2YBQA

The x-ray structure of the sam-dependent uroporphyrinogen iii methyltransferase nire from pseudomonas aeruginosa in complex with sah and uroporphyrinogen iii
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
254
structure length
242
Chain Sequence
VDFPAGSVALVGAGPGDPGLLTLRAWALLQQAEVVVYDRLVARELIALLPESCQRIYVGPQEEINELLVRLARQQRRVVRLKGGDPFIFGRGAEELERLLEAGVDCQVVPGVTAASGCSTYAGIPLTHRDLAQSCTFVTGHLQLDLDWAGLARGKQTLVFYMGLGNLAEIAARLVEHGLASDTPAALVSQGTQAGQQVTRGALAELPALARRYQLKPPTLIVVGQVVALFAERAMAHPSYLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Heme D1 Biosynthesis Enzyme Nire in Complex with its Substrate Reveals New Insights Into the Catalytic Mechanism of S-Adenosyl-L-Methionine-Dependent Uroporphyrinogen III Methyltransferases.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
molecule keywords METHYLTRANSFERASE
total genus 72
structure length 242
sequence length 254
ec nomenclature ec 2.1.1.107: Uroporphyrinogen-III C-methyltransferase.
pdb deposition date 2011-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00590 TP_methylase Tetrapyrrole (Corrin/Porphyrin) Methylases
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.950.10 Alpha Beta 2-Layer Sandwich Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 2ybqA02
3.40.1010.10 Alpha Beta 3-Layer(aba) Sandwich Cobalt-precorrin-4 Transmethylase; domain 1 Cobalt-precorrin-4 Transmethylase; Domain 1 2ybqA01
2P6KA 2NPNA 3NDCA 3FFYA 2EN5A 2OWGA 2P6LA 2ELEA 1S4DA 2E7RA 2DSHA 2ZVCA 2PCIA 1WDEA 2EK7A 2DSIA 2YBQA 2EJZA 2EL1A 3NEIA 2E15A 2PCHA 1VHVA 3ND1A 2E8QA 2EEQA 2EHLA 1V9AA 1VE2A 2EMUA 1PJSA 2DSGA 2EGSA 1VCEA 2HUQA 2EKAA 1WYZA 2E8SA 4E16A 2EL2A 1CBFA 2Z6RA 2CBFA 2E17A 2HUTA 2YBOA 2PCGA 2DV5A 2P5FA 2ZVBA 2EL3A 3FQ6A 2EK4A 2E0KA 2E0NA 2DXVA 2PB6A 2PCMA 1PJQA 2E8HA 2P6DA 2HUVA 2EH4A 2OWKA 2EL0A 2EHCA 2ELDA 2EH2A 3KWPA 3I4TA 5HW4A 2EJJA 2E08A 2DV7A 2PCKA 2BB3A 2P6IA 2EH5A 1WNGA 2DV3A 2E8RA 2EK2A 2E16A 1VA0A 2OWFA 2PCAA 2E4RA 3NUTA 2EGBA 2OWVA 2ED3A 2QBUA 2DXXA 2E4NA 2PB5A 2ENIA 2P9DA 2E07A 2DEKA 2OWUA 2EMRA 2EJKA 2DV4A 2DXWA 2EK3A 2PB4A 2HR8A 1PJTA 2HUXA 2EGLA 3HH1A 2P5CA 2P2XA 2ED5A
chains in the Genus database with same CATH superfamily
2P6KA 2NPNA 3SZOA 3NDCA 3FFYA 2EN5A 2OWGA 3T0FA 4MV5A 2P6LA 2ELEA 1S4DA 2E7RA 2DSHA 2ZVCA 2KYYA 2PCIA 1WDEA 2EK7A 2DSIA 2YBQA 2EJZA 2EL1A 3NEIA 2E15A 3DNFA 2PCHA 1VHVA 3ND1A 2E8QA 3UTDA 3UV6A 2EEQA 2EHLA 3KE9A 1V9AA 1VE2A 4MV0A 2EMUA 1PJSA 2DSGA 2EGSA 1VCEA 2HUQA 2EKAA 1WYZA 2E8SA 3SZUA 3TIXB 4E16A 3ZGNA 2EL2A 1CBFA 2Z6RA 2CBFA 2E17A 2HUTA 2YBOA 2PCGA 2DV5A 4MUYA 3UTCA 3KELA 3SZLA 2P5FA 2ZVBA 2EL3A 3FQ6A 2EK4A 2E0KA 2E0NA 2DXVA 2PB6A 2PCMA 4H4EA 4MUXA 1PJQA 2E8HA 2P6DA 2HUVA 2EH4A 2OWKA 4N7BA 2EL0A 2EHCA 2ELDA 2EH2A 3KWPA 3F7TA 3I4TA 5HW4A 2EJJA 2E08A 2DV7A 2PCKA 2BB3A 2P6IA 2EH5A 3LMMA 4H4DA 1WNGA 2DV3A 2E8RA 2EK2A 2E16A 1VA0A 2OWFA 3UV3A 2PCAA 2E4RA 3KE8A 3NUTA 3URKA 2EGBA 3KEMA 3UWMA 2OWVA 2ED3A 2QBUA 4H4CA 2DXXA 2E4NA 2PB5A 2ENIA 3T0GA 2P9DA 2E07A 2DEKA 2OWUA 2EMRA 2EJKA 2DV4A 3UV7A 2DXWA 2EK3A 2PB4A 2HR8A 1PJTA 2HUXA 2EGLA 3HH1A 2P5CA 2P2XA 3ZGLA 2ED5A 3KEFA 4EB3A
chains in the Genus database with same CATH topology
2P6KA 2NPNA 3SZOA 3NDCA 3FFYA 2EN5A 2OWGA 3T0FA 4MV5A 2P6LA 2ELEA 1S4DA 2E7RA 2DSHA 2ZVCA 2KYYA 2PCIA 1WDEA 2EK7A 2DSIA 2YBQA 2EJZA 2EL1A 3NEIA 2E15A 3DNFA 2PCHA 1VHVA 3ND1A 2E8QA 3UTDA 3UV6A 2EEQA 2EHLA 3KE9A 1V9AA 1VE2A 4MV0A 2EMUA 1PJSA 2DSGA 2EGSA 1VCEA 2HUQA 2EKAA 1WYZA 2E8SA 3SZUA 3TIXB 4E16A 3ZGNA 2EL2A 1CBFA 2Z6RA 2CBFA 2E17A 2HUTA 2YBOA 2PCGA 2DV5A 4MUYA 3UTCA 3KELA 3SZLA 2P5FA 2ZVBA 2EL3A 3FQ6A 2EK4A 2E0KA 2E0NA 2DXVA 2PB6A 2PCMA 4H4EA 4MUXA 1PJQA 2E8HA 2P6DA 2HUVA 2EH4A 2OWKA 4N7BA 2EL0A 2EHCA 2ELDA 2EH2A 3KWPA 3F7TA 3I4TA 5HW4A 2EJJA 2E08A 2DV7A 2PCKA 2BB3A 2P6IA 2EH5A 3LMMA 4H4DA 1WNGA 2DV3A 2E8RA 2EK2A 2E16A 1VA0A 2OWFA 3UV3A 2PCAA 2E4RA 3KE8A 3NUTA 3URKA 2EGBA 3KEMA 3UWMA 2OWVA 2ED3A 2QBUA 4H4CA 2DXXA 2E4NA 2PB5A 2ENIA 3T0GA 2P9DA 2E07A 2DEKA 2OWUA 2EMRA 2EJKA 2DV4A 3UV7A 2DXWA 2EK3A 2PB4A 2HR8A 1PJTA 2HUXA 2EGLA 3HH1A 2P5CA 2P2XA 3ZGLA 2ED5A 3KEFA 4EB3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P6K A;  2NPN A;  3NDC A;  3FFY A;  2EN5 A;  2OWG A;  2P6L A;  2ELE A;  1S4D A;  2E7R A;  2DSH A;  2ZVC A;  2PCI A;  1WDE A;  2EK7 A;  2DSI A;  2YBQ A;  2EJZ A;  2EL1 A;  3NEI A;  2E15 A;  2PCH A;  1VHV A;  3ND1 A;  2E8Q A;  2EEQ A;  2EHL A;  1V9A A;  1VE2 A;  2EMU A;  1PJS A;  2DSG A;  2EGS A;  1VCE A;  2HUQ A;  2EKA A;  1WYZ A;  2E8S A;  4E16 A;  2EL2 A;  1CBF A;  2Z6R A;  2CBF A;  2E17 A;  2HUT A;  2YBO A;  2PCG A;  2DV5 A;  2P5F A;  2ZVB A;  2EL3 A;  3FQ6 A;  2EK4 A;  2E0K A;  2E0N A;  2DXV A;  2PB6 A;  2PCM A;  1PJQ A;  2E8H A;  2P6D A;  2HUV A;  2EH4 A;  2OWK A;  2EL0 A;  2EHC A;  2ELD A;  2EH2 A;  3KWP A;  3I4T A;  5HW4 A;  2EJJ A;  2E08 A;  2DV7 A;  2PCK A;  2BB3 A;  2P6I A;  2EH5 A;  1WNG A;  2DV3 A;  2E8R A;  2EK2 A;  2E16 A;  1VA0 A;  2OWF A;  2PCA A;  2E4R A;  3NUT A;  2EGB A;  2OWV A;  2ED3 A;  2QBU A;  2DXX A;  2E4N A;  2PB5 A;  2ENI A;  2P9D A;  2E07 A;  2DEK A;  2OWU A;  2EMR A;  2EJK A;  2DV4 A;  2DXW A;  2EK3 A;  2PB4 A;  2HR8 A;  1PJT A;  2HUX A;  2EGL A;  3HH1 A;  2P5C A;  2P2X A;  2ED5 A; 
#chains in the Genus database with same CATH topology
 2P6K A;  2NPN A;  3SZO A;  3NDC A;  3FFY A;  2EN5 A;  2OWG A;  3T0F A;  4MV5 A;  2P6L A;  2ELE A;  1S4D A;  2E7R A;  2DSH A;  2ZVC A;  2KYY A;  2PCI A;  1WDE A;  2EK7 A;  2DSI A;  2YBQ A;  2EJZ A;  2EL1 A;  3NEI A;  2E15 A;  3DNF A;  2PCH A;  1VHV A;  3ND1 A;  2E8Q A;  3UTD A;  3UV6 A;  2EEQ A;  2EHL A;  3KE9 A;  1V9A A;  1VE2 A;  4MV0 A;  2EMU A;  1PJS A;  2DSG A;  2EGS A;  1VCE A;  2HUQ A;  2EKA A;  1WYZ A;  2E8S A;  3SZU A;  3TIX B;  4E16 A;  3ZGN A;  2EL2 A;  1CBF A;  2Z6R A;  2CBF A;  2E17 A;  2HUT A;  2YBO A;  2PCG A;  2DV5 A;  4MUY A;  3UTC A;  3KEL A;  3SZL A;  2P5F A;  2ZVB A;  2EL3 A;  3FQ6 A;  2EK4 A;  2E0K A;  2E0N A;  2DXV A;  2PB6 A;  2PCM A;  4H4E A;  4MUX A;  1PJQ A;  2E8H A;  2P6D A;  2HUV A;  2EH4 A;  2OWK A;  4N7B A;  2EL0 A;  2EHC A;  2ELD A;  2EH2 A;  3KWP A;  3F7T A;  3I4T A;  5HW4 A;  2EJJ A;  2E08 A;  2DV7 A;  2PCK A;  2BB3 A;  2P6I A;  2EH5 A;  3LMM A;  4H4D A;  1WNG A;  2DV3 A;  2E8R A;  2EK2 A;  2E16 A;  1VA0 A;  2OWF A;  3UV3 A;  2PCA A;  2E4R A;  3KE8 A;  3NUT A;  3URK A;  2EGB A;  3KEM A;  3UWM A;  2OWV A;  2ED3 A;  2QBU A;  4H4C A;  2DXX A;  2E4N A;  2PB5 A;  2ENI A;  3T0G A;  2P9D A;  2E07 A;  2DEK A;  2OWU A;  2EMR A;  2EJK A;  2DV4 A;  3UV7 A;  2DXW A;  2EK3 A;  2PB4 A;  2HR8 A;  1PJT A;  2HUX A;  2EGL A;  3HH1 A;  2P5C A;  2P2X A;  3ZGL A;  2ED5 A;  3KEF A;  4EB3 A; 
#chains in the Genus database with same CATH homology
 2P6K A;  2NPN A;  3SZO A;  3NDC A;  3FFY A;  2EN5 A;  2OWG A;  3T0F A;  4MV5 A;  2P6L A;  2ELE A;  1S4D A;  2E7R A;  2DSH A;  2ZVC A;  2KYY A;  2PCI A;  1WDE A;  2EK7 A;  2DSI A;  2YBQ A;  2EJZ A;  2EL1 A;  3NEI A;  2E15 A;  3DNF A;  2PCH A;  1VHV A;  3ND1 A;  2E8Q A;  3UTD A;  3UV6 A;  2EEQ A;  2EHL A;  3KE9 A;  1V9A A;  1VE2 A;  4MV0 A;  2EMU A;  1PJS A;  2DSG A;  2EGS A;  1VCE A;  2HUQ A;  2EKA A;  1WYZ A;  2E8S A;  3SZU A;  3TIX B;  4E16 A;  3ZGN A;  2EL2 A;  1CBF A;  2Z6R A;  2CBF A;  2E17 A;  2HUT A;  2YBO A;  2PCG A;  2DV5 A;  4MUY A;  3UTC A;  3KEL A;  3SZL A;  2P5F A;  2ZVB A;  2EL3 A;  3FQ6 A;  2EK4 A;  2E0K A;  2E0N A;  2DXV A;  2PB6 A;  2PCM A;  4H4E A;  4MUX A;  1PJQ A;  2E8H A;  2P6D A;  2HUV A;  2EH4 A;  2OWK A;  4N7B A;  2EL0 A;  2EHC A;  2ELD A;  2EH2 A;  3KWP A;  3F7T A;  3I4T A;  5HW4 A;  2EJJ A;  2E08 A;  2DV7 A;  2PCK A;  2BB3 A;  2P6I A;  2EH5 A;  3LMM A;  4H4D A;  1WNG A;  2DV3 A;  2E8R A;  2EK2 A;  2E16 A;  1VA0 A;  2OWF A;  3UV3 A;  2PCA A;  2E4R A;  3KE8 A;  3NUT A;  3URK A;  2EGB A;  3KEM A;  3UWM A;  2OWV A;  2ED3 A;  2QBU A;  4H4C A;  2DXX A;  2E4N A;  2PB5 A;  2ENI A;  3T0G A;  2P9D A;  2E07 A;  2DEK A;  2OWU A;  2EMR A;  2EJK A;  2DV4 A;  3UV7 A;  2DXW A;  2EK3 A;  2PB4 A;  2HR8 A;  1PJT A;  2HUX A;  2EGL A;  3HH1 A;  2P5C A;  2P2X A;  3ZGL A;  2ED5 A;  3KEF A;  4EB3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...