2YBOA

The x-ray structure of the sam-dependent uroporphyrinogen iii methyltransferase nire from pseudomonas aeruginosa in complex with sah
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
256
structure length
248
Chain Sequence
b'LDVDFPAGSVALVGAGPGDPGLLTLRAWALLQQAEVVVYDRLVARELIALLPESCQRIYVGPQEEINELLVRLARQQRRVVRLKGGDPFIFGRGAEELERLLEAGVDCQVVPGVTAASGCSTYAGIPLTHRDLAQSCTFVTGHLQNDGRLDLDWAGLARGKQTLVFYMGLGNLAEIAARLVEHGLASDTPAALVSQGTQAGQQVTRGALAELPALARRYQLKPPTLIVVGQVVALFAERAMAHPSYLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHYLTRANSFERASE
publication title Crystal Structure of the Heme D1 Biosynthesis Enzyme Nire in Complex with its Substrate Reveals New Insights Into the Catalytic Mechanism of S-Adenosyl-L-Methionine-Dependent Uroporphyrinogen III Methyltransferases.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 72
structure length 248
sequence length 256
ec nomenclature ec 2.1.1.107: Uroporphyrinogen-III C-methyltransferase.
pdb deposition date 2011-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00590 TP_methylase Tetrapyrrole (Corrin/Porphyrin) Methylases
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.950.10 Alpha Beta 2-Layer Sandwich Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 2yboA02
3.40.1010.10 Alpha Beta 3-Layer(aba) Sandwich Cobalt-precorrin-4 Transmethylase; domain 1 Cobalt-precorrin-4 Transmethylase; Domain 1 2yboA01
2E0KA 3FFYA 2EL2A 2E15A 2EL0A 2PCIA 1PJTA 2QBUA 2DV7A 2EK4A 3NUTA 2NPNA 2P9DA 1VCEA 2EGBA 2EGSA 2ENIA 2ELEA 1S4DA 2E7RA 3ND1A 2PCHA 1V9AA 4E16A 2E8RA 2HR8A 2DV4A 2EH4A 2EK2A 2PB4A 2PCGA 2EMRA 1WDEA 3HH1A 1WNGA 2CBFA 2PB6A 3NDCA 2EJKA 2EJJA 2HUXA 2P6IA 2DV5A 2DXWA 2P5FA 2EK3A 3KWPA 2DV3A 2EEQA 2P6LA 1PJSA 2PCMA 2EHCA 2EK7A 2HUVA 2E8QA 2EH2A 2Z6RA 2EL3A 3I4TA 2DSIA 2BB3A 2ED3A 2EL1A 2YBQA 2EKAA 2OWUA 2E0NA 2HUQA 2OWKA 2P2XA 2EGLA 2DXXA 2ZVCA 2ZVBA 2DEKA 2P6DA 2DSHA 2E4RA 2ED5A 2E4NA 2DXVA 2EHLA 2ELDA 2PCKA 3NEIA 2PB5A 1VHVA 2E8HA 2EMUA 2PCAA 3FQ6A 5HW4A 2E8SA 2OWFA 2E17A 2OWGA 1VE2A 2E08A 2HUTA 2E16A 1PJQA 2OWVA 2DSGA 1CBFA 2YBOA 2E07A 2P5CA 2P6KA 1VA0A 1WYZA 2EN5A 2EH5A 2EJZA
chains in the Genus database with same CATH superfamily
2E0KA 3FFYA 4H4EA 3KEFA 2EL2A 3KE9A 2E15A 4MUYA 2EL0A 2PCIA 1PJTA 2QBUA 2DV7A 3KEMA 3DNFA 2EK4A 3NUTA 2NPNA 2P9DA 1VCEA 2EGBA 2EGSA 2ENIA 2ELEA 1S4DA 2E7RA 3ND1A 2PCHA 3UTCA 1V9AA 4E16A 2E8RA 3KE8A 2HR8A 2DV4A 2EH4A 2EK2A 2PB4A 2PCGA 2EMRA 3UV7A 3URKA 3T0FA 3UV6A 1WDEA 3HH1A 1WNGA 2CBFA 4MUXA 3LMMA 2PB6A 3NDCA 2EJKA 2EJJA 2HUXA 2P6IA 3UWMA 4H4CA 2DV5A 2DXWA 2P5FA 3F7TA 2EK3A 3KWPA 2DV3A 3ZGNA 3SZUA 3TIXB 2EEQA 4MV0A 2P6LA 1PJSA 2PCMA 2EHCA 2EK7A 2HUVA 2E8QA 2EH2A 2Z6RA 2EL3A 3I4TA 2DSIA 2BB3A 2ED3A 2EL1A 2YBQA 2EKAA 2OWUA 2E0NA 2HUQA 2OWKA 2P2XA 2EGLA 3SZLA 2DXXA 2ZVCA 2ZVBA 2DEKA 2P6DA 4N7BA 2DSHA 3SZOA 2E4RA 2ED5A 2E4NA 2DXVA 2EHLA 2ELDA 2PCKA 3NEIA 2PB5A 1VHVA 4MV5A 2E8HA 2EMUA 2PCAA 3FQ6A 3UTDA 5HW4A 2E8SA 2OWFA 3ZGLA 3T0GA 2E17A 2OWGA 1VE2A 2E08A 2HUTA 2E16A 4H4DA 1PJQA 2OWVA 3KELA 2DSGA 4EB3A 1CBFA 2YBOA 3UV3A 2E07A 2P5CA 2KYYA 2P6KA 1VA0A 1WYZA 2EN5A 2EH5A 2EJZA
chains in the Genus database with same CATH topology
2E0KA 3FFYA 4H4EA 3KEFA 2EL2A 3KE9A 2E15A 4MUYA 2EL0A 2PCIA 1PJTA 2QBUA 2DV7A 3KEMA 3DNFA 2EK4A 3NUTA 2NPNA 2P9DA 1VCEA 2EGBA 2EGSA 2ENIA 2ELEA 1S4DA 2E7RA 3ND1A 2PCHA 3UTCA 1V9AA 4E16A 2E8RA 3KE8A 2HR8A 2DV4A 2EH4A 2EK2A 2PB4A 2PCGA 2EMRA 3UV7A 3URKA 3T0FA 3UV6A 1WDEA 3HH1A 1WNGA 2CBFA 4MUXA 3LMMA 2PB6A 3NDCA 2EJKA 2EJJA 2HUXA 2P6IA 3UWMA 4H4CA 2DV5A 2DXWA 2P5FA 3F7TA 2EK3A 3KWPA 2DV3A 3ZGNA 3SZUA 3TIXB 2EEQA 4MV0A 2P6LA 1PJSA 2PCMA 2EHCA 2EK7A 2HUVA 2E8QA 2EH2A 2Z6RA 2EL3A 3I4TA 2DSIA 2BB3A 2ED3A 2EL1A 2YBQA 2EKAA 2OWUA 2E0NA 2HUQA 2OWKA 2P2XA 2EGLA 3SZLA 2DXXA 2ZVCA 2ZVBA 2DEKA 2P6DA 4N7BA 2DSHA 3SZOA 2E4RA 2ED5A 2E4NA 2DXVA 2EHLA 2ELDA 2PCKA 3NEIA 2PB5A 1VHVA 4MV5A 2E8HA 2EMUA 2PCAA 3FQ6A 3UTDA 5HW4A 2E8SA 2OWFA 3ZGLA 3T0GA 2E17A 2OWGA 1VE2A 2E08A 2HUTA 2E16A 4H4DA 1PJQA 2OWVA 3KELA 2DSGA 4EB3A 1CBFA 2YBOA 3UV3A 2E07A 2P5CA 2KYYA 2P6KA 1VA0A 1WYZA 2EN5A 2EH5A 2EJZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E0K A;  3FFY A;  2EL2 A;  2E15 A;  2EL0 A;  2PCI A;  1PJT A;  2QBU A;  2DV7 A;  2EK4 A;  3NUT A;  2NPN A;  2P9D A;  1VCE A;  2EGB A;  2EGS A;  2ENI A;  2ELE A;  1S4D A;  2E7R A;  3ND1 A;  2PCH A;  1V9A A;  4E16 A;  2E8R A;  2HR8 A;  2DV4 A;  2EH4 A;  2EK2 A;  2PB4 A;  2PCG A;  2EMR A;  1WDE A;  3HH1 A;  1WNG A;  2CBF A;  2PB6 A;  3NDC A;  2EJK A;  2EJJ A;  2HUX A;  2P6I A;  2DV5 A;  2DXW A;  2P5F A;  2EK3 A;  3KWP A;  2DV3 A;  2EEQ A;  2P6L A;  1PJS A;  2PCM A;  2EHC A;  2EK7 A;  2HUV A;  2E8Q A;  2EH2 A;  2Z6R A;  2EL3 A;  3I4T A;  2DSI A;  2BB3 A;  2ED3 A;  2EL1 A;  2YBQ A;  2EKA A;  2OWU A;  2E0N A;  2HUQ A;  2OWK A;  2P2X A;  2EGL A;  2DXX A;  2ZVC A;  2ZVB A;  2DEK A;  2P6D A;  2DSH A;  2E4R A;  2ED5 A;  2E4N A;  2DXV A;  2EHL A;  2ELD A;  2PCK A;  3NEI A;  2PB5 A;  1VHV A;  2E8H A;  2EMU A;  2PCA A;  3FQ6 A;  5HW4 A;  2E8S A;  2OWF A;  2E17 A;  2OWG A;  1VE2 A;  2E08 A;  2HUT A;  2E16 A;  1PJQ A;  2OWV A;  2DSG A;  1CBF A;  2YBO A;  2E07 A;  2P5C A;  2P6K A;  1VA0 A;  1WYZ A;  2EN5 A;  2EH5 A;  2EJZ A; 
#chains in the Genus database with same CATH topology
 2E0K A;  3FFY A;  4H4E A;  3KEF A;  2EL2 A;  3KE9 A;  2E15 A;  4MUY A;  2EL0 A;  2PCI A;  1PJT A;  2QBU A;  2DV7 A;  3KEM A;  3DNF A;  2EK4 A;  3NUT A;  2NPN A;  2P9D A;  1VCE A;  2EGB A;  2EGS A;  2ENI A;  2ELE A;  1S4D A;  2E7R A;  3ND1 A;  2PCH A;  3UTC A;  1V9A A;  4E16 A;  2E8R A;  3KE8 A;  2HR8 A;  2DV4 A;  2EH4 A;  2EK2 A;  2PB4 A;  2PCG A;  2EMR A;  3UV7 A;  3URK A;  3T0F A;  3UV6 A;  1WDE A;  3HH1 A;  1WNG A;  2CBF A;  4MUX A;  3LMM A;  2PB6 A;  3NDC A;  2EJK A;  2EJJ A;  2HUX A;  2P6I A;  3UWM A;  4H4C A;  2DV5 A;  2DXW A;  2P5F A;  3F7T A;  2EK3 A;  3KWP A;  2DV3 A;  3ZGN A;  3SZU A;  3TIX B;  2EEQ A;  4MV0 A;  2P6L A;  1PJS A;  2PCM A;  2EHC A;  2EK7 A;  2HUV A;  2E8Q A;  2EH2 A;  2Z6R A;  2EL3 A;  3I4T A;  2DSI A;  2BB3 A;  2ED3 A;  2EL1 A;  2YBQ A;  2EKA A;  2OWU A;  2E0N A;  2HUQ A;  2OWK A;  2P2X A;  2EGL A;  3SZL A;  2DXX A;  2ZVC A;  2ZVB A;  2DEK A;  2P6D A;  4N7B A;  2DSH A;  3SZO A;  2E4R A;  2ED5 A;  2E4N A;  2DXV A;  2EHL A;  2ELD A;  2PCK A;  3NEI A;  2PB5 A;  1VHV A;  4MV5 A;  2E8H A;  2EMU A;  2PCA A;  3FQ6 A;  3UTD A;  5HW4 A;  2E8S A;  2OWF A;  3ZGL A;  3T0G A;  2E17 A;  2OWG A;  1VE2 A;  2E08 A;  2HUT A;  2E16 A;  4H4D A;  1PJQ A;  2OWV A;  3KEL A;  2DSG A;  4EB3 A;  1CBF A;  2YBO A;  3UV3 A;  2E07 A;  2P5C A;  2KYY A;  2P6K A;  1VA0 A;  1WYZ A;  2EN5 A;  2EH5 A;  2EJZ A; 
#chains in the Genus database with same CATH homology
 2E0K A;  3FFY A;  4H4E A;  3KEF A;  2EL2 A;  3KE9 A;  2E15 A;  4MUY A;  2EL0 A;  2PCI A;  1PJT A;  2QBU A;  2DV7 A;  3KEM A;  3DNF A;  2EK4 A;  3NUT A;  2NPN A;  2P9D A;  1VCE A;  2EGB A;  2EGS A;  2ENI A;  2ELE A;  1S4D A;  2E7R A;  3ND1 A;  2PCH A;  3UTC A;  1V9A A;  4E16 A;  2E8R A;  3KE8 A;  2HR8 A;  2DV4 A;  2EH4 A;  2EK2 A;  2PB4 A;  2PCG A;  2EMR A;  3UV7 A;  3URK A;  3T0F A;  3UV6 A;  1WDE A;  3HH1 A;  1WNG A;  2CBF A;  4MUX A;  3LMM A;  2PB6 A;  3NDC A;  2EJK A;  2EJJ A;  2HUX A;  2P6I A;  3UWM A;  4H4C A;  2DV5 A;  2DXW A;  2P5F A;  3F7T A;  2EK3 A;  3KWP A;  2DV3 A;  3ZGN A;  3SZU A;  3TIX B;  2EEQ A;  4MV0 A;  2P6L A;  1PJS A;  2PCM A;  2EHC A;  2EK7 A;  2HUV A;  2E8Q A;  2EH2 A;  2Z6R A;  2EL3 A;  3I4T A;  2DSI A;  2BB3 A;  2ED3 A;  2EL1 A;  2YBQ A;  2EKA A;  2OWU A;  2E0N A;  2HUQ A;  2OWK A;  2P2X A;  2EGL A;  3SZL A;  2DXX A;  2ZVC A;  2ZVB A;  2DEK A;  2P6D A;  4N7B A;  2DSH A;  3SZO A;  2E4R A;  2ED5 A;  2E4N A;  2DXV A;  2EHL A;  2ELD A;  2PCK A;  3NEI A;  2PB5 A;  1VHV A;  4MV5 A;  2E8H A;  2EMU A;  2PCA A;  3FQ6 A;  3UTD A;  5HW4 A;  2E8S A;  2OWF A;  3ZGL A;  3T0G A;  2E17 A;  2OWG A;  1VE2 A;  2E08 A;  2HUT A;  2E16 A;  4H4D A;  1PJQ A;  2OWV A;  3KEL A;  2DSG A;  4EB3 A;  1CBF A;  2YBO A;  3UV3 A;  2E07 A;  2P5C A;  2KYY A;  2P6K A;  1VA0 A;  1WYZ A;  2EN5 A;  2EH5 A;  2EJZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...