 A;  3DYO A;  3K4Z A;  2BGO A;  4A3Z A;  3T0D A;  2VJX A;  2QQM A;  5CYY A;  3NNG A;  3IDA A;  1CZT A;  2VMC A;  3DYM A;  2JD9 A;  2ID4 A;  2VMF A;  1UYZ A;  2WAA A;  3WNL A;  5EJZ B;  3U37 A;  1UY2 A;  2X10 A;  3I2H A;  1NKG A;  3SEP A;  4CUC A;  3C7O A;  2QQJ A;  1K3I A;  2EIC A;  4UAP A;  2Y6J A;  4QB6 A;  2VZ1 A;  2JDA A;  3GXU A;  3I2J A;  1SDD B;  2LS6 A;  3I3B A;  2BZD A;  4QAW A;  4MAD A;  5B4N A;  3C7E A;  3K75 B;  1IQD C;  4XUQ A;  3OGS A;  2X05 A;  1GMM A;  4A41 A;  4TXW A;  3NJX A;  2WQ8 A;  2W92 A;  3J7H A;  3LEK A;  4RYD A;  2XQX A;  1W99 A;  4OZO A;  1JU3 A;  1JI6 A;  4QPW A;  1JZ8 A;  5JUV A;  2WZ8 A;  1WKY A;  2BBA A;  2ORZ A;  4CUA A;  1LNS A;  2EIE A;  4E8D A;  4XVH A;  2W1U A;  2VZV A;  2VZQ A;  2VZU A;  5DN2 A;  3HNY M;  3WNP A;  2J1U A;  2WDB A;  1W8N A;  4XUT A;  2W91 A;  3OBA A;  3FHQ A;  4W4Z A;  1XNA A;  2ZEY A;  2Y8K A;  1JYV A;  2E26 A;  2QQO A;  1PMJ X;  3CZJ A;  4W50 A;  2JE8 A;  2VO5 A;  2WYS A;  2VCC A;  3NQH A;  3CKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...