2YBAA

Crystal structure of nurf55 in complex with histone h3
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
407
structure length
390
Chain Sequence
AESFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTKQDGKDYSVHRLILGTHTSDEQNHLLIASVQLPSSHYDNVCGKIEIEIKINHEGEVNRARYMPQNACVIATKTPSSDVLVFDYTKHPSKPEPSGECQPDLRLRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWDTRNNNTSKPSHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSTEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENVYND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE HISTONE-BINDING PROTEIN CAF1
publication title Histone Methylation by Prc2 is Inhibited by Active Chromatin Marks
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
total genus 102
structure length 390
sequence length 407
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ybaA00
1GXRA 1SQJA 4JSPC 1PI6A 3UKRC 2OVPB 4GQBB 2HKMA 1JOFA 3NVXA 2BBKH 4GQ2P 3KRWB 2OK4A 5EM2B 3RN0D 4EWRA 2OJYA 4L3GD 1XHMA 4JD2C 2IUVA 4A09B 3B7FA 5TEEA 4CI8A 4A0AA 1JMXB 3PXTD 3C99A 2Z2PA 4D6VA 4H5JA 3JROA 2IUPA 4O3TB 4J81A 4JSXC 5HE3B 3I7PA 1U2VC 2BCJB 2CE9A 3RRMC 5FQDA 5IC7A 3AL9A 2H6NA 2H6KA 1GOTB 4QRJA 5IJ8E 3P4FA 1PEVA 4PBYA 3RLMD 4E54A 3ORVD 4GGCA 4A09A 3IKOA 5HE0B 4A08A 4FWWA 5I5IA 3I7KA 4LG9A 4ZOVA 5HE2B 5HE1B 3ODTA 4MK0B 3F3FA 4FA5D 3IJCA 4PSXB 5EALA 4GM8A 5HQGA 5C2WB 3L4MD 4R7AB 5EMMB 1YFQA 3JRPA 3MZLA 4A2MA 5TDHB 2IURA 1GP2B 4OZUA 4J79A 3PXSD 2O9KA 2HJBA 3C5MA 3I7HA 3MXXA 4FAVD 2HYEA 3CFVA 4GGDA 3BWSA 3I2NA 3SN6B 2H9PA 4J82A 1SQ9A 3OKYA 3EU7A 2UZYB 2XL2A 4A11A 2B5LA 4U7AA 4A0BB 5SXMA 3RMZD 2AH1A 2PM7B 3PSLA 5GXHA 4A2LA 2TRCB 3OTTA 4CZXA 2YBAA 5A2Qg 3UKUC 3IJ1A 1PBYB 3EI3A 2H13A 2H9NA 4TZ4A 5K1CC 2GNQA 2Z2OA 2IWFA 5H1MA 5FXYA 2YMUA 3I89A 4J84A 4ERZA 2XYIA 3VA6A 2P9KC 4A0BA 3I7OA 3SXTD 3EI2A 3MKQA 2IWKA 1P22A 2EBSA 3V5WB 3N0EA 4ERYA 3UVKA 2I3SA 5AMSA 5FLXg 2GC4A 4FHLA 4PBZA 2H9MA 4N14A 4GM9A 2HJ4A 3EWEA 3C9CA 2GC7A 2QXVA 1NEXB 3SBPA 2CN2A 4E54B 4X61B 1N6DA 2AGXA 2AGYA 3AL8A 3VGZA 4A08B 4O3UB 2P9PC 2B5NA 3SBQA 4L1QD 4JT5C 3OKTA 3RFHA 4CI3A 2P9IC 3UVNA 5FKQA 3JB9L 4ERQA 2Q7QA 2W18A 2YNOA 4FB1D 2AQ5A 3EI4A 4L9OA 4Y7RA 3SVWD 3MZKA 3DWLC 2CE8A 5IT9g 2OVRB 2OIZA 3I7NA 4UI9R 3CFSB 5CYKA 4CI1A 3F3PA 1L0QA 5CXBA 5C9ZB 2P9UC 5AFU3 4H5IA 4JSVC 2PM6B 2G99A 3I8CA 4XEIC 3OKYB 3SCYA 4A11B 4ZOYA 1NR0A 5EMKB 4PNKB 3RFGA 5IGOA 5IJ7E 1PGUA 1N6FA 3K26A 2I0SA 2P9NC 5EARA 4LG8A 5I5JA 2IUQA 4Y5RD 3EI3B 2CO0A 2I0RA 2I3TA 3OW8A 2P9LC 5GXIA 3AH8B 4FA4D 4AEZA 4FAND 1MG3A 2J57G 4BL0A 1B9YA 3PSCB 4CI2A 4PXWA 1QNIA 3GFCA 4J8BA 3FGBA 3EI2B 3I7LA 2P9SC 3ZWLB 1N6EA 3EG6A 5FA5B 5IGQA 1MDAH 5THAA 2J55H 4IMMA 4IA9A 3V7DB 3EI1B 3UVLA 1JMZB 4X63B 4X60B 3J80g 4J87A 2H47A 4ESGA 2PBIB 3OL2A 4K3ID 5AJAA 2OK6A 4BH6A 4I79A 3AL8B 3ULEC 4BUJC 2B4EA 3DSMA 1JJUB 4J73A 4J86A 1R5MA 4LGNA 3EI1A 3NVNA 1OMWB 2I0TA 1OLZA 2YNPA 4QT8A 5FKSA 5C2VB 4L3HD 4GM3A 4J78A 4PSWB 3DM0A 1K8KC 1VYHC 4O45A 3J81g 3EI4B 4XYIA 4CY2A 3F3GA 3IJ0A 4K3JB 5TF2A 5I5MA 5H17A 4XYHA 4G56B 3FRXA 4GZ8A 2CNXA 5CYKB 3PVWB 2XL3A 4ES0A 3JZHA 3AFCA 1GG2B 3W15A 4CC9A 2UZXB 5CXBB 5KDOB 4J8GA 2IAAA 1S4UX 3UVOA 3I8EA 4JT6C 3BG0A 1TYQC 2PM9A 3JZGA 1RI6A 4J77A 4GMBA 2G9AA 2J56H 2AH0A 4QQEA 3JAMg 1SHYB 2H14A 3OKWA 4KFMB 5CXCB 3DXMC 5HYNB 4O9DA 4ZOZA 2CO0C 3C75H 1K32A 3DXKC 2H3XA 3L4OD 2MTAH 3PXWD 4D0KA 2AGWA 4J0XA 2HKRA 3HFQA 2B5MA 5EM2A 4O1QD 3N0DA 3VH0A 1U4CA 3SHFA 4X3EA 4FA9D 4E5ZB 2AGLA 4OWRA 1ERJA 4YVDA 2CN3A 4CY1A 4GQ1A 4A7JA 5GSAA 5CXCA 4FA1D 2QC5A 2YB8B 1B9XA 3PE7A 4PC0A 1XIPA 4NSXA 3JZNA 5GMKn 4U1EI 4QL1A 3OL2B 5JWZA 2XU7A 2H6QA 2OVQB 3PVUB 5FKTA 2HXCA 5TEFA 3CIKB 3RN1D 4E5ZA 1XKSA 3K27A 3MMYA 3SJLD 4J0WA 3NVQA 4CZYA 5EMLB 3RSEC 5EAPA 3A0FA 3UVMA 3SMRA 3E0CA 3JPXA 5B4WA 3BG1A 1MG2A 4CY5A 5EMJB 5H14A 3EMHA 2YNNA 2Z2NA 3MKSB 3U4YA 4JXMA 4ZOXA 4GGAA 2AGZA 5FKRA 4JSNC 3IIYA 4CY3A 3GREA 3SBRA 1Q47A 4HDJA 1A0RB 3IIWA 2PM9B 2H9LA 3FM0A 3SLED 3KRXB 5K19A 3UR4A 4AOWA 2H68A 2HESX 4A0AB 3SFZA 1FWXA 4ZN4A 3SWSD 1TBGA 4Z8LA 4CZVA 5EAMA 3V9FA
chains in the Genus database with same CATH superfamily
1GXRA 1SQJA 4JSPC 1PI6A 1H2XA 1JV2A 3UKRC 2HU5A 2OVPB 4GQBB 2HKMA 1JOFA 3NVXA 2BBKH 4GQ2P 3KRWB 2OK4A 3EQ8A 5M61A 3RN0D 4EWRA 5EM2B 3MUNA 4QAMA 2OJYA 4L3GD 1XHMA 4JD2C 3IUMA 3K6SA 2IUVA 4A09B 3B7FA 5TEEA 4CI8A 4A0AA 3ZDXA 1JMXB 1O6FA 3PXTD 4AN0A 3C99A 4AN1A 2Z2PA 4DNVA 4D6VA 4H5JA 3JROA 2IUPA 4O3TB 4J81A 4JSXC 5HE3B 4AMYA 3I7PA 1U2VC 2BCJB 2CE9A 2XZGA 3RRMC 2QZPA 5FQDA 5IC7A 3NIDA 1H2ZA 3AL9A 2H6NA 2H6KA 4G1MA 1GOTB 2VDRA 4QRJA 1E8MA 5C86A 3P4FA 5IJ8E 1PEVA 3ZE2A 4PBYA 3RLMD 4E54A 1K3IA 3ORVD 4JHPC 4GGCA 4A09A 3IKOA 5HE0B 4A08A 4FWWA 5I5IA 3I7KA 1QFSA 5M5VA 4LG9A 4ZOVA 5HE2B 3IVMA 5HE1B 3ODTA 3MVDK 4MK0B 3F3FA 4FA5D 3IJCA 4PSXB 5EALA 4GM8A 5HQGA 4BCCA 5C2WB 3L4MD 4R7AB 1UOQA 1YFQA 5EMMB 3JRPA 3MZLA 4A2MA 5TDHB 2IURA 1GP2B 4OZUA 4J79A 3PXSD 2O9KA 2XDWA 3ZDZA 2HJBA 3C5MA 3I7HA 3MXXA 4FAVD 5M5SA 3CFVA 4GGDA 3FCUA 3O4IA 2HYEA 4MMZA 3BWSA 4BP8A 3I2NA 3SN6B 2H9PA 4J82A 1SQ9A 3OKYA 3EU7A 2UZYB 2XL2A 4A11A 2B5LA 4U7AA 4A0BB 5SXMA 3RMZD 2AH1A 2PM7B 4MMXA 3PSLA 5GXHA 3FCSA 4A2LA 2TRCB 3OTTA 4CZXA 2YBAA 5A2Qg 3UKUC 3IJ1A 1PBYB 3EI3A 2H13A 2H9NA 4TZ4A 5K1CC 2GNQA 4WK0A 4NBMA 2Z2OA 2IWFA 3ZDYA 5H1MA 5FXYA 2YMUA 3I89A 4J84A 4JHNA 3NIGA 4ERZA 2XYIA 3VA6A 2P9KC 4A0BA 3I7OA 3SXTD 3EI2A 2HU8A 3MKQA 4AMZA 2IWKA 1P22A 4DNWA 2EBSA 3V5WB 3N0EA 4ERYA 3UVKA 2I3SA 5AMSA 5FLXg 2GC4A 4FHLA 4PBZA 2H9MA 1UTCA 4N14A 3DDUA 4GM9A 2HJ4A 3EWEA 4O2WA 3C9CA 4UM9A 2GC7A 2QXVA 1NEXB 3SBPA 2CN2A 4E54B 1E8NA 4X61B 1N6DA 2AGXA 2AGYA 3AL8A 3VGZA 4A08B 4O3UB 2P9PC 2B5NA 3SBQA 3IUNA 4L1QD 4JT5C 3OKTA 4Z7OA 3RFHA 5M5TA 4CI3A 2P9IC 4UM8A 3UVNA 5FKQA 2VZ3A 3T3MA 3JB9L 4ERQA 2Q7QA 3K71A 2W18A 1GOFA 2YNOA 1H2WA 3EQ9A 2VDPA 4FB1D 2AQ5A 3EI4A 3GC3B 5C92A 4L9OA 4Y7RA 3SVWD 3MZKA 3IULA 4DNUA 3DWLC 2CE8A 5M5RA 5IT9g 2OVRB 2OIZA 3I7NA 4UI9R 3CFSB 5CYKA 4CI1A 3F3PA 3O4JA 1L0QA 5CXBA 5C9ZB 4WJKA 2P9UC 5AFU3 4H5IA 4JSVC 2PM6B 2G99A 3I8CA 4XEIC 3OKYB 3SCYA 3MUOA 4A11B 3IUQA 4ZOYA 4NAAA 1NR0A 5EMKB 4PNKB 3RFGA 5IGOA 4NENA 5IJ7E 1PGUA 1N6FA 3K26A 4O02A 2I0SA 2P9NC 5EARA 4LG8A 4AX4A 5I5JA 1E5TA 2IUQA 4Y5RD 3EI3B 2CO0A 2I0RA 2I3TA 3OW8A 2P9LC 5GXIA 3AH8B 3OF7A 3ZE0A 4FA4D 4AEZA 4WK4A 4FAND 1C9LA 1MG3A 2J57G 1B9YA 4BL0A 3PSCB 4CI2A 2EICA 4PXWA 1QNIA 3GFCA 3O4HA 5FFGA 4J8BA 3FGBA 1U8CA 2WQ8A 3ZE1A 3EI2B 2EIBA 3I7LA 1YR2A 2P9SC 3ZWLB 1N6EA 3EG6A 5FA5B 4RE5A 5IGQA 1MDAH 5THAA 3QI0A 1UOOA 2J55H 4IMMA 3NIFA 4IA9A 3V7DB 5HDBA 2XE4A 3EI1B 3UVLA 1JMZB 1VZ2A 4X63B 4X60B 3J80g 4J87A 2H47A 4Z7QA 4ESGA 2PBIB 3OL2A 4K3ID 5AJAA 3IUJA 2OK6A 4BH6A 4I79A 3AL8B 2EIDA 3ULEC 4BUJC 4Z7NA 2B4EA 3KCIA 3DSMA 4L1MA 1JJUB 3GD1I 4WK2A 4J73A 4J86A 2VC2A 1R5MA 4LGNA 4G55A 3EI1A 1VZ3A 3NVNA 1OMWB 2I0TA 1OLZA 2YNPA 2VDMA 4QT8A 5FKSA 5C2VB 4L3HD 4GM3A 4J78A 4PSWB 3DM0A 1K8KC 1VYHC 4O45A 2VDQA 3J81g 3EI4B 4XYIA 1O6GA 3V4VA 4CY2A 3F3GA 3IJ0A 4K3JB 5TF2A 5I5MA 2VDKA 5H17A 4XYHA 4G56B 3T3PA 4RE6A 3FRXA 4GZ8A 2CNXA 5CYKB 3PVWB 2XL3A 4ES0A 3JZHA 3AFCA 1GG2B 3W15A 4CC9A 2UZXB 5CXBB 5KDOB 4J8GA 2IAAA 1S4UX 3UVOA 3I8EA 4JT6C 3BG0A 1TYQC 2PM9A 3JZGA 1RI6A 4J77A 4GMBA 3QHYB 2G9AA 2J56H 2AH0A 1QFMA 3IJEA 4QQEA 3JAMg 1GOGA 1SHYB 4BCBA 4NC4A 3EQ7A 2H14A 3OKWA 2VZ1A 4KFMB 5CXCB 2JKXA 3DXMC 5HYNB 4O9DA 4ZOZA 2CO0C 3C75H 1K32A 3DXKC 2H3XA 3O4GA 3L4OD 2MTAH 3PXWD 4D0KA 1UOPA 2AGWA 4J0XA 2HKRA 2VDLA 3HFQA 2B5MA 1I2MB 5EM2A 1VE7A 4O1QD 3N0DA 4MMYA 3VH0A 1U4CA 3SHFA 1VE6A 4X3EA 4FA9D 4E5ZB 2EIEA 4BCDA 2AGLA 2QR5A 4OWRA 1ERJA 3VI4A 4YVDA 2CN3A 4CY1A 5M5UA 1H2YA 4GQ1A 4A7JA 5GSAA 5CXCA 4D9SA 2QC5A 2YB8B 4FA1D 1B9XA 3PE7A 2VDNA 4PC0A 1XIPA 4NSXA 3JZNA 5GMKn 4U1EI 4QL1A 3OL2B 5JWZA 2XU7A 2H6QA 2OVQB 3PVUB 5FFOA 5FKTA 1C9IA 2HXCA 1BPOA 5TEFA 3CIKB 2VDOA 3RN1D 4E5ZA 3IURA 3V4PA 1XKSA 3K27A 3MMYA 3SJLD 4J0WA 3NVQA 4CZYA 5EMLB 3RSEC 5E6UA 5EAPA 3A0FA 3UVMA 3SMRA 3E0CA 3JPXA 2HU7A 3BG1A 5B4WA 1MG2A 4CY5A 1M1XA 5EMJB 5H14A 3VI3A 3EMHA 1L5GA 1T2XA 2YNNA 2Z2NA 3MKSB 5E6RA 3U4YA 1A12A 4JXMA 4ZOXA 4GGAA 4G1EA 2AGZA 5FKRA 1GOHA 4JSNC 3IIYA 4CY3A 3GREA 3SBRA 4BP9A 1Q47A 1TYEA 4HDJA 1A0RB 3IIWA 2PM9B 2H9LA 3FM0A 3SLED 3KRXB 5K19A 3UR4A 3K72A 4AOWA 2BKLA 2H68A 2HESX 4IRZA 5E6SA 4A0AB 3SFZA 1FWXA 4ZN4A 3SWSD 1TBGA 4Z8LA 4CZVA 5EAMA 1JTDB 3V9FA
chains in the Genus database with same CATH topology
1GXRA 1SQJA 4JSPC 1PI6A 3UKRC 2OVPB 4GQBB 2HKMA 1JOFA 3NVXA 2BBKH 4GQ2P 3KRWB 2OK4A 5EM2B 3RN0D 4EWRA 2OJYA 4L3GD 1XHMA 4JD2C 2IUVA 4A09B 3B7FA 5TEEA 4CI8A 4A0AA 1JMXB 3PXTD 3C99A 2Z2PA 4D6VA 4H5JA 3JROA 2IUPA 4O3TB 4J81A 4JSXC 5HE3B 3I7PA 1U2VC 2BCJB 2CE9A 3RRMC 5FQDA 5IC7A 3AL9A 2H6NA 2H6KA 1GOTB 4QRJA 5IJ8E 3P4FA 1PEVA 4PBYA 3RLMD 4E54A 3ORVD 4GGCA 4A09A 3IKOA 5HE0B 4A08A 4FWWA 5I5IA 3I7KA 4LG9A 4ZOVA 5HE2B 5HE1B 3ODTA 4MK0B 3F3FA 4FA5D 3IJCA 4PSXB 5EALA 4GM8A 5HQGA 5C2WB 3L4MD 4R7AB 5EMMB 1YFQA 3JRPA 3MZLA 4A2MA 5TDHB 2IURA 1GP2B 4OZUA 4J79A 3PXSD 2O9KA 2HJBA 3C5MA 3I7HA 3MXXA 4FAVD 2HYEA 3CFVA 4GGDA 3BWSA 3I2NA 3SN6B 2H9PA 4J82A 1SQ9A 3OKYA 3EU7A 2UZYB 2XL2A 4A11A 2B5LA 4U7AA 4A0BB 5SXMA 3RMZD 2AH1A 2PM7B 3PSLA 5GXHA 4A2LA 2TRCB 3OTTA 4CZXA 2YBAA 5A2Qg 3UKUC 3IJ1A 1PBYB 3EI3A 2H13A 2H9NA 4TZ4A 5K1CC 2GNQA 2Z2OA 2IWFA 5H1MA 5FXYA 2YMUA 3I89A 4J84A 4ERZA 2XYIA 3VA6A 2P9KC 4A0BA 3I7OA 3SXTD 3EI2A 3MKQA 2IWKA 1P22A 2EBSA 3V5WB 3N0EA 4ERYA 3UVKA 2I3SA 5AMSA 5FLXg 2GC4A 4FHLA 4PBZA 2H9MA 4N14A 4GM9A 2HJ4A 3EWEA 3C9CA 2GC7A 2QXVA 1NEXB 3SBPA 2CN2A 4E54B 4X61B 1N6DA 2AGXA 2AGYA 3AL8A 3VGZA 4A08B 4O3UB 2P9PC 2B5NA 3SBQA 4L1QD 4JT5C 3OKTA 3RFHA 4CI3A 2P9IC 3UVNA 5FKQA 3JB9L 4ERQA 2Q7QA 2W18A 2YNOA 4FB1D 2AQ5A 3EI4A 4L9OA 4Y7RA 3SVWD 3MZKA 3DWLC 2CE8A 5IT9g 2OVRB 2OIZA 3I7NA 4UI9R 3CFSB 5CYKA 4CI1A 3F3PA 1L0QA 5CXBA 5C9ZB 2P9UC 5AFU3 4H5IA 4JSVC 2PM6B 2G99A 3I8CA 4XEIC 3OKYB 3SCYA 4A11B 4ZOYA 1NR0A 5EMKB 4PNKB 3RFGA 5IGOA 5IJ7E 1PGUA 1N6FA 3K26A 2I0SA 2P9NC 5EARA 4LG8A 5I5JA 2IUQA 4Y5RD 3EI3B 2CO0A 2I0RA 2I3TA 3OW8A 2P9LC 5GXIA 3AH8B 4FA4D 4AEZA 4FAND 1MG3A 2J57G 4BL0A 1B9YA 3PSCB 4CI2A 4PXWA 1QNIA 3GFCA 4J8BA 3FGBA 3EI2B 3I7LA 2P9SC 3ZWLB 1N6EA 3EG6A 5FA5B 5IGQA 1MDAH 5THAA 2J55H 4IMMA 4IA9A 3V7DB 3EI1B 3UVLA 1JMZB 4X63B 4X60B 3J80g 4J87A 2H47A 4ESGA 2PBIB 3OL2A 4K3ID 5AJAA 2OK6A 4BH6A 4I79A 3AL8B 3ULEC 4BUJC 2B4EA 3DSMA 1JJUB 4J73A 4J86A 1R5MA 4LGNA 3EI1A 3NVNA 1OMWB 2I0TA 1OLZA 2YNPA 4QT8A 5FKSA 5C2VB 4L3HD 4GM3A 4J78A 4PSWB 3DM0A 1K8KC 1VYHC 4O45A 3J81g 3EI4B 4XYIA 4CY2A 3F3GA 3IJ0A 4K3JB 5TF2A 5I5MA 5H17A 4XYHA 4G56B 3FRXA 4GZ8A 2CNXA 5CYKB 3PVWB 2XL3A 4ES0A 3JZHA 3AFCA 1GG2B 3W15A 4CC9A 2UZXB 5CXBB 5KDOB 4J8GA 2IAAA 1S4UX 3UVOA 3I8EA 4JT6C 3BG0A 1TYQC 2PM9A 3JZGA 1RI6A 4J77A 4GMBA 2G9AA 2J56H 2AH0A 4QQEA 3JAMg 1SHYB 2H14A 3OKWA 4KFMB 5CXCB 3DXMC 5HYNB 4O9DA 4ZOZA 2CO0C 3C75H 1K32A 3DXKC 2H3XA 3L4OD 2MTAH 3PXWD 4D0KA 2AGWA 4J0XA 2HKRA 3HFQA 2B5MA 5EM2A 4O1QD 3N0DA 3VH0A 1U4CA 3SHFA 4X3EA 4FA9D 4E5ZB 2AGLA 4OWRA 1ERJA 4YVDA 2CN3A 4CY1A 4GQ1A 4A7JA 5GSAA 5CXCA 4FA1D 2QC5A 2YB8B 1B9XA 3PE7A 4PC0A 1XIPA 4NSXA 3JZNA 5GMKn 4U1EI 4QL1A 3OL2B 5JWZA 2XU7A 2H6QA 2OVQB 3PVUB 5FKTA 2HXCA 5TEFA 3CIKB 3RN1D 4E5ZA 1XKSA 3K27A 3MMYA 3SJLD 4J0WA 3NVQA 4CZYA 5EMLB 3RSEC 5EAPA 3A0FA 3UVMA 3SMRA 3E0CA 3JPXA 5B4WA 3BG1A 1MG2A 4CY5A 5EMJB 5H14A 3EMHA 2YNNA 2Z2NA 3MKSB 3U4YA 4JXMA 4ZOXA 4GGAA 2AGZA 5FKRA 4JSNC 3IIYA 4CY3A 3GREA 3SBRA 1Q47A 4HDJA 1A0RB 3IIWA 2PM9B 2H9LA 3FM0A 3SLED 3KRXB 5K19A 3UR4A 4AOWA 2H68A 2HESX 4A0AB 3SFZA 1FWXA 4ZN4A 3SWSD 1TBGA 4Z8LA 4CZVA 5EAMA 3V9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GXR A;  1SQJ A;  4JSP C;  1PI6 A;  3UKR C;  2OVP B;  4GQB B;  2HKM A;  1JOF A;  3NVX A;  2BBK H;  4GQ2 P;  3KRW B;  2OK4 A;  5EM2 B;  3RN0 D;  4EWR A;  2OJY A;  4L3G D;  1XHM A;  4JD2 C;  2IUV A;  4A09 B;  3B7F A;  5TEE A;  4CI8 A;  4A0A A;  1JMX B;  3PXT D;  3C99 A;  2Z2P A;  4D6V A;  4H5J A;  3JRO A;  2IUP A;  4O3T B;  4J81 A;  4JSX C;  5HE3 B;  3I7P A;  1U2V C;  2BCJ B;  2CE9 A;  3RRM C;  5FQD A;  5IC7 A;  3AL9 A;  2H6N A;  2H6K A;  1GOT B;  4QRJ A;  5IJ8 E;  3P4F A;  1PEV A;  4PBY A;  3RLM D;  4E54 A;  3ORV D;  4GGC A;  4A09 A;  3IKO A;  5HE0 B;  4A08 A;  4FWW A;  5I5I A;  3I7K A;  4LG9 A;  4ZOV A;  5HE2 B;  5HE1 B;  3ODT A;  4MK0 B;  3F3F A;  4FA5 D;  3IJC A;  4PSX B;  5EAL A;  4GM8 A;  5HQG A;  5C2W B;  3L4M D;  4R7A B;  5EMM B;  1YFQ A;  3JRP A;  3MZL A;  4A2M A;  5TDH B;  2IUR A;  1GP2 B;  4OZU A;  4J79 A;  3PXS D;  2O9K A;  2HJB A;  3C5M A;  3I7H A;  3MXX A;  4FAV D;  2HYE A;  3CFV A;  4GGD A;  3BWS A;  3I2N A;  3SN6 B;  2H9P A;  4J82 A;  1SQ9 A;  3OKY A;  3EU7 A;  2UZY B;  2XL2 A;  4A11 A;  2B5L A;  4U7A A;  4A0B B;  5SXM A;  3RMZ D;  2AH1 A;  2PM7 B;  3PSL A;  5GXH A;  4A2L A;  2TRC B;  3OTT A;  4CZX A;  2YBA A;  5A2Q g;  3UKU C;  3IJ1 A;  1PBY B;  3EI3 A;  2H13 A;  2H9N A;  4TZ4 A;  5K1C C;  2GNQ A;  2Z2O A;  2IWF A;  5H1M A;  5FXY A;  2YMU A;  3I89 A;  4J84 A;  4ERZ A;  2XYI A;  3VA6 A;  2P9K C;  4A0B A;  3I7O A;  3SXT D;  3EI2 A;  3MKQ A;  2IWK A;  1P22 A;  2EBS A;  3V5W B;  3N0E A;  4ERY A;  3UVK A;  2I3S A;  5AMS A;  5FLX g;  2GC4 A;  4FHL A;  4PBZ A;  2H9M A;  4N14 A;  4GM9 A;  2HJ4 A;  3EWE A;  3C9C A;  2GC7 A;  2QXV A;  1NEX B;  3SBP A;  2CN2 A;  4E54 B;  4X61 B;  1N6D A;  2AGX A;  2AGY A;  3AL8 A;  3VGZ A;  4A08 B;  4O3U B;  2P9P C;  2B5N A;  3SBQ A;  4L1Q D;  4JT5 C;  3OKT A;  3RFH A;  4CI3 A;  2P9I C;  3UVN A;  5FKQ A;  3JB9 L;  4ERQ A;  2Q7Q A;  2W18 A;  2YNO A;  4FB1 D;  2AQ5 A;  3EI4 A;  4L9O A;  4Y7R A;  3SVW D;  3MZK A;  3DWL C;  2CE8 A;  5IT9 g;  2OVR B;  2OIZ A;  3I7N A;  4UI9 R;  3CFS B;  5CYK A;  4CI1 A;  3F3P A;  1L0Q A;  5CXB A;  5C9Z B;  2P9U C;  5AFU 3;  4H5I A;  4JSV C;  2PM6 B;  2G99 A;  3I8C A;  4XEI C;  3OKY B;  3SCY A;  4A11 B;  4ZOY A;  1NR0 A;  5EMK B;  4PNK B;  3RFG A;  5IGO A;  5IJ7 E;  1PGU A;  1N6F A;  3K26 A;  2I0S A;  2P9N C;  5EAR A;  4LG8 A;  5I5J A;  2IUQ A;  4Y5R D;  3EI3 B;  2CO0 A;  2I0R A;  2I3T A;  3OW8 A;  2P9L C;  5GXI A;  3AH8 B;  4FA4 D;  4AEZ A;  4FAN D;  1MG3 A;  2J57 G;  4BL0 A;  1B9Y A;  3PSC B;  4CI2 A;  4PXW A;  1QNI A;  3GFC A;  4J8B A;  3FGB A;  3EI2 B;  3I7L A;  2P9S C;  3ZWL B;  1N6E A;  3EG6 A;  5FA5 B;  5IGQ A;  1MDA H;  5THA A;  2J55 H;  4IMM A;  4IA9 A;  3V7D B;  3EI1 B;  3UVL A;  1JMZ B;  4X63 B;  4X60 B;  3J80 g;  4J87 A;  2H47 A;  4ESG A;  2PBI B;  3OL2 A;  4K3I D;  5AJA A;  2OK6 A;  4BH6 A;  4I79 A;  3AL8 B;  3ULE C;  4BUJ C;  2B4E A;  3DSM A;  1JJU B;  4J73 A;  4J86 A;  1R5M A;  4LGN A;  3EI1 A;  3NVN A;  1OMW B;  2I0T A;  1OLZ A;  2YNP A;  4QT8 A;  5FKS A;  5C2V B;  4L3H D;  4GM3 A;  4J78 A;  4PSW B;  3DM0 A;  1K8K C;  1VYH C;  4O45 A;  3J81 g;  3EI4 B;  4XYI A;  4CY2 A;  3F3G A;  3IJ0 A;  4K3J B;  5TF2 A;  5I5M A;  5H17 A;  4XYH A;  4G56 B;  3FRX A;  4GZ8 A;  2CNX A;  5CYK B;  3PVW B;  2XL3 A;  4ES0 A;  3JZH A;  3AFC A;  1GG2 B;  3W15 A;  4CC9 A;  2UZX B;  5CXB B;  5KDO B;  4J8G A;  2IAA A;  1S4U X;  3UVO A;  3I8E A;  4JT6 C;  3BG0 A;  1TYQ C;  2PM9 A;  3JZG A;  1RI6 A;  4J77 A;  4GMB A;  2G9A A;  2J56 H;  2AH0 A;  4QQE A;  3JAM g;  1SHY B;  2H14 A;  3OKW A;  4KFM B;  5CXC B;  3DXM C;  5HYN B;  4O9D A;  4ZOZ A;  2CO0 C;  3C75 H;  1K32 A;  3DXK C;  2H3X A;  3L4O D;  2MTA H;  3PXW D;  4D0K A;  2AGW A;  4J0X A;  2HKR A;  3HFQ A;  2B5M A;  5EM2 A;  4O1Q D;  3N0D A;  3VH0 A;  1U4C A;  3SHF A;  4X3E A;  4FA9 D;  4E5Z B;  2AGL A;  4OWR A;  1ERJ A;  4YVD A;  2CN3 A;  4CY1 A;  4GQ1 A;  4A7J A;  5GSA A;  5CXC A;  4FA1 D;  2QC5 A;  2YB8 B;  1B9X A;  3PE7 A;  4PC0 A;  1XIP A;  4NSX A;  3JZN A;  5GMK n;  4U1E I;  4QL1 A;  3OL2 B;  5JWZ A;  2XU7 A;  2H6Q A;  2OVQ B;  3PVU B;  5FKT A;  2HXC A;  5TEF A;  3CIK B;  3RN1 D;  4E5Z A;  1XKS A;  3K27 A;  3MMY A;  3SJL D;  4J0W A;  3NVQ A;  4CZY A;  5EML B;  3RSE C;  5EAP A;  3A0F A;  3UVM A;  3SMR A;  3E0C A;  3JPX A;  5B4W A;  3BG1 A;  1MG2 A;  4CY5 A;  5EMJ B;  5H14 A;  3EMH A;  2YNN A;  2Z2N A;  3MKS B;  3U4Y A;  4JXM A;  4ZOX A;  4GGA A;  2AGZ A;  5FKR A;  4JSN C;  3IIY A;  4CY3 A;  3GRE A;  3SBR A;  1Q47 A;  4HDJ A;  1A0R B;  3IIW A;  2PM9 B;  2H9L A;  3FM0 A;  3SLE D;  3KRX B;  5K19 A;  3UR4 A;  4AOW A;  2H68 A;  2HES X;  4A0A B;  3SFZ A;  1FWX A;  4ZN4 A;  3SWS D;  1TBG A;  4Z8L A;  4CZV A;  5EAM A;  3V9F A; 
#chains in the Genus database with same CATH topology
 1GXR A;  1SQJ A;  4JSP C;  1PI6 A;  1H2X A;  1JV2 A;  3UKR C;  2HU5 A;  2OVP B;  4GQB B;  2HKM A;  1JOF A;  3NVX A;  2BBK H;  4GQ2 P;  3KRW B;  2OK4 A;  3EQ8 A;  5M61 A;  3RN0 D;  4EWR A;  5EM2 B;  3MUN A;  4QAM A;  2OJY A;  4L3G D;  1XHM A;  4JD2 C;  3IUM A;  3K6S A;  2IUV A;  4A09 B;  3B7F A;  5TEE A;  4CI8 A;  4A0A A;  3ZDX A;  1JMX B;  1O6F A;  3PXT D;  4AN0 A;  3C99 A;  4AN1 A;  2Z2P A;  4DNV A;  4D6V A;  4H5J A;  3JRO A;  2IUP A;  4O3T B;  4J81 A;  4JSX C;  5HE3 B;  4AMY A;  3I7P A;  1U2V C;  2BCJ B;  2CE9 A;  2XZG A;  3RRM C;  2QZP A;  5FQD A;  5IC7 A;  3NID A;  1H2Z A;  3AL9 A;  2H6N A;  2H6K A;  4G1M A;  1GOT B;  2VDR A;  4QRJ A;  1E8M A;  5C86 A;  3P4F A;  5IJ8 E;  1PEV A;  3ZE2 A;  4PBY A;  3RLM D;  4E54 A;  1K3I A;  3ORV D;  4JHP C;  4GGC A;  4A09 A;  3IKO A;  5HE0 B;  4A08 A;  4FWW A;  5I5I A;  3I7K A;  1QFS A;  5M5V A;  4LG9 A;  4ZOV A;  5HE2 B;  3IVM A;  5HE1 B;  3ODT A;  3MVD K;  4MK0 B;  3F3F A;  4FA5 D;  3IJC A;  4PSX B;  5EAL A;  4GM8 A;  5HQG A;  4BCC A;  5C2W B;  3L4M D;  4R7A B;  1UOQ A;  1YFQ A;  5EMM B;  3JRP A;  3MZL A;  4A2M A;  5TDH B;  2IUR A;  1GP2 B;  4OZU A;  4J79 A;  3PXS D;  2O9K A;  2XDW A;  3ZDZ A;  2HJB A;  3C5M A;  3I7H A;  3MXX A;  4FAV D;  5M5S A;  3CFV A;  4GGD A;  3FCU A;  3O4I A;  2HYE A;  4MMZ A;  3BWS A;  4BP8 A;  3I2N A;  3SN6 B;  2H9P A;  4J82 A;  1SQ9 A;  3OKY A;  3EU7 A;  2UZY B;  2XL2 A;  4A11 A;  2B5L A;  4U7A A;  4A0B B;  5SXM A;  3RMZ D;  2AH1 A;  2PM7 B;  4MMX A;  3PSL A;  5GXH A;  3FCS A;  4A2L A;  2TRC B;  3OTT A;  4CZX A;  2YBA A;  5A2Q g;  3UKU C;  3IJ1 A;  1PBY B;  3EI3 A;  2H13 A;  2H9N A;  4TZ4 A;  5K1C C;  2GNQ A;  4WK0 A;  4NBM A;  2Z2O A;  2IWF A;  3ZDY A;  5H1M A;  5FXY A;  2YMU A;  3I89 A;  4J84 A;  4JHN A;  3NIG A;  4ERZ A;  2XYI A;  3VA6 A;  2P9K C;  4A0B A;  3I7O A;  3SXT D;  3EI2 A;  2HU8 A;  3MKQ A;  4AMZ A;  2IWK A;  1P22 A;  4DNW A;  2EBS A;  3V5W B;  3N0E A;  4ERY A;  3UVK A;  2I3S A;  5AMS A;  5FLX g;  2GC4 A;  4FHL A;  4PBZ A;  2H9M A;  1UTC A;  4N14 A;  3DDU A;  4GM9 A;  2HJ4 A;  3EWE A;  4O2W A;  3C9C A;  4UM9 A;  2GC7 A;  2QXV A;  1NEX B;  3SBP A;  2CN2 A;  4E54 B;  1E8N A;  4X61 B;  1N6D A;  2AGX A;  2AGY A;  3AL8 A;  3VGZ A;  4A08 B;  4O3U B;  2P9P C;  2B5N A;  3SBQ A;  3IUN A;  4L1Q D;  4JT5 C;  3OKT A;  4Z7O A;  3RFH A;  5M5T A;  4CI3 A;  2P9I C;  4UM8 A;  3UVN A;  5FKQ A;  2VZ3 A;  3T3M A;  3JB9 L;  4ERQ A;  2Q7Q A;  3K71 A;  2W18 A;  1GOF A;  2YNO A;  1H2W A;  3EQ9 A;  2VDP A;  4FB1 D;  2AQ5 A;  3EI4 A;  3GC3 B;  5C92 A;  4L9O A;  4Y7R A;  3SVW D;  3MZK A;  3IUL A;  4DNU A;  3DWL C;  2CE8 A;  5M5R A;  5IT9 g;  2OVR B;  2OIZ A;  3I7N A;  4UI9 R;  3CFS B;  5CYK A;  4CI1 A;  3F3P A;  3O4J A;  1L0Q A;  5CXB A;  5C9Z B;  4WJK A;  2P9U C;  5AFU 3;  4H5I A;  4JSV C;  2PM6 B;  2G99 A;  3I8C A;  4XEI C;  3OKY B;  3SCY A;  3MUO A;  4A11 B;  3IUQ A;  4ZOY A;  4NAA A;  1NR0 A;  5EMK B;  4PNK B;  3RFG A;  5IGO A;  4NEN A;  5IJ7 E;  1PGU A;  1N6F A;  3K26 A;  4O02 A;  2I0S A;  2P9N C;  5EAR A;  4LG8 A;  4AX4 A;  5I5J A;  1E5T A;  2IUQ A;  4Y5R D;  3EI3 B;  2CO0 A;  2I0R A;  2I3T A;  3OW8 A;  2P9L C;  5GXI A;  3AH8 B;  3OF7 A;  3ZE0 A;  4FA4 D;  4AEZ A;  4WK4 A;  4FAN D;  1C9L A;  1MG3 A;  2J57 G;  1B9Y A;  4BL0 A;  3PSC B;  4CI2 A;  2EIC A;  4PXW A;  1QNI A;  3GFC A;  3O4H A;  5FFG A;  4J8B A;  3FGB A;  1U8C A;  2WQ8 A;  3ZE1 A;  3EI2 B;  2EIB A;  3I7L A;  1YR2 A;  2P9S C;  3ZWL B;  1N6E A;  3EG6 A;  5FA5 B;  4RE5 A;  5IGQ A;  1MDA H;  5THA A;  3QI0 A;  1UOO A;  2J55 H;  4IMM A;  3NIF A;  4IA9 A;  3V7D B;  5HDB A;  2XE4 A;  3EI1 B;  3UVL A;  1JMZ B;  1VZ2 A;  4X63 B;  4X60 B;  3J80 g;  4J87 A;  2H47 A;  4Z7Q A;  4ESG A;  2PBI B;  3OL2 A;  4K3I D;  5AJA A;  3IUJ A;  2OK6 A;  4BH6 A;  4I79 A;  3AL8 B;  2EID A;  3ULE C;  4BUJ C;  4Z7N A;  2B4E A;  3KCI A;  3DSM A;  4L1M A;  1JJU B;  3GD1 I;  4WK2 A;  4J73 A;  4J86 A;  2VC2 A;  1R5M A;  4LGN A;  4G55 A;  3EI1 A;  1VZ3 A;  3NVN A;  1OMW B;  2I0T A;  1OLZ A;  2YNP A;  2VDM A;  4QT8 A;  5FKS A;  5C2V B;  4L3H D;  4GM3 A;  4J78 A;  4PSW B;  3DM0 A;  1K8K C;  1VYH C;  4O45 A;  2VDQ A;  3J81 g;  3EI4 B;  4XYI A;  1O6G A;  3V4V A;  4CY2 A;  3F3G A;  3IJ0 A;  4K3J B;  5TF2 A;  5I5M A;  2VDK A;  5H17 A;  4XYH A;  4G56 B;  3T3P A;  4RE6 A;  3FRX A;  4GZ8 A;  2CNX A;  5CYK B;  3PVW B;  2XL3 A;  4ES0 A;  3JZH A;  3AFC A;  1GG2 B;  3W15 A;  4CC9 A;  2UZX B;  5CXB B;  5KDO B;  4J8G A;  2IAA A;  1S4U X;  3UVO A;  3I8E A;  4JT6 C;  3BG0 A;  1TYQ C;  2PM9 A;  3JZG A;  1RI6 A;  4J77 A;  4GMB A;  3QHY B;  2G9A A;  2J56 H;  2AH0 A;  1QFM A;  3IJE A;  4QQE A;  3JAM g;  1GOG A;  1SHY B;  4BCB A;  4NC4 A;  3EQ7 A;  2H14 A;  3OKW A;  2VZ1 A;  4KFM B;  5CXC B;  2JKX A;  3DXM C;  5HYN B;  4O9D A;  4ZOZ A;  2CO0 C;  3C75 H;  1K32 A;  3DXK C;  2H3X A;  3O4G A;  3L4O D;  2MTA H;  3PXW D;  4D0K A;  1UOP A;  2AGW A;  4J0X A;  2HKR A;  2VDL A;  3HFQ A;  2B5M A;  1I2M B;  5EM2 A;  1VE7 A;  4O1Q D;  3N0D A;  4MMY A;  3VH0 A;  1U4C A;  3SHF A;  1VE6 A;  4X3E A;  4FA9 D;  4E5Z B;  2EIE A;  4BCD A;  2AGL A;  2QR5 A;  4OWR A;  1ERJ A;  3VI4 A;  4YVD A;  2CN3 A;  4CY1 A;  5M5U A;  1H2Y A;  4GQ1 A;  4A7J A;  5GSA A;  5CXC A;  4D9S A;  2QC5 A;  2YB8 B;  4FA1 D;  1B9X A;  3PE7 A;  2VDN A;  4PC0 A;  1XIP A;  4NSX A;  3JZN A;  5GMK n;  4U1E I;  4QL1 A;  3OL2 B;  5JWZ A;  2XU7 A;  2H6Q A;  2OVQ B;  3PVU B;  5FFO A;  5FKT A;  1C9I A;  2HXC A;  1BPO A;  5TEF A;  3CIK B;  2VDO A;  3RN1 D;  4E5Z A;  3IUR A;  3V4P A;  1XKS A;  3K27 A;  3MMY A;  3SJL D;  4J0W A;  3NVQ A;  4CZY A;  5EML B;  3RSE C;  5E6U A;  5EAP A;  3A0F A;  3UVM A;  3SMR A;  3E0C A;  3JPX A;  2HU7 A;  3BG1 A;  5B4W A;  1MG2 A;  4CY5 A;  1M1X A;  5EMJ B;  5H14 A;  3VI3 A;  3EMH A;  1L5G A;  1T2X A;  2YNN A;  2Z2N A;  3MKS B;  5E6R A;  3U4Y A;  1A12 A;  4JXM A;  4ZOX A;  4GGA A;  4G1E A;  2AGZ A;  5FKR A;  1GOH A;  4JSN C;  3IIY A;  4CY3 A;  3GRE A;  3SBR A;  4BP9 A;  1Q47 A;  1TYE A;  4HDJ A;  1A0R B;  3IIW A;  2PM9 B;  2H9L A;  3FM0 A;  3SLE D;  3KRX B;  5K19 A;  3UR4 A;  3K72 A;  4AOW A;  2BKL A;  2H68 A;  2HES X;  4IRZ A;  5E6S A;  4A0A B;  3SFZ A;  1FWX A;  4ZN4 A;  3SWS D;  1TBG A;  4Z8L A;  4CZV A;  5EAM A;  1JTD B;  3V9F A; 
#chains in the Genus database with same CATH homology
 1GXR A;  1SQJ A;  4JSP C;  1PI6 A;  3UKR C;  2OVP B;  4GQB B;  2HKM A;  1JOF A;  3NVX A;  2BBK H;  4GQ2 P;  3KRW B;  2OK4 A;  5EM2 B;  3RN0 D;  4EWR A;  2OJY A;  4L3G D;  1XHM A;  4JD2 C;  2IUV A;  4A09 B;  3B7F A;  5TEE A;  4CI8 A;  4A0A A;  1JMX B;  3PXT D;  3C99 A;  2Z2P A;  4D6V A;  4H5J A;  3JRO A;  2IUP A;  4O3T B;  4J81 A;  4JSX C;  5HE3 B;  3I7P A;  1U2V C;  2BCJ B;  2CE9 A;  3RRM C;  5FQD A;  5IC7 A;  3AL9 A;  2H6N A;  2H6K A;  1GOT B;  4QRJ A;  5IJ8 E;  3P4F A;  1PEV A;  4PBY A;  3RLM D;  4E54 A;  3ORV D;  4GGC A;  4A09 A;  3IKO A;  5HE0 B;  4A08 A;  4FWW A;  5I5I A;  3I7K A;  4LG9 A;  4ZOV A;  5HE2 B;  5HE1 B;  3ODT A;  4MK0 B;  3F3F A;  4FA5 D;  3IJC A;  4PSX B;  5EAL A;  4GM8 A;  5HQG A;  5C2W B;  3L4M D;  4R7A B;  5EMM B;  1YFQ A;  3JRP A;  3MZL A;  4A2M A;  5TDH B;  2IUR A;  1GP2 B;  4OZU A;  4J79 A;  3PXS D;  2O9K A;  2HJB A;  3C5M A;  3I7H A;  3MXX A;  4FAV D;  2HYE A;  3CFV A;  4GGD A;  3BWS A;  3I2N A;  3SN6 B;  2H9P A;  4J82 A;  1SQ9 A;  3OKY A;  3EU7 A;  2UZY B;  2XL2 A;  4A11 A;  2B5L A;  4U7A A;  4A0B B;  5SXM A;  3RMZ D;  2AH1 A;  2PM7 B;  3PSL A;  5GXH A;  4A2L A;  2TRC B;  3OTT A;  4CZX A;  2YBA A;  5A2Q g;  3UKU C;  3IJ1 A;  1PBY B;  3EI3 A;  2H13 A;  2H9N A;  4TZ4 A;  5K1C C;  2GNQ A;  2Z2O A;  2IWF A;  5H1M A;  5FXY A;  2YMU A;  3I89 A;  4J84 A;  4ERZ A;  2XYI A;  3VA6 A;  2P9K C;  4A0B A;  3I7O A;  3SXT D;  3EI2 A;  3MKQ A;  2IWK A;  1P22 A;  2EBS A;  3V5W B;  3N0E A;  4ERY A;  3UVK A;  2I3S A;  5AMS A;  5FLX g;  2GC4 A;  4FHL A;  4PBZ A;  2H9M A;  4N14 A;  4GM9 A;  2HJ4 A;  3EWE A;  3C9C A;  2GC7 A;  2QXV A;  1NEX B;  3SBP A;  2CN2 A;  4E54 B;  4X61 B;  1N6D A;  2AGX A;  2AGY A;  3AL8 A;  3VGZ A;  4A08 B;  4O3U B;  2P9P C;  2B5N A;  3SBQ A;  4L1Q D;  4JT5 C;  3OKT A;  3RFH A;  4CI3 A;  2P9I C;  3UVN A;  5FKQ A;  3JB9 L;  4ERQ A;  2Q7Q A;  2W18 A;  2YNO A;  4FB1 D;  2AQ5 A;  3EI4 A;  4L9O A;  4Y7R A;  3SVW D;  3MZK A;  3DWL C;  2CE8 A;  5IT9 g;  2OVR B;  2OIZ A;  3I7N A;  4UI9 R;  3CFS B;  5CYK A;  4CI1 A;  3F3P A;  1L0Q A;  5CXB A;  5C9Z B;  2P9U C;  5AFU 3;  4H5I A;  4JSV C;  2PM6 B;  2G99 A;  3I8C A;  4XEI C;  3OKY B;  3SCY A;  4A11 B;  4ZOY A;  1NR0 A;  5EMK B;  4PNK B;  3RFG A;  5IGO A;  5IJ7 E;  1PGU A;  1N6F A;  3K26 A;  2I0S A;  2P9N C;  5EAR A;  4LG8 A;  5I5J A;  2IUQ A;  4Y5R D;  3EI3 B;  2CO0 A;  2I0R A;  2I3T A;  3OW8 A;  2P9L C;  5GXI A;  3AH8 B;  4FA4 D;  4AEZ A;  4FAN D;  1MG3 A;  2J57 G;  4BL0 A;  1B9Y A;  3PSC B;  4CI2 A;  4PXW A;  1QNI A;  3GFC A;  4J8B A;  3FGB A;  3EI2 B;  3I7L A;  2P9S C;  3ZWL B;  1N6E A;  3EG6 A;  5FA5 B;  5IGQ A;  1MDA H;  5THA A;  2J55 H;  4IMM A;  4IA9 A;  3V7D B;  3EI1 B;  3UVL A;  1JMZ B;  4X63 B;  4X60 B;  3J80 g;  4J87 A;  2H47 A;  4ESG A;  2PBI B;  3OL2 A;  4K3I D;  5AJA A;  2OK6 A;  4BH6 A;  4I79 A;  3AL8 B;  3ULE C;  4BUJ C;  2B4E A;  3DSM A;  1JJU B;  4J73 A;  4J86 A;  1R5M A;  4LGN A;  3EI1 A;  3NVN A;  1OMW B;  2I0T A;  1OLZ A;  2YNP A;  4QT8 A;  5FKS A;  5C2V B;  4L3H D;  4GM3 A;  4J78 A;  4PSW B;  3DM0 A;  1K8K C;  1VYH C;  4O45 A;  3J81 g;  3EI4 B;  4XYI A;  4CY2 A;  3F3G A;  3IJ0 A;  4K3J B;  5TF2 A;  5I5M A;  5H17 A;  4XYH A;  4G56 B;  3FRX A;  4GZ8 A;  2CNX A;  5CYK B;  3PVW B;  2XL3 A;  4ES0 A;  3JZH A;  3AFC A;  1GG2 B;  3W15 A;  4CC9 A;  2UZX B;  5CXB B;  5KDO B;  4J8G A;  2IAA A;  1S4U X;  3UVO A;  3I8E A;  4JT6 C;  3BG0 A;  1TYQ C;  2PM9 A;  3JZG A;  1RI6 A;  4J77 A;  4GMB A;  2G9A A;  2J56 H;  2AH0 A;  4QQE A;  3JAM g;  1SHY B;  2H14 A;  3OKW A;  4KFM B;  5CXC B;  3DXM C;  5HYN B;  4O9D A;  4ZOZ A;  2CO0 C;  3C75 H;  1K32 A;  3DXK C;  2H3X A;  3L4O D;  2MTA H;  3PXW D;  4D0K A;  2AGW A;  4J0X A;  2HKR A;  3HFQ A;  2B5M A;  5EM2 A;  4O1Q D;  3N0D A;  3VH0 A;  1U4C A;  3SHF A;  4X3E A;  4FA9 D;  4E5Z B;  2AGL A;  4OWR A;  1ERJ A;  4YVD A;  2CN3 A;  4CY1 A;  4GQ1 A;  4A7J A;  5GSA A;  5CXC A;  4FA1 D;  2QC5 A;  2YB8 B;  1B9X A;  3PE7 A;  4PC0 A;  1XIP A;  4NSX A;  3JZN A;  5GMK n;  4U1E I;  4QL1 A;  3OL2 B;  5JWZ A;  2XU7 A;  2H6Q A;  2OVQ B;  3PVU B;  5FKT A;  2HXC A;  5TEF A;  3CIK B;  3RN1 D;  4E5Z A;  1XKS A;  3K27 A;  3MMY A;  3SJL D;  4J0W A;  3NVQ A;  4CZY A;  5EML B;  3RSE C;  5EAP A;  3A0F A;  3UVM A;  3SMR A;  3E0C A;  3JPX A;  5B4W A;  3BG1 A;  1MG2 A;  4CY5 A;  5EMJ B;  5H14 A;  3EMH A;  2YNN A;  2Z2N A;  3MKS B;  3U4Y A;  4JXM A;  4ZOX A;  4GGA A;  2AGZ A;  5FKR A;  4JSN C;  3IIY A;  4CY3 A;  3GRE A;  3SBR A;  1Q47 A;  4HDJ A;  1A0R B;  3IIW A;  2PM9 B;  2H9L A;  3FM0 A;  3SLE D;  3KRX B;  5K19 A;  3UR4 A;  4AOW A;  2H68 A;  2HES X;  4A0A B;  3SFZ A;  1FWX A;  4ZN4 A;  3SWS D;  1TBG A;  4Z8L A;  4CZV A;  5EAM A;  3V9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...