2YB7A

Cbm62 in complex with 6-alpha-d-galactosyl-mannotriose
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
140
structure length
140
Chain Sequence
SYPKLTGTVIGTQGSWNNIGNTIHKAFDGDLNTFFDGPTANGCWLGLDFGEGVRNVITQIKFCPRSGYEQRMIGGIFQGANKEDFSDAVTLFTITSLPGSGTLTSVDVDNPTGFRYVRYLSPDGSNGNIAELQFFGTPAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Novel, Noncatalytic Carbohydrate-Binding Module Displays Specificity for Galactose-Containing Polysaccharides Through Calcium-Mediated Oligomerization.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Sugar binding protein
molecule keywords CARBOHYDRATE BINDING FAMILY 6
total genus 33
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2yb7A00
1NX9A 3T0AA 1DYOA 3IIIA 3CMGA 3BN6A 2VZVA 4CUCA 4W50A 3I97A 2CDOA 1W0NA 3VDAA 1K3IA 1OF4A 5G04L 2OKXA 1K45A 1GQPA 4QX3A 1CZTA 5HXMA 4ARYA 3I2FA 4XUPA 1RYYA 3VDBA 1UX7A 4KI5M 4MGQA 2DCJA 1US2A 2WO1A 2W91A 3UESA 5EJZB 4YPJA 3C7EA 4P02B 3OEBA 2E33A 2VZTA 3I3EA 3D3AA 3I2GA 2ZEZA 4UI9L 3SKVA 5LA0A 3ECQA 1MPXA 5CYYA 3A7QA 2WAOA 1JZ7A 2Y6LA 2VC9A 3OGSA 4W4ZA 4ZZ8A 4D0QA 1NAEA 3IAPA 4P5YA 4QX2A 2W5FA 2Z4FA 1J84A 4XZUG 3FHAA 3MUZ1 3MV11 2WYSA 2QQKA 1UZ0A 3ACIA 3DYMA 3SEPA 1GOFA 2KD7A 4CUBA 3U37A 4JKMA 1ULOA 3ACGA 4CUAA 4XUTA 4A45A 5JXGA 4CU7A 1H6XA 1SHWB 4P08A 2QQLA 2DDUA 5HPOA 1JZ5A 4QB6A 1L7RA 3VD3A 1IQDC 3JXSA 4JX0A 3MV01 3VD4A 5LA1A 3ETPA 4GWJA 1LNSA 4BJ0A 4QB2A 5C70A 4UOJA 3OBAA 2WQ8A 2YFZA 2W47A 1W9WA 4MADA 2VMEA 2VO5A 1W8NA 2WZEA 2L9LA 5JR2A 3T0DA 1BHGA 2XOMA 1US3A 3DECA 3OEAA 1EUTA 2YC2A 3C7HA 4D8MA 4DUVA 2VJXA 3FL7A 1JYXA 5IFPA 2Y6HA 3HNBM 2ZEXA 3SEEA 1JZ8A 5DN2A 3I2JA 4E8DA 3CQOA 1TVGA 5JXIA 1PMHX 2VZSA 4QAWA 3T0BA 1K42A 3EYPA 5IHRA 5DMYA 3W5NA 1WCQA 1KEXA 2WZ8A 3LE0A 1NUKA 2QQMA 4W8JA 2RV9A 1OT5A 2VMFA 2BBAA 1UY4A 3MO4A 3W5MA 1ULPA 2C26A 3ABZA 4XURA 2X09A 1UWWA 2EIDA 2JE8A 1H6YA 1F4HA 2Y8KA 3WNOA 2BERA 2W3JA 2J1AA 4M4PA 1GMMA 4DUWA 1JZ4A 3CIHA 2VTFA 2VMDA 2QQOA 1O8PA 4MO3M 3MBWA 4UAPA 2J1VA 2WO3A 4L0PA 1W9TA 1YQ2A 4XUNA 1UXZA 3HEIA 2BGOA 2VMCA 2C4XA 3PUHA 1R64A 1WKYA 2VZOA 4DUXA 3K4DA 4MOAA 4DXTA 3HN3A 1DP0A 2VZRA 3THDA 1D7PM 3HJRA 4OZOA 1CZVA 5JMOA 4ZY9A 4PT6A 2ZEWA 2W46A 3T2PA 3CKHA 2XQXA 4RN5A 4PQQA 2RJ2A 3WF2A 3PUIA 4BDVB 1TG7A 4RYDA 2ZXQA 1I5PA 2W87A 1T2XA 3DYOA 5C7GA 1NKGA 1GNYA 4QB1A 3ZM8A 4ZXEA 5B4NA 4DXSA 4OUEA 4KMQA 5B4XA 1OF3A 3GGLA 2RVAA 1JZ2A 3A21A 3I3BA 5J1XA 3SKJE 3WF4A 1JU3A 2HLEA 2WAAA 2VL4A 2WDBA 3C7FA 5JXJA 3T08A 1XC6A 2J7MA 4A42A 3FN9A 2B9VA 5C71A 1JZ3A 1KGYA 3WNNA 1GOHA 3K4AA 4ARXA 1CZSA 4GZ9A 3A23A 1CX1A 3K75B 4PF1A 3FHQA 4A41A 4DEVA 1O8SA 2ORZA 4HG6B 2VQUA 3K77A 3HOBA 2VZ1A 3NQHA 2VOTA 1PX4A 2C9KA 2VZPA 2QQNA 1UYYA 2XHNA 3NNGA 2Y6KA 4BK4A 3WEZA 3LEGA 3HNMA 4MGSA 1K12A 2E26A 2ID4A 2Y64A 1JHJA 3T2QA 2B4KA 3WF3A 1UMIA 5EJ1B 4A44A 1W9SA 1W99A 4DXRA 1J83A 5FUIA 2YG0A 3LPGA 2VCAA 1CIYA 2LW8A 2W1QA 3GXUA 5F7UA 4Z2AA 2JD9A 2ZEYA 2YFUA 5I0DA 2VM9A 2LS6A 1XPWA 3CDZB 2Y6JA 3CZUA 3T2OA 3I2IA 3HNYM 2DCKA 2W1UA 2QQJA 3C7OA 3OB8A 4LKSA 3VDCA 4CU6A 1O59A 3AC0A 4E8CA 1JYWA 2J1TA 2WN3A 3GDBA 2VZQA 3WNMA 3WF0A 2W1WA 4XVHA 3WF1A 1GU3A 4CVUA 1PMJX 2W92A 1GUIA 3A22A 2WBKA 2HYXA 2J1RA 2E32A 3DYPA 2VCCA 3OG2A 3ACFA 5IJRA 3WNPA 4ET7A 2J1UA 3UETA 3NJXA 4XUQA 1XNAA 2VZ3A 1JYVA 1UXXX 1HN1A 4QDSA 4JHZA 4A6OA 4QDQA 4BK5A 4M4RA 4LPLA 2CDPA 5DQ0A 2Y6GA 1GOGA 1SDDB 2J1SA 5DPNA 3ACHA 3P6BA 1UMHA 1SG3A 3LPFA 1XNTA 2W95A 3UNPA 2WO2A 1P8JA 3LEIA 4A4AA 1UY0A 3WSOA 3C8XA 3GM8A 3HPNA 2J1EA 2WUHA 2YC4A 3NRUA 2ORXA 3T09A 4KWUA 4QPWA 2BZDA 5G05L 3I3DA 3NJVA 1JU4A 3LEKA 3LQCA 5IFTA 4OMDA 4A3ZA 2VQTA 5CZKA 2VR4A 4TTGA 1W8OA 3P1IA 4DEQA 1JZ6A 3EB7A 5EIYB 5JXHA 1UY2A 2J22A 2W9XA 1UYXA 3WNKA 1L7QA 1UYZA 2BGPA 5JUVA 3K46A 2VZUA 1DLCA 3VD7A 2X05A 4CU8A 3C7GA 5IYYA 1JYNA 4AAXA 4JKKA 4ZZ5A 4QDRA 2V5DA 2V4VA 4IUGA 2XONA 3MUY1 3F2ZA 1OD3A 3J7HA 2W1SA 2QBXA 4BXSV 3IB3A 3CZJA 4XUOA 2VCBA 4JKLA 2W94A 4LHSA 3I2KA 3E1F1 2R7EB 4OYUA 4P00B 3VD9A 3K4ZA 3IDAA 2WABA 3IAQA 4FI9A 2YB7A 3VD5A 4QX0A 4CU9A 2E31A 2X10A 3THCA 1PX3A 1OH4A 1UY1A 4OMCA 1JI6A 2QQIA 3I2HA 2EIBA 3WNLA 4AG4A 5LCWL 1EUUA 4LQRA 3OGVA 2V72A 2JKXA 4TXWA 3OGRA 5LA2A 5A1AA 3BGAA 2EICA 4GWIA 1UY3A 2JDAA 4QX1A 2EIEA 1F4AA 2PQSA 2WN2A 3WQBA
chains in the Genus database with same CATH superfamily
1UOGA 1GICA 3KQRA 3FBMA 1VB4A 3H8XA 1NX9A 4W6XA 3ZSJA 4JVAA 4OI2A 4XIKA 1COV1 4QX7A 3T0AA 2AH2A 3VKOA 3KV9A 1QJX2 2XDVA 3I97A 1CONA 2XL9A 3LSDA 1UPIA 4EZ4A 4YW5A 1S0FA 4CPBD 5G04L 1K45A 2AEYA 4NJ4A 2ZKNA 1JHNA 4ARYA 5C9AC 1DG6A 1XNCA 3I2FA 1RYYA 4HKOA 1LOEA 3QH6A 2D98A 4O7XA 3NL1A 4MGQA 2XJRA 1MQTA 4AI1A 2QQVA 1CVNA 1K5MC 1AJOA 1OVPA 3ZXJA 5IVCA 1GSLA 4OULA 3WHTA 1SZBA 2W91A 5EJZB 3TEXA 2OYZA 2R043 2SBAA 1N1TA 3OEBA 3KQ4B 4YRDA 3OBZA 3I3EA 5E8AA 4YZ4A 3D3AA 2PLV1 2HEVF 3GJAA 4CCMA 3ECQA 4Q26A 3ZYHA 4CDQC 5L7OC 3W58A 3NKTA 1R092 3A7QA 5JI7A 3VBUB 3EXUA 1NYWA 1W8FA 1QXPA 1YQCA 2A73B 4QXCA 1NCRB 3WZ1A 4XFBA 5JSRA 1WLWA 3SISA 2JIGA 4AAPA 5IATA 1Q8OA 3IAPA 2ADEA 2HEYF 4P5YA 1OSGA 3NMBA 2ILMA 4FAHA 1L3JA 1JMUB 1DYPA 4GH4B 3WDXA 1O3RA 3MUZ1 1SBDA 4QPIA 4KWKA 5F32A 1PVC2 1LHVA 4KWLA 5BNNC 1UZYA 2WNUB 3LA3A 1NE6A 2ZOEB 4K1YA 3ACIA 4ZPIA 1GOFA 1PIV1 2DVDA 5IK7A 4N53A 3GHNA 2Y6FA 5A6XA 3AVRA 3U37A 1ULOA 2VH9A 2RS12 2VVDA 2OQ6A 4BCUA 5JXGA 1V9U3 3FFQA 3HMYA 3AP5A 4ZXKA 4HSLA 1WBLA 3NJYA 4AOCA 4CEWC 4XFIA 3GF6A 4HVOA 4D6QA 3ILFA 4N7IA 2WNVC 2GC0A 3TYJA 4KBZA 3AP6A 5KHIA 1PGL1 4UFIA 1BEV3 1L7RA 3VBOB 1IQDC 2JG8C 3JXSA 4LBQB 4Q0UA 3PNAA 3VD4A 2FHRA 3ETPA 1UAIA 1AX2A 4Q4Y1 4UOJA 1FMD3 4LMFA 2YFZA 2W47A 4PF5A 4YVWC 1YQ5A 3RZMA 3KMHA 2R32A 2GAUA 3F95A 5JR2A 1US3A 1HDKA 2GH2A 4Q2FA 4AI2A 1FNYA 3MYXA 1I1EA 4UXAA 4XMIA 1S0CA 1ZZ7A 1POV0 3U75A 5D8AA 3BIEA 5FKBA 4Y26A 5C6CA 1JYXA 1H4HA 5IFPA 1IS6A 4XQDA 1JZ8A 4COVA 5AVAA 5ABJB 1POV3 3ZYFA 3BU7A 1WW7A 4FQZA 1DQ6A 2WINB 3T0BA 1D4VB 1AL0G 1BBT1 4GULA 2NM1A 1MACA 4P9GA 5K9YA 2WZ8A 2FDHA 4IEWA 3FE5A 1LEMA 3KD4A 1NUKA 2QQMA 2ZPXA 5JOYA 1WD3A 2YXSA 2IFWA 5CU1A 1VE0A 1D4M2 2VE1A 4W8JA 4CXXA 4CSWA 4JGYA 1A78A 3MIHA 3WINE 1OT5A 2CGPA 4QKBA 2YC0A 2X8KA 3WUCA 2I45A 4YFZA 3AX4A 2BPA2 1W2AX 1RUI1 5CG9A 1SCRA 2ATFA 1D0HA 1OA3A 1S1AA 1UNBA 2ARBA 4Z07A 1W0OA 3TEWA 2D43A 5GZCA 1A8DA 3UV9A 3ST7A 1PVXA 3WR0A 1F4HA 4FO9A 3RYPA 5J98B 2W3JA 1FV2A 1YFUA 4XXAA 2VOWA 5KXEA 1LOGA 2FDGA 1TMF3 1XSQA 2CV6A 1N1VA 5T5JA 1S2KA 3KHBA 1LU2A 1HRV3 2VBDA 3AMPA 4N43B 1VBD2 4BWOA 4AVVA 4RQPC 5LBFA 4OUMA 2HWC1 4K8FA 5A7NA 2G9FA 3JD71 3SLIA 4UAPA 2J1VA 1JYCA 1ZZCA 2D6LX 1PGSA 4HXCA 4L0PA 4RR3C 2FDKA 2XXZA 4HPKA 3M3EA 3D0JA 1W9TA 2W68A 1WLCA 2I74A 1OOPA 2ZS6B 1PZ8A 4XXPA 4XUNA 2BGOA 2BBVA 1QNWA 1YO8A 5C3SA 3ZLIA 2F6BA 2PQQA 2XQRA 2VZOA 3NNJA 4LBQA 2WA4A 1ENRA 2RDQA 1FV3A 4IEVA 4RHV2 4YSFA 4QQLA 4E9KA 1NE4A 3K51A 2HWD2 2VCMA 5KXDA 1DP0A 1VPHA 2VZRA 3G6JB 1XRUA 2WR9A 1X82A 4XQ4A 1CZVA 3NNMA 4WM8B 4PT6A 3ZPOA 4LUMA 4S2HA 2JDNA 2PHXA 3N7KA 1LB2A 4YW6A 4K40A 1U5XA 3ZFGB 2AC1A 3ILNA 3IKWA 5J7MA 1VBB1 1AR61 1RUF2 4KGQA 4UF0A 4RYDA 4TYSA 3OPZA 3WP4A 3ZFFA 2BOJA 5FZFA 2EXKA 3AXEA 4AFDA 1T2XA 3BCWA 1HLCA 3O14A 1Z0HA 2QDNA 2ENRA 3MICA 3MW4A 3ZM8A 4COWA 3SITA 1DQ2A 4K20A 3ZYIB 3B9CA 5CBLA 2B5HA 5DZEA 3H8UA 4FP3A 3T3YA 2VUDA 2K0GA 2KA3A 3H9AA 4FT8A 3V0BA 3J4UH 2RVAA 4YGEA 4Q4Y3 1EAH3 3SCGA 3TN93 5J1XA 4NPRA 1EYBA 1BLZA 1FMD1 2DCZA 4BPZA 3VN4A 1Y9QA 1NLQA 4B3NA 2C0ZA 4J25A 4U2AA 2LM3A 2WDBA 2BW8A 4RHV1 4J6GA 4FBFA 1F8VA 4DPNA 1JYIA 2LROA 4AI9A 4FCAA 1HV0A 1RTVA 2DBNA 3ZR5A 4HVQA 2H6BA 3RZHA 1W28A 1FX5A 1PIV3 2B9VA 3RI8A 2WZR2 3WNXA 2XB6C 3MI8A 1WBFA 4MZUA 3K4AA 3IBMA 3JZVA 4ARXA 2NN8A 4FTBA 2B46X 4IXLA 5GLVA 5I8YA 2VOVA 4G4FA 4H55A 2FCVA 3K75B 2VNOA 2QDRA 3VBUC 1UZZA 3R4UA 3RJ2X 1NCRC 1U5ZA 4LLOA 4LUKA 4HG6B 1G9CA 3I8TA 1XOYA 2VQUA 3RRDA 1O4ZA 2PHTA 4Q4W1 1NCRA 4I30A 1MZ5A 3WXPA 1SFPA 5I93A 3B7MA 1SCSA 1UZWA 4MH0E 1QGLA 4QHZA 1PM7A 2OXBA 4BMBA 4L8QA 4BK4A 1GZ9A 4DQAA 2WS92 2WNUC 2ZMLA 3LF7A 1K12A 2E26A 3AP9A 1SLAA 4AI8A 5DAWA 1PNFA 2B4KA 3WF3A 5A7PA 5EJ1B 5C3PA 1KITA 1W9SA 3IMNA 4DXRA 5JZGA 2D7FA 3A0NA 2A3YA 1QJX3 4CYDA 4OCTA 5JVVA 2LW8A 1W2NA 2VXRA 1RUNA 5F7UA 2ZEYA 1CAUB 2YFUA 3QCWA 2DYCA 1NLRA 5L7OA 2LS6A 1D2SA 3R4DB 3N7JA 3UJOA 3JU9A 4XBQA 1OMIA 3NO8A 2JDPA 2Y6JA 3CZUA 2JECA 3KHCA 2DCKA 3QOPA 3LZZA 3VBOA 5FXWA 1DHKB 3SH4A 2IXHA 4LKSA 2VG9A 3ZFEB 1WA4A 5FMOL 4E8CA 3W59A 1O6UA 3LA2A 1ZM1A 5EYYA 1L7LA 4HANA 4LOSA 2VBPA 5FXZA 2YY1A 3WF0A 5DG2A 3B02A 4XVHA 4K8RB 4CA9A 2BVBA 1HB2A 3RMYA 1COV3 4N9IA 2OZ6A 5H9PA 5K0UB 3QACA 2IXKA 2RG4A 4N8MA 3FBYA 3S57A 5T5OA 5C3OA 4BLJA 4WM7A 1H4GA 1GUIA 3VZNA 1RUJ3 3A22A 1JUHA 2WBKA 5KXBA 5C9AA 2YHJA 5FLJA 1MZFA 3OUHA 2SLIA 2VCCA 3DYPA 3ZXDA 2JX9A 3A0KA 3BTAA 1GKBA 4WM7C 2ZGOA 4I02A 5ABJC 4C0HA 2G1MA 2WQZC 3TAYA 4A7ZA 3O0XA 1PVC1 4NVPA 3FHIB 5BNQA 3H50A 3R6SA 3ZXGA 1FT9A 5DXDA 5IVVA 2PHFA 4YVSB 4BK5A 3LD8A 4LO4B 3Q8AA 3T30A 4PDWC 4LTAA 4LPLA 2CDPA 5DQ0A 1QF3A 4PCRA 2JG9C 1CAVA 1SDDB 2EXHA 4MGZE 3OY8B 2NP0A 3MFCA 1HV1A 4FXGB 3VZOA 3ACHA 1MS1A 1V9U2 5FYVA 1SG3A 1BQPA 1V6MA 4V2WA 3LGRA 3PDQA 1ULCA 4YARA 4R9BA 2PTMA 1VBA3 2ZGUA 4JTOA 2ZACA 4ES8A 4LJHA 3H8OA 1HIXA 2JE9A 5FXXA 4ATEA 5HCFA 1SFNA 4EWAA 5JPMB 2AYHA 4KGGA 4QPIC 5IAVA 2PXJA 3OOXA 3P3PA 4N43C 5FZHA 1ZREA 3GM8A 1PGL2 3HPNA 2ZX1A 3H3ZA 5GZFA 5L19A 2BEOA 2YC4A 3ZN6B 4CDUA 1JH5A 3KS7A 4TZDA 2R071 5LBBA 3RZGA 5F5AA 4XOGA 4UWDA 1J3QA 4FPKA 4QPWA 3ZSMA 4NHKA 1PO13 5D2AA 3OD4A 3I3DA 3ZYGA 1FATA 3I2DA 3O5SA 2GC2A 4TN7A 1ZBA2 3VHPA 1DGWA 1CJPA 1UZVA 2MEV3 5A80A 5KWRA 1UL9A 5IK8A 4RS5A 4HPKB 2UWBA 3LEKA 3LQCA 2WNVA 2VQTA 2UYBA 4FVVA 5CZKA 2XJQA 3HT2A 1DQ1A 1GWLA 2WC2A 5FY4A 1FPN2 4EV0A 1W8OA 5CEHA 4QPGB 3PJQA 1H1MA 5I0SA 2UYAA 2R063 4GD4A 4FPCA 1UY2A 1L7QA 5JIAA 4LO6B 2VULA 4CCJA 3IIAA 4TLGA 2BGPA 5JUVA 2XVLA 3K46A 5LWBA 2VZUA 4NE9A 4XDQA 4CU8A 4GWNA 2FCTA 4AAXA 3HT1A 3KT4A 4ASLA 1E57A 4ZZ5A 5CAZA 5D8AC 5F1RA 5FZ3A 4RR3A 1O3TA 2XMLA 1A34A 4EWDA 2V5DA 3LB9A 1WA6X 4GA9A 1DF0A 1OBNA 1ZA7A 2GZWA 2XONA 3F2ZA 4CDXC 1YLLA 3J7HA 2Y34A 1OKQA 3WD5A 4E4DX 2QBXA 4HN0A 4GWMA 3CEWA 5FYMA 4GB33 4BXSV 4HONA 4HZFA 3WQ0A 4O9GA 2AENA 2HH9A 2IUWA 2W94A 3K3OA 4JKLA 4KG8A 2WWSA 5HI0A 1R1ZA 1OQEA 2P5BA 4N90A 1C5IA 4JGYC 3CF6E 1G7YA 1U5IA 2WYFA 4MX3A 3O1TA 3BU0A 2HWC2 4ISRA 4FI9A 2WNEA 4QX0A 2A1XA 3OJBA 5I0UA 4CU9A 3S7EA 5GZEA 1OLRA 4RD7A 4K6BA 5ACA2 2OA2A 1DCSA 1REEA 4PBPA 1ASJ3 1VBC1 3LEMA 2H6CA 1WCUA 4OMCA 3WCSA 2HWD3 4I3GA 3OBTA 4AQ6A 5BNPC 4Y20A 4MLOA 1D4M1 2VVEA 2RS52 3OGRA 5E1RA 1YFWA 2JDUA 5CFCB 5L9RA 3VBHC 1ZZ6A 2BNOA 3N9OA 4GWIA 4OQ9A 4EROA 5A6QA 4AEDC 2WIIB 3H3UA 3PURA 2YGLA 4MXWA 5GM0A 3PUAA 1OVSA 3NSTA 2Y0IA 4GIQA 1F4AA 1XE0A 4DS0A 2WN2A 3E6BA 2ZMNA 4OHYA 2QKDA 4Q4X1 5F2WA 1ZRDA 3TN91 4AGVA 3KV6A 3BN6A 1VBD1 4W50A 1O3QA 4A2UA 1LOBA 1OKOA 1W0NA 5C8WA 3VDAA 1BZWA 3G7DA 1EV11 2KR2A 2RMU2 1K3IA 1YCIA 5CFDA 2ZX4A 1YHFA 1W6NB 4XJUA 4N7UA 4D69A 3IPVB 4QX3A 1QJY3 1QJU2 5FK7A 2WFPA 4XJZA 3NV1A 4BM8A 4OI1A 3RDIA 1S0BA 3LDRA 3VDBA 1UX7A 1W6OB 2F17A 2XWJB 5FJKA 1ZBE1 4KI5M 2DCJA 2ZHLA 2CNAA 3BB6A 1US2A 4MV2A 5AFEA 1PK6C 4HKLA 3I54A 1RITA 2ZABA 1QJU1 3O0VA 5F3GA 4JDMA 1RUC3 3PIJA 1RUG1 2TEPA 3PLQA 1OPOA 5FV3A 1NY71 4XFGA 1PIV2 2WZR3 2ZEZA 3SKVA 3U78A 1MPXA 5AFBA 3AMNA 3OBRA 5CYYA 4LKEA 1X33A 1OQ1A 2XLAA 1JZ7A 3WW2A 4R4ZA 4D7TA 2J42A 2X5IA 1BVVA 1VBA1 2VC9A 2XJUA 2RJKA 3OGSA 1QDCA 3SC7X 4D0QA 1AR81 4M0HA 1VAVA 4QX2A 2YU2A 2X53S 3VKNA 1H1IA 4P14A 1QOSA 3V56A 4QWNA 5EYXA 4URAA 1QOOA 1VBC2 2WYSA 3PUSA 3OSDA 3D6EA 1QH7A 4M00A 4DOUA 5CKNA 3VBSC 1DDLA 1AR93 3FMGA 3ZSKA 1YEWA 5KC5A 2WS93 1CJDA 3DGTA 2R16A 1XYNA 4ISQA 3W20A 2OS2A 3Q8EA 4YFWA 1BK1A 3CL1A 3DPRA 4PLOA 1FXZA 4MYEA 5A1LA 1J59A 2VUJA 4P08A 2FBEA 5FZ1A 1KDMA 1LENA 1W2UA 4IV3B 5LY2A 2K2SA 5L9VA 5JOZA 5HV0A 5HPOA 4H2AA 3AL6A 2EAAA 2G19A 5FPXA 1KJRA 4Y1YA 4AHWA 3ENRA 1H2LA 1WCSA 1RIRA 1IQAA 3MV01 1XQNA 4LITA 1VP6A 2CAUA 1UMZA 4Z82A 4AI0A 5LA1A 4GWJA 1W9YA 2W52A 3FJSA 3I2OA 1AX1A 1LNSA 2XKOA 5A70A 5IW0A 4YNIA 1XNBA 2WQ8A 4NIIA 4JRLA 2RS33 5FMOS 1W9WA 3KZ4C 1QXJA 1QDOA 2VMEA 1FOD1 1E5HA 2VO5A 1CAXA 3JB4C 3NAPB 4YW3A 3ZOIA 5APAA 2YMZA 1BHGA 3ZXAC 4NPMA 3T0DA 1RUJ1 3O1PA 4FFFA 3DECA 1H1AA 3OEAA 1WLTA 2V4AA 4JGZB 3C7HA 4LE3A 3DCQA 4D8MA 2RDRA 3FLRA 3H8RA 1SLIA 3E97A 1GNHA 4QX5A 1H8VA 3BIWE 4RSUA 1VBE2 1UF2C 2AACA 4IL7A 4LO8A 1KS4A 3SEEA 3IDBB 1ENSA 4K9SA 3H1WA 3I2JA 4NAMA 4QKDA 2DVGA 4FQ4A 1TVGA 1N3OA 2BDRA 5ACA1 2VZSA 4QAWA 4XFAA 5A3MA 2XHKA 4QPGC 5IVFA 1TME3 3W5NA 2BFUS 2I07B 4YW2A 1WCQA 2XUEA 5E88A 2AREA 2VTXJ 2YBKA 3LE0A 1RB8G 1AYN2 2E7TA 4DZGA 5JOWA 1XYOA 1I5ZA 3POJA 4N53C 1FOD2 3N9MA 3LDBA 1AR82 4J1WA 2FMDA 3H1MA 4K1ZA 5JWPA 1UY4A 1Q5OA 1YIFA 3MO4A 2Z79A 1OUXA 4S2DA 3W9AA 5DUWA 2HBTA 2Z69A 2X09A 5T3NA 3VBFB 3WCRA 4CRQA 4O65A 5FIXA 1V6OA 5KHHA 1AR73 1XBFA 3HQUA 3OCPA 1QMJA 5J48A 4C90A 4FSJA 3H7JA 2J1AA 4XTMA 4IGPA 5CFDB 2EA7A 1RUC1 5CISA 5FZIA 3KV5A 2XGXA 3RGBA 4RA0A 5FQ0A 5C33A 2FDIA 5FKCA 2PLV3 4SBVA 1O8PA 1W6OA 3MBWA 4CCCA 1NCQC 1RUE2 2A71A 2WO3A 3AFGA 2GP5A 5A33A 1LHNA 2ZCWA 4Q4V3 4K3UA 1YQ2A 2RM21 2VECA 3ZIWA 1UXZA 5T55A 3FC0A 1N1YA 2C4XA 4H7MA 1OH3A 1ONAA 1R64A 2P3KA 4JDOA 4C1WA 1WKYA 1A6CA 1W06A 2XBO2 1I3HA 5LB6A 5T5LA 4DUXA 2UURA 4MOAA 5HXVA 5ISLA 2ZMKA 1ZBA3 3S5QA 3OUJA 2P6HA 2BWCA 1QJZA 2G4IA 2MEV2 3AKRA 4QQ2A 1W8UA 3BYWA 2VNGA 2XPJA 4OZOA 1EY2A 2YPDA 3WDWA 4L97A 2BYVE 1X9TA 4ZY9A 2E9QA 1Q8VA 1YC61 2NMOA 4AL9A 4XDPA 1SEFA 2R49A 4N43A 3VKMA 5JSPA 5F6LB 3UGFA 3B00A 4RN5A 4I2OA 1XNDA 1OFNA 4PJYA 5BV6A 4D7SA 4LNVA 1R1A2 3VBRA 1BYHA 1MEC3 1AJKA 2GDFA 2E51A 4UW3A 4WVMA 2WWUA 4BISA 2F4PA 5C7GA 3K48A 1NKGA 5FP3A 4CZSA 4LLFA 3EO6A 1NA1C 1TNRA 5B4NA 2BGCA 1NZCA 4Q8KA 3ZYJB 1NLSA 4Q4X2 3L9JT 5DUVA 5JMCA 2IFRA 5B4XA 1OF3A 1PO22 1F31A 2ZX3A 4QU2A 1J3RA 1OFSA 4I3PA 3X29B 3LIHA 3I3BA 5F9TA 2QTWB 2B42B 2BRTA 3AZVA 1IS3A 3SKJE 1W6NA 3WF4A 1JU3A 5H9QA 2WAAA 3UT0A 2W0XA 3C7FA 2XBO1 3DPRB 3O12A 4BIFA 4UYBA 4XEZA 2CY6A 2DTWA 1ND3C 4NIGA 3L2YA 3WP3A 1XC6A 3JUUA 4WVVA 2J7MA 1HRI1 4A42A 3NV2A 3FN9A 4DO0A 3KGZA 2UY9A 1IKPA 3LOBA 3B93A 4XFCA 1W04A 1W8HA 2HWC3 4Y1VA 3GBWA 2UWCA 1I9RA 4Q1PA 3MIGA 3ROUA 1RVF1 1H2MA 2VAUA 4HK9A 5FQ0B 4GZ9A 2IWGB 1HXS2 5ACA3 1DQ0A 2IXJA 1RUE1 3VB9A 3DXTA 4H7LA 4DEVA 3UJQA 3IWZA 4Y1XA 2RDSA 4IE5A 2VGDA 1SBFA 1LGCA 1ZZBA 4Y22A 1REFA 1OPMA 4Y24A 5FYCA 2WT0A 3DN7A 3OYWB 1AX0A 1D2QA 2JG8A 1AYM1 5K8SA 4OZXA 4C8DA 2RS31 2PAEA 2ZGTA 2YYOA 3FWEA 3RNSA 2Y6KA 4FPEA 4F3JA 5C4WA 3LEGA 4MGSA 4IW3A 4ITCA 2D3PA 4QM9A 5FZEA 4CDUB 1C8M2 4LBLA 5BNOC 4UT5A 1DU3D 3ORJA 4W6WA 1JHJA 4WM8C 3T2QA 1UMIA 3J8F1 4Q0SA 2HWE3 1SMVA 5FZGA 1W99A 1VBB2 1J83A 2YG0A 3LPGA 1CIYA 1AYN1 3PUQA 2W1QA 3ATGA 3GXUA 3T1MA 5IK4A 2JDYA 2JD9A 5DDJ2 4Y1ZA 3JD73 1ULDA 1W2TA 5DUUA 2H0VA 3VZMA 4A7YA 1UYPA 1IZ3A 1B35A 1YRZA 4Y5Z0 5BNNA 5FOJB 3N36A 1QJU3 3T2OA 1AHSA 4AEDA 2VMHA 2W1UA 3T4VA 1MVEA 2R1BA 5FZOA 4B1MA 3C7OA 1LULA 4CU6A 3USUA 1O59A 3AC0A 3RFRA 2RR12 4EN0A 3JB8A 3ZN5A 3GDBA 4XHXA 2Q1FA 2VZQA 2IVJA 2ZX2A 3ON7A 3POYA 2YPJA 3NAPA 1RC6A 3GZUC 4FPLA 1OQDA 1N1SA 2XR4A 3ZKUA 4CVUA 4XAEA 4BQYA 4DRRA 2UWAA 2RJLA 2W92A 2YU1A 1FAYA 4LIUA 3RVHA 3TNPB 3VKLA 1EV13 3QD6A 3OGJA 4OHWA 3J26N 4RFT0 2P3JA 3OG2A 1RJ8A 2K9ZA 1QJY1 5FDBA 4GH4A 3ETQA 4YG0A 4YVWA 5FY5A 3AZWA 4MGTA 4ET7A 2OVUA 1J1TA 1STMA 2A6WA 3ZN4A 4UFLA 1ZBE3 5FY0A 4GMP0 4XUQA 3UGHA 2VZ3A 1J1LA 3ME2A 2PFWA 2RDNA 4JQRA 1UXXX 4NUBA 1GZTA 5B2GB 1HN1A 4GH4C 1VBE1 2RM23 4QDQA 4M4RA 4Q4W3 5A3UA 1IHMA 2YV8A 2Y6GA 3FUQA 4DB5A 3AP4A 3KVBA 3TNQA 1E5RA 2J1SA 2MNGA 2PMWB 3IDEA 5GALA 3EQEA 5DPNA 1CWPA 2GMEA 4NWWA 3O0WA 3P6BA 4LE4A 3WW3A 5FPZA 1IPSA 2FCUA 4G3YC 1SPPA 1XNTA 4KBBA 3UGGA 4C91A 4DXZA 5AC91 3OPWA 2CWSA 1C8M1 5CKQA 3UNPA 3MIDA 4FPYA 2WO2A 5DAXA 1P8JA 3WX5A 4QXHA 4XAAA 3U10A 4CCDA 4A4AA 5A7OA 4L99A 3WSOA 2ZA9A 2WLQA 3GHMA 1S0IA 3E6DA 4OLLA 3PIGA 5F3EA 4KWJA 2WUHA 1VRH3 1W6PB 3E6CC 1K5JA 3T09A 4EN8B 3KGLA 3R4SA 4YW7A 2YGMA 4HVRA 1AF9A 4KWUA 2ERFA 2BP6A 2OT7A 2R072 1C8NA 4UW6A 5BNNB 3M3CA 4AK3A 2R042 1ZA4A 5G05L 3NJVA 4FPOB 4BQ5A 1XB9A 4R4XA 4WV8A 3D4KA 3WT3A 4BXFA 1RUH3 4OMDA 4A3ZA 4D6SA 4KU8A 5C5UA 2C5DA 2VR4A 3JBG2 3P1IA 3AM2A 1OURA 4OI4A 4PQ9A 3C2UA 4DEQA 1HQWA 1UX6A 5JXHA 1S0DA 2ARCA 2JB4A 1DYKA 4WVZA 1M4WA 2GSYA 2J22A 4ONUA 2D97A 1TME2 5CIRA 4LIVA 1UYZA 4YGCA 5F3IA 2QJVA 1S0JA 2DUOA 2V09A 3FZ3A 4GALA 2JG8B 1DGLA 4HKWA 3PTRB 1WD4A 5KHJA 1AYN3 1C57A 4AQ2A 3UKVA 5C8CA 3HQRA 5BUVA 5F39A 4LHKA 1FOD3 1PVC3 2D3SA 4IDZA 3HBZA 3Q9OA 2O0OA 1BVP1 2D6NA 4GXLA 4GAZA 3U14A 5JSOA 5KC6A 3WG2A 1LOAA 2P37A 1BMV1 2YBPA 2CU5A 4IUGA 4XMAA 5GLWA 1ZRRA 3MUY1 1OD3A 1HJGA 1SACA 4H3WA 4XILA 1AR72 4NHLA 4UW5A 1PNGA 2X5IB 4XE9A 1LOCA 3WQ1A 4YZ1A 4YVSC 3TEYA 3IB3A 3EBRA 5IK5A 4QKFA 2R041 4XTPA 4XUOA 1AVBA 2XKPA 3CHXA 4GMP1 4I0BA 4JHTA 5BPXA 4XJ9A 4LHSA 1WUVA 5C3RA 3AZYA 1NQJA 1QNYA 3E1F1 1BEV2 3ZSLA 3SH5A 4CP9A 1LAJA 2YUEA 4EWEA 1PK6A 2AGSA 1LJ7A 2W2IA 1SPPB 2CYFA 3RQ0A 4QHOA 2NQYA 3S5AA 3IDAA 3IAQA 1FMD2 3M8LA 2Q1MA 4KG0A 3J8F3 5GLZA 2NLRA 3FUOA 3LFMA 4K7JA 4B29A 4BE3A 1NQDA 4RS5C 4IEQA 4XQWA 4QPIB 3SQOA 1OC1A 2JDMA 1PX3A 3Q8CA 1UY1A 2GALA 4BH9A 5JZGC 1G9FA 2JXAA 5FZ6A 3V0AB 1AZDA 4FPFA 4AG4A 5LCWL 1Z78A 2GNBA 5HCHA 4QT6A 4LBMA 4EN9B 2V72A 4TXWA 5A1AA 4LO7A 5A1FA 5FYHA 5FO8B 4E2GA 1DGWX 3AVSA 2IC1A 3AKTA 4JC1A 4LT5A 4AHYA 4FXKB 3ZFGC 5FMBA 4UBGA 1R1A3 3AYAA 3I3MA 1MEC2 3WOGA 4AFCA 1ALYA 4IV1B 1FPN1 5BXXA 1ND3A 5DG1A 2FDFA 5A6ZA 1Y4WA 3NV4A 4DIQA 5BNOB 4META 5J37A 1DYOA 3AMQA 3IIIA 3CMGA 4Q29A 4P9YA 2VZVA 3V0BB 2VOXA 4E4HA 1ST8A 2ARAA 3E5QA 2Q1ZB 4GJYA 4HETA 1PO23 4JV4A 2LRPA 4KU7A 4BIOA 1OF4A 1Z7S3 2H0BA 3ZMNA 4Y20B 2OKXA 2UY8A 5FY7A 1CZTA 5HXMA 4NRMA 1CPNA 1JOBA 2ZGRA 3AKQA 5F8PA 1HRI3 3IMMA 3LA7A 1ZZ9A 3C3VA 5JPNB 3M3IA 4YGBA 5FLHA 5FMCA 3T2TA 2ZZJA 5EHDA 4R9CA 4MVTA 5FZ9A 1QQP3 4WZFA 2WO1A 1QU0A 1JW6A 4X6QB 4XBLA 2VY0A 2AR6A 3QH7A 4YPJA 3C7EA 1RUD3 2E33A 2G9GA 3POFA 4B7KA 1K5MA 4GJZA 4AGRA 2VUCA 4QD2A 1UPSA 4UI9L 3E5XA 5LA0A 2V73A 3KSCA 3MPBA 4RGKA 4PDWA 4BQ4A 4F83A 1UU4A 1LODA 1C1FA 2WAOA 1HXS3 2VPVA 2Y6LA 3LFIA 4L11A 5FYZA 2QZ2A 1XSRA 5EPAA 5FBZA 3P5BA 1W6QA 4W4ZA 4ZZ8A 1UU5A 1VMFA 1WMEA 4DY5A 1CR7A 2VVFA 2XUMA 3U4XA 1MS4A 1N3PA 1WCDJ 2W5FA 5L36A 2Z4FA 1O5UA 3FHAA 3R05A 4Q0VA 3B69A 1RMU2 3MV11 1GP6A 4OFGA 2UU8A 4IEOA 3DYMA 2K46A 3WG4A 1O3SA 3SEPA 1AYM2 3AFKA 3POEA 4AEMA 4FPJA 2XL7A 1V6KA 3KV4A 3SCHA 4JQTA 4P9XA 1KRIA 4BHPA 4JKMA 4GB31 4Y4YA 3ZYRA 2PA7A 4CUAA 4XUTA 3VKFC 5DABA 2BQPA 2VW1A 3LAGA 4FOWA 3U11A 2QQLA 1OLQA 2DDUA 4S2FA 3SH3A 2ZAHA 1F5FA 4AVSA 5CFCA 3JD72 4ZS3A 4QB6A 2GNDA 4IV1A 3CJIA 3V65A 1VMJA 1ENXA 4IQPA 4JTNA 1EAH2 1ZZ8A 3AJZA 3VD3A 5FPUA 4O61A 2VW0A 4JX0A 3WP6A 4Q5OA 4GQ7A 3J9SA 1LHWA 1O4TA 4BJ0A 2JB8A 2JDHA 5C70A 3TRSB 2B8MA 5FP9A 4AYUA 2RR13 1GNZA 1R081 4MADA 4Y1UA 2ZBJA 3JQWA 1W8NA 3VBRB 2WZEA 3I59A 4BQ3A 1YYNA 2XOMA 5FYBA 1ZRFA 1NZIA 4KH9A 4COUA 1EUTA 4JAAA 5FZ7A 3OUIA 4CCLA 4BQ2A 5FOBB 1BCXA 4INDA 3BPZA 3VBFA 1ND2C 3FL7A 1T6GC 1PK6B 3BTZA 4TSVA 5IT6A 1X36A 3WV6A 2HKXA 1RHI2 1EV12 2ZEXA 5DN2A 5FP8A 5JDBA 1YI7A 4E8DA 4ES9A 3CQOA 4V1PA 3MF9A 5JXIA 3IZOA 1PMHX 4I0AA 2D44A 3MW3A 3DF0A 5FYSA 5GJ6A 4AQSA 2O8OA 4IGQA 4XACA 1S4CA 3POSA 5IHRA 1AL22 1KEXA 1E5IA 4OUSA 4Y4RA 2D6OX 1S0EA 3WG3A 1JXNA 1TE1B 2WRAA 3N35A 5FBJA 3ZYBA 1IKQA 2W08A 3GCWA 2RM22 2BBAA 4JGZA 4AHXA 4UFJA 3DKWA 2D6MA 5EWSA 2ZZQA 5LRRA 4CP1A 4XURA 3VL9A 1UWWA 5FPBA 3WUDA 2EIDA 2JE8A 2ZGPA 1ULFA 2GNMA 1GZWA 1H6YA 3B9IA 4HK8A 4XJ8A 1Y43B 1RJ7A 4XPVA 1FNZA 2BERA 2YBSA 3VBSB 4M4PA 4CCKA 1GMMA 4DUWA 4NAOA 4TWTA 5A32B 5BNPA 3O1MA 1JZ4A 4COZA 1HQLA 2VTFA 2P2KA 4PI0A 3GBGA 4Y22B 3SCFA 3VHRA 4YZ2A 2EF6A 3BTXA 1URXA 4R52A 2A6YA 1PO11 1RMU1 3EMRA 1VRH2 5BYNA 4E2SA 2ZGLA 1GYKA 1TQ5A 1LU1A 2VBBA 3SXWA 3B3QE 4CDWB 2O14A 2R30A 3CNAA 1YFYA 2A75A 2MPFA 3UKTA 4LKFA 4EN7B 3E5UA 4AVBA 3INAA 4H14A 3RWKX 4DRVA 1DZTA 2C6SA 2W39A 4A7KA 3QBQA 3MW2A 2JG9B 1COV2 3HJRA 3HBKA 3NNFA 5ERLA 5JMOA 2HWB1 4WZCA 1WW6A 2GC3A 1YNAA 1LCLA 1XU1A 2ZEWA 4LEJA 4QPGA 3JBG3 4S2GA 4ATFA 2W46A 1RUJ2 3MEPA 3T2PA 3ZFFC 3ZPYA 2P6CA 1V00A 2WS91 1H2KA 4PQQA 1DLLA 1UD1A 1Q43A 1SLBA 5FREA 1GP5A 2DBIA 2ARXA 2ZAAA 1T6BX 3PUIA 4YVSA 4E2QA 1CAXB 1UIJA 1VRH1 2AUYA 3GZTB 5JAXA 1RL3A 3QLQA 4IESA 4YW4A 3WQ7A 1GQGA 3DYOA 2RS13 1BBT3 3RZKA 1KXGA 2D6PA 4Z8BA 4QB1A 2XJPA 3ZX7A 1JOPA 3WY6A 1CAWA 4KMQA 2ZHNA 4BYYA 2PN5A 1CIWA 1QOTA 3GGLA 4Y33A 4DNYA 4E4SA 1JZ2A 4HT1T 5J36A 2HWB2 1ZVFA 4U36A 2RR11 4N53B 4XF0A 3ZDVA 4C0BA 5F3CA 2BNMA 5HCBA 1Y7BA 4P9WA 2VL4A 1LEDA 1HW5A 4NHYA 2XJVA 4D7YA 4LA2A 1AR71 1QHDA 2WKKA 3A4UA 4X6RB 4PIZA 4XF3A 3RI9A 4YG6A 5FO7B 3GZAA 5I0RA 3M70A 2NMNA 2B45X 2KM2A 3ILRA 3EJKA 5C71A 3GZEA 2XG3A 4LHNA 5LK7B 1X50A 2C1FA 5A3WA 4Z92B 1S2EA 4CEWB 1QKQA 3MIBA 1CZSA 2ETEA 4PIYA 2QE3A 1CX1A 4B1LA 1PO12 4JZRA 5FY8A 4A41A 1BXHA 5EV7A 4AW7A 5D8AB 5HV4A 2QFEA 2FZ1A 2P4EA 1EPZA 1JS9A 1O8SA 2ORZA 3ASIA 3SNMA 2GMPA 1Y3TA 1QJFA 1VJ2A 3NKGA 4YM1A 4RGGA 5DAVA 4I0WB 3K77A 3MLJA 1ZBA1 1NY72 3HOBA 3VBUA 1QH6A 2VZ1A 1LGNA 5FWEA 4LKDA 2C9KA 1FPN3 1YQ8A 2QQNA 3I3QA 4IEUA 4M3CE 1JYTA 1DFQA 2XHNA 4L92A 4AVCA 1W0PA 2EALA 3NNGA 1R083 3VHNA 1VAMA 1XYPA 1J58A 2WLPA 4NN0A 4EJRA 5K4LA 2D93A 2IVIB 3B5LB 2ID4A 3KT1A 5F5IA 3DXUA 5A3NA 4C1XA 3IPVA 3MHZA 4AXOA 1AL21 4W6YA 2KXLA 4A44A 5A3PA 1H8TA 4B4RA 4ZHNA 4A6SA 1HKDA 2HBUA 5FUIA 1G9AA 1H30A 2VCAA 3ZN6A 1QWRA 3OYWA 3KVAA 5E89A 3ZDSA 3HAGA 5I0DA 3ZIXA 2WWJA 1RXGA 1XPWA 1RXFA 1X7NA 1TNFA 3CDZB 5FZ8A 1V9U1 4BMEA 4CTEA 1QQP1 3DKQA 4UBHA 3V64A 5C4WB 3OF1A 2FQPA 3I2IA 2IXLA 3LWCA 4Q4V1 4XF9A 4LR4A 4XHBA 3WW4A 4BOWA 2OIIA 1U5YA 3OPTA 4YVWB 5FP4A 3ZR6A 5BNPB 1RUD1 3M3QA 3OB8A 5LW9A 4MHUA 1GLHA 3IT8A 1N47A 3AMHA 3VHOA 2J1TA 1QQP2 2WN3A 2NPIA 2ZHKA 1G8WA 1UCXA 1ZYBA 2MEV1 1V6LA 2R0FA 4W65A 4X8PA 5DUXA 2NZ9A 4RHV3 3VBHB 3WNMA 5T5PA 4AHZA 5FLIA 1RUD2 2XLGA 1CQ9A 5C8CB 5E16A 2VXJA 3KCYA 4SLIA 1RUG2 2O8QA 1YIPA 3WF1A 1GP4A 1IGOA 4BQ1A 5D1IA 1PMJX 3JCIA 4MXWB 4XJWA 4RGAA 4IERA 2JENA 1PO21 2WA3A 5GLUA 2HYXA 2D5HA 4FOVA 1RGSA 2DCYA 4ZU5A 3ZXEA 1ASJ2 3VDDB 3ACFA 3NWKA 5LRSA 3WNPA 1POQA 3KF3A 1APNA 5EXOA 2RS11 2JIJA 2Y26A 1O4YA 4D6RA 4LBJA 3NV3A 1XNAA 4YLZA 2RS53 5I0TA 4NRPA 2HWF3 1RMU3 3CJIC 4MUVA 5GZDA 1SDWA 5ABJA 4JHZA 2EVXA 4ASMB 5FK8A 2EAKA 4WM8A 4A6OA 2JEMA 1ULEA 5FFOC 1IG0A 3BTYA 2CGOA 4HFSA 4QGMA 3WLUA 1XNKA 4Y5SA 1AYM3 2PYTA 4MGKE 2JDKA 4XF4A 3DEMA 1G9DA 4NRQA 5D21A 5IAXA 2E63A 1A3KA 2E7QA 2N7GA 4LA3A 4NPLA 1EPWA 3AJYA 4D94A 1Q3EA 1UMHA 4MHRA 1S0GA 2YZ4A 3LPFA 5FYUA 1B35C 3GBFA 5K7PA 3I49A 5FPAA 1RUI3 4HOOA 3WG1A 2JD4A 3UK9A 1DIWA 2D6KA 2W95A 2GU9A 4NIDA 5CNAA 3LEIA 1UY0A 2CL2A 1EP0A 5I91A 1QJY2 2VW2A 3C8XA 4BB3A 2Q0AA 1TMF1 5DAPA 5ANQA 4FTSA 1WW4A 4HBNA 2ORXA 1M06G 3JQXA 1NG0A 2DUPA 5GLTA 2R1DA 1QXRA 1NOVA 1Q8PA 3HR9A 4AE2A 4QQOA 2DWRA 3LCPA 2BZDA 3LDKA 1RUC2 4CDWC 4F7ZA 4BZ4A 3AP7A 1OUSA 4R8HA 4E4ZA 1ENQA 5EQUA 3THPA 4XJAA 4IEXA 3M1HA 4CEWA 1LOFC 4Q1RA 5IFTA 4NIAA 4IE7A 4JGZC 1HX6A 4XW3A 1RHI3 4TTGA 2OUHA 2C24A 1DQ4A 3FLTA 5FZAA 5E6HA 4LBKA 1JZ6A 2Z2SB 3EB7A 4M3CF 5I8TA 2Y38A 3CBNA 2HYKA 4RL7A 3IM0A 3KLSA 4YM0A 2W9XA 1OD5A 1UYXA 1W39A 3AXDA 1AL23 1VRBA 4UF0B 1O7FA 2ADDA 1UN1A 3WVJA 3HVDA 4B8EA 4ZKTB 2LUWA 4CP9B 2VNRA 1DLCA 4AWDA 4HLTA 3Q8BA 4LBNA 3KWVA 4FPGA 5IYYA 4XCBA 1C5HA 4JKKA 4QMAA 2P34A 1WWYA 4QDRA 2WT2A 1K5MB 4Y5TA 2GP3A 5FZ0A 3TBDA 2DV9A 4IV3A 2JDZA 2V4VA 2D5FA 3RS6A 4AFAA 4AVAA 5TSWA 3MIFA 3T4HB 3ZSEA 4OVEA 1UW8A 1W2OA 4XFFA 4CEYA 5LZ6A 3LKJA 1CAUA 3HN1A 3POGA 5IUQA 2QQPA 5FRAA 5L7OB 2ZKLA 1LRHA 1PM4A 3BI3A 1DZQA 5DZGA 3MPPG 4Q0QA 1E5SA 1HB3A 5FP7A 5SV5A 1LGBA 2HJIA 4CEYC 1ZRIA 3UKNA 1WMFA 1NA1A 2QZ3A 4EQVA 3SHRA 3PVBB 1MS0A 1QIQA 1XXNA 2XVGA 4QQPA 5JIUA 1MZ6A 2QNKA 3P3NA 4OYUA 4X8NA 4XBNA 1F5JA 5FYYA 3K4ZA 4DFSA 4NIHA 2GH8A 2WABA 2YB7A 4MGYE 5FYTA 3VD5A 2JICA 4WVWA 5GZGA 2RS32 2GN7A 2FDJA 1WW5A 5BNOA 3LSEA 2Q8EA 2Q8CA 4FAGA 2E31A 2X10A 3KB5A 3THCA 3H3LA 1OH4A 2AZ5A 3JBG1 1WGPA 4FOQA 1NXD1 4YYOA 2QQIA 2PHRA 3I2HA 2EIBA 4PLNA 3TWIA 3WNLA 1HJFA 2PHWA 3R0RA 4DY3A 1KDKA 4OHXA 3OGVA 5T54A 3U0ZA 1AR91 3N7LA 3RZLA 1VBE3 4WVMB 3AZZA 4QGLA 2I2SA 3NNLA 1MEC1 2PAMA 3PMSA 1I6XA 1RUH1 4YM2A 2YDEA 3GALA 1ZNPA 2JDAA 2VOKA 4CP0A 3O1VA 3FLPA 5FZ4A 1OOPC 4QX1A 1OLMA 2EIEA 2R061 3VDDA 2DU1A 1LKNA 2PHLA 3WQBA 4ZU7A 5K0UC 1W8TA 1W90A 3EHKA 4FFHA 2CSGA 1BBT2 1NCQB 1PMIA 1X9PA 2ZJCA 1UIKA 3RZZA 4EE2A 3CJXA 2BOIA 4CUCA 3BUCA 2P1BA 3M2MA 2CDOA 1D0GA 1KJLA 1VBA2 3MDPA 1GFF2 1MR5A 4FPHA 5J09A 2FD8A 5T50A 1C4RA 1YQ6A 3UYJA 1PZ7A 1W8WA 4XF1A 1GQPA 3J7MA 2HWB3 1DGRN 1CX4A 2Y33A 4P9JA 4PIXA 4XZPA 2WZPP 3TB0A 3ZFEC 4XUPA 5FJHA 4B7EA 2WSVA 4OI0A 2TBVA 5C4WC 3PVOA 3N4MA 2RS51 1OXCA 3IDCB 4CE8A 2Y60A 4LORA 5FXVA 1LESA 1W8ZA 5FPLA 5FZCA 1W6QB 1SFYA 3VZLA 3UESA 4LOTA 2IXCA 4K21A 3S0MA 2PLV2 2GC1A 1ODMA 2BFUL 3D8CA 4P02B 1HRV1 3U1XA 4DMIA 2VZTA 5FR3A 3KT7A 2A7AA 5LY1A 3N9NA 1RUE3 3I2GA 5CADA 2DF7A 2X5IC 5GKAC 4HL0A 4XCAA 4Q4V2 4YZ5A 2WNUA 2ZX0A 3GNEA 4WM7B 1SLCA 2XH6A 2R062 4RFRB 2DFBA 2PAKA 1NAEA 3GCXA 4IEPA 3ZXFA 3VBSA 5CA6A 5FYIA 5EP9A 2HEWF 1J84A 4UW4A 4XZUG 4ZU4A 3AB0A 3BVCA 5A7QA 5EJ3A 2XLFA 4RS5B 1CN1A 3URFA 3VUOA 4PDWB 1CD3G 1X8MA 1GQHA 2QQKA 5DZFA 4COYA 2BTVC 1S55A 3CLPA 4LHLA 1XE7A 5KR7A 1QEXA 1UZ0A 3DPRC 1R082 1YI9A 4LULA 3K3NA 5FO9B 2KD7A 1C1LA 5BY5A 3MIEA 3PHMA 4CUBA 3NW4A 3ACGA 1R091 1SLTA 4A45A 4CU7A 5LBEA 1H6XA 1SHWB 4GMP3 4RR3B 3WDTA 1YUDA 4GB32 3S30A 1VMHA 2P3IA 4QXBA 5A33B 4Q4X3 3TOJA 2VQAA 3WHUA 4F8AA 4M01A 1B35B 1JZ5A 3WP5A 1JUIA 1MQTC 2EXIA 2QUOA 1Q56A 4MGIE 3AZXA 4J1XA 1RUF1 1AR62 4QB2A 1C28A 2WFF1 3OBAA 1Y9GA 3OD0A 4KNCA 1G9BA 4LK7A 2F4LA 4XYXA 1DBNA 1UO9A 2ET7A 2WL1A 4M3CB 1ZX5A 2L9LA 4CDQA 4NROA 1UKRA 5IVJA 3ES1A 3J7NA 5CKMA 5DDJ1 2IZWA 3VZJA 1H0BA 4FFIA 4WBBA 2YC2A 4IETA 4BQWA 3MLLA 4DUVA 1RUG3 3OTFA 1F9KA 2VJXA 1IPJA 3VL8A 5FZDA 4MG2A 2Y6HA 2WZR1 3HNBM 2C9AA 3N9QA 4AI3A 1MS8A 2DVFA 5FTTC 3CU7A 5LK5A 2VNVA 4GKXA 4L2NA 4LBQD 1B09A 3ZVXA 1HQNA 1K42A 3EYPA 1GZWB 3I4IA 5F2SA 4QHBA 5DMYA 2VU9A 4N9HA 5EZWA 1RUOA 1UKGA 3UL2A 2WFF2 3WDYA 1VB2A 1JTZX 2BWAA 2HWF2 2ZTNA 2RHPA 4CCNA 5L9BA 4YG3A 5KHKA 1WZXA 1YJLA 3MF6A 4EN6B 2RV9A 2VMFA 3T1LA 3WDVA 1Q8SA 2RMU3 1CGPA 3W5MA 1V0AA 2IXIA 1ULPA 2C26A 1YJKA 3B01A 5FAXA 5AC93 5J3UA 3ABZA 5KBFA 2XVKA 1C8M3 1KFXL 5CFCC 2B39A 2BUKA 2E53A 1HB4A 2OPWA 2Y8KA 3N9LA 3WNOA 4CDWA 2OPKA 4BLIA 1RUI2 2OUJA 4B4QA 1NCQA 1BMV2 5H9SA 4JGYB 3CIHA 1QJX1 2VMDA 4QGNA 3O1OA 2QQOA 5FUNA 4MO3M 3O1SA 1JODA 4NWVA 3ELNA 1WLDA 2VMIA 3NVCA 4CEYB 4ORFA 1H9WA 2CAVA 3POBA 4ZONA 3RYRA 2ZGSA 1HXS1 1V6IA 3AYCA 4YWAA 3ZFGA 3HEIA 1MS3A 3HD8B 5A6YA 2VMCA 3O1RA 3PUHA 4XIOA 3VGIA 2BJSA 2DVBA 3AKSA 3K4DA 3IN9A 4NOTA 1RHI1 3POWA 4DXTA 2DCTA 4KL1A 1U12A 1NT0A 3AK0A 3HN3A 4PI2A 1RVF2 5F6KA 2OX0A 1BJQA 3THDA 1D7PM 1YFXA 1FI2A 1G86A 4AFMA 2WT1A 4HMZA 4JCKA 1JN2P 3O7OA 2LTNA 1ASJ1 1QJEA 1VBC3 2ET1A 1CAWB 2RE9A 2FMYA 3VBRC 3PU3A 1MS9A 1AR92 3CKHA 4AF9A 1W03A 2XQXA 5FCCA 4CDXA 2RJ2A 1W05A 2Z42A 3WF2A 5A7SA 1PGW2 1MZEA 1W6MB 2ZHMA 1IG3A 4P9IA 1TG7A 4BDVB 2HWE1 3ZKYA 5KXCA 2ZXQA 1ODNA 3KCXA 1ND2B 1I5PA 1ZBE2 1V70A 3Q8FA 2W87A 3SMHA 1OOPB 1TME1 2VMGA 3PU8A 1GNYA 1SQ4A 3HQXA 4ZXEA 3MZHA 1PGW1 2XJTA 4Q8LA 5ANNA 5FUPA 4DXSA 3USUB 4Q4W2 4OUEA 5F5CA 5T52A 1UQXA 3GYDA 1VLNA 3WDUA 3A21A 4XFHA 3H0OA 4KQ7A 4BQXA 2A6VA 2EXJA 4P5HA 3PVNA 2HLEA 2ZGKA 5LASA 4YGDA 1GWKA 4RQPA 4MXVA 4QKNA 2ES3A 5JXJA 3T08A 2CGNA 2WO7A 3ZO0B 1IS4A 4URTA 5C5TA 5A3TA 1GANA 1W3XA 1AXYA 2O1QA 3M3OA 4CUGA 1GZCA 5KHGA 1JZ3A 1KGYA 4FOYA 2CHHA 4I09A 3N3HA 2D3RA 3WNNA 4BU2A 4IV3C 4QQHA 1GOHA 1R093 5FZMA 3RSJA 1DQ5A 1IOAA 1H8TB 3A23A 1N3QA 3J7LA 3ZMOA 2R073 4PF1A 2BU9A 3AKPA 2DFCA 4G9SB 3FHQA 4PBOA 3W21A 3ZYPA 1ZRCA 4XETA 2VD7A 3ES4A 5FPVA 5A32A 3BOPA 4R9AA 2PHDA 3DUIA 1RUH2 3NJZA 5JZGB 1W9FA 1AXKA 1DZRA 4NO4A 3NQHA 2VOTA 1PX4A 5FZLA 1PHMA 2VZPA 2Y0OA 5A7WA 1C3HA 1UYYA 1AR83 3USSA 3ZFEA 2A70A 3POIA 2GN3A 2ZGQA 1XU2A 4Y3OA 2DURA 2JE7A 3D5OA 3HNMA 3WEZA 4ASKA 2Y64A 4JDNA 2Q8DA 4QM8A 2Q5TA 5EFUA 4BA6A 3RZJA 4NR1A 4FP2A 5FY1A 4EYUA 2JG9A 3HWJA 4R9DA 4ZS2A 1H9PA 4NMIA 3RWNA 1S2BA 4Z1VA 4Z2AA 1RINA 1U0AA 5LBCA 2VM9A 5C9AB 1ND2A 5JOXA 4PLMA 4IGOA 3KF5A 5DAQA 3PMEA 3HNYM 5CVRA 3AL5A 2ZGNA 1MQTB 5I8SA 2QQJA 2P3YA 2Q30A 3VDCA 4P9LA 4TLFA 3NAPC 2GNTA 2DTYA 4Q0PA 3HIFA 2YROA 3BOWA 4B4PA 1JYWA 5IVYA 5L73A 2A3WA 4XABA 3RG0A 1JBCA 3VZKA 3WW1A 1UOJA 2DVAA 2JWPA 3ACLA 2XBO3 4M3CA 1J3PA 2W1WA 4IE0A 5FMDA 3KM5A 3THTA 4CDQB 5CB7A 1YWKA 4A3XA 3O1UA 2BNNA 3B94A 4Q27A 2FZ2A 4AQTA 1GU3A 3RJRA 4IV1C 5CFDC 2NYYA 3BKZA 3J8F2 4QPYA 2G9ZA 2DU0A 1WCKA 1UOBA 2J1RA 2E32A 1BK0A 1O91A 3MGUA 1XJAA 4M0NA 1LHOA 5J96B 1CAVB 4O9EA 2E6VA 5IJRA 2OQ7A 2A6XA 1PZ9A 4QX8A 2R0HA 4NHXA 4YZ3A 4AR2A 5LATA 2J1UA 3UETA 1SBEA 2HWD1 3NJXA 3D0SA 1A8MA 1JYVA 4CDXB 1F15A 2V5YA 1D4M3 1H2NA 4QDSA 4QXKA 3PL0A 1W6MA 2B7YA 4IE6A 5FWJA 5IVEA 4OQ8A 1DGRA 4FFGA 4IE4A 3RYKA 3VBFC 5LA9A 1OLME 1LECA 1WMDA 1VALA 2BV4A 4CXYA 1GOGA 4YM3A 3H7YA 3LIGA 1UU6A 5JR7B 2QCSB 3KCCA 4LO5B 3S7IA 3ZXLA 5M0TA 5IWFA 3AMMA 5LEKA 1F35A 2PHUA 3PVEA 2AEZA 3BODA 4I01A 3LOIA 3DV8A 2WNVB 2WQ4A 4Z2WA 1TMF2 1GR3A 3I7DA 4V2VA 3VBOC 2A3XA 4IEYA 1HRV2 1KQRA 1GWMA 4FTEA 1VBD3 5SV8A 4CPBA 2B9UA 1Z7S2 3BALA 2XWBB 2A6ZA 1ULGA 3I59B 2OZJA 1AR63 1BKZA 1IPKA 2JJ6A 3CO2A 4AVTA 1GV9A 1YXWA 1TEIA 3M7AA 3RMXA 2J1EA 3V0AA 3NRUA 1HRI2 1QY4A 3GJBA 2PELA 3M4FA 4MSVA 1KFUL 1GBGA 2WJSA 2QQWA 2VTXA 4E27A 2CTVA 1VAKA 2E7AA 2R6QA 4CCEA 1LR5A 3OY8A 4AEDB 2TUNA 3PJYA 1IS5A 4JRAA 1OA4A 5A3OA 1JU4A 2XJSA 1EAH1 1OA2A 4L9BA 5FZKA 4XDOA 5A3LA 5C3QA 1ND3B 5JLVA 1LTEA 1CPMA 1G6NA 2ZGMA 1XE8A 1R1A1 5EIYB 1BEV1 1NXMA 1RUF3 3H1YA 4NHMA 4CXWA 5C8CC 4D3WA 3WNKA 3VBHA 3AYEA 4XC9A 1NA1B 2RMU1 2WFF3 5A7WB 4IEZA 4GKYA 5LEJA 2HWE2 3VD7A 3S6PA 3L2HA 2X05A 1VBB3 1VR3A 3C7GA 3ZXKA 2Q8OA 5JCTA 4UFKA 1HN0A 1Z7S1 4UFMA 5K0UA 3VDDC 1REDA 2D40A 1JYNA 1W3VA 2HWF1 3PTYA 2OW4A 2VQ0A 5DDJ3 3H42B 5HBAA 1CESA 2WSUA 4HSJA 5AC92 5CG8A 1V6JA 1WMXA 2EIGA 4Q4Y2 1Q8QA 4CCOA 1ACCA 1SLLA 3TN92 2Q4SA 2W1SA 3CJIB 3DL3A 3MLKA 5IVBA 1MS5A 4LK6A 2DUQA 4LBOA 4HN1A 3CZJA 4RQPB 1KD7A 3K2OA 1F2NA 2VCBA 2A5ZA 3TEZA 2QQUA 5F37A 1VIWB 1X8EA 1JOJA 3I2KA 4CDUC 1MVQA 2MHFA 3AYDA 5H9RA 1UOFA 1FYUA 4LXLA 2R7EB 2VUAA 4DINB 4P00B 3APBA 3VD9A 2P17A 2Z5WA 4QU1A 2BVVA 5FZOB 4AFBA 1KS5A 3FFZA 4EZHA 1LOFA 1V6NA 4AZZA 5HCAA 3MFAA 4AGGA 1OI6A 5JI9A 3N9PA 1AXZA 3RPQA 3FX3A 1H8TC 5AVPA 1JI6A 1W6PA 4OHZA 1RVF3 1HB1A 5FZBA 2TNFA 1EUUA 2GMMA 4LQRA 3D82A 4YW1A 2JKXA 5LA2A 5F5QA 4PHZA 1TZOA 3U4SA 3BGAA 3VV1A 2LALA 2QVSB 2CWMA 3VLBB 2EICA 1LHUA 1UY3A 4AEJA 4OHVA 2X29A 5FY9A 1AUYA 4UFHA 1OHFA 3OGGA 1O5LA 2WNOA 3N7MA 4CP2A 3ZFFB 3U07A 3ITQA 3BPSA 1Y9MA 1POV1 3ALQA 2PQSA 2JKBA 4AEKA
chains in the Genus database with same CATH topology
1NX9A 3T0AA 1DYOA 3IIIA 3CMGA 3BN6A 2VZVA 4CUCA 4W50A 3I97A 2CDOA 1W0NA 3VDAA 1K3IA 1OF4A 5G04L 2OKXA 1K45A 1GQPA 4QX3A 1CZTA 5HXMA 4ARYA 3I2FA 4XUPA 1RYYA 3VDBA 1UX7A 4KI5M 4MGQA 2DCJA 1US2A 2WO1A 2W91A 3UESA 5EJZB 4YPJA 3C7EA 4P02B 3OEBA 2E33A 2VZTA 3I3EA 3D3AA 3I2GA 2ZEZA 4UI9L 3SKVA 5LA0A 3ECQA 1MPXA 5CYYA 3A7QA 2WAOA 1JZ7A 2Y6LA 2VC9A 3OGSA 4W4ZA 4ZZ8A 4D0QA 1NAEA 3IAPA 4P5YA 4QX2A 2W5FA 2Z4FA 1J84A 4XZUG 3FHAA 3MUZ1 3MV11 2WYSA 2QQKA 1UZ0A 3ACIA 3DYMA 3SEPA 1GOFA 2KD7A 4CUBA 3U37A 4JKMA 1ULOA 3ACGA 4CUAA 4XUTA 4A45A 5JXGA 4CU7A 1H6XA 1SHWB 4P08A 2QQLA 2DDUA 5HPOA 1JZ5A 4QB6A 1L7RA 3VD3A 1IQDC 3JXSA 4JX0A 3MV01 3VD4A 5LA1A 3ETPA 4GWJA 1LNSA 4BJ0A 4QB2A 5C70A 4UOJA 3OBAA 2WQ8A 2YFZA 2W47A 1W9WA 4MADA 2VMEA 2VO5A 1W8NA 2WZEA 2L9LA 5JR2A 3T0DA 1BHGA 2XOMA 1US3A 3DECA 3OEAA 1EUTA 2YC2A 3C7HA 4D8MA 4DUVA 2VJXA 3FL7A 1JYXA 5IFPA 2Y6HA 3HNBM 2ZEXA 3SEEA 1JZ8A 5DN2A 3I2JA 4E8DA 3CQOA 1TVGA 5JXIA 1PMHX 2VZSA 4QAWA 3T0BA 1K42A 3EYPA 5IHRA 5DMYA 3W5NA 1WCQA 1KEXA 2WZ8A 3LE0A 1NUKA 2QQMA 4W8JA 2RV9A 1OT5A 2VMFA 2BBAA 1UY4A 3MO4A 3W5MA 1ULPA 2C26A 3ABZA 4XURA 2X09A 1UWWA 2EIDA 2JE8A 1H6YA 1F4HA 2Y8KA 3WNOA 2BERA 2W3JA 2J1AA 4M4PA 1GMMA 4DUWA 1JZ4A 3CIHA 2VTFA 2VMDA 2QQOA 1O8PA 4MO3M 3MBWA 4UAPA 2J1VA 2WO3A 4L0PA 1W9TA 1YQ2A 4XUNA 1UXZA 3HEIA 2BGOA 2VMCA 2C4XA 3PUHA 1R64A 1WKYA 2VZOA 4DUXA 3K4DA 4MOAA 4DXTA 3HN3A 1DP0A 2VZRA 3THDA 1D7PM 3HJRA 4OZOA 1CZVA 5JMOA 4ZY9A 4PT6A 2ZEWA 2W46A 3T2PA 3CKHA 2XQXA 4RN5A 4PQQA 2RJ2A 3WF2A 3PUIA 4BDVB 1TG7A 4RYDA 2ZXQA 1I5PA 2W87A 1T2XA 3DYOA 5C7GA 1NKGA 1GNYA 4QB1A 3ZM8A 4ZXEA 5B4NA 4DXSA 4OUEA 4KMQA 5B4XA 1OF3A 3GGLA 2RVAA 1JZ2A 3A21A 3I3BA 5J1XA 3SKJE 3WF4A 1JU3A 2HLEA 2WAAA 2VL4A 2WDBA 3C7FA 5JXJA 3T08A 1XC6A 2J7MA 4A42A 3FN9A 2B9VA 5C71A 1JZ3A 1KGYA 3WNNA 1GOHA 3K4AA 4ARXA 1CZSA 4GZ9A 3A23A 1CX1A 3K75B 4PF1A 3FHQA 4A41A 4DEVA 1O8SA 2ORZA 4HG6B 2VQUA 3K77A 3HOBA 2VZ1A 3NQHA 2VOTA 1PX4A 2C9KA 2VZPA 2QQNA 1UYYA 2XHNA 3NNGA 2Y6KA 4BK4A 3WEZA 3LEGA 3HNMA 4MGSA 1K12A 2E26A 2ID4A 2Y64A 1JHJA 3T2QA 2B4KA 3WF3A 1UMIA 5EJ1B 4A44A 1W9SA 1W99A 4DXRA 1J83A 5FUIA 2YG0A 3LPGA 2VCAA 1CIYA 2LW8A 2W1QA 3GXUA 5F7UA 4Z2AA 2JD9A 2ZEYA 2YFUA 5I0DA 2VM9A 2LS6A 1XPWA 3CDZB 2Y6JA 3CZUA 3T2OA 3I2IA 3HNYM 2DCKA 2W1UA 2QQJA 3C7OA 3OB8A 4LKSA 3VDCA 4CU6A 1O59A 3AC0A 4E8CA 1JYWA 2J1TA 2WN3A 3GDBA 2VZQA 3WNMA 3WF0A 2W1WA 4XVHA 3WF1A 1GU3A 4CVUA 1PMJX 2W92A 1GUIA 3A22A 2WBKA 2HYXA 2J1RA 2E32A 3DYPA 2VCCA 3OG2A 3ACFA 5IJRA 3WNPA 4ET7A 2J1UA 3UETA 3NJXA 4XUQA 1XNAA 2VZ3A 1JYVA 1UXXX 1HN1A 4QDSA 4JHZA 4A6OA 4QDQA 4BK5A 4M4RA 4LPLA 2CDPA 5DQ0A 2Y6GA 1GOGA 1SDDB 2J1SA 5DPNA 3ACHA 3P6BA 1UMHA 1SG3A 3LPFA 1XNTA 2W95A 3UNPA 2WO2A 1P8JA 3LEIA 4A4AA 1UY0A 3WSOA 3C8XA 3GM8A 3HPNA 2J1EA 2WUHA 2YC4A 3NRUA 2ORXA 3T09A 4KWUA 4QPWA 2BZDA 5G05L 3I3DA 3NJVA 1JU4A 3LEKA 3LQCA 5IFTA 4OMDA 4A3ZA 2VQTA 5CZKA 2VR4A 4TTGA 1W8OA 3P1IA 4DEQA 1JZ6A 3EB7A 5EIYB 5JXHA 1UY2A 2J22A 2W9XA 1UYXA 3WNKA 1L7QA 1UYZA 2BGPA 5JUVA 3K46A 2VZUA 1DLCA 3VD7A 2X05A 4CU8A 3C7GA 5IYYA 1JYNA 4AAXA 4JKKA 4ZZ5A 4QDRA 2V5DA 2V4VA 4IUGA 2XONA 3MUY1 3F2ZA 1OD3A 3J7HA 2W1SA 2QBXA 4BXSV 3IB3A 3CZJA 4XUOA 2VCBA 4JKLA 2W94A 4LHSA 3I2KA 3E1F1 2R7EB 4OYUA 4P00B 3VD9A 3K4ZA 3IDAA 2WABA 3IAQA 4FI9A 2YB7A 3VD5A 4QX0A 4CU9A 2E31A 2X10A 3THCA 1PX3A 1OH4A 1UY1A 4OMCA 1JI6A 2QQIA 3I2HA 2EIBA 3WNLA 4AG4A 5LCWL 1EUUA 4LQRA 3OGVA 2V72A 2JKXA 4TXWA 3OGRA 5LA2A 5A1AA 3BGAA 2EICA 4GWIA 1UY3A 2JDAA 4QX1A 2EIEA 1F4AA 2PQSA 2WN2A 3WQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NX9 A;  3T0A A;  1DYO A;  3III A;  3CMG A;  3BN6 A;  2VZV A;  4CUC A;  4W50 A;  3I97 A;  2CDO A;  1W0N A;  3VDA A;  1K3I A;  1OF4 A;  5G04 L;  2OKX A;  1K45 A;  1GQP A;  4QX3 A;  1CZT A;  5HXM A;  4ARY A;  3I2F A;  4XUP A;  1RYY A;  3VDB A;  1UX7 A;  4KI5 M;  4MGQ A;  2DCJ A;  1US2 A;  2WO1 A;  2W91 A;  3UES A;  5EJZ B;  4YPJ A;  3C7E A;  4P02 B;  3OEB A;  2E33 A;  2VZT A;  3I3E A;  3D3A A;  3I2G A;  2ZEZ A;  4UI9 L;  3SKV A;  5LA0 A;  3ECQ A;  1MPX A;  5CYY A;  3A7Q A;  2WAO A;  1JZ7 A;  2Y6L A;  2VC9 A;  3OGS A;  4W4Z A;  4ZZ8 A;  4D0Q A;  1NAE A;  3IAP A;  4P5Y A;  4QX2 A;  2W5F A;  2Z4F A;  1J84 A;  4XZU G;  3FHA A;  3MUZ 1;  3MV1 1;  2WYS A;  2QQK A;  1UZ0 A;  3ACI A;  3DYM A;  3SEP A;  1GOF A;  2KD7 A;  4CUB A;  3U37 A;  4JKM A;  1ULO A;  3ACG A;  4CUA A;  4XUT A;  4A45 A;  5JXG A;  4CU7 A;  1H6X A;  1SHW B;  4P08 A;  2QQL A;  2DDU A;  5HPO A;  1JZ5 A;  4QB6 A;  1L7R A;  3VD3 A;  1IQD C;  3JXS A;  4JX0 A;  3MV0 1;  3VD4 A;  5LA1 A;  3ETP A;  4GWJ A;  1LNS A;  4BJ0 A;  4QB2 A;  5C70 A;  4UOJ A;  3OBA A;  2WQ8 A;  2YFZ A;  2W47 A;  1W9W A;  4MAD A;  2VME A;  2VO5 A;  1W8N A;  2WZE A;  2L9L A;  5JR2 A;  3T0D A;  1BHG A;  2XOM A;  1US3 A;  3DEC A;  3OEA A;  1EUT A;  2YC2 A;  3C7H A;  4D8M A;  4DUV A;  2VJX A;  3FL7 A;  1JYX A;  5IFP A;  2Y6H A;  3HNB M;  2ZEX A;  3SEE A;  1JZ8 A;  5DN2 A;  3I2J A;  4E8D A;  3CQO A;  1TVG A;  5JXI A;  1PMH X;  2VZS A;  4QAW A;  3T0B A;  1K42 A;  3EYP A;  5IHR A;  5DMY A;  3W5N A;  1WCQ A;  1KEX A;  2WZ8 A;  3LE0 A;  1NUK A;  2QQM A;  4W8J A;  2RV9 A;  1OT5 A;  2VMF A;  2BBA A;  1UY4 A;  3MO4 A;  3W5M A;  1ULP A;  2C26 A;  3ABZ A;  4XUR A;  2X09 A;  1UWW A;  2EID A;  2JE8 A;  1H6Y A;  1F4H A;  2Y8K A;  3WNO A;  2BER A;  2W3J A;  2J1A A;  4M4P A;  1GMM A;  4DUW A;  1JZ4 A;  3CIH A;  2VTF A;  2VMD A;  2QQO A;  1O8P A;  4MO3 M;  3MBW A;  4UAP A;  2J1V A;  2WO3 A;  4L0P A;  1W9T A;  1YQ2 A;  4XUN A;  1UXZ A;  3HEI A;  2BGO A;  2VMC A;  2C4X A;  3PUH A;  1R64 A;  1WKY A;  2VZO A;  4DUX A;  3K4D A;  4MOA A;  4DXT A;  3HN3 A;  1DP0 A;  2VZR A;  3THD A;  1D7P M;  3HJR A;  4OZO A;  1CZV A;  5JMO A;  4ZY9 A;  4PT6 A;  2ZEW A;  2W46 A;  3T2P A;  3CKH A;  2XQX A;  4RN5 A;  4PQQ A;  2RJ2 A;  3WF2 A;  3PUI A;  4BDV B;  1TG7 A;  4RYD A;  2ZXQ A;  1I5P A;  2W87 A;  1T2X A;  3DYO A;  5C7G A;  1NKG A;  1GNY A;  4QB1 A;  3ZM8 A;  4ZXE A;  5B4N A;  4DXS A;  4OUE A;  4KMQ A;  5B4X A;  1OF3 A;  3GGL A;  2RVA A;  1JZ2 A;  3A21 A;  3I3B A;  5J1X A;  3SKJ E;  3WF4 A;  1JU3 A;  2HLE A;  2WAA A;  2VL4 A;  2WDB A;  3C7F A;  5JXJ A;  3T08 A;  1XC6 A;  2J7M A;  4A42 A;  3FN9 A;  2B9V A;  5C71 A;  1JZ3 A;  1KGY A;  3WNN A;  1GOH A;  3K4A A;  4ARX A;  1CZS A;  4GZ9 A;  3A23 A;  1CX1 A;  3K75 B;  4PF1 A;  3FHQ A;  4A41 A;  4DEV A;  1O8S A;  2ORZ A;  4HG6 B;  2VQU A;  3K77 A;  3HOB A;  2VZ1 A;  3NQH A;  2VOT A;  1PX4 A;  2C9K A;  2VZP A;  2QQN A;  1UYY A;  2XHN A;  3NNG A;  2Y6K A;  4BK4 A;  3WEZ A;  3LEG A;  3HNM A;  4MGS A;  1K12 A;  2E26 A;  2ID4 A;  2Y64 A;  1JHJ A;  3T2Q A;  2B4K A;  3WF3 A;  1UMI A;  5EJ1 B;  4A44 A;  1W9S A;  1W99 A;  4DXR A;  1J83 A;  5FUI A;  2YG0 A;  3LPG A;  2VCA A;  1CIY A;  2LW8 A;  2W1Q A;  3GXU A;  5F7U A;  4Z2A A;  2JD9 A;  2ZEY A;  2YFU A;  5I0D A;  2VM9 A;  2LS6 A;  1XPW A;  3CDZ B;  2Y6J A;  3CZU A;  3T2O A;  3I2I A;  3HNY M;  2DCK A;  2W1U A;  2QQJ A;  3C7O A;  3OB8 A;  4LKS A;  3VDC A;  4CU6 A;  1O59 A;  3AC0 A;  4E8C A;  1JYW A;  2J1T A;  2WN3 A;  3GDB A;  2VZQ A;  3WNM A;  3WF0 A;  2W1W A;  4XVH A;  3WF1 A;  1GU3 A;  4CVU A;  1PMJ X;  2W92 A;  1GUI A;  3A22 A;  2WBK A;  2HYX A;  2J1R A;  2E32 A;  3DYP A;  2VCC A;  3OG2 A;  3ACF A;  5IJR A;  3WNP A;  4ET7 A;  2J1U A;  3UET A;  3NJX A;  4XUQ A;  1XNA A;  2VZ3 A;  1JYV A;  1UXX X;  1HN1 A;  4QDS A;  4JHZ A;  4A6O A;  4QDQ A;  4BK5 A;  4M4R A;  4LPL A;  2CDP A;  5DQ0 A;  2Y6G A;  1GOG A;  1SDD B;  2J1S A;  5DPN A;  3ACH A;  3P6B A;  1UMH A;  1SG3 A;  3LPF A;  1XNT A;  2W95 A;  3UNP A;  2WO2 A;  1P8J A;  3LEI A;  4A4A A;  1UY0 A;  3WSO A;  3C8X A;  3GM8 A;  3HPN A;  2J1E A;  2WUH A;  2YC4 A;  3NRU A;  2ORX A;  3T09 A;  4KWU A;  4QPW A;  2BZD A;  5G05 L;  3I3D A;  3NJV A;  1JU4 A;  3LEK A;  3LQC A;  5IFT A;  4OMD A;  4A3Z A;  2VQT A;  5CZK A;  2VR4 A;  4TTG A;  1W8O A;  3P1I A;  4DEQ A;  1JZ6 A;  3EB7 A;  5EIY B;  5JXH A;  1UY2 A;  2J22 A;  2W9X A;  1UYX A;  3WNK A;  1L7Q A;  1UYZ A;  2BGP A;  5JUV A;  3K46 A;  2VZU A;  1DLC A;  3VD7 A;  2X05 A;  4CU8 A;  3C7G A;  5IYY A;  1JYN A;  4AAX A;  4JKK A;  4ZZ5 A;  4QDR A;  2V5D A;  2V4V A;  4IUG A;  2XON A;  3MUY 1;  3F2Z A;  1OD3 A;  3J7H A;  2W1S A;  2QBX A;  4BXS V;  3IB3 A;  3CZJ A;  4XUO A;  2VCB A;  4JKL A;  2W94 A;  4LHS A;  3I2K A;  3E1F 1;  2R7E B;  4OYU A;  4P00 B;  3VD9 A;  3K4Z A;  3IDA A;  2WAB A;  3IAQ A;  4FI9 A;  2YB7 A;  3VD5 A;  4QX0 A;  4CU9 A;  2E31 A;  2X10 A;  3THC A;  1PX3 A;  1OH4 A;  1UY1 A;  4OMC A;  1JI6 A;  2QQI A;  3I2H A;  2EIB A;  3WNL A;  4AG4 A;  5LCW L;  1EUU A;  4LQR A;  3OGV A;  2V72 A;  2JKX A;  4TXW A;  3OGR A;  5LA2 A;  5A1A A;  3BGA A;  2EIC A;  4GWI A;  1UY3 A;  2JDA A;  4QX1 A;  2EIE A;  1F4A A;  2PQS A;  2WN2 A;  3WQB A; 
#chains in the Genus database with same CATH topology
 1UOG A;  1GIC A;  3KQR A;  3FBM A;  1VB4 A;  3H8X A;  1NX9 A;  4W6X A;  3ZSJ A;  4JVA A;  4OI2 A;  4XIK A;  1COV 1;  4QX7 A;  3T0A A;  2AH2 A;  3VKO A;  3KV9 A;  1QJX 2;  2XDV A;  3I97 A;  1CON A;  2XL9 A;  3LSD A;  1UPI A;  4EZ4 A;  4YW5 A;  1S0F A;  4CPB D;  5G04 L;  1K45 A;  2AEY A;  4NJ4 A;  2ZKN A;  1JHN A;  4ARY A;  5C9A C;  1DG6 A;  1XNC A;  3I2F A;  1RYY A;  4HKO A;  1LOE A;  3QH6 A;  2D98 A;  4O7X A;  3NL1 A;  4MGQ A;  2XJR A;  1MQT A;  4AI1 A;  2QQV A;  1CVN A;  1K5M C;  1AJO A;  1OVP A;  3ZXJ A;  5IVC A;  1GSL A;  4OUL A;  3WHT A;  1SZB A;  2W91 A;  5EJZ B;  3TEX A;  2OYZ A;  2R04 3;  2SBA A;  1N1T A;  3OEB A;  3KQ4 B;  4YRD A;  3OBZ A;  3I3E A;  5E8A A;  4YZ4 A;  3D3A A;  2PLV 1;  2HEV F;  3GJA A;  4CCM A;  3ECQ A;  4Q26 A;  3ZYH A;  4CDQ C;  5L7O C;  3W58 A;  3NKT A;  1R09 2;  3A7Q A;  5JI7 A;  3VBU B;  3EXU A;  1NYW A;  1W8F A;  1QXP A;  1YQC A;  2A73 B;  4QXC A;  1NCR B;  3WZ1 A;  4XFB A;  5JSR A;  1WLW A;  3SIS A;  2JIG A;  4AAP A;  5IAT A;  1Q8O A;  3IAP A;  2ADE A;  2HEY F;  4P5Y A;  1OSG A;  3NMB A;  2ILM A;  4FAH A;  1L3J A;  1JMU B;  1DYP A;  4GH4 B;  3WDX A;  1O3R A;  3MUZ 1;  1SBD A;  4QPI A;  4KWK A;  5F32 A;  1PVC 2;  1LHV A;  4KWL A;  5BNN C;  1UZY A;  2WNU B;  3LA3 A;  1NE6 A;  2ZOE B;  4K1Y A;  3ACI A;  4ZPI A;  1GOF A;  1PIV 1;  2DVD A;  5IK7 A;  4N53 A;  3GHN A;  2Y6F A;  5A6X A;  3AVR A;  3U37 A;  1ULO A;  2VH9 A;  2RS1 2;  2VVD A;  2OQ6 A;  4BCU A;  5JXG A;  1V9U 3;  3FFQ A;  3HMY A;  3AP5 A;  4ZXK A;  4HSL A;  1WBL A;  3NJY A;  4AOC A;  4CEW C;  4XFI A;  3GF6 A;  4HVO A;  4D6Q A;  3ILF A;  4N7I A;  2WNV C;  2GC0 A;  3TYJ A;  4KBZ A;  3AP6 A;  5KHI A;  1PGL 1;  4UFI A;  1BEV 3;  1L7R A;  3VBO B;  1IQD C;  2JG8 C;  3JXS A;  4LBQ B;  4Q0U A;  3PNA A;  3VD4 A;  2FHR A;  3ETP A;  1UAI A;  1AX2 A;  4Q4Y 1;  4UOJ A;  1FMD 3;  4LMF A;  2YFZ A;  2W47 A;  4PF5 A;  4YVW C;  1YQ5 A;  3RZM A;  3KMH A;  2R32 A;  2GAU A;  3F95 A;  5JR2 A;  1US3 A;  1HDK A;  2GH2 A;  4Q2F A;  4AI2 A;  1FNY A;  3MYX A;  1I1E A;  4UXA A;  4XMI A;  1S0C A;  1ZZ7 A;  1POV 0;  3U75 A;  5D8A A;  3BIE A;  5FKB A;  4Y26 A;  5C6C A;  1JYX A;  1H4H A;  5IFP A;  1IS6 A;  4XQD A;  1JZ8 A;  4COV A;  5AVA A;  5ABJ B;  1POV 3;  3ZYF A;  3BU7 A;  1WW7 A;  4FQZ A;  1DQ6 A;  2WIN B;  3T0B A;  1D4V B;  1AL0 G;  1BBT 1;  4GUL A;  2NM1 A;  1MAC A;  4P9G A;  5K9Y A;  2WZ8 A;  2FDH A;  4IEW A;  3FE5 A;  1LEM A;  3KD4 A;  1NUK A;  2QQM A;  2ZPX A;  5JOY A;  1WD3 A;  2YXS A;  2IFW A;  5CU1 A;  1VE0 A;  1D4M 2;  2VE1 A;  4W8J A;  4CXX A;  4CSW A;  4JGY A;  1A78 A;  3MIH A;  3WIN E;  1OT5 A;  2CGP A;  4QKB A;  2YC0 A;  2X8K A;  3WUC A;  2I45 A;  4YFZ A;  3AX4 A;  2BPA 2;  1W2A X;  1RUI 1;  5CG9 A;  1SCR A;  2ATF A;  1D0H A;  1OA3 A;  1S1A A;  1UNB A;  2ARB A;  4Z07 A;  1W0O A;  3TEW A;  2D43 A;  5GZC A;  1A8D A;  3UV9 A;  3ST7 A;  1PVX A;  3WR0 A;  1F4H A;  4FO9 A;  3RYP A;  5J98 B;  2W3J A;  1FV2 A;  1YFU A;  4XXA A;  2VOW A;  5KXE A;  1LOG A;  2FDG A;  1TMF 3;  1XSQ A;  2CV6 A;  1N1V A;  5T5J A;  1S2K A;  3KHB A;  1LU2 A;  1HRV 3;  2VBD A;  3AMP A;  4N43 B;  1VBD 2;  4BWO A;  4AVV A;  4RQP C;  5LBF A;  4OUM A;  2HWC 1;  4K8F A;  5A7N A;  2G9F A;  3JD7 1;  3SLI A;  4UAP A;  2J1V A;  1JYC A;  1ZZC A;  2D6L X;  1PGS A;  4HXC A;  4L0P A;  4RR3 C;  2FDK A;  2XXZ A;  4HPK A;  3M3E A;  3D0J A;  1W9T A;  2W68 A;  1WLC A;  2I74 A;  1OOP A;  2ZS6 B;  1PZ8 A;  4XXP A;  4XUN A;  2BGO A;  2BBV A;  1QNW A;  1YO8 A;  5C3S A;  3ZLI A;  2F6B A;  2PQQ A;  2XQR A;  2VZO A;  3NNJ A;  4LBQ A;  2WA4 A;  1ENR A;  2RDQ A;  1FV3 A;  4IEV A;  4RHV 2;  4YSF A;  4QQL A;  4E9K A;  1NE4 A;  3K51 A;  2HWD 2;  2VCM A;  5KXD A;  1DP0 A;  1VPH A;  2VZR A;  3G6J B;  1XRU A;  2WR9 A;  1X82 A;  4XQ4 A;  1CZV A;  3NNM A;  4WM8 B;  4PT6 A;  3ZPO A;  4LUM A;  4S2H A;  2JDN A;  2PHX A;  3N7K A;  1LB2 A;  4YW6 A;  4K40 A;  1U5X A;  3ZFG B;  2AC1 A;  3ILN A;  3IKW A;  5J7M A;  1VBB 1;  1AR6 1;  1RUF 2;  4KGQ A;  4UF0 A;  4RYD A;  4TYS A;  3OPZ A;  3WP4 A;  3ZFF A;  2BOJ A;  5FZF A;  2EXK A;  3AXE A;  4AFD A;  1T2X A;  3BCW A;  1HLC A;  3O14 A;  1Z0H A;  2QDN A;  2ENR A;  3MIC A;  3MW4 A;  3ZM8 A;  4COW A;  3SIT A;  1DQ2 A;  4K20 A;  3ZYI B;  3B9C A;  5CBL A;  2B5H A;  5DZE A;  3H8U A;  4FP3 A;  3T3Y A;  2VUD A;  2K0G A;  2KA3 A;  3H9A A;  4FT8 A;  3V0B A;  3J4U H;  2RVA A;  4YGE A;  4Q4Y 3;  1EAH 3;  3SCG A;  3TN9 3;  5J1X A;  4NPR A;  1EYB A;  1BLZ A;  1FMD 1;  2DCZ A;  4BPZ A;  3VN4 A;  1Y9Q A;  1NLQ A;  4B3N A;  2C0Z A;  4J25 A;  4U2A A;  2LM3 A;  2WDB A;  2BW8 A;  4RHV 1;  4J6G A;  4FBF A;  1F8V A;  4DPN A;  1JYI A;  2LRO A;  4AI9 A;  4FCA A;  1HV0 A;  1RTV A;  2DBN A;  3ZR5 A;  4HVQ A;  2H6B A;  3RZH A;  1W28 A;  1FX5 A;  1PIV 3;  2B9V A;  3RI8 A;  2WZR 2;  3WNX A;  2XB6 C;  3MI8 A;  1WBF A;  4MZU A;  3K4A A;  3IBM A;  3JZV A;  4ARX A;  2NN8 A;  4FTB A;  2B46 X;  4IXL A;  5GLV A;  5I8Y A;  2VOV A;  4G4F A;  4H55 A;  2FCV A;  3K75 B;  2VNO A;  2QDR A;  3VBU C;  1UZZ A;  3R4U A;  3RJ2 X;  1NCR C;  1U5Z A;  4LLO A;  4LUK A;  4HG6 B;  1G9C A;  3I8T A;  1XOY A;  2VQU A;  3RRD A;  1O4Z A;  2PHT A;  4Q4W 1;  1NCR A;  4I30 A;  1MZ5 A;  3WXP A;  1SFP A;  5I93 A;  3B7M A;  1SCS A;  1UZW A;  4MH0 E;  1QGL A;  4QHZ A;  1PM7 A;  2OXB A;  4BMB A;  4L8Q A;  4BK4 A;  1GZ9 A;  4DQA A;  2WS9 2;  2WNU C;  2ZML A;  3LF7 A;  1K12 A;  2E26 A;  3AP9 A;  1SLA A;  4AI8 A;  5DAW A;  1PNF A;  2B4K A;  3WF3 A;  5A7P A;  5EJ1 B;  5C3P A;  1KIT A;  1W9S A;  3IMN A;  4DXR A;  5JZG A;  2D7F A;  3A0N A;  2A3Y A;  1QJX 3;  4CYD A;  4OCT A;  5JVV A;  2LW8 A;  1W2N A;  2VXR A;  1RUN A;  5F7U A;  2ZEY A;  1CAU B;  2YFU A;  3QCW A;  2DYC A;  1NLR A;  5L7O A;  2LS6 A;  1D2S A;  3R4D B;  3N7J A;  3UJO A;  3JU9 A;  4XBQ A;  1OMI A;  3NO8 A;  2JDP A;  2Y6J A;  3CZU A;  2JEC A;  3KHC A;  2DCK A;  3QOP A;  3LZZ A;  3VBO A;  5FXW A;  1DHK B;  3SH4 A;  2IXH A;  4LKS A;  2VG9 A;  3ZFE B;  1WA4 A;  5FMO L;  4E8C A;  3W59 A;  1O6U A;  3LA2 A;  1ZM1 A;  5EYY A;  1L7L A;  4HAN A;  4LOS A;  2VBP A;  5FXZ A;  2YY1 A;  3WF0 A;  5DG2 A;  3B02 A;  4XVH A;  4K8R B;  4CA9 A;  2BVB A;  1HB2 A;  3RMY A;  1COV 3;  4N9I A;  2OZ6 A;  5H9P A;  5K0U B;  3QAC A;  2IXK A;  2RG4 A;  4N8M A;  3FBY A;  3S57 A;  5T5O A;  5C3O A;  4BLJ A;  4WM7 A;  1H4G A;  1GUI A;  3VZN A;  1RUJ 3;  3A22 A;  1JUH A;  2WBK A;  5KXB A;  5C9A A;  2YHJ A;  5FLJ A;  1MZF A;  3OUH A;  2SLI A;  2VCC A;  3DYP A;  3ZXD A;  2JX9 A;  3A0K A;  3BTA A;  1GKB A;  4WM7 C;  2ZGO A;  4I02 A;  5ABJ C;  4C0H A;  2G1M A;  2WQZ C;  3TAY A;  4A7Z A;  3O0X A;  1PVC 1;  4NVP A;  3FHI B;  5BNQ A;  3H50 A;  3R6S A;  3ZXG A;  1FT9 A;  5DXD A;  5IVV A;  2PHF A;  4YVS B;  4BK5 A;  3LD8 A;  4LO4 B;  3Q8A A;  3T30 A;  4PDW C;  4LTA A;  4LPL A;  2CDP A;  5DQ0 A;  1QF3 A;  4PCR A;  2JG9 C;  1CAV A;  1SDD B;  2EXH A;  4MGZ E;  3OY8 B;  2NP0 A;  3MFC A;  1HV1 A;  4FXG B;  3VZO A;  3ACH A;  1MS1 A;  1V9U 2;  5FYV A;  1SG3 A;  1BQP A;  1V6M A;  4V2W A;  3LGR A;  3PDQ A;  1ULC A;  4YAR A;  4R9B A;  2PTM A;  1VBA 3;  2ZGU A;  4JTO A;  2ZAC A;  4ES8 A;  4LJH A;  3H8O A;  1HIX A;  2JE9 A;  5FXX A;  4ATE A;  5HCF A;  1SFN A;  4EWA A;  5JPM B;  2AYH A;  4KGG A;  4QPI C;  5IAV A;  2PXJ A;  3OOX A;  3P3P A;  4N43 C;  5FZH A;  1ZRE A;  3GM8 A;  1PGL 2;  3HPN A;  2ZX1 A;  3H3Z A;  5GZF A;  5L19 A;  2BEO A;  2YC4 A;  3ZN6 B;  4CDU A;  1JH5 A;  3KS7 A;  4TZD A;  2R07 1;  5LBB A;  3RZG A;  5F5A A;  4XOG A;  4UWD A;  1J3Q A;  4FPK A;  4QPW A;  3ZSM A;  4NHK A;  1PO1 3;  5D2A A;  3OD4 A;  3I3D A;  3ZYG A;  1FAT A;  3I2D A;  3O5S A;  2GC2 A;  4TN7 A;  1ZBA 2;  3VHP A;  1DGW A;  1CJP A;  1UZV A;  2MEV 3;  5A80 A;  5KWR A;  1UL9 A;  5IK8 A;  4RS5 A;  4HPK B;  2UWB A;  3LEK A;  3LQC A;  2WNV A;  2VQT A;  2UYB A;  4FVV A;  5CZK A;  2XJQ A;  3HT2 A;  1DQ1 A;  1GWL A;  2WC2 A;  5FY4 A;  1FPN 2;  4EV0 A;  1W8O A;  5CEH A;  4QPG B;  3PJQ A;  1H1M A;  5I0S A;  2UYA A;  2R06 3;  4GD4 A;  4FPC A;  1UY2 A;  1L7Q A;  5JIA A;  4LO6 B;  2VUL A;  4CCJ A;  3IIA A;  4TLG A;  2BGP A;  5JUV A;  2XVL A;  3K46 A;  5LWB A;  2VZU A;  4NE9 A;  4XDQ A;  4CU8 A;  4GWN A;  2FCT A;  4AAX A;  3HT1 A;  3KT4 A;  4ASL A;  1E57 A;  4ZZ5 A;  5CAZ A;  5D8A C;  5F1R A;  5FZ3 A;  4RR3 A;  1O3T A;  2XML A;  1A34 A;  4EWD A;  2V5D A;  3LB9 A;  1WA6 X;  4GA9 A;  1DF0 A;  1OBN A;  1ZA7 A;  2GZW A;  2XON A;  3F2Z A;  4CDX C;  1YLL A;  3J7H A;  2Y34 A;  1OKQ A;  3WD5 A;  4E4D X;  2QBX A;  4HN0 A;  4GWM A;  3CEW A;  5FYM A;  4GB3 3;  4BXS V;  4HON A;  4HZF A;  3WQ0 A;  4O9G A;  2AEN A;  2HH9 A;  2IUW A;  2W94 A;  3K3O A;  4JKL A;  4KG8 A;  2WWS A;  5HI0 A;  1R1Z A;  1OQE A;  2P5B A;  4N90 A;  1C5I A;  4JGY C;  3CF6 E;  1G7Y A;  1U5I A;  2WYF A;  4MX3 A;  3O1T A;  3BU0 A;  2HWC 2;  4ISR A;  4FI9 A;  2WNE A;  4QX0 A;  2A1X A;  3OJB A;  5I0U A;  4CU9 A;  3S7E A;  5GZE A;  1OLR A;  4RD7 A;  4K6B A;  5ACA 2;  2OA2 A;  1DCS A;  1REE A;  4PBP A;  1ASJ 3;  1VBC 1;  3LEM A;  2H6C A;  1WCU A;  4OMC A;  3WCS A;  2HWD 3;  4I3G A;  3OBT A;  4AQ6 A;  5BNP C;  4Y20 A;  4MLO A;  1D4M 1;  2VVE A;  2RS5 2;  3OGR A;  5E1R A;  1YFW A;  2JDU A;  5CFC B;  5L9R A;  3VBH C;  1ZZ6 A;  2BNO A;  3N9O A;  4GWI A;  4OQ9 A;  4ERO A;  5A6Q A;  4AED C;  2WII B;  3H3U A;  3PUR A;  2YGL A;  4MXW A;  5GM0 A;  3PUA A;  1OVS A;  3NST A;  2Y0I A;  4GIQ A;  1F4A A;  1XE0 A;  4DS0 A;  2WN2 A;  3E6B A;  2ZMN A;  4OHY A;  2QKD A;  4Q4X 1;  5F2W A;  1ZRD A;  3TN9 1;  4AGV A;  3KV6 A;  3BN6 A;  1VBD 1;  4W50 A;  1O3Q A;  4A2U A;  1LOB A;  1OKO A;  1W0N A;  5C8W A;  3VDA A;  1BZW A;  3G7D A;  1EV1 1;  2KR2 A;  2RMU 2;  1K3I A;  1YCI A;  5CFD A;  2ZX4 A;  1YHF A;  1W6N B;  4XJU A;  4N7U A;  4D69 A;  3IPV B;  4QX3 A;  1QJY 3;  1QJU 2;  5FK7 A;  2WFP A;  4XJZ A;  3NV1 A;  4BM8 A;  4OI1 A;  3RDI A;  1S0B A;  3LDR A;  3VDB A;  1UX7 A;  1W6O B;  2F17 A;  2XWJ B;  5FJK A;  1ZBE 1;  4KI5 M;  2DCJ A;  2ZHL A;  2CNA A;  3BB6 A;  1US2 A;  4MV2 A;  5AFE A;  1PK6 C;  4HKL A;  3I54 A;  1RIT A;  2ZAB A;  1QJU 1;  3O0V A;  5F3G A;  4JDM A;  1RUC 3;  3PIJ A;  1RUG 1;  2TEP A;  3PLQ A;  1OPO A;  5FV3 A;  1NY7 1;  4XFG A;  1PIV 2;  2WZR 3;  2ZEZ A;  3SKV A;  3U78 A;  1MPX A;  5AFB A;  3AMN A;  3OBR A;  5CYY A;  4LKE A;  1X33 A;  1OQ1 A;  2XLA A;  1JZ7 A;  3WW2 A;  4R4Z A;  4D7T A;  2J42 A;  2X5I A;  1BVV A;  1VBA 1;  2VC9 A;  2XJU A;  2RJK A;  3OGS A;  1QDC A;  3SC7 X;  4D0Q A;  1AR8 1;  4M0H A;  1VAV A;  4QX2 A;  2YU2 A;  2X53 S;  3VKN A;  1H1I A;  4P14 A;  1QOS A;  3V56 A;  4QWN A;  5EYX A;  4URA A;  1QOO A;  1VBC 2;  2WYS A;  3PUS A;  3OSD A;  3D6E A;  1QH7 A;  4M00 A;  4DOU A;  5CKN A;  3VBS C;  1DDL A;  1AR9 3;  3FMG A;  3ZSK A;  1YEW A;  5KC5 A;  2WS9 3;  1CJD A;  3DGT A;  2R16 A;  1XYN A;  4ISQ A;  3W20 A;  2OS2 A;  3Q8E A;  4YFW A;  1BK1 A;  3CL1 A;  3DPR A;  4PLO A;  1FXZ A;  4MYE A;  5A1L A;  1J59 A;  2VUJ A;  4P08 A;  2FBE A;  5FZ1 A;  1KDM A;  1LEN A;  1W2U A;  4IV3 B;  5LY2 A;  2K2S A;  5L9V A;  5JOZ A;  5HV0 A;  5HPO A;  4H2A A;  3AL6 A;  2EAA A;  2G19 A;  5FPX A;  1KJR A;  4Y1Y A;  4AHW A;  3ENR A;  1H2L A;  1WCS A;  1RIR A;  1IQA A;  3MV0 1;  1XQN A;  4LIT A;  1VP6 A;  2CAU A;  1UMZ A;  4Z82 A;  4AI0 A;  5LA1 A;  4GWJ A;  1W9Y A;  2W52 A;  3FJS A;  3I2O A;  1AX1 A;  1LNS A;  2XKO A;  5A70 A;  5IW0 A;  4YNI A;  1XNB A;  2WQ8 A;  4NII A;  4JRL A;  2RS3 3;  5FMO S;  1W9W A;  3KZ4 C;  1QXJ A;  1QDO A;  2VME A;  1FOD 1;  1E5H A;  2VO5 A;  1CAX A;  3JB4 C;  3NAP B;  4YW3 A;  3ZOI A;  5APA A;  2YMZ A;  1BHG A;  3ZXA C;  4NPM A;  3T0D A;  1RUJ 1;  3O1P A;  4FFF A;  3DEC A;  1H1A A;  3OEA A;  1WLT A;  2V4A A;  4JGZ B;  3C7H A;  4LE3 A;  3DCQ A;  4D8M A;  2RDR A;  3FLR A;  3H8R A;  1SLI A;  3E97 A;  1GNH A;  4QX5 A;  1H8V A;  3BIW E;  4RSU A;  1VBE 2;  1UF2 C;  2AAC A;  4IL7 A;  4LO8 A;  1KS4 A;  3SEE A;  3IDB B;  1ENS A;  4K9S A;  3H1W A;  3I2J A;  4NAM A;  4QKD A;  2DVG A;  4FQ4 A;  1TVG A;  1N3O A;  2BDR A;  5ACA 1;  2VZS A;  4QAW A;  4XFA A;  5A3M A;  2XHK A;  4QPG C;  5IVF A;  1TME 3;  3W5N A;  2BFU S;  2I07 B;  4YW2 A;  1WCQ A;  2XUE A;  5E88 A;  2ARE A;  2VTX J;  2YBK A;  3LE0 A;  1RB8 G;  1AYN 2;  2E7T A;  4DZG A;  5JOW A;  1XYO A;  1I5Z A;  3POJ A;  4N53 C;  1FOD 2;  3N9M A;  3LDB A;  1AR8 2;  4J1W A;  2FMD A;  3H1M A;  4K1Z A;  5JWP A;  1UY4 A;  1Q5O A;  1YIF A;  3MO4 A;  2Z79 A;  1OUX A;  4S2D A;  3W9A A;  5DUW A;  2HBT A;  2Z69 A;  2X09 A;  5T3N A;  3VBF B;  3WCR A;  4CRQ A;  4O65 A;  5FIX A;  1V6O A;  5KHH A;  1AR7 3;  1XBF A;  3HQU A;  3OCP A;  1QMJ A;  5J48 A;  4C90 A;  4FSJ A;  3H7J A;  2J1A A;  4XTM A;  4IGP A;  5CFD B;  2EA7 A;  1RUC 1;  5CIS A;  5FZI A;  3KV5 A;  2XGX A;  3RGB A;  4RA0 A;  5FQ0 A;  5C33 A;  2FDI A;  5FKC A;  2PLV 3;  4SBV A;  1O8P A;  1W6O A;  3MBW A;  4CCC A;  1NCQ C;  1RUE 2;  2A71 A;  2WO3 A;  3AFG A;  2GP5 A;  5A33 A;  1LHN A;  2ZCW A;  4Q4V 3;  4K3U A;  1YQ2 A;  2RM2 1;  2VEC A;  3ZIW A;  1UXZ A;  5T55 A;  3FC0 A;  1N1Y A;  2C4X A;  4H7M A;  1OH3 A;  1ONA A;  1R64 A;  2P3K A;  4JDO A;  4C1W A;  1WKY A;  1A6C A;  1W06 A;  2XBO 2;  1I3H A;  5LB6 A;  5T5L A;  4DUX A;  2UUR A;  4MOA A;  5HXV A;  5ISL A;  2ZMK A;  1ZBA 3;  3S5Q A;  3OUJ A;  2P6H A;  2BWC A;  1QJZ A;  2G4I A;  2MEV 2;  3AKR A;  4QQ2 A;  1W8U A;  3BYW A;  2VNG A;  2XPJ A;  4OZO A;  1EY2 A;  2YPD A;  3WDW A;  4L97 A;  2BYV E;  1X9T A;  4ZY9 A;  2E9Q A;  1Q8V A;  1YC6 1;  2NMO A;  4AL9 A;  4XDP A;  1SEF A;  2R49 A;  4N43 A;  3VKM A;  5JSP A;  5F6L B;  3UGF A;  3B00 A;  4RN5 A;  4I2O A;  1XND A;  1OFN A;  4PJY A;  5BV6 A;  4D7S A;  4LNV A;  1R1A 2;  3VBR A;  1BYH A;  1MEC 3;  1AJK A;  2GDF A;  2E51 A;  4UW3 A;  4WVM A;  2WWU A;  4BIS A;  2F4P A;  5C7G A;  3K48 A;  1NKG A;  5FP3 A;  4CZS A;  4LLF A;  3EO6 A;  1NA1 C;  1TNR A;  5B4N A;  2BGC A;  1NZC A;  4Q8K A;  3ZYJ B;  1NLS A;  4Q4X 2;  3L9J T;  5DUV A;  5JMC A;  2IFR A;  5B4X A;  1OF3 A;  1PO2 2;  1F31 A;  2ZX3 A;  4QU2 A;  1J3R A;  1OFS A;  4I3P A;  3X29 B;  3LIH A;  3I3B A;  5F9T A;  2QTW B;  2B42 B;  2BRT A;  3AZV A;  1IS3 A;  3SKJ E;  1W6N A;  3WF4 A;  1JU3 A;  5H9Q A;  2WAA A;  3UT0 A;  2W0X A;  3C7F A;  2XBO 1;  3DPR B;  3O12 A;  4BIF A;  4UYB A;  4XEZ A;  2CY6 A;  2DTW A;  1ND3 C;  4NIG A;  3L2Y A;  3WP3 A;  1XC6 A;  3JUU A;  4WVV A;  2J7M A;  1HRI 1;  4A42 A;  3NV2 A;  3FN9 A;  4DO0 A;  3KGZ A;  2UY9 A;  1IKP A;  3LOB A;  3B93 A;  4XFC A;  1W04 A;  1W8H A;  2HWC 3;  4Y1V A;  3GBW A;  2UWC A;  1I9R A;  4Q1P A;  3MIG A;  3ROU A;  1RVF 1;  1H2M A;  2VAU A;  4HK9 A;  5FQ0 B;  4GZ9 A;  2IWG B;  1HXS 2;  5ACA 3;  1DQ0 A;  2IXJ A;  1RUE 1;  3VB9 A;  3DXT A;  4H7L A;  4DEV A;  3UJQ A;  3IWZ A;  4Y1X A;  2RDS A;  4IE5 A;  2VGD A;  1SBF A;  1LGC A;  1ZZB A;  4Y22 A;  1REF A;  1OPM A;  4Y24 A;  5FYC A;  2WT0 A;  3DN7 A;  3OYW B;  1AX0 A;  1D2Q A;  2JG8 A;  1AYM 1;  5K8S A;  4OZX A;  4C8D A;  2RS3 1;  2PAE A;  2ZGT A;  2YYO A;  3FWE A;  3RNS A;  2Y6K A;  4FPE A;  4F3J A;  5C4W A;  3LEG A;  4MGS A;  4IW3 A;  4ITC A;  2D3P A;  4QM9 A;  5FZE A;  4CDU B;  1C8M 2;  4LBL A;  5BNO C;  4UT5 A;  1DU3 D;  3ORJ A;  4W6W A;  1JHJ A;  4WM8 C;  3T2Q A;  1UMI A;  3J8F 1;  4Q0S A;  2HWE 3;  1SMV A;  5FZG A;  1W99 A;  1VBB 2;  1J83 A;  2YG0 A;  3LPG A;  1CIY A;  1AYN 1;  3PUQ A;  2W1Q A;  3ATG A;  3GXU A;  3T1M A;  5IK4 A;  2JDY A;  2JD9 A;  5DDJ 2;  4Y1Z A;  3JD7 3;  1ULD A;  1W2T A;  5DUU A;  2H0V A;  3VZM A;  4A7Y A;  1UYP A;  1IZ3 A;  1B35 A;  1YRZ A;  4Y5Z 0;  5BNN A;  5FOJ B;  3N36 A;  1QJU 3;  3T2O A;  1AHS A;  4AED A;  2VMH A;  2W1U A;  3T4V A;  1MVE A;  2R1B A;  5FZO A;  4B1M A;  3C7O A;  1LUL A;  4CU6 A;  3USU A;  1O59 A;  3AC0 A;  3RFR A;  2RR1 2;  4EN0 A;  3JB8 A;  3ZN5 A;  3GDB A;  4XHX A;  2Q1F A;  2VZQ A;  2IVJ A;  2ZX2 A;  3ON7 A;  3POY A;  2YPJ A;  3NAP A;  1RC6 A;  3GZU C;  4FPL A;  1OQD A;  1N1S A;  2XR4 A;  3ZKU A;  4CVU A;  4XAE A;  4BQY A;  4DRR A;  2UWA A;  2RJL A;  2W92 A;  2YU1 A;  1FAY A;  4LIU A;  3RVH A;  3TNP B;  3VKL A;  1EV1 3;  3QD6 A;  3OGJ A;  4OHW A;  3J26 N;  4RFT 0;  2P3J A;  3OG2 A;  1RJ8 A;  2K9Z A;  1QJY 1;  5FDB A;  4GH4 A;  3ETQ A;  4YG0 A;  4YVW A;  5FY5 A;  3AZW A;  4MGT A;  4ET7 A;  2OVU A;  1J1T A;  1STM A;  2A6W A;  3ZN4 A;  4UFL A;  1ZBE 3;  5FY0 A;  4GMP 0;  4XUQ A;  3UGH A;  2VZ3 A;  1J1L A;  3ME2 A;  2PFW A;  2RDN A;  4JQR A;  1UXX X;  4NUB A;  1GZT A;  5B2G B;  1HN1 A;  4GH4 C;  1VBE 1;  2RM2 3;  4QDQ A;  4M4R A;  4Q4W 3;  5A3U A;  1IHM A;  2YV8 A;  2Y6G A;  3FUQ A;  4DB5 A;  3AP4 A;  3KVB A;  3TNQ A;  1E5R A;  2J1S A;  2MNG A;  2PMW B;  3IDE A;  5GAL A;  3EQE A;  5DPN A;  1CWP A;  2GME A;  4NWW A;  3O0W A;  3P6B A;  4LE4 A;  3WW3 A;  5FPZ A;  1IPS A;  2FCU A;  4G3Y C;  1SPP A;  1XNT A;  4KBB A;  3UGG A;  4C91 A;  4DXZ A;  5AC9 1;  3OPW A;  2CWS A;  1C8M 1;  5CKQ A;  3UNP A;  3MID A;  4FPY A;  2WO2 A;  5DAX A;  1P8J A;  3WX5 A;  4QXH A;  4XAA A;  3U10 A;  4CCD A;  4A4A A;  5A7O A;  4L99 A;  3WSO A;  2ZA9 A;  2WLQ A;  3GHM A;  1S0I A;  3E6D A;  4OLL A;  3PIG A;  5F3E A;  4KWJ A;  2WUH A;  1VRH 3;  1W6P B;  3E6C C;  1K5J A;  3T09 A;  4EN8 B;  3KGL A;  3R4S A;  4YW7 A;  2YGM A;  4HVR A;  1AF9 A;  4KWU A;  2ERF A;  2BP6 A;  2OT7 A;  2R07 2;  1C8N A;  4UW6 A;  5BNN B;  3M3C A;  4AK3 A;  2R04 2;  1ZA4 A;  5G05 L;  3NJV A;  4FPO B;  4BQ5 A;  1XB9 A;  4R4X A;  4WV8 A;  3D4K A;  3WT3 A;  4BXF A;  1RUH 3;  4OMD A;  4A3Z A;  4D6S A;  4KU8 A;  5C5U A;  2C5D A;  2VR4 A;  3JBG 2;  3P1I A;  3AM2 A;  1OUR A;  4OI4 A;  4PQ9 A;  3C2U A;  4DEQ A;  1HQW A;  1UX6 A;  5JXH A;  1S0D A;  2ARC A;  2JB4 A;  1DYK A;  4WVZ A;  1M4W A;  2GSY A;  2J22 A;  4ONU A;  2D97 A;  1TME 2;  5CIR A;  4LIV A;  1UYZ A;  4YGC A;  5F3I A;  2QJV A;  1S0J A;  2DUO A;  2V09 A;  3FZ3 A;  4GAL A;  2JG8 B;  1DGL A;  4HKW A;  3PTR B;  1WD4 A;  5KHJ A;  1AYN 3;  1C57 A;  4AQ2 A;  3UKV A;  5C8C A;  3HQR A;  5BUV A;  5F39 A;  4LHK A;  1FOD 3;  1PVC 3;  2D3S A;  4IDZ A;  3HBZ A;  3Q9O A;  2O0O A;  1BVP 1;  2D6N A;  4GXL A;  4GAZ A;  3U14 A;  5JSO A;  5KC6 A;  3WG2 A;  1LOA A;  2P37 A;  1BMV 1;  2YBP A;  2CU5 A;  4IUG A;  4XMA A;  5GLW A;  1ZRR A;  3MUY 1;  1OD3 A;  1HJG A;  1SAC A;  4H3W A;  4XIL A;  1AR7 2;  4NHL A;  4UW5 A;  1PNG A;  2X5I B;  4XE9 A;  1LOC A;  3WQ1 A;  4YZ1 A;  4YVS C;  3TEY A;  3IB3 A;  3EBR A;  5IK5 A;  4QKF A;  2R04 1;  4XTP A;  4XUO A;  1AVB A;  2XKP A;  3CHX A;  4GMP 1;  4I0B A;  4JHT A;  5BPX A;  4XJ9 A;  4LHS A;  1WUV A;  5C3R A;  3AZY A;  1NQJ A;  1QNY A;  3E1F 1;  1BEV 2;  3ZSL A;  3SH5 A;  4CP9 A;  1LAJ A;  2YUE A;  4EWE A;  1PK6 A;  2AGS A;  1LJ7 A;  2W2I A;  1SPP B;  2CYF A;  3RQ0 A;  4QHO A;  2NQY A;  3S5A A;  3IDA A;  3IAQ A;  1FMD 2;  3M8L A;  2Q1M A;  4KG0 A;  3J8F 3;  5GLZ A;  2NLR A;  3FUO A;  3LFM A;  4K7J A;  4B29 A;  4BE3 A;  1NQD A;  4RS5 C;  4IEQ A;  4XQW A;  4QPI B;  3SQO A;  1OC1 A;  2JDM A;  1PX3 A;  3Q8C A;  1UY1 A;  2GAL A;  4BH9 A;  5JZG C;  1G9F A;  2JXA A;  5FZ6 A;  3V0A B;  1AZD A;  4FPF A;  4AG4 A;  5LCW L;  1Z78 A;  2GNB A;  5HCH A;  4QT6 A;  4LBM A;  4EN9 B;  2V72 A;  4TXW A;  5A1A A;  4LO7 A;  5A1F A;  5FYH A;  5FO8 B;  4E2G A;  1DGW X;  3AVS A;  2IC1 A;  3AKT A;  4JC1 A;  4LT5 A;  4AHY A;  4FXK B;  3ZFG C;  5FMB A;  4UBG A;  1R1A 3;  3AYA A;  3I3M A;  1MEC 2;  3WOG A;  4AFC A;  1ALY A;  4IV1 B;  1FPN 1;  5BXX A;  1ND3 A;  5DG1 A;  2FDF A;  5A6Z A;  1Y4W A;  3NV4 A;  4DIQ A;  5BNO B;  4MET A;  5J37 A;  1DYO A;  3AMQ A;  3III A;  3CMG A;  4Q29 A;  4P9Y A;  2VZV A;  3V0B B;  2VOX A;  4E4H A;  1ST8 A;  2ARA A;  3E5Q A;  2Q1Z B;  4GJY A;  4HET A;  1PO2 3;  4JV4 A;  2LRP A;  4KU7 A;  4BIO A;  1OF4 A;  1Z7S 3;  2H0B A;  3ZMN A;  4Y20 B;  2OKX A;  2UY8 A;  5FY7 A;  1CZT A;  5HXM A;  4NRM A;  1CPN A;  1JOB A;  2ZGR A;  3AKQ A;  5F8P A;  1HRI 3;  3IMM A;  3LA7 A;  1ZZ9 A;  3C3V A;  5JPN B;  3M3I A;  4YGB A;  5FLH A;  5FMC A;  3T2T A;  2ZZJ A;  5EHD A;  4R9C A;  4MVT A;  5FZ9 A;  1QQP 3;  4WZF A;  2WO1 A;  1QU0 A;  1JW6 A;  4X6Q B;  4XBL A;  2VY0 A;  2AR6 A;  3QH7 A;  4YPJ A;  3C7E A;  1RUD 3;  2E33 A;  2G9G A;  3POF A;  4B7K A;  1K5M A;  4GJZ A;  4AGR A;  2VUC A;  4QD2 A;  1UPS A;  4UI9 L;  3E5X A;  5LA0 A;  2V73 A;  3KSC A;  3MPB A;  4RGK A;  4PDW A;  4BQ4 A;  4F83 A;  1UU4 A;  1LOD A;  1C1F A;  2WAO A;  1HXS 3;  2VPV A;  2Y6L A;  3LFI A;  4L11 A;  5FYZ A;  2QZ2 A;  1XSR A;  5EPA A;  5FBZ A;  3P5B A;  1W6Q A;  4W4Z A;  4ZZ8 A;  1UU5 A;  1VMF A;  1WME A;  4DY5 A;  1CR7 A;  2VVF A;  2XUM A;  3U4X A;  1MS4 A;  1N3P A;  1WCD J;  2W5F A;  5L36 A;  2Z4F A;  1O5U A;  3FHA A;  3R05 A;  4Q0V A;  3B69 A;  1RMU 2;  3MV1 1;  1GP6 A;  4OFG A;  2UU8 A;  4IEO A;  3DYM A;  2K46 A;  3WG4 A;  1O3S A;  3SEP A;  1AYM 2;  3AFK A;  3POE A;  4AEM A;  4FPJ A;  2XL7 A;  1V6K A;  3KV4 A;  3SCH A;  4JQT A;  4P9X A;  1KRI A;  4BHP A;  4JKM A;  4GB3 1;  4Y4Y A;  3ZYR A;  2PA7 A;  4CUA A;  4XUT A;  3VKF C;  5DAB A;  2BQP A;  2VW1 A;  3LAG A;  4FOW A;  3U11 A;  2QQL A;  1OLQ A;  2DDU A;  4S2F A;  3SH3 A;  2ZAH A;  1F5F A;  4AVS A;  5CFC A;  3JD7 2;  4ZS3 A;  4QB6 A;  2GND A;  4IV1 A;  3CJI A;  3V65 A;  1VMJ A;  1ENX A;  4IQP A;  4JTN A;  1EAH 2;  1ZZ8 A;  3AJZ A;  3VD3 A;  5FPU A;  4O61 A;  2VW0 A;  4JX0 A;  3WP6 A;  4Q5O A;  4GQ7 A;  3J9S A;  1LHW A;  1O4T A;  4BJ0 A;  2JB8 A;  2JDH A;  5C70 A;  3TRS B;  2B8M A;  5FP9 A;  4AYU A;  2RR1 3;  1GNZ A;  1R08 1;  4MAD A;  4Y1U A;  2ZBJ A;  3JQW A;  1W8N A;  3VBR B;  2WZE A;  3I59 A;  4BQ3 A;  1YYN A;  2XOM A;  5FYB A;  1ZRF A;  1NZI A;  4KH9 A;  4COU A;  1EUT A;  4JAA A;  5FZ7 A;  3OUI A;  4CCL A;  4BQ2 A;  5FOB B;  1BCX A;  4IND A;  3BPZ A;  3VBF A;  1ND2 C;  3FL7 A;  1T6G C;  1PK6 B;  3BTZ A;  4TSV A;  5IT6 A;  1X36 A;  3WV6 A;  2HKX A;  1RHI 2;  1EV1 2;  2ZEX A;  5DN2 A;  5FP8 A;  5JDB A;  1YI7 A;  4E8D A;  4ES9 A;  3CQO A;  4V1P A;  3MF9 A;  5JXI A;  3IZO A;  1PMH X;  4I0A A;  2D44 A;  3MW3 A;  3DF0 A;  5FYS A;  5GJ6 A;  4AQS A;  2O8O A;  4IGQ A;  4XAC A;  1S4C A;  3POS A;  5IHR A;  1AL2 2;  1KEX A;  1E5I A;  4OUS A;  4Y4R A;  2D6O X;  1S0E A;  3WG3 A;  1JXN A;  1TE1 B;  2WRA A;  3N35 A;  5FBJ A;  3ZYB A;  1IKQ A;  2W08 A;  3GCW A;  2RM2 2;  2BBA A;  4JGZ A;  4AHX A;  4UFJ A;  3DKW A;  2D6M A;  5EWS A;  2ZZQ A;  5LRR A;  4CP1 A;  4XUR A;  3VL9 A;  1UWW A;  5FPB A;  3WUD A;  2EID A;  2JE8 A;  2ZGP A;  1ULF A;  2GNM A;  1GZW A;  1H6Y A;  3B9I A;  4HK8 A;  4XJ8 A;  1Y43 B;  1RJ7 A;  4XPV A;  1FNZ A;  2BER A;  2YBS A;  3VBS B;  4M4P A;  4CCK A;  1GMM A;  4DUW A;  4NAO A;  4TWT A;  5A32 B;  5BNP A;  3O1M A;  1JZ4 A;  4COZ A;  1HQL A;  2VTF A;  2P2K A;  4PI0 A;  3GBG A;  4Y22 B;  3SCF A;  3VHR A;  4YZ2 A;  2EF6 A;  3BTX A;  1URX A;  4R52 A;  2A6Y A;  1PO1 1;  1RMU 1;  3EMR A;  1VRH 2;  5BYN A;  4E2S A;  2ZGL A;  1GYK A;  1TQ5 A;  1LU1 A;  2VBB A;  3SXW A;  3B3Q E;  4CDW B;  2O14 A;  2R30 A;  3CNA A;  1YFY A;  2A75 A;  2MPF A;  3UKT A;  4LKF A;  4EN7 B;  3E5U A;  4AVB A;  3INA A;  4H14 A;  3RWK X;  4DRV A;  1DZT A;  2C6S A;  2W39 A;  4A7K A;  3QBQ A;  3MW2 A;  2JG9 B;  1COV 2;  3HJR A;  3HBK A;  3NNF A;  5ERL A;  5JMO A;  2HWB 1;  4WZC A;  1WW6 A;  2GC3 A;  1YNA A;  1LCL A;  1XU1 A;  2ZEW A;  4LEJ A;  4QPG A;  3JBG 3;  4S2G A;  4ATF A;  2W46 A;  1RUJ 2;  3MEP A;  3T2P A;  3ZFF C;  3ZPY A;  2P6C A;  1V00 A;  2WS9 1;  1H2K A;  4PQQ A;  1DLL A;  1UD1 A;  1Q43 A;  1SLB A;  5FRE A;  1GP5 A;  2DBI A;  2ARX A;  2ZAA A;  1T6B X;  3PUI A;  4YVS A;  4E2Q A;  1CAX B;  1UIJ A;  1VRH 1;  2AUY A;  3GZT B;  5JAX A;  1RL3 A;  3QLQ A;  4IES A;  4YW4 A;  3WQ7 A;  1GQG A;  3DYO A;  2RS1 3;  1BBT 3;  3RZK A;  1KXG A;  2D6P A;  4Z8B A;  4QB1 A;  2XJP A;  3ZX7 A;  1JOP A;  3WY6 A;  1CAW A;  4KMQ A;  2ZHN A;  4BYY A;  2PN5 A;  1CIW A;  1QOT A;  3GGL A;  4Y33 A;  4DNY A;  4E4S A;  1JZ2 A;  4HT1 T;  5J36 A;  2HWB 2;  1ZVF A;  4U36 A;  2RR1 1;  4N53 B;  4XF0 A;  3ZDV A;  4C0B A;  5F3C A;  2BNM A;  5HCB A;  1Y7B A;  4P9W A;  2VL4 A;  1LED A;  1HW5 A;  4NHY A;  2XJV A;  4D7Y A;  4LA2 A;  1AR7 1;  1QHD A;  2WKK A;  3A4U A;  4X6R B;  4PIZ A;  4XF3 A;  3RI9 A;  4YG6 A;  5FO7 B;  3GZA A;  5I0R A;  3M70 A;  2NMN A;  2B45 X;  2KM2 A;  3ILR A;  3EJK A;  5C71 A;  3GZE A;  2XG3 A;  4LHN A;  5LK7 B;  1X50 A;  2C1F A;  5A3W A;  4Z92 B;  1S2E A;  4CEW B;  1QKQ A;  3MIB A;  1CZS A;  2ETE A;  4PIY A;  2QE3 A;  1CX1 A;  4B1L A;  1PO1 2;  4JZR A;  5FY8 A;  4A41 A;  1BXH A;  5EV7 A;  4AW7 A;  5D8A B;  5HV4 A;  2QFE A;  2FZ1 A;  2P4E A;  1EPZ A;  1JS9 A;  1O8S A;  2ORZ A;  3ASI A;  3SNM A;  2GMP A;  1Y3T A;  1QJF A;  1VJ2 A;  3NKG A;  4YM1 A;  4RGG A;  5DAV A;  4I0W B;  3K77 A;  3MLJ A;  1ZBA 1;  1NY7 2;  3HOB A;  3VBU A;  1QH6 A;  2VZ1 A;  1LGN A;  5FWE A;  4LKD A;  2C9K A;  1FPN 3;  1YQ8 A;  2QQN A;  3I3Q A;  4IEU A;  4M3C E;  1JYT A;  1DFQ A;  2XHN A;  4L92 A;  4AVC A;  1W0P A;  2EAL A;  3NNG A;  1R08 3;  3VHN A;  1VAM A;  1XYP A;  1J58 A;  2WLP A;  4NN0 A;  4EJR A;  5K4L A;  2D93 A;  2IVI B;  3B5L B;  2ID4 A;  3KT1 A;  5F5I A;  3DXU A;  5A3N A;  4C1X A;  3IPV A;  3MHZ A;  4AXO A;  1AL2 1;  4W6Y A;  2KXL A;  4A44 A;  5A3P A;  1H8T A;  4B4R A;  4ZHN A;  4A6S A;  1HKD A;  2HBU A;  5FUI A;  1G9A A;  1H30 A;  2VCA A;  3ZN6 A;  1QWR A;  3OYW A;  3KVA A;  5E89 A;  3ZDS A;  3HAG A;  5I0D A;  3ZIX A;  2WWJ A;  1RXG A;  1XPW A;  1RXF A;  1X7N A;  1TNF A;  3CDZ B;  5FZ8 A;  1V9U 1;  4BME A;  4CTE A;  1QQP 1;  3DKQ A;  4UBH A;  3V64 A;  5C4W B;  3OF1 A;  2FQP A;  3I2I A;  2IXL A;  3LWC A;  4Q4V 1;  4XF9 A;  4LR4 A;  4XHB A;  3WW4 A;  4BOW A;  2OII A;  1U5Y A;  3OPT A;  4YVW B;  5FP4 A;  3ZR6 A;  5BNP B;  1RUD 1;  3M3Q A;  3OB8 A;  5LW9 A;  4MHU A;  1GLH A;  3IT8 A;  1N47 A;  3AMH A;  3VHO A;  2J1T A;  1QQP 2;  2WN3 A;  2NPI A;  2ZHK A;  1G8W A;  1UCX A;  1ZYB A;  2MEV 1;  1V6L A;  2R0F A;  4W65 A;  4X8P A;  5DUX A;  2NZ9 A;  4RHV 3;  3VBH B;  3WNM A;  5T5P A;  4AHZ A;  5FLI A;  1RUD 2;  2XLG A;  1CQ9 A;  5C8C B;  5E16 A;  2VXJ A;  3KCY A;  4SLI A;  1RUG 2;  2O8Q A;  1YIP A;  3WF1 A;  1GP4 A;  1IGO A;  4BQ1 A;  5D1I A;  1PMJ X;  3JCI A;  4MXW B;  4XJW A;  4RGA A;  4IER A;  2JEN A;  1PO2 1;  2WA3 A;  5GLU A;  2HYX A;  2D5H A;  4FOV A;  1RGS A;  2DCY A;  4ZU5 A;  3ZXE A;  1ASJ 2;  3VDD B;  3ACF A;  3NWK A;  5LRS A;  3WNP A;  1POQ A;  3KF3 A;  1APN A;  5EXO A;  2RS1 1;  2JIJ A;  2Y26 A;  1O4Y A;  4D6R A;  4LBJ A;  3NV3 A;  1XNA A;  4YLZ A;  2RS5 3;  5I0T A;  4NRP A;  2HWF 3;  1RMU 3;  3CJI C;  4MUV A;  5GZD A;  1SDW A;  5ABJ A;  4JHZ A;  2EVX A;  4ASM B;  5FK8 A;  2EAK A;  4WM8 A;  4A6O A;  2JEM A;  1ULE A;  5FFO C;  1IG0 A;  3BTY A;  2CGO A;  4HFS A;  4QGM A;  3WLU A;  1XNK A;  4Y5S A;  1AYM 3;  2PYT A;  4MGK E;  2JDK A;  4XF4 A;  3DEM A;  1G9D A;  4NRQ A;  5D21 A;  5IAX A;  2E63 A;  1A3K A;  2E7Q A;  2N7G A;  4LA3 A;  4NPL A;  1EPW A;  3AJY A;  4D94 A;  1Q3E A;  1UMH A;  4MHR A;  1S0G A;  2YZ4 A;  3LPF A;  5FYU A;  1B35 C;  3GBF A;  5K7P A;  3I49 A;  5FPA A;  1RUI 3;  4HOO A;  3WG1 A;  2JD4 A;  3UK9 A;  1DIW A;  2D6K A;  2W95 A;  2GU9 A;  4NID A;  5CNA A;  3LEI A;  1UY0 A;  2CL2 A;  1EP0 A;  5I91 A;  1QJY 2;  2VW2 A;  3C8X A;  4BB3 A;  2Q0A A;  1TMF 1;  5DAP A;  5ANQ A;  4FTS A;  1WW4 A;  4HBN A;  2ORX A;  1M06 G;  3JQX A;  1NG0 A;  2DUP A;  5GLT A;  2R1D A;  1QXR A;  1NOV A;  1Q8P A;  3HR9 A;  4AE2 A;  4QQO A;  2DWR A;  3LCP A;  2BZD A;  3LDK A;  1RUC 2;  4CDW C;  4F7Z A;  4BZ4 A;  3AP7 A;  1OUS A;  4R8H A;  4E4Z A;  1ENQ A;  5EQU A;  3THP A;  4XJA A;  4IEX A;  3M1H A;  4CEW A;  1LOF C;  4Q1R A;  5IFT A;  4NIA A;  4IE7 A;  4JGZ C;  1HX6 A;  4XW3 A;  1RHI 3;  4TTG A;  2OUH A;  2C24 A;  1DQ4 A;  3FLT A;  5FZA A;  5E6H A;  4LBK A;  1JZ6 A;  2Z2S B;  3EB7 A;  4M3C F;  5I8T A;  2Y38 A;  3CBN A;  2HYK A;  4RL7 A;  3IM0 A;  3KLS A;  4YM0 A;  2W9X A;  1OD5 A;  1UYX A;  1W39 A;  3AXD A;  1AL2 3;  1VRB A;  4UF0 B;  1O7F A;  2ADD A;  1UN1 A;  3WVJ A;  3HVD A;  4B8E A;  4ZKT B;  2LUW A;  4CP9 B;  2VNR A;  1DLC A;  4AWD A;  4HLT A;  3Q8B A;  4LBN A;  3KWV A;  4FPG A;  5IYY A;  4XCB A;  1C5H A;  4JKK A;  4QMA A;  2P34 A;  1WWY A;  4QDR A;  2WT2 A;  1K5M B;  4Y5T A;  2GP3 A;  5FZ0 A;  3TBD A;  2DV9 A;  4IV3 A;  2JDZ A;  2V4V A;  2D5F A;  3RS6 A;  4AFA A;  4AVA A;  5TSW A;  3MIF A;  3T4H B;  3ZSE A;  4OVE A;  1UW8 A;  1W2O A;  4XFF A;  4CEY A;  5LZ6 A;  3LKJ A;  1CAU A;  3HN1 A;  3POG A;  5IUQ A;  2QQP A;  5FRA A;  5L7O B;  2ZKL A;  1LRH A;  1PM4 A;  3BI3 A;  1DZQ A;  5DZG A;  3MPP G;  4Q0Q A;  1E5S A;  1HB3 A;  5FP7 A;  5SV5 A;  1LGB A;  2HJI A;  4CEY C;  1ZRI A;  3UKN A;  1WMF A;  1NA1 A;  2QZ3 A;  4EQV A;  3SHR A;  3PVB B;  1MS0 A;  1QIQ A;  1XXN A;  2XVG A;  4QQP A;  5JIU A;  1MZ6 A;  2QNK A;  3P3N A;  4OYU A;  4X8N A;  4XBN A;  1F5J A;  5FYY A;  3K4Z A;  4DFS A;  4NIH A;  2GH8 A;  2WAB A;  2YB7 A;  4MGY E;  5FYT A;  3VD5 A;  2JIC A;  4WVW A;  5GZG A;  2RS3 2;  2GN7 A;  2FDJ A;  1WW5 A;  5BNO A;  3LSE A;  2Q8E A;  2Q8C A;  4FAG A;  2E31 A;  2X10 A;  3KB5 A;  3THC A;  3H3L A;  1OH4 A;  2AZ5 A;  3JBG 1;  1WGP A;  4FOQ A;  1NXD 1;  4YYO A;  2QQI A;  2PHR A;  3I2H A;  2EIB A;  4PLN A;  3TWI A;  3WNL A;  1HJF A;  2PHW A;  3R0R A;  4DY3 A;  1KDK A;  4OHX A;  3OGV A;  5T54 A;  3U0Z A;  1AR9 1;  3N7L A;  3RZL A;  1VBE 3;  4WVM B;  3AZZ A;  4QGL A;  2I2S A;  3NNL A;  1MEC 1;  2PAM A;  3PMS A;  1I6X A;  1RUH 1;  4YM2 A;  2YDE A;  3GAL A;  1ZNP A;  2JDA A;  2VOK A;  4CP0 A;  3O1V A;  3FLP A;  5FZ4 A;  1OOP C;  4QX1 A;  1OLM A;  2EIE A;  2R06 1;  3VDD A;  2DU1 A;  1LKN A;  2PHL A;  3WQB A;  4ZU7 A;  5K0U C;  1W8T A;  1W90 A;  3EHK A;  4FFH A;  2CSG A;  1BBT 2;  1NCQ B;  1PMI A;  1X9P A;  2ZJC A;  1UIK A;  3RZZ A;  4EE2 A;  3CJX A;  2BOI A;  4CUC A;  3BUC A;  2P1B A;  3M2M A;  2CDO A;  1D0G A;  1KJL A;  1VBA 2;  3MDP A;  1GFF 2;  1MR5 A;  4FPH A;  5J09 A;  2FD8 A;  5T50 A;  1C4R A;  1YQ6 A;  3UYJ A;  1PZ7 A;  1W8W A;  4XF1 A;  1GQP A;  3J7M A;  2HWB 3;  1DGR N;  1CX4 A;  2Y33 A;  4P9J A;  4PIX A;  4XZP A;  2WZP P;  3TB0 A;  3ZFE C;  4XUP A;  5FJH A;  4B7E A;  2WSV A;  4OI0 A;  2TBV A;  5C4W C;  3PVO A;  3N4M A;  2RS5 1;  1OXC A;  3IDC B;  4CE8 A;  2Y60 A;  4LOR A;  5FXV A;  1LES A;  1W8Z A;  5FPL A;  5FZC A;  1W6Q B;  1SFY A;  3VZL A;  3UES A;  4LOT A;  2IXC A;  4K21 A;  3S0M A;  2PLV 2;  2GC1 A;  1ODM A;  2BFU L;  3D8C A;  4P02 B;  1HRV 1;  3U1X A;  4DMI A;  2VZT A;  5FR3 A;  3KT7 A;  2A7A A;  5LY1 A;  3N9N A;  1RUE 3;  3I2G A;  5CAD A;  2DF7 A;  2X5I C;  5GKA C;  4HL0 A;  4XCA A;  4Q4V 2;  4YZ5 A;  2WNU A;  2ZX0 A;  3GNE A;  4WM7 B;  1SLC A;  2XH6 A;  2R06 2;  4RFR B;  2DFB A;  2PAK A;  1NAE A;  3GCX A;  4IEP A;  3ZXF A;  3VBS A;  5CA6 A;  5FYI A;  5EP9 A;  2HEW F;  1J84 A;  4UW4 A;  4XZU G;  4ZU4 A;  3AB0 A;  3BVC A;  5A7Q A;  5EJ3 A;  2XLF A;  4RS5 B;  1CN1 A;  3URF A;  3VUO A;  4PDW B;  1CD3 G;  1X8M A;  1GQH A;  2QQK A;  5DZF A;  4COY A;  2BTV C;  1S55 A;  3CLP A;  4LHL A;  1XE7 A;  5KR7 A;  1QEX A;  1UZ0 A;  3DPR C;  1R08 2;  1YI9 A;  4LUL A;  3K3N A;  5FO9 B;  2KD7 A;  1C1L A;  5BY5 A;  3MIE A;  3PHM A;  4CUB A;  3NW4 A;  3ACG A;  1R09 1;  1SLT A;  4A45 A;  4CU7 A;  5LBE A;  1H6X A;  1SHW B;  4GMP 3;  4RR3 B;  3WDT A;  1YUD A;  4GB3 2;  3S30 A;  1VMH A;  2P3I A;  4QXB A;  5A33 B;  4Q4X 3;  3TOJ A;  2VQA A;  3WHU A;  4F8A A;  4M01 A;  1B35 B;  1JZ5 A;  3WP5 A;  1JUI A;  1MQT C;  2EXI A;  2QUO A;  1Q56 A;  4MGI E;  3AZX A;  4J1X A;  1RUF 1;  1AR6 2;  4QB2 A;  1C28 A;  2WFF 1;  3OBA A;  1Y9G A;  3OD0 A;  4KNC A;  1G9B A;  4LK7 A;  2F4L A;  4XYX A;  1DBN A;  1UO9 A;  2ET7 A;  2WL1 A;  4M3C B;  1ZX5 A;  2L9L A;  4CDQ A;  4NRO A;  1UKR A;  5IVJ A;  3ES1 A;  3J7N A;  5CKM A;  5DDJ 1;  2IZW A;  3VZJ A;  1H0B A;  4FFI A;  4WBB A;  2YC2 A;  4IET A;  4BQW A;  3MLL A;  4DUV A;  1RUG 3;  3OTF A;  1F9K A;  2VJX A;  1IPJ A;  3VL8 A;  5FZD A;  4MG2 A;  2Y6H A;  2WZR 1;  3HNB M;  2C9A A;  3N9Q A;  4AI3 A;  1MS8 A;  2DVF A;  5FTT C;  3CU7 A;  5LK5 A;  2VNV A;  4GKX A;  4L2N A;  4LBQ D;  1B09 A;  3ZVX A;  1HQN A;  1K42 A;  3EYP A;  1GZW B;  3I4I A;  5F2S A;  4QHB A;  5DMY A;  2VU9 A;  4N9H A;  5EZW A;  1RUO A;  1UKG A;  3UL2 A;  2WFF 2;  3WDY A;  1VB2 A;  1JTZ X;  2BWA A;  2HWF 2;  2ZTN A;  2RHP A;  4CCN A;  5L9B A;  4YG3 A;  5KHK A;  1WZX A;  1YJL A;  3MF6 A;  4EN6 B;  2RV9 A;  2VMF A;  3T1L A;  3WDV A;  1Q8S A;  2RMU 3;  1CGP A;  3W5M A;  1V0A A;  2IXI A;  1ULP A;  2C26 A;  1YJK A;  3B01 A;  5FAX A;  5AC9 3;  5J3U A;  3ABZ A;  5KBF A;  2XVK A;  1C8M 3;  1KFX L;  5CFC C;  2B39 A;  2BUK A;  2E53 A;  1HB4 A;  2OPW A;  2Y8K A;  3N9L A;  3WNO A;  4CDW A;  2OPK A;  4BLI A;  1RUI 2;  2OUJ A;  4B4Q A;  1NCQ A;  1BMV 2;  5H9S A;  4JGY B;  3CIH A;  1QJX 1;  2VMD A;  4QGN A;  3O1O A;  2QQO A;  5FUN A;  4MO3 M;  3O1S A;  1JOD A;  4NWV A;  3ELN A;  1WLD A;  2VMI A;  3NVC A;  4CEY B;  4ORF A;  1H9W A;  2CAV A;  3POB A;  4ZON A;  3RYR A;  2ZGS A;  1HXS 1;  1V6I A;  3AYC A;  4YWA A;  3ZFG A;  3HEI A;  1MS3 A;  3HD8 B;  5A6Y A;  2VMC A;  3O1R A;  3PUH A;  4XIO A;  3VGI A;  2BJS A;  2DVB A;  3AKS A;  3K4D A;  3IN9 A;  4NOT A;  1RHI 1;  3POW A;  4DXT A;  2DCT A;  4KL1 A;  1U12 A;  1NT0 A;  3AK0 A;  3HN3 A;  4PI2 A;  1RVF 2;  5F6K A;  2OX0 A;  1BJQ A;  3THD A;  1D7P M;  1YFX A;  1FI2 A;  1G86 A;  4AFM A;  2WT1 A;  4HMZ A;  4JCK A;  1JN2 P;  3O7O A;  2LTN A;  1ASJ 1;  1QJE A;  1VBC 3;  2ET1 A;  1CAW B;  2RE9 A;  2FMY A;  3VBR C;  3PU3 A;  1MS9 A;  1AR9 2;  3CKH A;  4AF9 A;  1W03 A;  2XQX A;  5FCC A;  4CDX A;  2RJ2 A;  1W05 A;  2Z42 A;  3WF2 A;  5A7S A;  1PGW 2;  1MZE A;  1W6M B;  2ZHM A;  1IG3 A;  4P9I A;  1TG7 A;  4BDV B;  2HWE 1;  3ZKY A;  5KXC A;  2ZXQ A;  1ODN A;  3KCX A;  1ND2 B;  1I5P A;  1ZBE 2;  1V70 A;  3Q8F A;  2W87 A;  3SMH A;  1OOP B;  1TME 1;  2VMG A;  3PU8 A;  1GNY A;  1SQ4 A;  3HQX A;  4ZXE A;  3MZH A;  1PGW 1;  2XJT A;  4Q8L A;  5ANN A;  5FUP A;  4DXS A;  3USU B;  4Q4W 2;  4OUE A;  5F5C A;  5T52 A;  1UQX A;  3GYD A;  1VLN A;  3WDU A;  3A21 A;  4XFH A;  3H0O A;  4KQ7 A;  4BQX A;  2A6V A;  2EXJ A;  4P5H A;  3PVN A;  2HLE A;  2ZGK A;  5LAS A;  4YGD A;  1GWK A;  4RQP A;  4MXV A;  4QKN A;  2ES3 A;  5JXJ A;  3T08 A;  2CGN A;  2WO7 A;  3ZO0 B;  1IS4 A;  4URT A;  5C5T A;  5A3T A;  1GAN A;  1W3X A;  1AXY A;  2O1Q A;  3M3O A;  4CUG A;  1GZC A;  5KHG A;  1JZ3 A;  1KGY A;  4FOY A;  2CHH A;  4I09 A;  3N3H A;  2D3R A;  3WNN A;  4BU2 A;  4IV3 C;  4QQH A;  1GOH A;  1R09 3;  5FZM A;  3RSJ A;  1DQ5 A;  1IOA A;  1H8T B;  3A23 A;  1N3Q A;  3J7L A;  3ZMO A;  2R07 3;  4PF1 A;  2BU9 A;  3AKP A;  2DFC A;  4G9S B;  3FHQ A;  4PBO A;  3W21 A;  3ZYP A;  1ZRC A;  4XET A;  2VD7 A;  3ES4 A;  5FPV A;  5A32 A;  3BOP A;  4R9A A;  2PHD A;  3DUI A;  1RUH 2;  3NJZ A;  5JZG B;  1W9F A;  1AXK A;  1DZR A;  4NO4 A;  3NQH A;  2VOT A;  1PX4 A;  5FZL A;  1PHM A;  2VZP A;  2Y0O A;  5A7W A;  1C3H A;  1UYY A;  1AR8 3;  3USS A;  3ZFE A;  2A70 A;  3POI A;  2GN3 A;  2ZGQ A;  1XU2 A;  4Y3O A;  2DUR A;  2JE7 A;  3D5O A;  3HNM A;  3WEZ A;  4ASK A;  2Y64 A;  4JDN A;  2Q8D A;  4QM8 A;  2Q5T A;  5EFU A;  4BA6 A;  3RZJ A;  4NR1 A;  4FP2 A;  5FY1 A;  4EYU A;  2JG9 A;  3HWJ A;  4R9D A;  4ZS2 A;  1H9P A;  4NMI A;  3RWN A;  1S2B A;  4Z1V A;  4Z2A A;  1RIN A;  1U0A A;  5LBC A;  2VM9 A;  5C9A B;  1ND2 A;  5JOX A;  4PLM A;  4IGO A;  3KF5 A;  5DAQ A;  3PME A;  3HNY M;  5CVR A;  3AL5 A;  2ZGN A;  1MQT B;  5I8S A;  2QQJ A;  2P3Y A;  2Q30 A;  3VDC A;  4P9L A;  4TLF A;  3NAP C;  2GNT A;  2DTY A;  4Q0P A;  3HIF A;  2YRO A;  3BOW A;  4B4P A;  1JYW A;  5IVY A;  5L73 A;  2A3W A;  4XAB A;  3RG0 A;  1JBC A;  3VZK A;  3WW1 A;  1UOJ A;  2DVA A;  2JWP A;  3ACL A;  2XBO 3;  4M3C A;  1J3P A;  2W1W A;  4IE0 A;  5FMD A;  3KM5 A;  3THT A;  4CDQ B;  5CB7 A;  1YWK A;  4A3X A;  3O1U A;  2BNN A;  3B94 A;  4Q27 A;  2FZ2 A;  4AQT A;  1GU3 A;  3RJR A;  4IV1 C;  5CFD C;  2NYY A;  3BKZ A;  3J8F 2;  4QPY A;  2G9Z A;  2DU0 A;  1WCK A;  1UOB A;  2J1R A;  2E32 A;  1BK0 A;  1O91 A;  3MGU A;  1XJA A;  4M0N A;  1LHO A;  5J96 B;  1CAV B;  4O9E A;  2E6V A;  5IJR A;  2OQ7 A;  2A6X A;  1PZ9 A;  4QX8 A;  2R0H A;  4NHX A;  4YZ3 A;  4AR2 A;  5LAT A;  2J1U A;  3UET A;  1SBE A;  2HWD 1;  3NJX A;  3D0S A;  1A8M A;  1JYV A;  4CDX B;  1F15 A;  2V5Y A;  1D4M 3;  1H2N A;  4QDS A;  4QXK A;  3PL0 A;  1W6M A;  2B7Y A;  4IE6 A;  5FWJ A;  5IVE A;  4OQ8 A;  1DGR A;  4FFG A;  4IE4 A;  3RYK A;  3VBF C;  5LA9 A;  1OLM E;  1LEC A;  1WMD A;  1VAL A;  2BV4 A;  4CXY A;  1GOG A;  4YM3 A;  3H7Y A;  3LIG A;  1UU6 A;  5JR7 B;  2QCS B;  3KCC A;  4LO5 B;  3S7I A;  3ZXL A;  5M0T A;  5IWF A;  3AMM A;  5LEK A;  1F35 A;  2PHU A;  3PVE A;  2AEZ A;  3BOD A;  4I01 A;  3LOI A;  3DV8 A;  2WNV B;  2WQ4 A;  4Z2W A;  1TMF 2;  1GR3 A;  3I7D A;  4V2V A;  3VBO C;  2A3X A;  4IEY A;  1HRV 2;  1KQR A;  1GWM A;  4FTE A;  1VBD 3;  5SV8 A;  4CPB A;  2B9U A;  1Z7S 2;  3BAL A;  2XWB B;  2A6Z A;  1ULG A;  3I59 B;  2OZJ A;  1AR6 3;  1BKZ A;  1IPK A;  2JJ6 A;  3CO2 A;  4AVT A;  1GV9 A;  1YXW A;  1TEI A;  3M7A A;  3RMX A;  2J1E A;  3V0A A;  3NRU A;  1HRI 2;  1QY4 A;  3GJB A;  2PEL A;  3M4F A;  4MSV A;  1KFU L;  1GBG A;  2WJS A;  2QQW A;  2VTX A;  4E27 A;  2CTV A;  1VAK A;  2E7A A;  2R6Q A;  4CCE A;  1LR5 A;  3OY8 A;  4AED B;  2TUN A;  3PJY A;  1IS5 A;  4JRA A;  1OA4 A;  5A3O A;  1JU4 A;  2XJS A;  1EAH 1;  1OA2 A;  4L9B A;  5FZK A;  4XDO A;  5A3L A;  5C3Q A;  1ND3 B;  5JLV A;  1LTE A;  1CPM A;  1G6N A;  2ZGM A;  1XE8 A;  1R1A 1;  5EIY B;  1BEV 1;  1NXM A;  1RUF 3;  3H1Y A;  4NHM A;  4CXW A;  5C8C C;  4D3W A;  3WNK A;  3VBH A;  3AYE A;  4XC9 A;  1NA1 B;  2RMU 1;  2WFF 3;  5A7W B;  4IEZ A;  4GKY A;  5LEJ A;  2HWE 2;  3VD7 A;  3S6P A;  3L2H A;  2X05 A;  1VBB 3;  1VR3 A;  3C7G A;  3ZXK A;  2Q8O A;  5JCT A;  4UFK A;  1HN0 A;  1Z7S 1;  4UFM A;  5K0U A;  3VDD C;  1RED A;  2D40 A;  1JYN A;  1W3V A;  2HWF 1;  3PTY A;  2OW4 A;  2VQ0 A;  5DDJ 3;  3H42 B;  5HBA A;  1CES A;  2WSU A;  4HSJ A;  5AC9 2;  5CG8 A;  1V6J A;  1WMX A;  2EIG A;  4Q4Y 2;  1Q8Q A;  4CCO A;  1ACC A;  1SLL A;  3TN9 2;  2Q4S A;  2W1S A;  3CJI B;  3DL3 A;  3MLK A;  5IVB A;  1MS5 A;  4LK6 A;  2DUQ A;  4LBO A;  4HN1 A;  3CZJ A;  4RQP B;  1KD7 A;  3K2O A;  1F2N A;  2VCB A;  2A5Z A;  3TEZ A;  2QQU A;  5F37 A;  1VIW B;  1X8E A;  1JOJ A;  3I2K A;  4CDU C;  1MVQ A;  2MHF A;  3AYD A;  5H9R A;  1UOF A;  1FYU A;  4LXL A;  2R7E B;  2VUA A;  4DIN B;  4P00 B;  3APB A;  3VD9 A;  2P17 A;  2Z5W A;  4QU1 A;  2BVV A;  5FZO B;  4AFB A;  1KS5 A;  3FFZ A;  4EZH A;  1LOF A;  1V6N A;  4AZZ A;  5HCA A;  3MFA A;  4AGG A;  1OI6 A;  5JI9 A;  3N9P A;  1AXZ A;  3RPQ A;  3FX3 A;  1H8T C;  5AVP A;  1JI6 A;  1W6P A;  4OHZ A;  1RVF 3;  1HB1 A;  5FZB A;  2TNF A;  1EUU A;  2GMM A;  4LQR A;  3D82 A;  4YW1 A;  2JKX A;  5LA2 A;  5F5Q A;  4PHZ A;  1TZO A;  3U4S A;  3BGA A;  3VV1 A;  2LAL A;  2QVS B;  2CWM A;  3VLB B;  2EIC A;  1LHU A;  1UY3 A;  4AEJ A;  4OHV A;  2X29 A;  5FY9 A;  1AUY A;  4UFH A;  1OHF A;  3OGG A;  1O5L A;  2WNO A;  3N7M A;  4CP2 A;  3ZFF B;  3U07 A;  3ITQ A;  3BPS A;  1Y9M A;  1POV 1;  3ALQ A;  2PQS A;  2JKB A;  4AEK A; 
#chains in the Genus database with same CATH homology
 1NX9 A;  3T0A A;  1DYO A;  3III A;  3CMG A;  3BN6 A;  2VZV A;  4CUC A;  4W50 A;  3I97 A;  2CDO A;  1W0N A;  3VDA A;  1K3I A;  1OF4 A;  5G04 L;  2OKX A;  1K45 A;  1GQP A;  4QX3 A;  1CZT A;  5HXM A;  4ARY A;  3I2F A;  4XUP A;  1RYY A;  3VDB A;  1UX7 A;  4KI5 M;  4MGQ A;  2DCJ A;  1US2 A;  2WO1 A;  2W91 A;  3UES A;  5EJZ B;  4YPJ A;  3C7E A;  4P02 B;  3OEB A;  2E33 A;  2VZT A;  3I3E A;  3D3A A;  3I2G A;  2ZEZ A;  4UI9 L;  3SKV A;  5LA0 A;  3ECQ A;  1MPX A;  5CYY A;  3A7Q A;  2WAO A;  1JZ7 A;  2Y6L A;  2VC9 A;  3OGS A;  4W4Z A;  4ZZ8 A;  4D0Q A;  1NAE A;  3IAP A;  4P5Y A;  4QX2 A;  2W5F A;  2Z4F A;  1J84 A;  4XZU G;  3FHA A;  3MUZ 1;  3MV1 1;  2WYS A;  2QQK A;  1UZ0 A;  3ACI A;  3DYM A;  3SEP A;  1GOF A;  2KD7 A;  4CUB A;  3U37 A;  4JKM A;  1ULO A;  3ACG A;  4CUA A;  4XUT A;  4A45 A;  5JXG A;  4CU7 A;  1H6X A;  1SHW B;  4P08 A;  2QQL A;  2DDU A;  5HPO A;  1JZ5 A;  4QB6 A;  1L7R A;  3VD3 A;  1IQD C;  3JXS A;  4JX0 A;  3MV0 1;  3VD4 A;  5LA1 A;  3ETP A;  4GWJ A;  1LNS A;  4BJ0 A;  4QB2 A;  5C70 A;  4UOJ A;  3OBA A;  2WQ8 A;  2YFZ A;  2W47 A;  1W9W A;  4MAD A;  2VME A;  2VO5 A;  1W8N A;  2WZE A;  2L9L A;  5JR2 A;  3T0D A;  1BHG A;  2XOM A;  1US3 A;  3DEC A;  3OEA A;  1EUT A;  2YC2 A;  3C7H A;  4D8M A;  4DUV A;  2VJX A;  3FL7 A;  1JYX A;  5IFP A;  2Y6H A;  3HNB M;  2ZEX A;  3SEE A;  1JZ8 A;  5DN2 A;  3I2J A;  4E8D A;  3CQO A;  1TVG A;  5JXI A;  1PMH X;  2VZS A;  4QAW A;  3T0B A;  1K42 A;  3EYP A;  5IHR A;  5DMY A;  3W5N A;  1WCQ A;  1KEX A;  2WZ8 A;  3LE0 A;  1NUK A;  2QQM A;  4W8J A;  2RV9 A;  1OT5 A;  2VMF A;  2BBA A;  1UY4 A;  3MO4 A;  3W5M A;  1ULP A;  2C26 A;  3ABZ A;  4XUR A;  2X09 A;  1UWW A;  2EID A;  2JE8 A;  1H6Y A;  1F4H A;  2Y8K A;  3WNO A;  2BER A;  2W3J A;  2J1A A;  4M4P A;  1GMM A;  4DUW A;  1JZ4 A;  3CIH A;  2VTF A;  2VMD A;  2QQO A;  1O8P A;  4MO3 M;  3MBW A;  4UAP A;  2J1V A;  2WO3 A;  4L0P A;  1W9T A;  1YQ2 A;  4XUN A;  1UXZ A;  3HEI A;  2BGO A;  2VMC A;  2C4X A;  3PUH A;  1R64 A;  1WKY A;  2VZO A;  4DUX A;  3K4D A;  4MOA A;  4DXT A;  3HN3 A;  1DP0 A;  2VZR A;  3THD A;  1D7P M;  3HJR A;  4OZO A;  1CZV A;  5JMO A;  4ZY9 A;  4PT6 A;  2ZEW A;  2W46 A;  3T2P A;  3CKH A;  2XQX A;  4RN5 A;  4PQQ A;  2RJ2 A;  3WF2 A;  3PUI A;  4BDV B;  1TG7 A;  4RYD A;  2ZXQ A;  1I5P A;  2W87 A;  1T2X A;  3DYO A;  5C7G A;  1NKG A;  1GNY A;  4QB1 A;  3ZM8 A;  4ZXE A;  5B4N A;  4DXS A;  4OUE A;  4KMQ A;  5B4X A;  1OF3 A;  3GGL A;  2RVA A;  1JZ2 A;  3A21 A;  3I3B A;  5J1X A;  3SKJ E;  3WF4 A;  1JU3 A;  2HLE A;  2WAA A;  2VL4 A;  2WDB A;  3C7F A;  5JXJ A;  3T08 A;  1XC6 A;  2J7M A;  4A42 A;  3FN9 A;  2B9V A;  5C71 A;  1JZ3 A;  1KGY A;  3WNN A;  1GOH A;  3K4A A;  4ARX A;  1CZS A;  4GZ9 A;  3A23 A;  1CX1 A;  3K75 B;  4PF1 A;  3FHQ A;  4A41 A;  4DEV A;  1O8S A;  2ORZ A;  4HG6 B;  2VQU A;  3K77 A;  3HOB A;  2VZ1 A;  3NQH A;  2VOT A;  1PX4 A;  2C9K A;  2VZP A;  2QQN A;  1UYY A;  2XHN A;  3NNG A;  2Y6K A;  4BK4 A;  3WEZ A;  3LEG A;  3HNM A;  4MGS A;  1K12 A;  2E26 A;  2ID4 A;  2Y64 A;  1JHJ A;  3T2Q A;  2B4K A;  3WF3 A;  1UMI A;  5EJ1 B;  4A44 A;  1W9S A;  1W99 A;  4DXR A;  1J83 A;  5FUI A;  2YG0 A;  3LPG A;  2VCA A;  1CIY A;  2LW8 A;  2W1Q A;  3GXU A;  5F7U A;  4Z2A A;  2JD9 A;  2ZEY A;  2YFU A;  5I0D A;  2VM9 A;  2LS6 A;  1XPW A;  3CDZ B;  2Y6J A;  3CZU A;  3T2O A;  3I2I A;  3HNY M;  2DCK A;  2W1U A;  2QQJ A;  3C7O A;  3OB8 A;  4LKS A;  3VDC A;  4CU6 A;  1O59 A;  3AC0 A;  4E8C A;  1JYW A;  2J1T A;  2WN3 A;  3GDB A;  2VZQ A;  3WNM A;  3WF0 A;  2W1W A;  4XVH A;  3WF1 A;  1GU3 A;  4CVU A;  1PMJ X;  2W92 A;  1GUI A;  3A22 A;  2WBK A;  2HYX A;  2J1R A;  2E32 A;  3DYP A;  2VCC A;  3OG2 A;  3ACF A;  5IJR A;  3WNP A;  4ET7 A;  2J1U A;  3UET A;  3NJX A;  4XUQ A;  1XNA A;  2VZ3 A;  1JYV A;  1UXX X;  1HN1 A;  4QDS A;  4JHZ A;  4A6O A;  4QDQ A;  4BK5 A;  4M4R A;  4LPL A;  2CDP A;  5DQ0 A;  2Y6G A;  1GOG A;  1SDD B;  2J1S A;  5DPN A;  3ACH A;  3P6B A;  1UMH A;  1SG3 A;  3LPF A;  1XNT A;  2W95 A;  3UNP A;  2WO2 A;  1P8J A;  3LEI A;  4A4A A;  1UY0 A;  3WSO A;  3C8X A;  3GM8 A;  3HPN A;  2J1E A;  2WUH A;  2YC4 A;  3NRU A;  2ORX A;  3T09 A;  4KWU A;  4QPW A;  2BZD A;  5G05 L;  3I3D A;  3NJV A;  1JU4 A;  3LEK A;  3LQC A;  5IFT A;  4OMD A;  4A3Z A;  2VQT A;  5CZK A;  2VR4 A;  4TTG A;  1W8O A;  3P1I A;  4DEQ A;  1JZ6 A;  3EB7 A;  5EIY B;  5JXH A;  1UY2 A;  2J22 A;  2W9X A;  1UYX A;  3WNK A;  1L7Q A;  1UYZ A;  2BGP A;  5JUV A;  3K46 A;  2VZU A;  1DLC A;  3VD7 A;  2X05 A;  4CU8 A;  3C7G A;  5IYY A;  1JYN A;  4AAX A;  4JKK A;  4ZZ5 A;  4QDR A;  2V5D A;  2V4V A;  4IUG A;  2XON A;  3MUY 1;  3F2Z A;  1OD3 A;  3J7H A;  2W1S A;  2QBX A;  4BXS V;  3IB3 A;  3CZJ A;  4XUO A;  2VCB A;  4JKL A;  2W94 A;  4LHS A;  3I2K A;  3E1F 1;  2R7E B;  4OYU A;  4P00 B;  3VD9 A;  3K4Z A;  3IDA A;  2WAB A;  3IAQ A;  4FI9 A;  2YB7 A;  3VD5 A;  4QX0 A;  4CU9 A;  2E31 A;  2X10 A;  3THC A;  1PX3 A;  1OH4 A;  1UY1 A;  4OMC A;  1JI6 A;  2QQI A;  3I2H A;  2EIB A;  3WNL A;  4AG4 A;  5LCW L;  1EUU A;  4LQR A;  3OGV A;  2V72 A;  2JKX A;  4TXW A;  3OGR A;  5LA2 A;  5A1A A;  3BGA A;  2EIC A;  4GWI A;  1UY3 A;  2JDA A;  4QX1 A;  2EIE A;  1F4A A;  2PQS A;  2WN2 A;  3WQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...