2YBYA

Structure of domains 6 and 7 of the mouse complement regulator factor h
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
123
structure length
123
Chain Sequence
ALKPCEFPQFKYGRLYYEESLRPNFPVSIGNKYSYKCDNGFSPPSGYSWDYLRCTAQGWEPEVPCVRKCVFHYVENGDSAYWEKVYVQGQSLKVQCYNGYSLQNGQDTMTCTENGWSPPPKCI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COMPLEMENT FACTOR H
publication title Design and Evaluation of Meningococcal Vaccines Through Structure-Based Modification of Host and Pathogen Molecules.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 22
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2011-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2ybyA02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2ybyA01
1G4FA 2RKYA 2KMSA 2ERJA 1TPGA 4B2RA 2V8EA 4ZH1D 2XRDA 3ERBA 2JGXA 4AYEA 1E5GA 2XWBF 1U5MA 1OK9A 5HYUB 3ZRZA 5FO8C 4J38B 1QGBA 1Q3XA 1OJWA 1TPMA 1H03P 3GOVA 2LOJA 3R62A 2JRAA 1MD8A 3OXUD 1Z92B 2XQWC 4C16A 1HCCA 2CG7A 1FBRA 1E88A 2B5ID 1NWVA 3GXEA 2IZ3A 1C1ZA 1O9AA 1GPZA 1SRZA 2RKZA 1HFHA 5HYTB 3TVJA 1G4GA 1TPNA 2A55A 4DJZA 1H2PP 2KRIA 1OJVA 4LOTA 1CKLA 3IU3I 2CKUA 4AYIA 2RL0A 4ONTD 2W80A 4PZ5A 4JHSA 1E8BA 1MD7A 3INBC 2EC3A 3L89M 4KKDA 1OK2A 2G7IA 1OK1A 3RJ3D 4LOSA 2O39C 1ZJKA 4K12A 1GKNA 2RLQA 1VVDA 1H2QP 2XRBA 5HYPA 2YRAA 1OK3A 4F4OC 3T5OA 3NFPI 3KZJA 1PPQA 4AYMA 1HFIA 2EHFA 2MCZA 4YNXA 2W81A 1QUBA 2RLPA 1UOTP 4MUCA 2YBYA 1VVCA 1GKGA 3CALA 3KXVA 1LY2A 4IGDA 3ZD1A 2QY0A 5JPMG 1OJYA 3OEDC 3SW0X 3EJHA 5I0QB 4B2SA 3IX0A 2IZ4A 4FXGG 2JGWA 2CG6A 1GHQB 2XWJI 4A5WB 5HZPB 4CSYA 1QO6A 2BZMA 1SS2A 2UWNA 3M7PA 1H04P 3O8EB 3MQLA 4WJG2 2WIIC 2MCYA 3ZD2A 4AYDA 3OP8A 1ELVA
chains in the Genus database with same CATH superfamily
1G4FA 2RKYA 2KMSA 2ERJA 5DN5A 1TPGA 4B2RA 2Y8SA 2V8EA 4ZH1D 2I2LA 4PO7A 4YIZA 2XRDA 3ERBA 2JGXA 5DN4A 4AYEA 1E5GA 2XWBF 1U5MA 1OK9A 5HYUB 3ZRZA 4APLA 5FO8C 4J38B 1QGBA 1Q3XA 3FGRA 1OJWA 1TPMA 1H03P 3GOVA 3ZLEA 2LOJA 3R62A 2JRAA 1MD8A 3OXUD 1Z92B 2XQWC 4C16A 1HCCA 2CG7A 1FBRA 1E88A 4MSLA 2B5ID 1NWVA 3GXEA 2IZ3A 1C1ZA 1O9AA 1GPZA 1SRZA 2RKZA 1HFHA 5HYTB 3NJAA 3TVJA 1G4GA 1TPNA 2A55A 4DJZA 2X2ZA 1H2PP 2KRIA 1OJVA 4LOTA 1CKLA 3IU3I 2CKUA 4AYIA 2RL0A 4ONTD 2W80A 4PZ5A 4JHSA 1E8BA 1MD7A 3INBC 3WSYA 2EC3A 3L89M 4KKDA 1OK2A 2G7IA 1OK1A 3RJ3D 4LOSA 3VWOA 2O39C 1ZJKA 4K12A 1GKNA 2RLQA 4BWCA 1VVDA 1H2QP 2XRBA 5HYPA 2YRAA 1OK3A 3K3TA 4F4OC 3F6KA 3T5OA 2ZYCA 3KZJA 3NFPI 1PPQA 4AYMA 1HFIA 2EHFA 2MCZA 4YNXA 4N7EA 3CI0J 2W81A 1QUBA 2RLPA 1UOTP 4MUCA 2YBYA 1VVCA 1GKGA 3CALA 3KXVA 3FGTA 1LY2A 2Y8RA 4IGDA 3ZD1A 2QY0A 5JPMG 1OJYA 3OEDC 3SW0X 1RLHA 3EJHA 5I0QB 4B2SA 3IX0A 2IZ4A 4FXGG 3ZLDA 2JGWA 2CG6A 1GHQB 2XWJI 4A5WB 5HZPB 4CSYA 1QO6A 2BZMA 1SS2A 2UWNA 3M7PA 1H04P 3O8EB 3WSXA 3MQLA 4WJG2 2WIIC 2MCYA 3ZD2A 2Y8TA 4AYDA 3OP8A 1ELVA
chains in the Genus database with same CATH topology
1G4FA 2RKYA 2KMSA 2ERJA 1TPGA 4B2RA 2V8EA 4ZH1D 2XRDA 3ERBA 2JGXA 4AYEA 1E5GA 2XWBF 1U5MA 1OK9A 5HYUB 3ZRZA 5FO8C 4J38B 1QGBA 1Q3XA 1OJWA 1TPMA 1H03P 3GOVA 2LOJA 3R62A 2JRAA 1MD8A 3OXUD 1Z92B 2XQWC 4C16A 1HCCA 2CG7A 1FBRA 1E88A 2B5ID 1NWVA 3GXEA 2IZ3A 1C1ZA 1O9AA 1GPZA 1SRZA 2RKZA 1HFHA 5HYTB 3TVJA 1G4GA 1TPNA 2A55A 4DJZA 1H2PP 2KRIA 1OJVA 4LOTA 1CKLA 3IU3I 2CKUA 4AYIA 2RL0A 4ONTD 2W80A 4PZ5A 4JHSA 1E8BA 1MD7A 3INBC 2EC3A 3L89M 4KKDA 1OK2A 2G7IA 1OK1A 3RJ3D 4LOSA 2O39C 1ZJKA 4K12A 1GKNA 2RLQA 1VVDA 1H2QP 2XRBA 5HYPA 2YRAA 1OK3A 4F4OC 3T5OA 3NFPI 3KZJA 1PPQA 4AYMA 1HFIA 2EHFA 2MCZA 4YNXA 2W81A 1QUBA 2RLPA 1UOTP 4MUCA 2YBYA 1VVCA 1GKGA 3CALA 3KXVA 1LY2A 4IGDA 3ZD1A 2QY0A 5JPMG 1OJYA 3OEDC 3SW0X 3EJHA 5I0QB 4B2SA 3IX0A 2IZ4A 4FXGG 2JGWA 2CG6A 1GHQB 2XWJI 4A5WB 5HZPB 4CSYA 1QO6A 2BZMA 1SS2A 2UWNA 3M7PA 1H04P 3O8EB 3MQLA 4WJG2 2WIIC 2MCYA 3ZD2A 4AYDA 3OP8A 1ELVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G4F A;  2RKY A;  2KMS A;  2ERJ A;  1TPG A;  4B2R A;  2V8E A;  4ZH1 D;  2XRD A;  3ERB A;  2JGX A;  4AYE A;  1E5G A;  2XWB F;  1U5M A;  1OK9 A;  5HYU B;  3ZRZ A;  5FO8 C;  4J38 B;  1QGB A;  1Q3X A;  1OJW A;  1TPM A;  1H03 P;  3GOV A;  2LOJ A;  3R62 A;  2JRA A;  1MD8 A;  3OXU D;  1Z92 B;  2XQW C;  4C16 A;  1HCC A;  2CG7 A;  1FBR A;  1E88 A;  2B5I D;  1NWV A;  3GXE A;  2IZ3 A;  1C1Z A;  1O9A A;  1GPZ A;  1SRZ A;  2RKZ A;  1HFH A;  5HYT B;  3TVJ A;  1G4G A;  1TPN A;  2A55 A;  4DJZ A;  1H2P P;  2KRI A;  1OJV A;  4LOT A;  1CKL A;  3IU3 I;  2CKU A;  4AYI A;  2RL0 A;  4ONT D;  2W80 A;  4PZ5 A;  4JHS A;  1E8B A;  1MD7 A;  3INB C;  2EC3 A;  3L89 M;  4KKD A;  1OK2 A;  2G7I A;  1OK1 A;  3RJ3 D;  4LOS A;  2O39 C;  1ZJK A;  4K12 A;  1GKN A;  2RLQ A;  1VVD A;  1H2Q P;  2XRB A;  5HYP A;  2YRA A;  1OK3 A;  4F4O C;  3T5O A;  3NFP I;  3KZJ A;  1PPQ A;  4AYM A;  1HFI A;  2EHF A;  2MCZ A;  4YNX A;  2W81 A;  1QUB A;  2RLP A;  1UOT P;  4MUC A;  2YBY A;  1VVC A;  1GKG A;  3CAL A;  3KXV A;  1LY2 A;  4IGD A;  3ZD1 A;  2QY0 A;  5JPM G;  1OJY A;  3OED C;  3SW0 X;  3EJH A;  5I0Q B;  4B2S A;  3IX0 A;  2IZ4 A;  4FXG G;  2JGW A;  2CG6 A;  1GHQ B;  2XWJ I;  4A5W B;  5HZP B;  4CSY A;  1QO6 A;  2BZM A;  1SS2 A;  2UWN A;  3M7P A;  1H04 P;  3O8E B;  3MQL A;  4WJG 2;  2WII C;  2MCY A;  3ZD2 A;  4AYD A;  3OP8 A;  1ELV A; 
#chains in the Genus database with same CATH topology
 1G4F A;  2RKY A;  2KMS A;  2ERJ A;  5DN5 A;  1TPG A;  4B2R A;  2Y8S A;  2V8E A;  4ZH1 D;  2I2L A;  4PO7 A;  4YIZ A;  2XRD A;  3ERB A;  2JGX A;  5DN4 A;  4AYE A;  1E5G A;  2XWB F;  1U5M A;  1OK9 A;  5HYU B;  3ZRZ A;  4APL A;  5FO8 C;  4J38 B;  1QGB A;  1Q3X A;  3FGR A;  1OJW A;  1TPM A;  1H03 P;  3GOV A;  3ZLE A;  2LOJ A;  3R62 A;  2JRA A;  1MD8 A;  3OXU D;  1Z92 B;  2XQW C;  4C16 A;  1HCC A;  2CG7 A;  1FBR A;  1E88 A;  4MSL A;  2B5I D;  1NWV A;  3GXE A;  2IZ3 A;  1C1Z A;  1O9A A;  1GPZ A;  1SRZ A;  2RKZ A;  1HFH A;  5HYT B;  3NJA A;  3TVJ A;  1G4G A;  1TPN A;  2A55 A;  4DJZ A;  2X2Z A;  1H2P P;  2KRI A;  1OJV A;  4LOT A;  1CKL A;  3IU3 I;  2CKU A;  4AYI A;  2RL0 A;  4ONT D;  2W80 A;  4PZ5 A;  4JHS A;  1E8B A;  1MD7 A;  3INB C;  3WSY A;  2EC3 A;  3L89 M;  4KKD A;  1OK2 A;  2G7I A;  1OK1 A;  3RJ3 D;  4LOS A;  3VWO A;  2O39 C;  1ZJK A;  4K12 A;  1GKN A;  2RLQ A;  4BWC A;  1VVD A;  1H2Q P;  2XRB A;  5HYP A;  2YRA A;  1OK3 A;  3K3T A;  4F4O C;  3F6K A;  3T5O A;  2ZYC A;  3KZJ A;  3NFP I;  1PPQ A;  4AYM A;  1HFI A;  2EHF A;  2MCZ A;  4YNX A;  4N7E A;  3CI0 J;  2W81 A;  1QUB A;  2RLP A;  1UOT P;  4MUC A;  2YBY A;  1VVC A;  1GKG A;  3CAL A;  3KXV A;  3FGT A;  1LY2 A;  2Y8R A;  4IGD A;  3ZD1 A;  2QY0 A;  5JPM G;  1OJY A;  3OED C;  3SW0 X;  1RLH A;  3EJH A;  5I0Q B;  4B2S A;  3IX0 A;  2IZ4 A;  4FXG G;  3ZLD A;  2JGW A;  2CG6 A;  1GHQ B;  2XWJ I;  4A5W B;  5HZP B;  4CSY A;  1QO6 A;  2BZM A;  1SS2 A;  2UWN A;  3M7P A;  1H04 P;  3O8E B;  3WSX A;  3MQL A;  4WJG 2;  2WII C;  2MCY A;  3ZD2 A;  2Y8T A;  4AYD A;  3OP8 A;  1ELV A; 
#chains in the Genus database with same CATH homology
 1G4F A;  2RKY A;  2KMS A;  2ERJ A;  1TPG A;  4B2R A;  2V8E A;  4ZH1 D;  2XRD A;  3ERB A;  2JGX A;  4AYE A;  1E5G A;  2XWB F;  1U5M A;  1OK9 A;  5HYU B;  3ZRZ A;  5FO8 C;  4J38 B;  1QGB A;  1Q3X A;  1OJW A;  1TPM A;  1H03 P;  3GOV A;  2LOJ A;  3R62 A;  2JRA A;  1MD8 A;  3OXU D;  1Z92 B;  2XQW C;  4C16 A;  1HCC A;  2CG7 A;  1FBR A;  1E88 A;  2B5I D;  1NWV A;  3GXE A;  2IZ3 A;  1C1Z A;  1O9A A;  1GPZ A;  1SRZ A;  2RKZ A;  1HFH A;  5HYT B;  3TVJ A;  1G4G A;  1TPN A;  2A55 A;  4DJZ A;  1H2P P;  2KRI A;  1OJV A;  4LOT A;  1CKL A;  3IU3 I;  2CKU A;  4AYI A;  2RL0 A;  4ONT D;  2W80 A;  4PZ5 A;  4JHS A;  1E8B A;  1MD7 A;  3INB C;  2EC3 A;  3L89 M;  4KKD A;  1OK2 A;  2G7I A;  1OK1 A;  3RJ3 D;  4LOS A;  2O39 C;  1ZJK A;  4K12 A;  1GKN A;  2RLQ A;  1VVD A;  1H2Q P;  2XRB A;  5HYP A;  2YRA A;  1OK3 A;  4F4O C;  3T5O A;  3NFP I;  3KZJ A;  1PPQ A;  4AYM A;  1HFI A;  2EHF A;  2MCZ A;  4YNX A;  2W81 A;  1QUB A;  2RLP A;  1UOT P;  4MUC A;  2YBY A;  1VVC A;  1GKG A;  3CAL A;  3KXV A;  1LY2 A;  4IGD A;  3ZD1 A;  2QY0 A;  5JPM G;  1OJY A;  3OED C;  3SW0 X;  3EJH A;  5I0Q B;  4B2S A;  3IX0 A;  2IZ4 A;  4FXG G;  2JGW A;  2CG6 A;  1GHQ B;  2XWJ I;  4A5W B;  5HZP B;  4CSY A;  1QO6 A;  2BZM A;  1SS2 A;  2UWN A;  3M7P A;  1H04 P;  3O8E B;  3MQL A;  4WJG 2;  2WII C;  2MCY A;  3ZD2 A;  4AYD A;  3OP8 A;  1ELV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...