2YBAA

Crystal structure of nurf55 in complex with histone h3
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
407
structure length
390
Chain Sequence
AESFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTKQDGKDYSVHRLILGTHTSDEQNHLLIASVQLPSSHYDNVCGKIEIEIKINHEGEVNRARYMPQNACVIATKTPSSDVLVFDYTKHPSKPEPSGECQPDLRLRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWDTRNNNTSKPSHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSTEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENVYND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Histone Methylation by Prc2 is Inhibited by Active Chromatin Marks
pubmed doi rcsb
molecule keywords PROBABLE HISTONE-BINDING PROTEIN CAF1
source organism Drosophila melanogaster
molecule tags Transcription
total genus 102
structure length 390
sequence length 407
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ybaA00
4GM9A 4H5JA 2J56H 3AL8B 4JT5C 4L1QD 4G56B 4GZ8A 5H17A 3RFHA 2H3XA 5CXBA 2I3SA 2CE8A 2HXCA 4GGAA 4A0BB 4YVDA 1NR0A 4ZOXA 4CY5A 4ERZA 4GQBB 2QXVA 2IWFA 4XEIC 4U7AA 4Y7RA 5FKRA 2H9NA 2I0TA 4PBZA 1JMXB 3MXXA 2Q7QA 3SMRA 2IAAA 5AJAA 3JPXA 4PSWB 1B9YA 3DSMA 3NVQA 2P9LC 4CY3A 2W18A 4GM3A 4Y5RD 1GOTB 3PE7A 2O9KA 2AGLA 3HFQA 3P4FA 3SXTD 4J8GA 2H6NA 3IKOA 3AL9A 4NSXA 3EG6A 3N0DA 1GG2B 5HQGA 5JWZA 3SHFA 4BH6A 2HJ4A 5AMSA 3GFCA 5IC7A 1PGUA 4X63B 4ERYA 4FAVD 2P9UC 5IGOA 3UKRC 2GNQA 3JZGA 3PSCB 4J78A 2AGYA 4ZOYA 4LG9A 2AGZA 3NVXA 4JSVC 2H9PA 3OKYA 3VA6A 5I5IA 3C99A 4J87A 4O3UB 4LG8A 2H9LA 2AGWA 3UVMA 4A2MA 5K19A 2YMUA 3V7DB 4J73A 2GC4A 5CYKB 4GQ2P 1JMZB 5EAPA 2YBAA 4PXWA 3F3FA 2P9NC 3UVLA 3F3PA 3JAMg 2H13A 1MG3A 4ESGA 1JOFA 3OL2A 4A2LA 5THAA 2P9PC 4A0AA 2J55H 1OLZA 2I0RA 5EM2B 4J82A 3C5MA 1RI6A 3SJLD 3IJCA 4ZN4A 4JD2C 5TDHB 5IJ8E 3PXSD 3GREA 4AEZA 2J57G 2YNNA 2GC7A 3EI2B 5GSAA 2YNOA 3EI1B 4ZOZA 3MKSB 2CN2A 1QNIA 3J81g 3PSLA 3MZLA 1R5MA 3V5WB 3CFSB 4HDJA 4IA9A 1PEVA 2P9KC 4QRJA 1N6DA 4E54A 3C75H 2IUPA 5C2WB 3RLMD 1OMWB 2P9SC 5GXHA 3K26A 4KFMB 2B5MA 2UZYB 3JROA 1SHYB 4A7JA 3RN1D 4Z8LA 2G99A 2IWKA 2HESX 4J79A 3UKUC 5TEFA 2OVRB 5H14A 1A0RB 4ES0A 3EI4A 5GXIA 4L9OA 5C2VB 4GGDA 5FKSA 4FA9D 1Q47A 2OVPB 4BL0A 3UR4A 3I2NA 3PXTD 3VH0A 4A09A 2I0SA 3EI1A 3JRPA 4QT8A 5EMJB 3C9CA 4EWRA 4E5ZA 3MKQA 4I79A 5EMMB 2CO0C 3VGZA 4XYHA 1PBYB 4XYIA 2YB8B 5FQDA 3AL8A 3SFZA 4D6VA 3V9FA 3I89A 3DM0A 4A11B 3JB9L 2B5NA 3BG0A 3EMHA 4O1QD 3W15A 3F3GA 4A0BA 1SQJA 3RSEC 4QL1A 4CI2A 5GMKn 3FRXA 3DWLC 4J0WA 1TBGA 3I8EA 4LGNA 4J8BA 1B9XA 2PM9B 3A0FA 5AFU3 4ERQA 1GP2B 1NEXB 1XKSA 5FKTA 5HE2B 3AFCA 5CXCB 2OK4A 4JSXC 3EI3B 5FA5B 5IJ7E 5HYNB 2CN3A 5B4WA 4O45A 3SBQA 3OKTA 5FLXg 2CE9A 5EAMA 3L4OD 4FA1D 2AGXA 4FHLA 4FA5D 2OVQB 3ZWLB 4QQEA 4FAND 2B5LA 4E54B 3UVNA 2PM7B 4K3JB 5HE1B 2OIZA 1FWXA 3PXWD 4JT6C 2P9IC 3FM0A 4IMMA 5CXBB 3N0EA 3BG1A 2Z2NA 3MZKA 3OTTA 4FB1D 3I7KA 4J77A 2OJYA 3I8CA 4GQ1A 3FGBA 5I5MA 2Z2PA 5CYKA 4PNKB 3RMZD 4O9DA 4R7AB 2H6KA 3EU7A 2PM6B 5SXMA 5KDOB 3IJ0A 5EMKB 2OK6A 2YNPA 5IGQA 3UVKA 5EM2A 3PVUB 3I7HA 3KRXB 3I7LA 5EALA 1XHMA 3DXMC 4GM8A 3B7FA 2H14A 5I5JA 3SLED 1YFQA 3DXKC 3SVWD 4J84A 3EI2A 2HYEA 4GMBA 2QC5A 4K3ID 3RFGA 1U4CA 3SCYA 2XL2A 4A08B 3OKYB 1N6EA 2HJBA 4CZYA 3JZHA 3SBRA 2AQ5A 4UI9R 5K1CC 1K32A 1K8KC 1MG2A 3IJ1A 4J0XA 2HKMA 2G9AA 3CFVA 1L0QA 2UZXB 3CIKB 2IUQA 4CI3A 5HE3B 2MTAH 1VYHC 3AH8B 3OL2B 4FA4D 5A2Qg 4A0AB 5FKQA 2EBSA 3EWEA 5EARA 2I3TA 1JJUB 1GXRA 4BUJC 1S4UX 4CI8A 4ZOVA 5IT9g 3I7PA 1MDAH 3ODTA 4J86A 5EMLB 3E0CA 3K27A 4L3GD 4H5IA 2BCJB 2HKRA 4A08A 3SWSD 2CO0A 4GGCA 5FXYA 5C9ZB 3PVWB 3RN0D 1N6FA 4X60B 2B4EA 2CNXA 4A11A 1ERJA 3OW8A 4U1EI 2IURA 2XU7A 4X61B 3SN6B 5TF2A 2AH1A 5HE0B 2XL3A 4OZUA 4CI1A 2Z2OA 3BWSA 4O3TB 4PSXB 3J80g 4TZ4A 4CC9A 3NVNA 5H1MA 5TEEA 2TRCB 3SBPA 2PM9A 2H9MA 3KRWB 3ULEC 1P22A 3I7NA 4CZVA 4AOWA 4JSPC 4D0KA 4MK0B 4J81A 2BBKH 3IIWA 3EI4B 2IUVA 4FWWA 5CXCA 1XIPA 3EI3A 3JZNA 3L4MD 4PBYA 3OKWA 4OWRA 3ORVD 2H6QA 3IIYA 1TYQC 4CY2A 4CY1A 4L3HD 2AH0A 1SQ9A 4CZXA 4A09B 4PC0A 1U2VC 4N14A 2H47A 2PBIB 3U4YA 4JXMA 4JSNC 2XYIA 3MMYA 2H68A 4E5ZB 3UVOA 4X3EA 1PI6A 3RRMC 3I7OA
chains in the Genus database with same CATH superfamily
4WK4A 3ZE0A 4GM9A 4H5JA 1TYEA 2VDPA 4BCCA 2J56H 3AL8B 4JT5C 4L1QD 4G56B 4GZ8A 5H17A 3RFHA 2H3XA 4NBMA 5CXBA 2I3SA 2CE8A 2HXCA 4GGAA 4A0BB 2VDKA 4YVDA 1NR0A 4ZOXA 1M1XA 4CY5A 3NIGA 4ERZA 4GQBB 2QXVA 2IWFA 4XEIC 4U7AA 4Y7RA 5FKRA 3QI0A 3EQ8A 2H9NA 2I0TA 4PBZA 1JMXB 3MXXA 2Q7QA 3SMRA 2IAAA 5AJAA 2VDNA 3JPXA 4O02A 4PSWB 1JTDB 1B9YA 3DSMA 3NVQA 2P9LC 4CY3A 2W18A 4GM3A 4Y5RD 3IJEA 5HDBA 1GOTB 4L1MA 4DNWA 3PE7A 2O9KA 2AGLA 3HFQA 1E8NA 3P4FA 3SXTD 4J8GA 2H6NA 3IKOA 3AL9A 2WQ8A 4NSXA 3EG6A 3N0DA 1GG2B 4QAMA 5HQGA 5JWZA 3SHFA 4BH6A 3K71A 4AN1A 2HU8A 2HJ4A 5AMSA 4UM8A 3GFCA 5IC7A 1PGUA 4X63B 4ERYA 4FAVD 2P9UC 5IGOA 3UKRC 2GNQA 3JZGA 3PSCB 4J78A 2AGYA 4ZOYA 4LG9A 2AGZA 3NVXA 4JSVC 3IVMA 2H9PA 3OKYA 3VA6A 4NC4A 5I5IA 3C99A 4J87A 4O3UB 4LG8A 2VZ3A 1BPOA 2H9LA 2AGWA 3UVMA 5E6SA 4A2MA 1C9LA 5K19A 2YMUA 3V7DB 4J73A 2GC4A 5CYKB 4GQ2P 1JMZB 5EAPA 5M5UA 2YBAA 4PXWA 3F3FA 2P9NC 3UVLA 3F3PA 3JAMg 2H13A 4DNUA 1MG3A 2VDMA 5E6RA 4ESGA 1H2YA 5FFGA 1JOFA 3OL2A 2VDLA 4A2LA 5THAA 2P9PC 4A0AA 2J55H 3NIFA 1OLZA 2I0RA 5EM2B 3K72A 4J82A 3C5MA 1RI6A 3SJLD 3IJCA 4ZN4A 4JD2C 3IUMA 5TDHB 3ZDZA 5IJ8E 1VZ3A 3PXSD 3GREA 4AEZA 2J57G 2QZPA 2YNNA 2GC7A 1UOQA 3EI2B 5GSAA 2YNOA 4WJKA 3EI1B 4ZOZA 3MKSB 2CN2A 1QNIA 2EIEA 3J81g 3PSLA 3MZLA 1R5MA 3V5WB 3CFSB 4HDJA 4IA9A 1PEVA 2P9KC 4QRJA 1N6DA 4E54A 4MMYA 3C75H 2IUPA 5C2WB 3T3PA 3RLMD 1OMWB 2P9SC 5GXHA 3K26A 4KFMB 2B5MA 2UZYB 3JROA 5C86A 1SHYB 3IUJA 3OF7A 4A7JA 3RN1D 4Z8LA 2G99A 2IWKA 2HESX 4J79A 3ZDYA 5M5SA 3UKUC 5TEFA 3T3MA 2OVRB 3RRMC 5H14A 1A0RB 4ES0A 3EI4A 5GXIA 4L9OA 5C2VB 4GGDA 4RE6A 1YR2A 5FKSA 3EQ9A 1U8CA 4IRZA 4NAAA 4FA9D 1Q47A 2OVPB 4BL0A 4RE5A 4UM9A 3UR4A 3I2NA 3PXTD 3VH0A 1JV2A 4A09A 2I0SA 3EI1A 3IURA 3JRPA 4QT8A 5EMJB 3C9CA 4EWRA 1C9IA 2EIBA 3O4IA 4E5ZA 3MKQA 4I79A 5EMMB 2CO0C 3VGZA 4XYHA 1PBYB 4XYIA 2YB8B 5FQDA 4AX4A 3AL8A 3SFZA 1QFSA 4D6VA 3V9FA 3I89A 3DM0A 4A11B 3JB9L 2B5NA 3DDUA 3BG0A 3EMHA 4O1QD 5FFOA 3W15A 3F3GA 4A0BA 1SQJA 2EICA 3RSEC 2VDRA 4QL1A 4CI2A 5GMKn 1O6FA 3FRXA 3DWLC 2EIDA 4J0WA 4BP9A 3IULA 1TBGA 3I8EA 4LGNA 4J8BA 1B9XA 2PM9B 3A0FA 5AFU3 4ERQA 1GP2B 1VZ2A 1NEXB 1XKSA 5FKTA 5HE2B 3AFCA 5CXCB 2OK4A 1UOPA 4JSXC 4WK2A 3EI3B 1GOGA 5FA5B 5IJ7E 2VDOA 2CN3A 5B4WA 5HYNB 4O45A 3SBQA 3OKTA 5FLXg 1GOFA 2CE9A 5EAMA 3L4OD 4FA1D 2AGXA 4FHLA 1E8MA 4FA5D 2OVQB 3ZWLB 4QQEA 4FAND 2B5LA 4E54B 5E6UA 3UVNA 2PM7B 4K3JB 5HE1B 2OIZA 4MMZA 1FWXA 3PXWD 4JT6C 2P9IC 3NIDA 3FM0A 4O2WA 4IMMA 2JKXA 5CXBB 5C92A 3N0EA 3BG1A 2Z2NA 3MUOA 5M5TA 3MZKA 3OTTA 4FB1D 3I7KA 4J77A 1QFMA 3FCSA 3VI3A 5M5VA 2OJYA 2HU7A 3I8CA 4GQ1A 3V4PA 4JHPC 3FGBA 5I5MA 2Z2PA 1GOHA 4G55A 5CYKA 4PNKB 3RMZD 4O9DA 4Z7QA 4R7AB 2H6KA 3EU7A 2PM6B 5SXMA 5KDOB 3IJ0A 5EMKB 3FCUA 2OK6A 2YNPA 5IGQA 1H2XA 3UVKA 3K6SA 5EM2A 4Z7NA 3PVUB 3I7HA 1A12A 3KRXB 3I7LA 3MVDK 3GC3B 3O4JA 5EALA 1XHMA 3DXMC 4GM8A 3O4GA 4D9SA 1H2WA 3B7FA 2H14A 5I5JA 3SLED 1YFQA 3DXKC 3SVWD 4J84A 3EI2A 1L5GA 2HYEA 4GMBA 2QC5A 2XDWA 4K3ID 3RFGA 1U4CA 3SCYA 2XL2A 4A08B 3OKYB 3VI4A 1N6EA 2HJBA 4CZYA 3JZHA 3SBRA 2AQ5A 4UI9R 5K1CC 1K32A 1K8KC 3EQ7A 1MG2A 3IJ1A 3KCIA 3MUNA 4J0XA 2QR5A 2HKMA 2G9AA 3CFVA 4WK0A 1L0QA 2UZXB 3CIKB 4DNVA 2IUQA 1O6GA 4CI3A 2XE4A 5HE3B 2MTAH 2VDQA 4Z7OA 1VYHC 3AH8B 3OL2B 4FA4D 5A2Qg 4A0AB 1H2ZA 5FKQA 4MMXA 2EBSA 2BKLA 3EWEA 3QHYB 5EARA 2I3TA 1JJUB 1GXRA 4BUJC 1S4UX 5M5RA 4CI8A 4ZOVA 5IT9g 3I7PA 3ZE1A 3ZE2A 4AMZA 3O4HA 5M61A 1MDAH 2VZ1A 1E5TA 1I2MB 3ODTA 4J86A 5EMLB 3E0CA 3GD1I 3K27A 4L3GD 4AN0A 4H5IA 2BCJB 2HKRA 4A08A 3SWSD 4BCDA 4BCBA 2CO0A 4GGCA 5FXYA 5C9ZB 3PVWB 3RN0D 4JHNA 1N6FA 4G1EA 4X60B 2B4EA 2CNXA 1UOOA 4BP8A 4A11A 1ERJA 3IUNA 3OW8A 4U1EI 2IURA 2XU7A 4X61B 3SN6B 5TF2A 2AH1A 5HE0B 2XL3A 4OZUA 4CI1A 2Z2OA 1UTCA 3BWSA 4O3TB 2HU5A 4PSXB 3ZDXA 3J80g 4TZ4A 4CC9A 3NVNA 5H1MA 5TEEA 2TRCB 3SBPA 1T2XA 2PM9A 2H9MA 1VE7A 3KRWB 3ULEC 1P22A 3I7NA 4CZVA 4AOWA 4JSPC 4D0KA 3V4VA 4MK0B 1VE6A 4J81A 2BBKH 3IIWA 3EI4B 2IUVA 4FWWA 5CXCA 1XIPA 3EI3A 3JZNA 3L4MD 2XZGA 4PBYA 3OKWA 4OWRA 3ORVD 2H6QA 3IIYA 1TYQC 4CY2A 4CY1A 4L3HD 2AH0A 1SQ9A 4CZXA 4A09B 4PC0A 1U2VC 4N14A 2H47A 2PBIB 2VC2A 4AMYA 3U4YA 4JXMA 4G1MA 3IUQA 4JSNC 2XYIA 3MMYA 1K3IA 2H68A 4E5ZB 3UVOA 4X3EA 1PI6A 4NENA 3I7OA
chains in the Genus database with same CATH topology
4GM9A 4H5JA 2J56H 3AL8B 4JT5C 4L1QD 4G56B 4GZ8A 5H17A 3RFHA 2H3XA 5CXBA 2I3SA 2CE8A 2HXCA 4GGAA 4A0BB 4YVDA 1NR0A 4ZOXA 4CY5A 4ERZA 4GQBB 2QXVA 2IWFA 4XEIC 4U7AA 4Y7RA 5FKRA 2H9NA 2I0TA 4PBZA 1JMXB 3MXXA 2Q7QA 3SMRA 2IAAA 5AJAA 3JPXA 4PSWB 1B9YA 3DSMA 3NVQA 2P9LC 4CY3A 2W18A 4GM3A 4Y5RD 1GOTB 3PE7A 2O9KA 2AGLA 3HFQA 3P4FA 3SXTD 4J8GA 2H6NA 3IKOA 3AL9A 4NSXA 3EG6A 3N0DA 1GG2B 5HQGA 5JWZA 3SHFA 4BH6A 2HJ4A 5AMSA 3GFCA 5IC7A 1PGUA 4X63B 4ERYA 4FAVD 2P9UC 5IGOA 3UKRC 2GNQA 3JZGA 3PSCB 4J78A 2AGYA 4ZOYA 4LG9A 2AGZA 3NVXA 4JSVC 2H9PA 3OKYA 3VA6A 5I5IA 3C99A 4J87A 4O3UB 4LG8A 2H9LA 2AGWA 3UVMA 4A2MA 5K19A 2YMUA 3V7DB 4J73A 2GC4A 5CYKB 4GQ2P 1JMZB 5EAPA 2YBAA 4PXWA 3F3FA 2P9NC 3UVLA 3F3PA 3JAMg 2H13A 1MG3A 4ESGA 1JOFA 3OL2A 4A2LA 5THAA 2P9PC 4A0AA 2J55H 1OLZA 2I0RA 5EM2B 4J82A 3C5MA 1RI6A 3SJLD 3IJCA 4ZN4A 4JD2C 5TDHB 5IJ8E 3PXSD 3GREA 4AEZA 2J57G 2YNNA 2GC7A 3EI2B 5GSAA 2YNOA 3EI1B 4ZOZA 3MKSB 2CN2A 1QNIA 3J81g 3PSLA 3MZLA 1R5MA 3V5WB 3CFSB 4HDJA 4IA9A 1PEVA 2P9KC 4QRJA 1N6DA 4E54A 3C75H 2IUPA 5C2WB 3RLMD 1OMWB 2P9SC 5GXHA 3K26A 4KFMB 2B5MA 2UZYB 3JROA 1SHYB 4A7JA 3RN1D 4Z8LA 2G99A 2IWKA 2HESX 4J79A 3UKUC 5TEFA 2OVRB 5H14A 1A0RB 4ES0A 3EI4A 5GXIA 4L9OA 5C2VB 4GGDA 5FKSA 4FA9D 1Q47A 2OVPB 4BL0A 3UR4A 3I2NA 3PXTD 3VH0A 4A09A 2I0SA 3EI1A 3JRPA 4QT8A 5EMJB 3C9CA 4EWRA 4E5ZA 3MKQA 4I79A 5EMMB 2CO0C 3VGZA 4XYHA 1PBYB 4XYIA 2YB8B 5FQDA 3AL8A 3SFZA 4D6VA 3V9FA 3I89A 3DM0A 4A11B 3JB9L 2B5NA 3BG0A 3EMHA 4O1QD 3W15A 3F3GA 4A0BA 1SQJA 3RSEC 4QL1A 4CI2A 5GMKn 3FRXA 3DWLC 4J0WA 1TBGA 3I8EA 4LGNA 4J8BA 1B9XA 2PM9B 3A0FA 5AFU3 4ERQA 1GP2B 1NEXB 1XKSA 5FKTA 5HE2B 3AFCA 5CXCB 2OK4A 4JSXC 3EI3B 5FA5B 5IJ7E 5HYNB 2CN3A 5B4WA 4O45A 3SBQA 3OKTA 5FLXg 2CE9A 5EAMA 3L4OD 4FA1D 2AGXA 4FHLA 4FA5D 2OVQB 3ZWLB 4QQEA 4FAND 2B5LA 4E54B 3UVNA 2PM7B 4K3JB 5HE1B 2OIZA 1FWXA 3PXWD 4JT6C 2P9IC 3FM0A 4IMMA 5CXBB 3N0EA 3BG1A 2Z2NA 3MZKA 3OTTA 4FB1D 3I7KA 4J77A 2OJYA 3I8CA 4GQ1A 3FGBA 5I5MA 2Z2PA 5CYKA 4PNKB 3RMZD 4O9DA 4R7AB 2H6KA 3EU7A 2PM6B 5SXMA 5KDOB 3IJ0A 5EMKB 2OK6A 2YNPA 5IGQA 3UVKA 5EM2A 3PVUB 3I7HA 3KRXB 3I7LA 5EALA 1XHMA 3DXMC 4GM8A 3B7FA 2H14A 5I5JA 3SLED 1YFQA 3DXKC 3SVWD 4J84A 3EI2A 2HYEA 4GMBA 2QC5A 4K3ID 3RFGA 1U4CA 3SCYA 2XL2A 4A08B 3OKYB 1N6EA 2HJBA 4CZYA 3JZHA 3SBRA 2AQ5A 4UI9R 5K1CC 1K32A 1K8KC 1MG2A 3IJ1A 4J0XA 2HKMA 2G9AA 3CFVA 1L0QA 2UZXB 3CIKB 2IUQA 4CI3A 5HE3B 2MTAH 1VYHC 3AH8B 3OL2B 4FA4D 5A2Qg 4A0AB 5FKQA 2EBSA 3EWEA 5EARA 2I3TA 1JJUB 1GXRA 4BUJC 1S4UX 4CI8A 4ZOVA 5IT9g 3I7PA 1MDAH 3ODTA 4J86A 5EMLB 3E0CA 3K27A 4L3GD 4H5IA 2BCJB 2HKRA 4A08A 3SWSD 2CO0A 4GGCA 5FXYA 5C9ZB 3PVWB 3RN0D 1N6FA 4X60B 2B4EA 2CNXA 4A11A 1ERJA 3OW8A 4U1EI 2IURA 2XU7A 4X61B 3SN6B 5TF2A 2AH1A 5HE0B 2XL3A 4OZUA 4CI1A 2Z2OA 3BWSA 4O3TB 4PSXB 3J80g 4TZ4A 4CC9A 3NVNA 5H1MA 5TEEA 2TRCB 3SBPA 2PM9A 2H9MA 3KRWB 3ULEC 1P22A 3I7NA 4CZVA 4AOWA 4JSPC 4D0KA 4MK0B 4J81A 2BBKH 3IIWA 3EI4B 2IUVA 4FWWA 5CXCA 1XIPA 3EI3A 3JZNA 3L4MD 4PBYA 3OKWA 4OWRA 3ORVD 2H6QA 3IIYA 1TYQC 4CY2A 4CY1A 4L3HD 2AH0A 1SQ9A 4CZXA 4A09B 4PC0A 1U2VC 4N14A 2H47A 2PBIB 3U4YA 4JXMA 4JSNC 2XYIA 3MMYA 2H68A 4E5ZB 3UVOA 4X3EA 1PI6A 3RRMC 3I7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GM9 A;  4H5J A;  2J56 H;  3AL8 B;  4JT5 C;  4L1Q D;  4G56 B;  4GZ8 A;  5H17 A;  3RFH A;  2H3X A;  5CXB A;  2I3S A;  2CE8 A;  2HXC A;  4GGA A;  4A0B B;  4YVD A;  1NR0 A;  4ZOX A;  4CY5 A;  4ERZ A;  4GQB B;  2QXV A;  2IWF A;  4XEI C;  4U7A A;  4Y7R A;  5FKR A;  2H9N A;  2I0T A;  4PBZ A;  1JMX B;  3MXX A;  2Q7Q A;  3SMR A;  2IAA A;  5AJA A;  3JPX A;  4PSW B;  1B9Y A;  3DSM A;  3NVQ A;  2P9L C;  4CY3 A;  2W18 A;  4GM3 A;  4Y5R D;  1GOT B;  3PE7 A;  2O9K A;  2AGL A;  3HFQ A;  3P4F A;  3SXT D;  4J8G A;  2H6N A;  3IKO A;  3AL9 A;  4NSX A;  3EG6 A;  3N0D A;  1GG2 B;  5HQG A;  5JWZ A;  3SHF A;  4BH6 A;  2HJ4 A;  5AMS A;  3GFC A;  5IC7 A;  1PGU A;  4X63 B;  4ERY A;  4FAV D;  2P9U C;  5IGO A;  3UKR C;  2GNQ A;  3JZG A;  3PSC B;  4J78 A;  2AGY A;  4ZOY A;  4LG9 A;  2AGZ A;  3NVX A;  4JSV C;  2H9P A;  3OKY A;  3VA6 A;  5I5I A;  3C99 A;  4J87 A;  4O3U B;  4LG8 A;  2H9L A;  2AGW A;  3UVM A;  4A2M A;  5K19 A;  2YMU A;  3V7D B;  4J73 A;  2GC4 A;  5CYK B;  4GQ2 P;  1JMZ B;  5EAP A;  2YBA A;  4PXW A;  3F3F A;  2P9N C;  3UVL A;  3F3P A;  3JAM g;  2H13 A;  1MG3 A;  4ESG A;  1JOF A;  3OL2 A;  4A2L A;  5THA A;  2P9P C;  4A0A A;  2J55 H;  1OLZ A;  2I0R A;  5EM2 B;  4J82 A;  3C5M A;  1RI6 A;  3SJL D;  3IJC A;  4ZN4 A;  4JD2 C;  5TDH B;  5IJ8 E;  3PXS D;  3GRE A;  4AEZ A;  2J57 G;  2YNN A;  2GC7 A;  3EI2 B;  5GSA A;  2YNO A;  3EI1 B;  4ZOZ A;  3MKS B;  2CN2 A;  1QNI A;  3J81 g;  3PSL A;  3MZL A;  1R5M A;  3V5W B;  3CFS B;  4HDJ A;  4IA9 A;  1PEV A;  2P9K C;  4QRJ A;  1N6D A;  4E54 A;  3C75 H;  2IUP A;  5C2W B;  3RLM D;  1OMW B;  2P9S C;  5GXH A;  3K26 A;  4KFM B;  2B5M A;  2UZY B;  3JRO A;  1SHY B;  4A7J A;  3RN1 D;  4Z8L A;  2G99 A;  2IWK A;  2HES X;  4J79 A;  3UKU C;  5TEF A;  2OVR B;  5H14 A;  1A0R B;  4ES0 A;  3EI4 A;  5GXI A;  4L9O A;  5C2V B;  4GGD A;  5FKS A;  4FA9 D;  1Q47 A;  2OVP B;  4BL0 A;  3UR4 A;  3I2N A;  3PXT D;  3VH0 A;  4A09 A;  2I0S A;  3EI1 A;  3JRP A;  4QT8 A;  5EMJ B;  3C9C A;  4EWR A;  4E5Z A;  3MKQ A;  4I79 A;  5EMM B;  2CO0 C;  3VGZ A;  4XYH A;  1PBY B;  4XYI A;  2YB8 B;  5FQD A;  3AL8 A;  3SFZ A;  4D6V A;  3V9F A;  3I89 A;  3DM0 A;  4A11 B;  3JB9 L;  2B5N A;  3BG0 A;  3EMH A;  4O1Q D;  3W15 A;  3F3G A;  4A0B A;  1SQJ A;  3RSE C;  4QL1 A;  4CI2 A;  5GMK n;  3FRX A;  3DWL C;  4J0W A;  1TBG A;  3I8E A;  4LGN A;  4J8B A;  1B9X A;  2PM9 B;  3A0F A;  5AFU 3;  4ERQ A;  1GP2 B;  1NEX B;  1XKS A;  5FKT A;  5HE2 B;  3AFC A;  5CXC B;  2OK4 A;  4JSX C;  3EI3 B;  5FA5 B;  5IJ7 E;  5HYN B;  2CN3 A;  5B4W A;  4O45 A;  3SBQ A;  3OKT A;  5FLX g;  2CE9 A;  5EAM A;  3L4O D;  4FA1 D;  2AGX A;  4FHL A;  4FA5 D;  2OVQ B;  3ZWL B;  4QQE A;  4FAN D;  2B5L A;  4E54 B;  3UVN A;  2PM7 B;  4K3J B;  5HE1 B;  2OIZ A;  1FWX A;  3PXW D;  4JT6 C;  2P9I C;  3FM0 A;  4IMM A;  5CXB B;  3N0E A;  3BG1 A;  2Z2N A;  3MZK A;  3OTT A;  4FB1 D;  3I7K A;  4J77 A;  2OJY A;  3I8C A;  4GQ1 A;  3FGB A;  5I5M A;  2Z2P A;  5CYK A;  4PNK B;  3RMZ D;  4O9D A;  4R7A B;  2H6K A;  3EU7 A;  2PM6 B;  5SXM A;  5KDO B;  3IJ0 A;  5EMK B;  2OK6 A;  2YNP A;  5IGQ A;  3UVK A;  5EM2 A;  3PVU B;  3I7H A;  3KRX B;  3I7L A;  5EAL A;  1XHM A;  3DXM C;  4GM8 A;  3B7F A;  2H14 A;  5I5J A;  3SLE D;  1YFQ A;  3DXK C;  3SVW D;  4J84 A;  3EI2 A;  2HYE A;  4GMB A;  2QC5 A;  4K3I D;  3RFG A;  1U4C A;  3SCY A;  2XL2 A;  4A08 B;  3OKY B;  1N6E A;  2HJB A;  4CZY A;  3JZH A;  3SBR A;  2AQ5 A;  4UI9 R;  5K1C C;  1K32 A;  1K8K C;  1MG2 A;  3IJ1 A;  4J0X A;  2HKM A;  2G9A A;  3CFV A;  1L0Q A;  2UZX B;  3CIK B;  2IUQ A;  4CI3 A;  5HE3 B;  2MTA H;  1VYH C;  3AH8 B;  3OL2 B;  4FA4 D;  5A2Q g;  4A0A B;  5FKQ A;  2EBS A;  3EWE A;  5EAR A;  2I3T A;  1JJU B;  1GXR A;  4BUJ C;  1S4U X;  4CI8 A;  4ZOV A;  5IT9 g;  3I7P A;  1MDA H;  3ODT A;  4J86 A;  5EML B;  3E0C A;  3K27 A;  4L3G D;  4H5I A;  2BCJ B;  2HKR A;  4A08 A;  3SWS D;  2CO0 A;  4GGC A;  5FXY A;  5C9Z B;  3PVW B;  3RN0 D;  1N6F A;  4X60 B;  2B4E A;  2CNX A;  4A11 A;  1ERJ A;  3OW8 A;  4U1E I;  2IUR A;  2XU7 A;  4X61 B;  3SN6 B;  5TF2 A;  2AH1 A;  5HE0 B;  2XL3 A;  4OZU A;  4CI1 A;  2Z2O A;  3BWS A;  4O3T B;  4PSX B;  3J80 g;  4TZ4 A;  4CC9 A;  3NVN A;  5H1M A;  5TEE A;  2TRC B;  3SBP A;  2PM9 A;  2H9M A;  3KRW B;  3ULE C;  1P22 A;  3I7N A;  4CZV A;  4AOW A;  4JSP C;  4D0K A;  4MK0 B;  4J81 A;  2BBK H;  3IIW A;  3EI4 B;  2IUV A;  4FWW A;  5CXC A;  1XIP A;  3EI3 A;  3JZN A;  3L4M D;  4PBY A;  3OKW A;  4OWR A;  3ORV D;  2H6Q A;  3IIY A;  1TYQ C;  4CY2 A;  4CY1 A;  4L3H D;  2AH0 A;  1SQ9 A;  4CZX A;  4A09 B;  4PC0 A;  1U2V C;  4N14 A;  2H47 A;  2PBI B;  3U4Y A;  4JXM A;  4JSN C;  2XYI A;  3MMY A;  2H68 A;  4E5Z B;  3UVO A;  4X3E A;  1PI6 A;  3RRM C;  3I7O A; 
#chains in the Genus database with same CATH topology
 4WK4 A;  3ZE0 A;  4GM9 A;  4H5J A;  1TYE A;  2VDP A;  4BCC A;  2J56 H;  3AL8 B;  4JT5 C;  4L1Q D;  4G56 B;  4GZ8 A;  5H17 A;  3RFH A;  2H3X A;  4NBM A;  5CXB A;  2I3S A;  2CE8 A;  2HXC A;  4GGA A;  4A0B B;  2VDK A;  4YVD A;  1NR0 A;  4ZOX A;  1M1X A;  4CY5 A;  3NIG A;  4ERZ A;  4GQB B;  2QXV A;  2IWF A;  4XEI C;  4U7A A;  4Y7R A;  5FKR A;  3QI0 A;  3EQ8 A;  2H9N A;  2I0T A;  4PBZ A;  1JMX B;  3MXX A;  2Q7Q A;  3SMR A;  2IAA A;  5AJA A;  2VDN A;  3JPX A;  4O02 A;  4PSW B;  1JTD B;  1B9Y A;  3DSM A;  3NVQ A;  2P9L C;  4CY3 A;  2W18 A;  4GM3 A;  4Y5R D;  3IJE A;  5HDB A;  1GOT B;  4L1M A;  4DNW A;  3PE7 A;  2O9K A;  2AGL A;  3HFQ A;  1E8N A;  3P4F A;  3SXT D;  4J8G A;  2H6N A;  3IKO A;  3AL9 A;  2WQ8 A;  4NSX A;  3EG6 A;  3N0D A;  1GG2 B;  4QAM A;  5HQG A;  5JWZ A;  3SHF A;  4BH6 A;  3K71 A;  4AN1 A;  2HU8 A;  2HJ4 A;  5AMS A;  4UM8 A;  3GFC A;  5IC7 A;  1PGU A;  4X63 B;  4ERY A;  4FAV D;  2P9U C;  5IGO A;  3UKR C;  2GNQ A;  3JZG A;  3PSC B;  4J78 A;  2AGY A;  4ZOY A;  4LG9 A;  2AGZ A;  3NVX A;  4JSV C;  3IVM A;  2H9P A;  3OKY A;  3VA6 A;  4NC4 A;  5I5I A;  3C99 A;  4J87 A;  4O3U B;  4LG8 A;  2VZ3 A;  1BPO A;  2H9L A;  2AGW A;  3UVM A;  5E6S A;  4A2M A;  1C9L A;  5K19 A;  2YMU A;  3V7D B;  4J73 A;  2GC4 A;  5CYK B;  4GQ2 P;  1JMZ B;  5EAP A;  5M5U A;  2YBA A;  4PXW A;  3F3F A;  2P9N C;  3UVL A;  3F3P A;  3JAM g;  2H13 A;  4DNU A;  1MG3 A;  2VDM A;  5E6R A;  4ESG A;  1H2Y A;  5FFG A;  1JOF A;  3OL2 A;  2VDL A;  4A2L A;  5THA A;  2P9P C;  4A0A A;  2J55 H;  3NIF A;  1OLZ A;  2I0R A;  5EM2 B;  3K72 A;  4J82 A;  3C5M A;  1RI6 A;  3SJL D;  3IJC A;  4ZN4 A;  4JD2 C;  3IUM A;  5TDH B;  3ZDZ A;  5IJ8 E;  1VZ3 A;  3PXS D;  3GRE A;  4AEZ A;  2J57 G;  2QZP A;  2YNN A;  2GC7 A;  1UOQ A;  3EI2 B;  5GSA A;  2YNO A;  4WJK A;  3EI1 B;  4ZOZ A;  3MKS B;  2CN2 A;  1QNI A;  2EIE A;  3J81 g;  3PSL A;  3MZL A;  1R5M A;  3V5W B;  3CFS B;  4HDJ A;  4IA9 A;  1PEV A;  2P9K C;  4QRJ A;  1N6D A;  4E54 A;  4MMY A;  3C75 H;  2IUP A;  5C2W B;  3T3P A;  3RLM D;  1OMW B;  2P9S C;  5GXH A;  3K26 A;  4KFM B;  2B5M A;  2UZY B;  3JRO A;  5C86 A;  1SHY B;  3IUJ A;  3OF7 A;  4A7J A;  3RN1 D;  4Z8L A;  2G99 A;  2IWK A;  2HES X;  4J79 A;  3ZDY A;  5M5S A;  3UKU C;  5TEF A;  3T3M A;  2OVR B;  3RRM C;  5H14 A;  1A0R B;  4ES0 A;  3EI4 A;  5GXI A;  4L9O A;  5C2V B;  4GGD A;  4RE6 A;  1YR2 A;  5FKS A;  3EQ9 A;  1U8C A;  4IRZ A;  4NAA A;  4FA9 D;  1Q47 A;  2OVP B;  4BL0 A;  4RE5 A;  4UM9 A;  3UR4 A;  3I2N A;  3PXT D;  3VH0 A;  1JV2 A;  4A09 A;  2I0S A;  3EI1 A;  3IUR A;  3JRP A;  4QT8 A;  5EMJ B;  3C9C A;  4EWR A;  1C9I A;  2EIB A;  3O4I A;  4E5Z A;  3MKQ A;  4I79 A;  5EMM B;  2CO0 C;  3VGZ A;  4XYH A;  1PBY B;  4XYI A;  2YB8 B;  5FQD A;  4AX4 A;  3AL8 A;  3SFZ A;  1QFS A;  4D6V A;  3V9F A;  3I89 A;  3DM0 A;  4A11 B;  3JB9 L;  2B5N A;  3DDU A;  3BG0 A;  3EMH A;  4O1Q D;  5FFO A;  3W15 A;  3F3G A;  4A0B A;  1SQJ A;  2EIC A;  3RSE C;  2VDR A;  4QL1 A;  4CI2 A;  5GMK n;  1O6F A;  3FRX A;  3DWL C;  2EID A;  4J0W A;  4BP9 A;  3IUL A;  1TBG A;  3I8E A;  4LGN A;  4J8B A;  1B9X A;  2PM9 B;  3A0F A;  5AFU 3;  4ERQ A;  1GP2 B;  1VZ2 A;  1NEX B;  1XKS A;  5FKT A;  5HE2 B;  3AFC A;  5CXC B;  2OK4 A;  1UOP A;  4JSX C;  4WK2 A;  3EI3 B;  1GOG A;  5FA5 B;  5IJ7 E;  2VDO A;  2CN3 A;  5B4W A;  5HYN B;  4O45 A;  3SBQ A;  3OKT A;  5FLX g;  1GOF A;  2CE9 A;  5EAM A;  3L4O D;  4FA1 D;  2AGX A;  4FHL A;  1E8M A;  4FA5 D;  2OVQ B;  3ZWL B;  4QQE A;  4FAN D;  2B5L A;  4E54 B;  5E6U A;  3UVN A;  2PM7 B;  4K3J B;  5HE1 B;  2OIZ A;  4MMZ A;  1FWX A;  3PXW D;  4JT6 C;  2P9I C;  3NID A;  3FM0 A;  4O2W A;  4IMM A;  2JKX A;  5CXB B;  5C92 A;  3N0E A;  3BG1 A;  2Z2N A;  3MUO A;  5M5T A;  3MZK A;  3OTT A;  4FB1 D;  3I7K A;  4J77 A;  1QFM A;  3FCS A;  3VI3 A;  5M5V A;  2OJY A;  2HU7 A;  3I8C A;  4GQ1 A;  3V4P A;  4JHP C;  3FGB A;  5I5M A;  2Z2P A;  1GOH A;  4G55 A;  5CYK A;  4PNK B;  3RMZ D;  4O9D A;  4Z7Q A;  4R7A B;  2H6K A;  3EU7 A;  2PM6 B;  5SXM A;  5KDO B;  3IJ0 A;  5EMK B;  3FCU A;  2OK6 A;  2YNP A;  5IGQ A;  1H2X A;  3UVK A;  3K6S A;  5EM2 A;  4Z7N A;  3PVU B;  3I7H A;  1A12 A;  3KRX B;  3I7L A;  3MVD K;  3GC3 B;  3O4J A;  5EAL A;  1XHM A;  3DXM C;  4GM8 A;  3O4G A;  4D9S A;  1H2W A;  3B7F A;  2H14 A;  5I5J A;  3SLE D;  1YFQ A;  3DXK C;  3SVW D;  4J84 A;  3EI2 A;  1L5G A;  2HYE A;  4GMB A;  2QC5 A;  2XDW A;  4K3I D;  3RFG A;  1U4C A;  3SCY A;  2XL2 A;  4A08 B;  3OKY B;  3VI4 A;  1N6E A;  2HJB A;  4CZY A;  3JZH A;  3SBR A;  2AQ5 A;  4UI9 R;  5K1C C;  1K32 A;  1K8K C;  3EQ7 A;  1MG2 A;  3IJ1 A;  3KCI A;  3MUN A;  4J0X A;  2QR5 A;  2HKM A;  2G9A A;  3CFV A;  4WK0 A;  1L0Q A;  2UZX B;  3CIK B;  4DNV A;  2IUQ A;  1O6G A;  4CI3 A;  2XE4 A;  5HE3 B;  2MTA H;  2VDQ A;  4Z7O A;  1VYH C;  3AH8 B;  3OL2 B;  4FA4 D;  5A2Q g;  4A0A B;  1H2Z A;  5FKQ A;  4MMX A;  2EBS A;  2BKL A;  3EWE A;  3QHY B;  5EAR A;  2I3T A;  1JJU B;  1GXR A;  4BUJ C;  1S4U X;  5M5R A;  4CI8 A;  4ZOV A;  5IT9 g;  3I7P A;  3ZE1 A;  3ZE2 A;  4AMZ A;  3O4H A;  5M61 A;  1MDA H;  2VZ1 A;  1E5T A;  1I2M B;  3ODT A;  4J86 A;  5EML B;  3E0C A;  3GD1 I;  3K27 A;  4L3G D;  4AN0 A;  4H5I A;  2BCJ B;  2HKR A;  4A08 A;  3SWS D;  4BCD A;  4BCB A;  2CO0 A;  4GGC A;  5FXY A;  5C9Z B;  3PVW B;  3RN0 D;  4JHN A;  1N6F A;  4G1E A;  4X60 B;  2B4E A;  2CNX A;  1UOO A;  4BP8 A;  4A11 A;  1ERJ A;  3IUN A;  3OW8 A;  4U1E I;  2IUR A;  2XU7 A;  4X61 B;  3SN6 B;  5TF2 A;  2AH1 A;  5HE0 B;  2XL3 A;  4OZU A;  4CI1 A;  2Z2O A;  1UTC A;  3BWS A;  4O3T B;  2HU5 A;  4PSX B;  3ZDX A;  3J80 g;  4TZ4 A;  4CC9 A;  3NVN A;  5H1M A;  5TEE A;  2TRC B;  3SBP A;  1T2X A;  2PM9 A;  2H9M A;  1VE7 A;  3KRW B;  3ULE C;  1P22 A;  3I7N A;  4CZV A;  4AOW A;  4JSP C;  4D0K A;  3V4V A;  4MK0 B;  1VE6 A;  4J81 A;  2BBK H;  3IIW A;  3EI4 B;  2IUV A;  4FWW A;  5CXC A;  1XIP A;  3EI3 A;  3JZN A;  3L4M D;  2XZG A;  4PBY A;  3OKW A;  4OWR A;  3ORV D;  2H6Q A;  3IIY A;  1TYQ C;  4CY2 A;  4CY1 A;  4L3H D;  2AH0 A;  1SQ9 A;  4CZX A;  4A09 B;  4PC0 A;  1U2V C;  4N14 A;  2H47 A;  2PBI B;  2VC2 A;  4AMY A;  3U4Y A;  4JXM A;  4G1M A;  3IUQ A;  4JSN C;  2XYI A;  3MMY A;  1K3I A;  2H68 A;  4E5Z B;  3UVO A;  4X3E A;  1PI6 A;  4NEN A;  3I7O A; 
#chains in the Genus database with same CATH homology
 4GM9 A;  4H5J A;  2J56 H;  3AL8 B;  4JT5 C;  4L1Q D;  4G56 B;  4GZ8 A;  5H17 A;  3RFH A;  2H3X A;  5CXB A;  2I3S A;  2CE8 A;  2HXC A;  4GGA A;  4A0B B;  4YVD A;  1NR0 A;  4ZOX A;  4CY5 A;  4ERZ A;  4GQB B;  2QXV A;  2IWF A;  4XEI C;  4U7A A;  4Y7R A;  5FKR A;  2H9N A;  2I0T A;  4PBZ A;  1JMX B;  3MXX A;  2Q7Q A;  3SMR A;  2IAA A;  5AJA A;  3JPX A;  4PSW B;  1B9Y A;  3DSM A;  3NVQ A;  2P9L C;  4CY3 A;  2W18 A;  4GM3 A;  4Y5R D;  1GOT B;  3PE7 A;  2O9K A;  2AGL A;  3HFQ A;  3P4F A;  3SXT D;  4J8G A;  2H6N A;  3IKO A;  3AL9 A;  4NSX A;  3EG6 A;  3N0D A;  1GG2 B;  5HQG A;  5JWZ A;  3SHF A;  4BH6 A;  2HJ4 A;  5AMS A;  3GFC A;  5IC7 A;  1PGU A;  4X63 B;  4ERY A;  4FAV D;  2P9U C;  5IGO A;  3UKR C;  2GNQ A;  3JZG A;  3PSC B;  4J78 A;  2AGY A;  4ZOY A;  4LG9 A;  2AGZ A;  3NVX A;  4JSV C;  2H9P A;  3OKY A;  3VA6 A;  5I5I A;  3C99 A;  4J87 A;  4O3U B;  4LG8 A;  2H9L A;  2AGW A;  3UVM A;  4A2M A;  5K19 A;  2YMU A;  3V7D B;  4J73 A;  2GC4 A;  5CYK B;  4GQ2 P;  1JMZ B;  5EAP A;  2YBA A;  4PXW A;  3F3F A;  2P9N C;  3UVL A;  3F3P A;  3JAM g;  2H13 A;  1MG3 A;  4ESG A;  1JOF A;  3OL2 A;  4A2L A;  5THA A;  2P9P C;  4A0A A;  2J55 H;  1OLZ A;  2I0R A;  5EM2 B;  4J82 A;  3C5M A;  1RI6 A;  3SJL D;  3IJC A;  4ZN4 A;  4JD2 C;  5TDH B;  5IJ8 E;  3PXS D;  3GRE A;  4AEZ A;  2J57 G;  2YNN A;  2GC7 A;  3EI2 B;  5GSA A;  2YNO A;  3EI1 B;  4ZOZ A;  3MKS B;  2CN2 A;  1QNI A;  3J81 g;  3PSL A;  3MZL A;  1R5M A;  3V5W B;  3CFS B;  4HDJ A;  4IA9 A;  1PEV A;  2P9K C;  4QRJ A;  1N6D A;  4E54 A;  3C75 H;  2IUP A;  5C2W B;  3RLM D;  1OMW B;  2P9S C;  5GXH A;  3K26 A;  4KFM B;  2B5M A;  2UZY B;  3JRO A;  1SHY B;  4A7J A;  3RN1 D;  4Z8L A;  2G99 A;  2IWK A;  2HES X;  4J79 A;  3UKU C;  5TEF A;  2OVR B;  5H14 A;  1A0R B;  4ES0 A;  3EI4 A;  5GXI A;  4L9O A;  5C2V B;  4GGD A;  5FKS A;  4FA9 D;  1Q47 A;  2OVP B;  4BL0 A;  3UR4 A;  3I2N A;  3PXT D;  3VH0 A;  4A09 A;  2I0S A;  3EI1 A;  3JRP A;  4QT8 A;  5EMJ B;  3C9C A;  4EWR A;  4E5Z A;  3MKQ A;  4I79 A;  5EMM B;  2CO0 C;  3VGZ A;  4XYH A;  1PBY B;  4XYI A;  2YB8 B;  5FQD A;  3AL8 A;  3SFZ A;  4D6V A;  3V9F A;  3I89 A;  3DM0 A;  4A11 B;  3JB9 L;  2B5N A;  3BG0 A;  3EMH A;  4O1Q D;  3W15 A;  3F3G A;  4A0B A;  1SQJ A;  3RSE C;  4QL1 A;  4CI2 A;  5GMK n;  3FRX A;  3DWL C;  4J0W A;  1TBG A;  3I8E A;  4LGN A;  4J8B A;  1B9X A;  2PM9 B;  3A0F A;  5AFU 3;  4ERQ A;  1GP2 B;  1NEX B;  1XKS A;  5FKT A;  5HE2 B;  3AFC A;  5CXC B;  2OK4 A;  4JSX C;  3EI3 B;  5FA5 B;  5IJ7 E;  5HYN B;  2CN3 A;  5B4W A;  4O45 A;  3SBQ A;  3OKT A;  5FLX g;  2CE9 A;  5EAM A;  3L4O D;  4FA1 D;  2AGX A;  4FHL A;  4FA5 D;  2OVQ B;  3ZWL B;  4QQE A;  4FAN D;  2B5L A;  4E54 B;  3UVN A;  2PM7 B;  4K3J B;  5HE1 B;  2OIZ A;  1FWX A;  3PXW D;  4JT6 C;  2P9I C;  3FM0 A;  4IMM A;  5CXB B;  3N0E A;  3BG1 A;  2Z2N A;  3MZK A;  3OTT A;  4FB1 D;  3I7K A;  4J77 A;  2OJY A;  3I8C A;  4GQ1 A;  3FGB A;  5I5M A;  2Z2P A;  5CYK A;  4PNK B;  3RMZ D;  4O9D A;  4R7A B;  2H6K A;  3EU7 A;  2PM6 B;  5SXM A;  5KDO B;  3IJ0 A;  5EMK B;  2OK6 A;  2YNP A;  5IGQ A;  3UVK A;  5EM2 A;  3PVU B;  3I7H A;  3KRX B;  3I7L A;  5EAL A;  1XHM A;  3DXM C;  4GM8 A;  3B7F A;  2H14 A;  5I5J A;  3SLE D;  1YFQ A;  3DXK C;  3SVW D;  4J84 A;  3EI2 A;  2HYE A;  4GMB A;  2QC5 A;  4K3I D;  3RFG A;  1U4C A;  3SCY A;  2XL2 A;  4A08 B;  3OKY B;  1N6E A;  2HJB A;  4CZY A;  3JZH A;  3SBR A;  2AQ5 A;  4UI9 R;  5K1C C;  1K32 A;  1K8K C;  1MG2 A;  3IJ1 A;  4J0X A;  2HKM A;  2G9A A;  3CFV A;  1L0Q A;  2UZX B;  3CIK B;  2IUQ A;  4CI3 A;  5HE3 B;  2MTA H;  1VYH C;  3AH8 B;  3OL2 B;  4FA4 D;  5A2Q g;  4A0A B;  5FKQ A;  2EBS A;  3EWE A;  5EAR A;  2I3T A;  1JJU B;  1GXR A;  4BUJ C;  1S4U X;  4CI8 A;  4ZOV A;  5IT9 g;  3I7P A;  1MDA H;  3ODT A;  4J86 A;  5EML B;  3E0C A;  3K27 A;  4L3G D;  4H5I A;  2BCJ B;  2HKR A;  4A08 A;  3SWS D;  2CO0 A;  4GGC A;  5FXY A;  5C9Z B;  3PVW B;  3RN0 D;  1N6F A;  4X60 B;  2B4E A;  2CNX A;  4A11 A;  1ERJ A;  3OW8 A;  4U1E I;  2IUR A;  2XU7 A;  4X61 B;  3SN6 B;  5TF2 A;  2AH1 A;  5HE0 B;  2XL3 A;  4OZU A;  4CI1 A;  2Z2O A;  3BWS A;  4O3T B;  4PSX B;  3J80 g;  4TZ4 A;  4CC9 A;  3NVN A;  5H1M A;  5TEE A;  2TRC B;  3SBP A;  2PM9 A;  2H9M A;  3KRW B;  3ULE C;  1P22 A;  3I7N A;  4CZV A;  4AOW A;  4JSP C;  4D0K A;  4MK0 B;  4J81 A;  2BBK H;  3IIW A;  3EI4 B;  2IUV A;  4FWW A;  5CXC A;  1XIP A;  3EI3 A;  3JZN A;  3L4M D;  4PBY A;  3OKW A;  4OWR A;  3ORV D;  2H6Q A;  3IIY A;  1TYQ C;  4CY2 A;  4CY1 A;  4L3H D;  2AH0 A;  1SQ9 A;  4CZX A;  4A09 B;  4PC0 A;  1U2V C;  4N14 A;  2H47 A;  2PBI B;  3U4Y A;  4JXM A;  4JSN C;  2XYI A;  3MMY A;  2H68 A;  4E5Z B;  3UVO A;  4X3E A;  1PI6 A;  3RRM C;  3I7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...