2YBQA

The x-ray structure of the sam-dependent uroporphyrinogen iii methyltransferase nire from pseudomonas aeruginosa in complex with sah and uroporphyrinogen iii
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
254
structure length
242
Chain Sequence
VDFPAGSVALVGAGPGDPGLLTLRAWALLQQAEVVVYDRLVARELIALLPESCQRIYVGPQEEINELLVRLARQQRRVVRLKGGDPFIFGRGAEELERLLEAGVDCQVVPGVTAASGCSTYAGIPLTHRDLAQSCTFVTGHLQLDLDWAGLARGKQTLVFYMGLGNLAEIAARLVEHGLASDTPAALVSQGTQAGQQVTRGALAELPALARRYQLKPPTLIVVGQVVALFAERAMAHPSYLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Heme D1 Biosynthesis Enzyme Nire in Complex with its Substrate Reveals New Insights Into the Catalytic Mechanism of S-Adenosyl-L-Methionine-Dependent Uroporphyrinogen III Methyltransferases.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
molecule keywords METHYLTRANSFERASE
total genus 72
structure length 242
sequence length 254
ec nomenclature ec 2.1.1.107: Uroporphyrinogen-III C-methyltransferase.
pdb deposition date 2011-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00590 TP_methylase Tetrapyrrole (Corrin/Porphyrin) Methylases
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.950.10 Alpha Beta 2-Layer Sandwich Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 2ybqA02
3.40.1010.10 Alpha Beta 3-Layer(aba) Sandwich Cobalt-precorrin-4 Transmethylase; domain 1 Cobalt-precorrin-4 Transmethylase; Domain 1 2ybqA01
2PB4A 1VA0A 2P6IA 1VCEA 2OWGA 2EJZA 2PCMA 2EGLA 2EHLA 2HR8A 2CBFA 2EH2A 2PCKA 3KWPA 2EGSA 2DV3A 2E4NA 2E4RA 2E7RA 1WYZA 2BB3A 2ELEA 2EN5A 2PB5A 2EK4A 2HUVA 2DSGA 2E8SA 2EK2A 3ND1A 3NUTA 2PCIA 2EMRA 2DEKA 3FFYA 2E15A 2NPNA 1PJQA 2DSIA 1S4DA 2ENIA 2YBQA 2EJKA 2HUXA 3I4TA 2P5CA 2EH4A 2DV4A 2EJJA 1VE2A 2DXWA 3NEIA 2ZVBA 2P6LA 2DXVA 2ED5A 2E08A 2EKAA 2HUTA 2QBUA 1PJTA 2OWFA 2EHCA 2ELDA 2OWKA 1WDEA 1WNGA 2DSHA 2ED3A 2EL2A 2ZVCA 2DV7A 2DXXA 3FQ6A 2E0NA 2EL1A 2Z6RA 2OWUA 2EH5A 2OWVA 2EGBA 2EMUA 1V9AA 2PCHA 3NDCA 2P6DA 2P9DA 2EEQA 4E16A 2E17A 2P5FA 2E16A 2HUQA 2EK3A 2EL0A 2DV5A 2EK7A 2PCAA 1PJSA 2E07A 5HW4A 2PB6A 2E8HA 3HH1A 1CBFA 2PCGA 2YBOA 1VHVA 2EL3A 2E8QA 2E8RA 2E0KA 2P6KA 2P2XA
chains in the Genus database with same CATH superfamily
2PB4A 3T0FA 1VA0A 2P6IA 1VCEA 2OWGA 2EJZA 2PCMA 2EGLA 2EHLA 2HR8A 2CBFA 2EH2A 2PCKA 3KWPA 2EGSA 2DV3A 3TIXB 2E4NA 3SZLA 3SZOA 2E4RA 2E7RA 1WYZA 2BB3A 3LMMA 2ELEA 4N7BA 2EN5A 2PB5A 3ZGNA 2EK4A 2HUVA 2DSGA 2E8SA 2EK2A 3ND1A 3NUTA 2PCIA 2EMRA 2DEKA 3FFYA 2E15A 2NPNA 4H4EA 1PJQA 2DSIA 1S4DA 2ENIA 2YBQA 2EJKA 2HUXA 3UWMA 3KE9A 3I4TA 2P5CA 2EH4A 2DV4A 4MUYA 2EJJA 1VE2A 2DXWA 3NEIA 2ZVBA 2P6LA 2DXVA 2ED5A 2E08A 2EKAA 2HUTA 2QBUA 1PJTA 2OWFA 2EHCA 2ELDA 2OWKA 1WDEA 4H4CA 1WNGA 2DSHA 3ZGLA 2ED3A 2EL2A 2ZVCA 3DNFA 2DV7A 2DXXA 2KYYA 3UV3A 3FQ6A 2E0NA 2EL1A 2Z6RA 3UTCA 2OWUA 2EH5A 2OWVA 3UV6A 2EGBA 2EMUA 1V9AA 2PCHA 3NDCA 3SZUA 2P6DA 2P9DA 2EEQA 4MV5A 4E16A 2E17A 4H4DA 3T0GA 3KEFA 4MV0A 2P5FA 2E16A 2HUQA 2EK3A 3KEMA 4MUXA 3F7TA 2EL0A 2DV5A 2EK7A 2PCAA 1PJSA 2E07A 3KELA 5HW4A 3KE8A 2PB6A 2E8HA 3HH1A 1CBFA 2PCGA 2YBOA 1VHVA 2EL3A 2E8QA 2E8RA 3UV7A 3URKA 4EB3A 3UTDA 2E0KA 2P6KA 2P2XA
chains in the Genus database with same CATH topology
2PB4A 3T0FA 1VA0A 2P6IA 1VCEA 2OWGA 2EJZA 2PCMA 2EGLA 2EHLA 2HR8A 2CBFA 2EH2A 2PCKA 3KWPA 2EGSA 2DV3A 3TIXB 2E4NA 3SZLA 3SZOA 2E4RA 2E7RA 1WYZA 2BB3A 3LMMA 2ELEA 4N7BA 2EN5A 2PB5A 3ZGNA 2EK4A 2HUVA 2DSGA 2E8SA 2EK2A 3ND1A 3NUTA 2PCIA 2EMRA 2DEKA 3FFYA 2E15A 2NPNA 4H4EA 1PJQA 2DSIA 1S4DA 2ENIA 2YBQA 2EJKA 2HUXA 3UWMA 3KE9A 3I4TA 2P5CA 2EH4A 2DV4A 4MUYA 2EJJA 1VE2A 2DXWA 3NEIA 2ZVBA 2P6LA 2DXVA 2ED5A 2E08A 2EKAA 2HUTA 2QBUA 1PJTA 2OWFA 2EHCA 2ELDA 2OWKA 1WDEA 4H4CA 1WNGA 2DSHA 3ZGLA 2ED3A 2EL2A 2ZVCA 3DNFA 2DV7A 2DXXA 2KYYA 3UV3A 3FQ6A 2E0NA 2EL1A 2Z6RA 3UTCA 2OWUA 2EH5A 2OWVA 3UV6A 2EGBA 2EMUA 1V9AA 2PCHA 3NDCA 3SZUA 2P6DA 2P9DA 2EEQA 4MV5A 4E16A 2E17A 4H4DA 3T0GA 3KEFA 4MV0A 2P5FA 2E16A 2HUQA 2EK3A 3KEMA 4MUXA 3F7TA 2EL0A 2DV5A 2EK7A 2PCAA 1PJSA 2E07A 3KELA 5HW4A 3KE8A 2PB6A 2E8HA 3HH1A 1CBFA 2PCGA 2YBOA 1VHVA 2EL3A 2E8QA 2E8RA 3UV7A 3URKA 4EB3A 3UTDA 2E0KA 2P6KA 2P2XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PB4 A;  1VA0 A;  2P6I A;  1VCE A;  2OWG A;  2EJZ A;  2PCM A;  2EGL A;  2EHL A;  2HR8 A;  2CBF A;  2EH2 A;  2PCK A;  3KWP A;  2EGS A;  2DV3 A;  2E4N A;  2E4R A;  2E7R A;  1WYZ A;  2BB3 A;  2ELE A;  2EN5 A;  2PB5 A;  2EK4 A;  2HUV A;  2DSG A;  2E8S A;  2EK2 A;  3ND1 A;  3NUT A;  2PCI A;  2EMR A;  2DEK A;  3FFY A;  2E15 A;  2NPN A;  1PJQ A;  2DSI A;  1S4D A;  2ENI A;  2YBQ A;  2EJK A;  2HUX A;  3I4T A;  2P5C A;  2EH4 A;  2DV4 A;  2EJJ A;  1VE2 A;  2DXW A;  3NEI A;  2ZVB A;  2P6L A;  2DXV A;  2ED5 A;  2E08 A;  2EKA A;  2HUT A;  2QBU A;  1PJT A;  2OWF A;  2EHC A;  2ELD A;  2OWK A;  1WDE A;  1WNG A;  2DSH A;  2ED3 A;  2EL2 A;  2ZVC A;  2DV7 A;  2DXX A;  3FQ6 A;  2E0N A;  2EL1 A;  2Z6R A;  2OWU A;  2EH5 A;  2OWV A;  2EGB A;  2EMU A;  1V9A A;  2PCH A;  3NDC A;  2P6D A;  2P9D A;  2EEQ A;  4E16 A;  2E17 A;  2P5F A;  2E16 A;  2HUQ A;  2EK3 A;  2EL0 A;  2DV5 A;  2EK7 A;  2PCA A;  1PJS A;  2E07 A;  5HW4 A;  2PB6 A;  2E8H A;  3HH1 A;  1CBF A;  2PCG A;  2YBO A;  1VHV A;  2EL3 A;  2E8Q A;  2E8R A;  2E0K A;  2P6K A;  2P2X A; 
#chains in the Genus database with same CATH topology
 2PB4 A;  3T0F A;  1VA0 A;  2P6I A;  1VCE A;  2OWG A;  2EJZ A;  2PCM A;  2EGL A;  2EHL A;  2HR8 A;  2CBF A;  2EH2 A;  2PCK A;  3KWP A;  2EGS A;  2DV3 A;  3TIX B;  2E4N A;  3SZL A;  3SZO A;  2E4R A;  2E7R A;  1WYZ A;  2BB3 A;  3LMM A;  2ELE A;  4N7B A;  2EN5 A;  2PB5 A;  3ZGN A;  2EK4 A;  2HUV A;  2DSG A;  2E8S A;  2EK2 A;  3ND1 A;  3NUT A;  2PCI A;  2EMR A;  2DEK A;  3FFY A;  2E15 A;  2NPN A;  4H4E A;  1PJQ A;  2DSI A;  1S4D A;  2ENI A;  2YBQ A;  2EJK A;  2HUX A;  3UWM A;  3KE9 A;  3I4T A;  2P5C A;  2EH4 A;  2DV4 A;  4MUY A;  2EJJ A;  1VE2 A;  2DXW A;  3NEI A;  2ZVB A;  2P6L A;  2DXV A;  2ED5 A;  2E08 A;  2EKA A;  2HUT A;  2QBU A;  1PJT A;  2OWF A;  2EHC A;  2ELD A;  2OWK A;  1WDE A;  4H4C A;  1WNG A;  2DSH A;  3ZGL A;  2ED3 A;  2EL2 A;  2ZVC A;  3DNF A;  2DV7 A;  2DXX A;  2KYY A;  3UV3 A;  3FQ6 A;  2E0N A;  2EL1 A;  2Z6R A;  3UTC A;  2OWU A;  2EH5 A;  2OWV A;  3UV6 A;  2EGB A;  2EMU A;  1V9A A;  2PCH A;  3NDC A;  3SZU A;  2P6D A;  2P9D A;  2EEQ A;  4MV5 A;  4E16 A;  2E17 A;  4H4D A;  3T0G A;  3KEF A;  4MV0 A;  2P5F A;  2E16 A;  2HUQ A;  2EK3 A;  3KEM A;  4MUX A;  3F7T A;  2EL0 A;  2DV5 A;  2EK7 A;  2PCA A;  1PJS A;  2E07 A;  3KEL A;  5HW4 A;  3KE8 A;  2PB6 A;  2E8H A;  3HH1 A;  1CBF A;  2PCG A;  2YBO A;  1VHV A;  2EL3 A;  2E8Q A;  2E8R A;  3UV7 A;  3URK A;  4EB3 A;  3UTD A;  2E0K A;  2P6K A;  2P2X A; 
#chains in the Genus database with same CATH homology
 2PB4 A;  3T0F A;  1VA0 A;  2P6I A;  1VCE A;  2OWG A;  2EJZ A;  2PCM A;  2EGL A;  2EHL A;  2HR8 A;  2CBF A;  2EH2 A;  2PCK A;  3KWP A;  2EGS A;  2DV3 A;  3TIX B;  2E4N A;  3SZL A;  3SZO A;  2E4R A;  2E7R A;  1WYZ A;  2BB3 A;  3LMM A;  2ELE A;  4N7B A;  2EN5 A;  2PB5 A;  3ZGN A;  2EK4 A;  2HUV A;  2DSG A;  2E8S A;  2EK2 A;  3ND1 A;  3NUT A;  2PCI A;  2EMR A;  2DEK A;  3FFY A;  2E15 A;  2NPN A;  4H4E A;  1PJQ A;  2DSI A;  1S4D A;  2ENI A;  2YBQ A;  2EJK A;  2HUX A;  3UWM A;  3KE9 A;  3I4T A;  2P5C A;  2EH4 A;  2DV4 A;  4MUY A;  2EJJ A;  1VE2 A;  2DXW A;  3NEI A;  2ZVB A;  2P6L A;  2DXV A;  2ED5 A;  2E08 A;  2EKA A;  2HUT A;  2QBU A;  1PJT A;  2OWF A;  2EHC A;  2ELD A;  2OWK A;  1WDE A;  4H4C A;  1WNG A;  2DSH A;  3ZGL A;  2ED3 A;  2EL2 A;  2ZVC A;  3DNF A;  2DV7 A;  2DXX A;  2KYY A;  3UV3 A;  3FQ6 A;  2E0N A;  2EL1 A;  2Z6R A;  3UTC A;  2OWU A;  2EH5 A;  2OWV A;  3UV6 A;  2EGB A;  2EMU A;  1V9A A;  2PCH A;  3NDC A;  3SZU A;  2P6D A;  2P9D A;  2EEQ A;  4MV5 A;  4E16 A;  2E17 A;  4H4D A;  3T0G A;  3KEF A;  4MV0 A;  2P5F A;  2E16 A;  2HUQ A;  2EK3 A;  3KEM A;  4MUX A;  3F7T A;  2EL0 A;  2DV5 A;  2EK7 A;  2PCA A;  1PJS A;  2E07 A;  3KEL A;  5HW4 A;  3KE8 A;  2PB6 A;  2E8H A;  3HH1 A;  1CBF A;  2PCG A;  2YBO A;  1VHV A;  2EL3 A;  2E8Q A;  2E8R A;  3UV7 A;  3URK A;  4EB3 A;  3UTD A;  2E0K A;  2P6K A;  2P2X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...