2YC0A

Factor inhibiting hif-1 alpha in complex with r-2-hydroxyglutarate
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
349
structure length
349
Chain Sequence
MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
publication title The oncometabolite 2-hydroxyglutarate inhibits histone lysine demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 104
structure length 349
sequence length 349
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2011-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2yc0A02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2yc0A01
1IZ3A 4QU2A 2CGOA 4Z1VA 4BIOA 1YCIA 4JAAA 4B7EA 4NR1A 1H2LA 3D8CA 3KCXA 1H2MA 2YC0A 2YDEA 4Z2WA 1H2NA 4AI8A 2WA3A 2W0XA 5JWPA 3KCYA 2ILMA 2CGNA 3P3PA 2XUMA 3P3NA 4B7KA 2Y0IA 3OD4A 1H2KA 2WA4A 1MZFA 1MZEA
chains in the Genus database with same CATH superfamily
1NCRB 3OUFA 2ZZQA 3T09A 4BQ1A 1ASJ3 4LNUB 4E4EA 3LWCA 2XASA 1IBLB 3OMNB 1QQP3 4Y4RA 1D5AA 4OFGA 3MHSC 3BOWA 1R1BA 2IFRA 4LFAO 1HR0B 3RYKA 4WFFA 2QQWA 3H3LA 1J1TA 4HKLA 1PMIA 2VWKA 1V55C 3GZAA 3PN1A 1XBFA 1AX0A 2VNRA 3DC5A 4COZA 2HLEA 3K04A 5ITZB 4FPPA 1O5LA 3VBHC 3VQXA 1NAEA 4JI4B 1NCQC 2H6BA 3DXRB 1ENVA 3N7MA 2R063 1S5JA 1WUVA 4P9YA 4X65O 4KNCA 3POSA 4L97A 1FAFA 5AVPA 2B46X 1R3IC 1W6PA 4XUQA 4U7OA 4QQOA 1PZ8A 2W39A 2BNNA 4O2AB 1CEZA 4FPEA 4CCJA 3Q8EA 4CU9A 3W20A 1F7YA 2W68A 1ULFA 4JRLA 1Z7S1 5J1XA 2CSGA 3D6EA 2QUOA 4XTMA 3URFA 1N1TA 3UJOA 3H1WA 4Q0PA 4COVA 4UV8A 4QWNA 1B04A 1I5ZA 2KG7B 2UUAB 1HJGA 1MS1A 1VF5B 5DDJ3 4XBFA 3H3ZA 1UYYA 2XJUA 2OUHA 1XQ8A 2D98A 3W7WA 2YFUA 4CEWC 4IEYA 2CY6A 5DAQA 2P4EA 5FZ3A 4C91A 2DCYA 4QNHB 1PGW2 1AXKA 5F6LB 2XBO3 4N53A 4JKKA 4QX1A 4YVWB 1S4CA 4PBPA 3H8OA 1K5JA 4RL7A 3CLPA 4MVUA 2HKOA 1ZRDA 2NR5A 2Q68A 2P90A 1AR5A 5EPAA 4OXSA 2HWC3 4LF9O 2HWB1 2BOCC 3FX7A 2UWAA 2WJSA 3OOXA 1XUQA 3CC2V 3CHXA 4BYYA 5L3FA 3T2OA 1LODA 1NCRC 5IK5A 4QM8A 2VMGA 4B29A 1VRH2 4DXRA 3QF7A 2YICA 3PUSA 2IXIA 1ROPA 4TQDA 4BIFA 2VR4A 1MG1A 4DEQA 2O8OA 1MS9A 2ZS6B 4S2GA 1F23A 3ZJZA 2JK5C 4CDXA 2JD9A 4ZIBA 5FZ1A 5JR2A 1XNRO 2F4VO 5C5TA 4LF8B 5F2SA 3SPIA 1D0GA 1AP6A 3BODA 5L9RA 1VAKA 4DR7B 2G9GA 3K4DA 3ZN5A 4MUVA 5FZMA 1N0NA 2JJ1G 5LMUB 1GBGA 2CK3G 4PV1B 3RYHA 3TB0A 2AZ0A 4JTOA 1FT9A 2GMPA 4R8CA 2EINB 2Z0AA 5FP9A 2ZD9A 5B5EZ 1HDJA 4AEKA 2XHKA 1R1A2 1COV1 2LUWA 1GP6A 1MZ6A 5HXVA 2N05A 3T2QA 3WVJA 2Q30A 5IYCO 3G80A 1FPN2 1GNZA 1JOYA 4K1YA 4QB6A 3A7QA 5D5PA 2JEUA 4S2DA 2OW4A 5IJ0A 2QEXV 3D82A 2E9QA 1H8HG 3O65A 1Q82W 4JI7B 3UGGA 2DVAA 3ZKUA 1H2NA 3NJVA 5IJ9B 3FLPA 5JMCA 1DFQA 1AR93 2ZMNA 4COWA 5ISLA 2RV9A 1W0KG 2QR4A 4ZU7A 1H38A 4XF9A 1SQXH 5BR8O 4CU6A 4H0LB 1RP3B 3UESA 2BPA2 4CH6A 4DV5O 4CXYA 3U37A 5A3TA 2ZEXA 3VQWA 4CVUA 1S76D 4YVWC 1XL6A 2DW4A 1IS5A 5IATA 3MF9A 3OEAA 1AZDA 1AUYA 3NNJA 2B4KA 1NKDA 3VDAA 1POV1 5KMGA 4LUMA 2XKOA 1KQSU 3U0ZA 4LOSA 2W92A 2VBDA 1EN4A 3AK1A 1ENSA 5G05L 1U5XA 4P00B 4L9BA 4CPBA 3VKFC 3ABLB 1IXMA 1NE6A 3I2GA 2Y6GA 2WWUA 5D5QA 1U5IA 1X82A 2Y4TA 1P84F 2XAJA 1N0JA 1D2DA 2ET1A 2E5LO 5SV8A 3WB2A 3WNNA 2F4LA 3J80N 1UNBA 1WW7A 3X29B 3PHMA 4CC5A 1YZBA 4IE7A 1GQHA 4AVAA 4M00A 4BQ3A 3DL3A 1KMIZ 1XE7A 1AYN2 4LBQA 4LXLA 5BV6A 4EQVA 1BVP1 5EBWC 4NWVA 1OXCA 4H7MA 3IB3A 2RR12 5D21A 2M6YA 4PIXA 3ZXEA 1V9PA 4DUZB 2UWCA 1Q56A 2A1XA 3DF0A 3NNMA 4XQWA 4LF5O 1NYWA 3A2FA 2EINC 2A3WA 4IT5A 2V5YA 4W65A 4CPBD 4OUEA 5K4LA 2F93B 2D6OX 4QHBA 1GRJA 1RIRA 2BWCA 4S2HA 2G1MA 4GWJA 1SQVH 5IYBO 5KR7A 5E88A 3RVYA 3CJXA 4WM7B 3WNLA 2A71A 1NH2D 4H55A 2R70A 2HWD2 2ZQMA 3STLC 3L74H 1WCSA 1CGPA 4JTCB 2PAMA 1KFXL 2XVLA 4QX7A 3ES4A 2EBOA 3LFIA 2VTXJ 4DR3O 4LBQD 3ACGA 2OX0A 3DPRA 1VBB2 2ZEYA 4UW6A 1MZEA 3AXDA 2NN8A 5A2QN 4LF6B 2ERFA 2BE3A 3O7OA 3TCUA 2PHXA 4JKMA 1EUUA 1YIFA 3J7MA 1OOPB 1J58A 1O59A 1ZVFA 3M3QA 4E2QA 4KMQA 2P6JA 2VCBA 3KZIZ 2DWDC 1RUI2 1JZ8A 5KXDA 3ZRSA 1LKNA 4RUEA 3NO8A 3VLBB 4O4JB 3ABLC 2HYKA 1AR61 4AHXA 5L3DA 1K8AW 4IIJA 4FSJA 1LGCA 4AILC 2UXBB 1A78A 3OY8A 4K1ZA 4FPFA 3MUZ1 4FPHA 3OGVA 5GLUA 4CSWA 3VZMA 2R1BA 3I2OA 3NKTA 1OFNA 3I5DA 3ZHUA 5FLHA 3GZEA 3CJHB 1LHUA 4YY3B 4DV4O 4CCDA 3JD0A 1ZX5A 1CD3G 4KH9A 3S57A 2HHHB 1RFYA 1U5ZA 4UXAA 5JI7A 4ZI7B 1IX9A 4BA6A 3A23A 1HDKA 3WG3A 3ACFA 4HG6B 2Z5WA 1POV3 2ZGOA 4W4LA 2FMDA 2VU9A 2VQ0A 1H1MA 2R073 1ZZ6A 4J80A 4EN9B 2X29A 2YMZA 4N21A 1OD3A 4BLJA 3GBWA 5IY5B 4WFHA 1AB3A 2W08A 3NRUA 4CEYB 3OBAA 2ZGNA 2JENA 2XWBB 3WW3A 3NNFA 4I9WA 4ATFA 4Y3OA 1Q90D 4UCSA 3CZJA 1F4AA 5GTIZ 4RO2A 4JYAO 1V6OA 3JSLA 1JR9A 3O12A 1SFPA 3CKHA 1JYCA 3Q9OA 2A0LA 1OZ0A 2JE7A 1OSGA 3R4UA 4WM7C 4BW5A 2YHJA 2RE9A 3LPFA 4DUYB 3OYWA 3ZPOA 4J25A 4HT1T 2OTJV 1X8MA 4BB3A 1Q8OA 2GN7A 5CBFA 1JYTA 1S0DA 4XHXA 1N33O 2XQXA 3H1MA 2W94A 1X4TA 1GKBA 1KD7A 1JZ6A 2QWNB 4EN6B 4C1XA 1OOPC 2IWGB 1MVEA 3ST7A 3HNMA 4XAAA 1H6XA 4B7EA 3PU8A 2FD8A 4PDLA 2JKBA 1VQ9V 1ZBE3 1QJEA 4K8RB 3GYDA 2XAHA 1APNA 2H94A 2YSUB 4AVBA 1SLAA 5A3UA 4NRPA 1JX9A 1LOCA 2B1IA 5DPNA 2TEPA 1PPJH 1TME3 3J7LA 4FM0A 1AYM2 1LOFA 1YFXA 3WF1A 4A3ZA 3OBZA 2RJKA 2JDAA 5EP9A 5AG2A 1W9YA 1L0LH 1Q8SA 1JZ5A 3VZNA 4NIGA 4AHCA 1RC6A 4P9IA 1R092 4UVCA 1F2NA 5KUMA 3R66A 2QVSB 2JB4A 1I9RA 3RYIB 3OT7A 1L1FA 1FJGO 4NAOA 5FBJA 5J2UA 3WW4A 1AROP 3ZYIB 2P5BA 4X20B 3ZMOA 4BCUA 5B4NA 4ZZ5A 2WSSG 4L8JA 2WZR2 2DVFA 1Q81W 1PM7A 1YJLA 2NM1A 4W4KA 4LMFA 2ITDC 1JYXA 4XF1A 3NV4A 1H8TB 5IY5C 2VUAA 4FOVA 1QJY3 5ABJB 4I9QA 4CEYC 5B1OA 3SEEA 5F2VO 3VD5A 1VRBA 4CDQA 4AQTA 1DZQA 4MG2A 1R082 2B9UA 5FYIA 1PGW1 2Y0PA 1OLME 2VMEA 2Q1ZB 2WNUB 3L70H 3KM5A 4LJHA 1OQ1A 4QXCA 1R6NA 3Q4HA 1XSQA 1KS5A 4JQTA 5BNNB 3OD4A 1JZ7A 1CP9A 2LFRA 4N23A 5A3OA 5HI0A 2Q0OC 4ICGA 4LO5B 4AVSA 1S77D 2D43A 1XPWA 1Q5OA 2VBPA 3H8RA 2F6BA 4MTFA 4AAPA 1ONAA 2EIGA 4XBNA 3I2HA 1QHTA 2P4KA 5JOYA 4IE5A 1TUBA 1VRH1 4LBMA 1HNWB 3OUIA 4J7ZA 1CONA 3M3IA 3B40A 1U97A 4YVSA 4XHBA 3TN93 3APOA 4QQ2A 1W39A 4LHLA 1BXHA 2BNMA 3T0BA 3RVZA 4TOIA 1ZL8B 1NX9A 4R4XA 3H1IH 4CTEA 2WN3A 4BISA 5B2GB 4JHTA 5EZYA 5HCBA 4LTAA 2DU0A 2QWPB 3T2TA 3UYJA 1I7FA 4JI8O 3OGGA 4IGPA 1BEV1 2B9VA 1ND2A 4IESA 2DFBA 3WEZA 4C0BA 5FZ0A 2NP0A 4KWLA 1SQFA 5FO9B 1HB4A 5DG1A 5A1AA 3BA8A 1YFYA 4N7UA 5JOXA 2WABA 1LGBA 1RUD3 4Q5OA 1OBNA 4MT8A 4MTGA 2ZKOA 4NPRA 1IG3A 4LO7A 1R1A1 1TNRA 1WP7A 5KA5A 1GOGA 4RHV3 1MNGA 4XF3A 3I3DA 1FPN1 2JDYA 5FLIA 4ONUA 1PL4A 3ZRXA 3GCWA 1VQLV 3V0BA 4GLXA 2Y48A 4QE7A 4CU7A 1HQLA 1N4CA 4J9YB 1H8TC 5ABJC 4AXOA 4RFT0 3CU7A 4N8MA 4YM1A 3CXHF 4RFRB 2W47A 1UU5A 1KKDA 3T1YB 4NAMA 4FBFA 3I56V 3MV01 1V00A 2WNUC 4LF6O 3HWJA 2BERA 1VPHA 4FTEA 5CMUA 4TV9B 2LW7A 5BNNC 1XNKA 4R7CA 4JGZB 5K9YA 3UKMA 3AYAA 5GM0A 1ND3B 4N90A 2K46A 5LA6A 3E22B 1C3HA 1EAH2 2GH2A 4Q0UA 2UUBB 4JI1B 1C28A 4AHWA 4DB5A 3D36A 1DGRN 5T52A 2LM3A 4YJ3B 4R4ZA 3NAPB 1EM1A 4I0XB 3GJAA 2X5IB 4H44B 1GZWB 2WO3A 1C4RA 4PQ9A 5FY4A 2VBBA 3I3QA 3ZVXA 2CTWA 3PIJA 3ASNB 1W2BU 4YY3O 2A3XA 4IE0A 1G9DA 2ZNIA 2A70A 2W3JA 4BQWA 3OB8A 2QKSA 1MEC1 2YBPA 4QPWA 4IETA 2YI9A 3BTZA 4PDWB 5C8YA 1AYN1 1QNMA 3VGIA 5JXGA 1XJAA 1DLBA 4YGDA 1YQ5A 3K3WA 2RR11 1FAYA 2YGMA 2ZX3A 1CAUA 3BKZA 2P3YA 3ME2A 4COUA 1C57A 1F51A 2IFWA 5GTHZ 3EHBB 2ETEA 5A6ZA 2Q8VA 1JYVA 3T1CA 4R9CA 3KQRA 1OUXA 3L75H 2GUZA 1TZOA 3RS6A 3K08A 3CCSV 1Q8QA 1G6NA 3VKOA 2IXKA 3ZYBA 5FY8A 1E5IA 1S0EA 2HWD1 1JVMA 3IIAA 5BXZA 1V54B 3ZSMA 3N9OA 5JJEB 3IDCB 2BVBA 2EAAA 5DEDA 4K21A 4ZU5A 1Z2GA 2PA7A 4Y5TA 1JZ4A 1EYBA 5A9GA 1VBB1 5HFMA 1CAXB 5I0RA 2VC9A 3M7MX 2XLFA 2WFF2 3JAKA 1PNLA 4UF0A 4CC6A 2BJSA 5EIYB 3IC7A 3E6CC 2WNEA 4FOQA 3B02A 1ULOA 4JGZC 5ACA2 1ND3C 2VE1A 4FM1A 1ZRIA 1ZLZA 2LALA 3I49A 1FPN3 1RUI1 4WFGA 2ZA9A 1W0OA 3AZWA 4MXVA 3PUHA 2OCCB 5GONA 3NAPC 4GYCB 2A9HA 4UB6Z 2X5IC 4OZXA 1WZXA 4JGSA 2GMMA 1R3JC 2FDGA 4B3MB 1IPKA 3KCCA 1K42A 1TA8A 4XOGA 3ACIA 3JASA 4UFJA 1XSRA 1PNGA 3ASNC 5JUVA 2O8QA 5CNAA 2HWE1 3FMGA 3OE7G 1SDWA 2YEVA 1J3PA 5J2TB 3THOA 1IXBA 2BCCH 1HNXO 3RZLA 3LSUA 1NKGA 5C5UA 5FZCA 4PDWC 2JDIG 4EWDA 1JODA 2EULA 4AEJA 4QGNA 1LOAA 4TSFG 5HPOA 2KSDA 1AVBA 1MABG 2WKKA 2CGOA 5CU1A 3FHQA 4MS2A 1QEXA 4O4HB 3QBQA 4CDWB 4TZDA 3RYFB 3VDCA 5H5NA 4META 1IHMA 2PHRA 5HXMA 4RR3A 3IAQA 1AR82 2DBNA 5L7OB 2ZR3A 1YHQV 3RI9A 1DCSA 3RFRA 3OBRA 3FB6C 4HKOA 1W8FA 1OPOA 2QQUA 1V6JA 2OPWA 1YXBA 1NTMH 1K4DC 4BIZA 3O1OA 4JVAA 4UUJC 3CCRV 3BTAA 3DSQA 3KHBA 1V54C 4AVCA 3WY6A 2HBTA 2DQ3A 5JJNB 3MICA 1RXGA 5LW9A 2XXZA 5FKBA 4Y22B 2OA2A 1RITA 3PUQA 3EJKA 2WBKA 4AL9A 1FPOA 4WVWA 3WLUA 2ID4A 1W8ZA 4UB8Z 3D4KA 5IVVA 3WW2A 4QXBA 1XOUA 3ZYHA 2Q5TA 4Q26A 3DKQA 1CAVB 4PA4A 1B35A 5FUIA 2Y26A 1ZZ9A 3SPCA 2IJKA 2R6QA 5LBCA 4YGBA 5GJ6A 2OPKA 5IYDO 4Z82A 4HANA 4QKDA 2GSYA 4LBKA 5FP3A 2VZVA 5IVBA 2ADEA 2OCCC 1TQ5A 3ZIXA 2R49A 4MW8A 2KD7A 2HWD3 5LOVA 3CRMA 3ZXJA 1UY4A 1AYM1 3LKJA 4MSVA 3K79A 3VDBA 2P6CA 4X1IB 3GZTB 2H3OA 4Z1VA 3NV3A 1O8PA 3MF6A 1GOFA 3CRAA 1REDA 4B4QA 3FJSA 1H6YA 4W4ZA 1VBC2 4JYYA 3LNMB 2E3CA 1VBB3 1ZZ7A 3BCCH 3UT5B 2ZX0A 3O0VA 4DMIA 3KF5A 3MFAA 1ZSPA 2VMDA 1LNSA 4CDUB 5J37A 2ZOEB 2XJTA 4UCTA 4CH5A 5AC92 3I7DA 4PA9A 3R05A 2YC2A 4OHVA 1VBE1 1S0VA 1LECA 2QM4A 2IJHA 3RQ0A 2P22C 4AI9A 4JAUA 3T1HB 4CDWC 4CUBA 3WB1A 1YTFD 1CESA 3W5MA 1FXKB 1YJKA 3G7DA 3WT3A 4BQ4A 3EHKA 5L7OC 5A7OA 4DV7B 1W59A 1R081 2WINB 1Q86W 1ZUQA 4I4TA 2FL4A 3RDIA 1FOD2 1FMD2 2I2SA 3MO4A 1MQTA 3RI8A 1UY1A 3GNEA 3D0SA 5LRSA 3RRDA 4JYBA 3ZXLA 5C7GA 4IV1B 1NS1A 1EFRG 3INAA 2VQEO 2ZHKA 3UGHA 3VZLA 3IAYA 2VWJA 4ATEA 1W6OA 2OIEA 3T3YA 1RUE2 1GNHA 4EE2A 1RPRA 2YPDA 1VQKV 4IW3A 2Q9LA 3LF7A 1BS3A 3NXSA 4PI0A 1DZTA 2E76B 2XPJA 4PF5A 3BU7A 1WCQA 1GO3F 3FE5A 3ZHVA 2HWF1 3AXEA 2ZGUA 3W7TA 3A4UA 2WDBA 3C2UA 5FMBA 4B4PA 4D94A 1DYOA 4XPVA 1ZRRA 5IFTA 2V72A 3HMYA 1LHWA 1ZBA2 4Z8BA 1KD1W 4Z07A 4JDMA 1X59A 1DGWA 4LE4A 3ZRVA 1NXMA 2UUCB 4KHPB 1VR3A 3AZXA 3M8LA 3GM8A 3MHZA 1QNYA 3VBHA 3TEZA 1UN1A 1F15A 4LKEA 4JV5B 1VMJA 1SLBA 2OTLV 4XILA 2CDYA 4HPKB 3MGUA 3SH3A 4EKWA 1F5JA 2X10A 1YIJV 5D2AA 1GWKA 4CDUC 5EJ3A 1NZCA 4J1WA 1DF5A 3FAVB 3QLQA 4H2AA 3JD72 4EJRA 4UWDA 4DRVA 1ZX3A 3OUHA 4YW1A 3SQOA 5M0TA 4FFFA 2PZSA 4OVEA 1YXWA 5K8SA 5FZAA 1MS3A 3V0AA 5EYPB 1FXKC 2JG8A 4PA7A 1K97A 3J8F2 4GKKO 3P5BA 4IGGA 3CB2A 5JXJA 3P32A 2GP3A 3R4SA 2JDKA 3ZXDA 5CA0A 4AEDA 1SBEA 2PFWA 3CWBH 1R093 1N3PA 5IFPA 5KXBA 2HJFC 1FI2A 2JD4A 1X9PA 4IV1C 1ZAUA 2Y6KA 4ZHQB 4DR6O 4K3UA 4FVMA 4C1WA 1T5EA 1ACCA 3AMPA 1F35A 2WS93 1CZVA 2CAVA 4AFDA 5EK0A 5DUVA 4WF9V 3R65A 2HBUA 3JAWA 1WMXA 2WZR3 1MS8A 3WU2Z 2ZMKA 2JB8A 2F95B 3T08A 2VMIA 1ZWIC 5EJZB 1K5SA 2AXTZ 2D3PA 1W04A 2CL2A 4YM2A 2BV4A 2F66C 1W2NA 5EHDA 1WJZA 2RDRA 2NLJC 1SZBA 2FCVA 3WNOA 1OLRA 5KHIA 2DCKA 1XL4A 2FDFA 1SFYA 5IYYA 3H7JA 4F83A 1VBA2 3WR0A 3H9VA 1RUJ2 4AQYO 1MS0A 5FOJB 5ITZA 3ZSJA 4V1PA 1OVSA 1WCDJ 3WXPA 1QF3A 5HFLA 3PJYA 5JCTA 3DXRA 4DR5O 4XJ8A 4FFHA 5HBAA 4QX2A 2RCVA 2RDNA 1BQPA 4BXFA 4E2SA 3PMEA 3TOJA 2Q69A 4Z92B 2E26A 1XU1A 4NHLA 2QNKA 2ZABA 3C7HA 1UU6A 2VZ1A 5DXDA 1UIKA 1AI5A 1V6KA 4QAWA 3VBOB 2I45A 5C33A 1RMU3 3K4AA 3QOPA 1UPSA 1QJFA 2ZGSA 5G04L 1QH6A 4GZ9A 3AK3A 2PYJA 2KG7A 4GKJB 1UF2C 1D7PM 2DWEC 3CO2A 1ENXA 4URTA 2KR2A 5A3WA 1NR1A 4ET7A 4XBLA 2VZTA 4YNIA 4JDNA 1GSLA 1O91A 3H1HH 4AF9A 3OPTA 1OMIA 3KKYA 3RN4A 4PF1A 5T55A 4N43B 1NTKH 3S30A 4PA3A 1YUDA 2WFF1 2E53A 4DXSA 3H0OA 4U3FH 1GMGA 5ACA1 3HD8B 5CA1A 1FV3A 3ZIWA 4CCKA 2FZ1A 4MXWB 2FDHA 1QJU2 1W06A 4UYBA 5IVFA 1KJRA 1ULEA 3FD9A 1OKQA 3FX3A 4DV3O 3QNEA 1N34O 2ZGMA 2ZGTA 5A7WA 3MYXA 4IEXA 1BBT2 2E6VA 4D8MA 4BM8A 5JZGB 2DF7A 1SERA 5GALA 1PL0A 2Z79A 5AFEA 3VBSB 4MGIE 3W7UA 2VG9A 3AMMA 5A80A 3WHTA 1VALA 1XI1A 1X8EA 2A7AA 1CZSA 4I55B 4FFBB 4CP1A 3LIHA 3EFFK 5K7PA 1WB7A 4DR1B 4WVMA 1AILA 4Q8KA 3HKEB 5KXCA 4RUFA 1OLMA 1AL22 3IDBB 4PDVA 3CNAA 1TG7A 4CE8A 1RM1B 4WFEA 3FYEB 4P9LA 4O61A 4YG3A 4MV2A 2A6ZA 1GN4A 2OIIA 3HBKA 1EAH3 1GLHA 4GX2A 3I3MA 2ZHMA 1G6UA 4A5UB 1FS0G 2JKXA 4ABMA 5JPNB 2P34A 2W1QA 4MHRA 4LORA 2D6PA 4LITA 3TNQA 4A7ZA 3BIEA 3ENRA 4AEMA 4DV7O 1AR81 5GW7A 5LL6Y 5C8CA 2CAUA 4L11A 2RNBA 3VBOC 4YW4A 4RS5B 3ZFEB 4FPGA 5CG8A 4FLUA 3WCRA 1OF4A 1SLIA 1PVC2 3KV5A 1I5PA 1YJWV 3SCGA 1UMHA 3ZDSA 2VW2A 4OYUA 5GKAC 1Q8IA 2Y64A 4OI4A 4Q2FA 2ARCA 1V9U2 2D5HA 2VQUA 1BVVA 3RNSA 1OI6A 2D6NA 4R8HA 1JS9A 2JDZA 4NIHA 3VL8A 3LDCA 1ASJ2 2OQ6A 5C93A 4Z2AA 4N43C 3VD3A 3LSSA 1RJ8A 1US6A 1VLNA 5ANNA 1BK1A 4KI5M 1GM7A 3OR7C 4UCRA 1RVF3 3SC7X 2IU3A 4BR6A 2DFCA 3ZOIA 5F1RA 1DG6A 4GMP0 3WDUA 2BFUS 4GCZA 5IAVA 2DJVA 1E5RA 5FNVA 5EIBD 4B3NA 1HWYA 2PYTA 1UQXA 5EV7A 1Y9QA 3SGIA 5JZGC 4GKXA 3C3VA 4RGAA 1K45A 3VBSC 1JJOA 2KA3A 2R062 3PVBB 2GBOA 1JFFB 5LYJB 3ZHRA 4QGLA 1VBC1 3VBUB 4JAAA 4FK5C 1C8M3 2AR6A 5J9PC 3D8CA 2GNDA 2WFF3 4LF4O 1J1LA 1Y4MA 1RM1C 1YSCA 5ACA3 3APBA 3HOBA 4DV2B 1N32B 4PQQA 2X09A 2BTQB 4AQ6A 3HKDB 5AC91 2DCJA 4UT5A 4WM8B 1A34A 2SLIA 5DDJ2 4PI2A 1YF2A 3P30A 3JD1A 2XOMA 4AI1A 1M1KW 4YZ1A 2LROA 4CCEA 2OS2A 2XBO2 3N2KA 3UQ8A 1PO23 3JSNA 1CJDA 1RUH2 1SQ4A 4RS5C 2QQPA 3ZFEC 3UK9A 5JVDB 4QB2A 4ZXEA 1ODMA 2RVAA 1FOD1 2VCAA 4B3RO 1FMD1 2FDKA 3ZYRA 2V5DA 2PQSA 1S0CA 4CUCA 3VQVA 1HQWA 1XILA 2HWC2 1OCCB 2XG3A 5L36A 1QXPA 1WMEA 5LEKA 4DXWA 4Z2WA 1PV0A 1BQZA 5CB7A 1OPMA 5T50A 2CDOA 4BU2A 2UXXA 4WCEV 1PX4A 3N9QA 2UU9O 2QM7A 1SLTA 3S5QA 4AGGA 4NIDA 1RUOA 4TQFA 1MZ5A 3E83A 2EIEA 3DKWA 2IU0A 3E5UA 1LOEA 1OOPA 2RJLA 1OCZB 4YW7A 3BABA 1VQ6V 2UXCO 3SXWA 5AVAA 5DUUA 4DV1B 5GLZA 4DR4B 1AR83 3POWA 4JQRA 2N7GA 1AI6A 2EILB 4FLYA 3VD7A 1W6QB 4LWSA 1IS6A 2WL1A 2JS3A 1KP2A 3K9SA 2XLGA 5CA6A 1XNCA 2GNMA 3QH7A 3JQXA 3PJQA 4O4JA 1V6LA 2UY9A 1GQPA 4P9PA 4LFBO 1ZBA1 1VJ2A 1X33A 1IDSA 5IYZB 5FZLA 4DV6O 2P67A 2WWWA 2LW1A 3VBUC 2VOVA 1CVNA 2BVVA 4QGPA 3O1TA 4P9OA 5FTTC 4MW3A 2GDFA 1TUEB 5FPAA 4AHYA 4GX1A 5FY9A 3ZHQA 4EB6B 3HQRA 4WM8C 4JASA 2KQXA 3QTCA 1AR92 1KP3A 4K0KB 2KM2A 3I59B 2VM9A 4JAVA 4QD2A 5BXXA 1WCUA 3K0DA 1O3TA 3ZFGB 1IGOA 3F2ZA 3J8F1 2PHWA 2FDIA 1MS4A 4GUNA 1XU2A 5CFCA 4UOJA 1IZ3A 2XL9A 1VBC3 2JGDB 1W9TA 1CIYA 2B5UA 4XABA 1KDMA 1OCCC 2ILMA 3KVBA 1YJ9V 1PZ9A 1Z5VA 4X62O 1PMJX 5FYVA 3K77A 2ARAA 3WF4A 4INDA 3L9JT 3G67A 4I50A 4UBHA 2ZIOA 4GX5A 1VMFA 4G4FA 4MSWC 5EYXA 4YJ2B 3AB0A 1I5YA 4BQXA 4ASMB 1OT5A 3MAQA 2ZT9B 4GX0A 1OCZC 2VRZA 2XKPA 1NY72 2QBXA 4C90A 4NTWA 5D8AB 1K73W 2EILC 4NIIA 5H9SA 5B66Z 3RYCB 3C7FA 1IBMO 1BK0A 3QH6A 2RMU3 4I02A 5L9BA 2X05A 3JYCA 1BGYH 3PVEA 2VULA 5ERLA 3WG2A 3NKGA 4JI6B 1VBA1 5LMNO 1LEDA 1XE0A 4JGYA 1RUJ1 5CISA 3IPVB 5FYSA 1HRI2 3VHOA 1WAZA 1WGPA 4YW3A 1Q6IA 5FQ0A 2WA4A 2J42A 4Y33A 5FMDA 1RUE3 1JU4A 4AE2A 2QWRB 3DYMA 5FZOB 5H9CA 4YM0A 2P5OA 1XYOA 4QT6A 3RYIA 1JYIA 3J26N 1UKRA 1W6PB 1GN2A 3POFA 4XFFA 4LFAB 4X20A 4HVRA 5A33B 2D3RA 2C5DA 4BAYA 1JMUB 3MIBA 4DO2A 1H8TA 1QXRA 2BOJA 3N7KA 1ZBA3 4CZZA 2RS52 2J1SA 5CA3A 5JIAA 3ZFGC 5L3GA 5JR7B 3TEYA 3ZFFB 4JI3O 2JVDA 3ZX7A 4G27B 4GAZA 2BP6A 3LE0A 1DLLA 1KU9A 1OQEA 3OAAG 4DV0O 2VCCA 4X65B 2LP7A 5FJKA 5BNNA 2VZRA 1SA0B 3B9CA 2WAOA 4N53B 4FPLA 2QWOB 2CUGA 5DM6V 2RS33 4X64O 4DZGA 3U07A 1UW8A 3F7VC 1JTZX 1QJU1 5FPLA 1S0BA 3L73H 1H1IA 1BE3H 5LHIA 4GA9A 3DXTA 3KMHA 1D4VB 5DUWA 5A1LA 4DUVA 4XJAA 3JD73 3OTFA 1AI7A 5KXEA 5GZDA 1BBT1 4I0WB 4NHYA 4O65A 2GALA 4QB1A 2Y6HA 3QVNA 3JATB 5CN0A 3V64A 1OUSA 1PIV2 1GWMA 5D8AC 1J95A 3CCUV 1VQPV 3POJA 1ZL8A 3CJIB 2PAKA 1ZZBA 1A8MA 2E31A 3RJRA 1AL21 4FPOB 4CDXB 1D0HA 4LEJA 5BYNA 2P37A 1QCEA 1JJ2U 3GDBA 2DCTA 1VQNV 1HN0A 1STMA 1VEWA 3O9OA 2R072 5KWRA 2DUOA 4P9JA 4LF9B 4CS3A 2JG9A 2HR3A 4JKLA 3K03A 3H8XA 3G6BA 2OQ7A 3C8XA 4IERA 4QHZA 1KUQA 3C7OA 2R16A 3LAGA 1SKVA 3FWEA 4K8XA 3WNKA 3RYHB 4KGGA 4BK4A 2ZGPA 1VBD2 4YSFA 1UWWA 1B6QA 1EP0A 5FRAA 4FPJA 4IEVA 5GZCA 5L19A 3N9NA 2JICA 5FPUA 2SBAA 2PMWB 4I7ZB 3HBZA 1BLZA 1UKGA 3POYA 2WSVA 2TBVA 1XNRB 2F4VB 2RHPA 5KAIZ 1PVC1 2D6KA 4QX3A 3WNPA 4NO4A 2WQZC 4XXAA 5IJ0B 1RPOA 1UOJA 4UXNA 5FAXA 5E6HA 1VBA3 1FKAO 2F17A 5KLVH 1V9U1 4QX0A 5FPBA 1US3A 3ZFFC 4UCUA 4QQHA 3KSCA 1OURA 1QJZA 3PUIA 1ASJ1 2VQTA 1JYNA 4GIQA 5HV0A 2TNFA 4K3AA 4JGZA 3H3UA 1ZBE2 4N53C 1ND3A 4DV1O 1QIQA 2EIBA 3T4HB 1F8VA 1G1XB 5CADA 2HJDA 4Q4V2 4BLIA 5JXHA 1NJIW 3TNPB 2R9AA 1YYNA 5KMGB 5CZKA 4CXXA 1TMF3 5J36A 3C90A 1TME2 4YJ3A 3CL1A 3D3AA 3AC0A 4I0XA 3LSDA 2QKCA 2X5IA 1GZWA 3JBG3 4OCTA 1ULGA 3W58A 2X6BA 2R061 4DV5B 5D1IA 3UO3A 3CJIC 4TN7A 1JZ3A 4ES8A 3ZYFA 4CDXC 3M8AA 1NH2B 5DAPA 4Y1VA 1IKPA 3STZC 1FV2A 1M4WA 3ZMVA 4LBJA 3N27A 4IEQA 4BQYA 1BMFG 1P8JA 2VW1A 3M7AA 4PDRA 1GNYA 2IH1C 1N36O 2IH3C 5C9AA 4CCOA 4KQ7A 4LBQB 3OFNG 1EV12 3ZSKA 4B3TO 1QJY2 4ZONA 2QE3A 2MK3A 5DDJ1 5FZFA 4HZ3A 3NJZA 4OI0A 2AYHA 2HEPA 1HRV3 2E7AA 2ARHA 4V2VA 5CG9A 2WLLA 1OH4A 3A0KA 1BBT3 3M1HA 3AKPA 3F7YC 5I8YA 2EF6A 2LFSA 3GHNA 1W99A 5FYZA 2E5LB 1S3JA 2X6CA 2Q73A 2XBO1 2XT9A 2JE8A 2XL7A 3S7IA 1RHI3 3AP5A 5GZFA 3UT0A 5LK7B 1LCLA 2FKXA 1F9KA 4HLTA 5EQUA 5LCWL 4BIUA 1XNQO 4QE9A 2PHDA 4E9KA 2GMEA 4Y5Z0 3OGIB 2HWC1 5T54A 3PVOA 1KKCA 4EEQA 3OGJA 1DQ4A 1JH5A 3T0DA 1WA4A 4ZU4A 2BTOA 3RMXA 4LA3A 4AZZA 4QDSA 3TN92 3A0NA 3I3EA 4XURA 4JZGA 4LF5B 2UYAA 1MACA 3ZMSA 3DPRB 2P3JA 1PO12 2XTAA 1QLEB 2WT2A 2YBSA 4Y24A 4P5HA 5LA0A 4YLZA 1Y74A 3AP7A 4K20A 4YG6A 1NA1B 2XJQA 4M3CE 3J7HA 1K34A 4TWTA 4I09A 4D0QA 5JXIA 2Q8EA 1KS4A 1H30A 2VW0A 4QIWF 4IE6A 5A3LA 1SDDB 4X8NA 4BMEA 4U7NA 1Y67A 2VGDA 5H9PA 4B3SO 3B3QE 4DR3B 1QMJA 1JPXA 2D3OW 1RUD2 1V9U3 2XNDG 2DTWA 5LP6B 3N4MA 2BYVE 3LEKA 2J1TA 1WMDA 4RHV2 1A8DA 5J2TA 3QD6A 3ZXGA 4BDVB 5B3SB 4QM9A 3SDLA 4OQ8A 1YDXA 2YB7A 4G9SB 4W6YA 4FAGA 2D5FA 3AM2A 2CV6A 4F3JA 5A7SA 4JTAB 4FOWA 4MGSA 4YZ5A 1ZYBA 2AENA 4AFBA 5IE9A 1HN1A 5C4WB 1AR91 4O4HA 1UZZA 4PLOA 4CDWA 2A73B 2L6LA 3RYFA 1B3QA 1W0PA 2YXLA 3D5OA 2V73A 1M93A 4LHSA 1JN2P 1VIWB 5IAXA 3PTYA 4XDKA 2QWQB 4ZKIA 4TV8B 4DV4B 4XQDA 4AI2A 2ZDIC 3LD8A 4BH9A 4FIPC 5JI9A 5LXTB 4XFIA 1I0HA 2GSMB 1VQ7V 2BGCA 2XB6C 1NUKA 3ZLIA 5EBMC 2R0HA 4Y22A 2VAUA 1WBLA 4X1KA 4LPLA 5IK4A 1X9TA 4JI2O 4EROA 3CCMV 4K40A 1OA3A 3SHRA 1OCOB 4GWIA 3OJBA 5FZKA 1IURA 3ETEA 1HB1A 3DPRC 3ILRA 2QZ3A 3FB5C 4ISRA 1IOAA 4I3PA 2CTQA 1QLEC 2WA3A 3E35A 3WUDA 1CAVA 5EWSA 1XMOB 4NRQA 2YXSA 1RB8G 4JYAB 1NY71 4DW1A 2R9RB 1NA1C 4QDQA 4I3GA 1RUH3 3ZN6B 2ZZJA 3B01A 2K0GA 1TGOA 3H9AA 3QCWA 4CBCA 3BCWA 3BIWE 1K3EA 2YU1A 1WN7A 3SKJE 3ETDA 4HK9A 3U10A 1Q43A 3PJSK 1WD3A 4LIUA 1W0NA 5I0TA 5KHGA 1G9BA 2WUHA 4CCLA 4X1IA 3L2YA 2Z4FA 5LP6C 3AYDA 5JH7B 1CQ9A 1UOFA 1QVGU 2AACA 2QDOA 1URXA 5F6KA 2ZHLA 3UT5A 3O5SA 1N33B 2VH9A 1K92A 5B3SC 2HKXA 3THPA 2BOIA 3O0WA 4O9EA 4CDUA 4XFBA 1RUG3 1DK1A 1I3HA 1BCCH 3I54A 3M4FA 5FZ9A 4UI9L 1KITA 3CPWU 1SQGA 1AJKA 5J2UB 5C4WC 2EJ7A 4I2OA 2ADPA 4MH0E 5DUXA 3DGEA 3HQXA 2Q8DA 4AW7A 1TNFA 3OR6C 4WZFA 4YZ4A 1SLCA 4LE3A 1L0NH 3RJ2X 1FXKA 3SJBC 4LK6A 2RMKB 1HP8A 2Y6FA 4CDQB 3B8NA 4JI5O 1QOOA 4PD4F 3CX5F 1P7BA 4NWWA 4YW2A 4HK8A 4HL0A 4X8AA 3U78A 1D2SA 3RZGA 1FJGB 2UYBA 4K9SA 3WP6A 5F8PA 3IMMA 3IIIA 5IHRA 3CSXA 3UJQA 2EXJA 2EVXA 2P06A 1OCOC 2QQLA 4XQ4A 4D6QA 3IDEA 5L73A 3AG2B 1GWLA 4Y4YA 2YV8A 3CCJV 2W2IA 2W6JG 3SEPA 4MGQA 1OCRB 2P3IA 1PIV1 1NG0A 1S1AA 4JZRA 3HT2A 2YBKA 4OHZA 2Q7HA 4QPKA 1UFIA 4I01A 3WQ0A 2EIMB 3IZOA 2WAMA 3GHMA 1UJWB 4NN0A 4DXTA 2R071 1CZTA 4XF0A 1P49A 4KWUA 4DQAA 4KBBA 3VKMA 4QPIA 1UY0A 1WB8A 4HXCA 4LA2A 5FXXA 5HCFA 4HPKA 1S55A 1SESA 3UV9A 1VBD1 2PLV3 1PM9A 3I2DA 2AEZA 3AKTA 2ZNJA 4LKFA 3GB7C 1E5HA 2Q1FA 2WWSA 2NNUA 3WCSA 4QKFA 3FAVA 2JDPA 1BMV2 3AG3B 1DGRA 4IEZA 3LNNA 2UXDO 3MIEA 3NJXA 4UW5A 4JI8B 3V0BB 5J48A 3NV2A 1DQ2A 3N35A 5I0UA 1K5MA 2DE0X 3SYPA 4Y26A 2ZR2A 5EYPA 1UY2A 2AUYA 2VNGA 1GANA 4U2AA 2R72A 3HKBA 4CDQC 1GH6A 1HRI3 1LUVA 3VN4A 1QNWA 2VQAA 2Z69A 4UFLA 3RG0A 4QX8A 1O9GA 1EBOA 2ATKC 3AP4A 4MLOA 1ZBE1 3O1PA 1A32A 3EB7A 4ZHQA 4Q4V1 2JDNA 1YNAA 2BSKA 1P7GA 4M0NA 1GU3A 3O1VA 1ODNA 3PTRB 4IYIA 4XFGA 2A6XA 1ZA7A 2VNVA 5C70A 4Y20A 3FLTA 1TME1 4MVSA 3PLQA 4XDJA 4NYKA 1M57B 1GK9A 1O6UA 1LR5A 4JPRA 3AG2C 2RDQA 3H50A 4IEPA 3DCQA 4N9IA 5EBLC 3WG7B 1OHHG 2RS53 3ASOB 2VZQA 1OCRC 4LH7A 1JUIA 3I97A 2VZOA 3AMQA 5TSWA 1AXZA 1F31A 5BNPB 3CEWA 3J81N 2VTXA 1OF3A 2QTWB 3ZRWB 1C8NA 2O14A 5CFDA 2EIMC 4AAXA 4MVQA 3U14A 5FPXA 2YYOA 4LHKA 3ZIAG 3JXSA 5GLTA 3WB0A 5C8YB 1Y7BA 1EV11 2NLRA 1QJY1 4FLVA 3ABUA 1XXNA 4UFZA 1DYPA 2BGOA 1NLQA 3VD4A 3OCPA 4NTXA 2AH2A 2N04A 1SMVA 3OTOO 1CAUB 3WUCA 1URFA 2ORZA 2QE7G 2AHZA 3D0JA 3IMNA 4GJZA 5IK7A 1RINA 4RQPA 3VBOA 1S2KA 4KG0A 3POBA 1PIV3 4IQPA 2GUZB 1C1LA 3C3SA 3K5OA 4BJ0A 3AG3C 4FLXA 5C3QA 3ETPA 3IJ4A 2WN2A 3UL2A 3FUQA 5DZEA 3ML0A 4CP2A 3WX5A 1QBZA 1XOYA 4FQZA 5TISZ 1NQJA 1YIPA 4NXNO 4RGGA 4XFAA 3I2FA 2OCHA 4DRRA 1W0JG 1DYKA 4DUXA 2B1GA 4QQLA 3MIGA 3SJQC 1FD9A 1DBNA 1HIXA 3TN91 4PJYA 4FVVA 4N43A 1DQ1A 2DVGA 5LATA 3K5NA 1HB2A 2D97A 3JCUZ 2QCSB 2YY1A 3BOPA 1XMOO 1PO11 3JAKB 4UF0B 4XUPA 3TWIA 1R6KA 1VBD3 4MXWA 2J7MA 4F6RA 3SR2C 4ZPIA 4YRDA 4HAMA 4J1XA 4E4SA 2HWB2 2WNVA 3JCIA 3WF0A 1G9AA 4F7ZA 1M57C 3L9DA 5JZGA 2CDPA 2VMCA 2MPFA 3WG7C 5GONB 5LEJA 4OHYA 3BVOA 3ASOC 3K75B 3A8TA 1XNTA 1RUD1 3HQUA 5BNPC 1CPNA 3HKEA 3JASB 4RHV1 1HXS3 1AVMA 1W6MA 2ZE8A 1GMMA 1PVXA 1KBHA 4FMTA 5HCHA 4DRXA 2XLAA 2Q4PA 3ZYGA 4IEUA 1BKZA 2ET7A 3O14A 1PX3A 5CKQA 3PL0A 1BHBA 3LUTB 4Q4V3 5FZ8A 3CC4V 3RT3C 1E1RG 4O9GA 2PHUA 4P08A 4ASLA 4MHUA 4KG8A 3ZSLA 2YZ4A 2PELA 1ZZCA 4P9GA 3NSTA 1KECA 4AI8A 2VUCA 1WLTA 2ZGLA 2BW8A 1PHMA 5FWEA 2CH7B 3JU9A 2WLHA 3VHNA 4RS5A 3ZFEA 5FXWA 3T1LA 1G9CA 3W5NA 1AX2A 5KBFA 1GAXA 4LFCO 1Z78A 3J4UH 1HNXB 2Q1MA 4OX9O 2R9IA 2PI4A 3SKVA 5F7UA 2WS92 4QQPA 4NPMA 1WLDA 2ZJCA 1SC5B 4KBZA 3WDWA 2GH8A 4FP2A 1ULCA 4PHZA 1EV13 5KHHA 3E8BA 3RYPA 2YIDA 5BUVA 1W8WA 3CXCU 3CS5A 3WP5A 2DV9A 3MFCA 3UCSC 5KX5B 4FPCA 2XOKG 3ETGA 2XONA 4Q4W2 1NI8A 1HV0A 4D6SA 3G6JB 2B45X 5JIUA 5FO7B 3ON7A 4ASUG 4NXMO 2A6YA 5FLJA 1Z5WA 1FXVA 2DYRB 3THCA 4CU8A 3WD5A 3P3PA 4JRAA 1B35B 4EZ4A 2Z42A 2ZBJA 1UCXA 5FKCA 1OLQA 3MLKA 3E86A 3EQEA 4NRMA 3MZHA 3K58A 3LIGA 3KF3A 5FK7A 1V6NA 1EN5A 1YTFB 2B7YA 3WFVA 5I8SA 3ZSEA 1XMQO 2IXJA 3AYCA 2K9PA 5LOVB 1VAVA 3MV11 1H8EG 5LYJA 4UV9A 4AQ2A 2D44A 4UCOA 2VECA 4O4LA 3JD3A 3TXSA 2WO1A 3IAPA 5IWFA 5FPVA 5E79Z 3B4SA 1RMU2 3AKQA 1PO13 3EMRA 4FLZA 2BTQA 2J22A 2VOWA 4GQ7A 2YIBA 3JARB 4HBNA 1BZKA 3RWKX 3KS7A 3VV1A 4WM8A 5KA6A 4E2LA 2EZPA 2B5HA 5FZEA 1XHXA 2J1EA 1GN6A 2NN4A 1LTEA 3BA9A 2O57A 4Q4Y3 3B2EE 1S0IA 3H8UA 2OYQA 3VD9A 3BU0A 1SF9A 1AL0G 5LY2A 5FBZA 1LRHA 1TE1B 4I4TB 2DYCA 3ZYJB 4MGTA 2OVUA 3E97A 3RZJA 2QJ1A 1G8WA 4PDMA 4Y1ZA 3ZN1A 2VJXA 3VBRA 5H6RA 1PK6A 2X6AA 4LBLA 1Y3TA 3E8GA 5F37A 4JI0O 3AX4A 2YIBD 1XRUA 2AREA 5FZ7A 3E2EA 1JU3A 1W6OB 5F2WA 4WVZA 3K51A 1D2QA 1G7YA 3DN7A 5FWJA 4E4DX 4DNYA 3LSQA 2DYRC 4Q29A 4UW4A 3ZO0B 3OD0A 4GKYA 1W6QA 5CB4B 2ATFA 4MGZE 1B35C 2QM8A 4HVOA 1N8RW 1RJ7A 1H2LA 3JALB 3T30A 4A6SA 2J1AA 1BHAA 4F4LA 3I2IA 1ENQA 1PKXA 4WZCA 5FMOS 1MA1A 2VQEB 4OUMA 4DUWA 2YUEA 4IHJB 4MX3A 4QPYA 1L8DA 3W21A 3TXQA 4LR3A 5JPMB 3RSJA 2EA7A 2ZMLA 5FYCA 1YI7A 3SYQA 3SITA 1H2MA 4W6XA 1Q6HA 4LK7A 2C0ZA 2RS13 4BZ4A 4DINB 3H42B 4TTGA 5CYYA 5DZFA 4M3CA 4P14A 1BMV1 3DYPA 2CAZC 1CXZB 4QU2A 4AI3A 2HEYF 3I59A 5FCCA 1W03A 2E32A 3MPPG 3QO8A 3WP3A 1ZM1A 4MTOA 4G2KA 1I08A 5IK8A 3V0AB 2JG8B 4L8QA 2ZXWB 3MIFA 4EN0A 3BYWA 5FZBA 1XDCA 3G4SV 2WLPA 2JGDA 2ZINA 1RVF2 4A41A 2YUAA 3ZX6A 2YXHA 3A0HZ 2DN9A 1MQTC 4AEDB 4XJUA 4LF7O 3BEHA 1FXHA 5CIRA 4AOCA 4ZOLA 3MW2A 5J98B 2YROA 5K0UA 4XUOA 1XQNA 1ZRCA 1MSDA 2EXKA 4P02B 4YJ2A 2IXCA 4YW5A 5EXOA 3AEIA 2W9XA 4XFHA 5C3OA 1G4YB 4MVMA 3W7SA 4GKKB 4LOTA 5LB6A 4AG4A 2F43G 5B1NA 2D3SA 2D6MA 1C8M2 5D8AA 3QO7A 2HG5C 3SLIA 2Q0AA 3RYCA 4AWDA 1W8TA 2W87A 1HV1A 2ZEWA 3CE2A 1LU1A 2EICA 1GV9A 4O7XA 4HVQA 5LRRA 4DR6B 4URAA 3IPVA 3DGTA 2LO1A 3VB9A 2IJIA 3M3EA 2B42B 2PTMA 2QQOA 4KWKA 2XJRA 4IEWA 3ABMB 3RZHA 4DY3A 1WA8B 3N2GA 3AFGA 2WIIB 2Y69B 3LSEA 1QXJA 2R1DA 1PO22 5FZOA 5F5CA 3GBGA 1QKQA 5IVJA 4X88A 2J1VA 1BT8A 3UM7A 1AJQA 1L7LA 2CGPA 2JWPA 2Y38A 5A33A 2KB1A 1NTZH 1HNZO 1Y9GA 4IV3A 1UYPA 1LGNA 2ZPXA 1KXGA 3FLRA 2XJVA 3FC0A 3CD6V 2D93A 3K4ZA 4J6GA 2IW5A 3CRRA 4NJ4A 4AQYB 4ES9A 2X53S 4X1YA 3KD4A 1O9HA 2VQFO 1WPXA 1ST8A 1YCIA 3ZFFA 1I6XA 4D7SA 2VVEA 2JG8C 3FKSG 2ZXWC 4X66O 3S6PA 4DR5B 1WA6X 2OZJA 1DF4A 1X50A 3JUUA 2Z2SB 4GXLA 1W2AX 4YGCA 1GR3A 1RSOB 3SJCC 1SA0A 4FQ4A 4DR2O 1UZVA 1YLLA 1VQ8V 2XJPA 3LCPA 1V70A 4AEDC 5L3EA 4XDLA 1DDLA 1FFTB 4JTDB 4X8PA 5LWBA 3T1MA 5CA1B 3M70A 2X7RB 3WF2A 4XAEA 1WW5A 3PNAA 3BRCA 4LNVA 1VMHA 3OPZA 1Y6XA 5T5LA 3Q8CA 5FP4A 4P30A 5A7WB 2JRIA 2PXJA 2JDUA 1RUNA 4BWOA 5J09A 2GTAA 1YO8A 3JATA 2Q6AA 2XJSA 4W8JA 4XCBA 2OXBA 2IUWA 4LCUC 4TUYA 3CJIA 4LC1A 5CEHA 1ZZ8A 4JHZA 4WBNA 1K12A 1SQBH 2QKAA 1S0FA 4RD7A 4WVMB 4EV0A 4GMP3 2WZEA 2CWMA 3I2JA 4D7TA 5JSPA 2RM23 2Q5ZA 1WW6A 2IZWA 2FTKA 1PMHX 2XVGA 4R50A 3KHCA 2V4AA 2PAEA 4D7YA 4NB5A 3NR7A 1BEV2 3ZMZA 4DV3B 5A7QA 3ABMC 3AK0A 1N34B 4M01A 1Y76A 4J11A 3AJYA 5FZHA 2Y69C 3SH5A 2WLQA 2NPIA 1YRZA 4M4RA 3O1MA 2P4VA 5FIXA 1FNYA 1W6NB 1WLEA 2DOSA 3CP1A 2W0XA 5GZGA 4U3JB 1R091 1POQA 3MW4A 5C8CB 1HX6A 4GWNA 4NHMA 4PIYA 1R64A 3RZZA 2HLDG 2KXLA 2CYFA 1OA2A 2WS91 1F4NA 1SG3A 2R32A 4FZ0A 4AFAA 3VZOA 1XB9A 1M9NA 4CCMA 4XACA 5H6QA 4RN5A 2WZR1 2GDSA 3HEIA 2ADDA 2A06H 3LEMA 5J7MA 4B8EA 3EXAA 4AGRA 3R4DB 4JDOA 4ZS3A 2CTPA 4JC1A 4CUGA 3E8HA 4M4PA 3OGSA 2VZUA 3ACLA 4Q4W1 4O4IB 4XJ9A 3JD4A 1H2KA 3LA2A 2QDNA 3M3CA 2RMU2 3NW4A 2PN5A 3HT1A 2A3YA 1SACA 1UXXX 4FP3A 1DGWX 1TVKA 3I4IA 1I94O 1N3OA 5FYBA 3OW2U 5C3RA 1H0BA 1Z7S3 4GB32 2B39A 1ZREA 5FNVB 3T0AA 2WLIA 3AVSA 5LA1A 5BNOA 4HSLA 3EXUA 5BMVB 3ZM8A 4LO8A 4QPJA 5E1AC 1S0GA 4XVHA 3TEXA 3WHUA 1FYJA 2QSAA 5FUPA 2JECA 3N9MA 3NWKA 1QHDA 5FV3A 1MEC2 2UWBA 1JHNA 1F4HA 2YDEA 1RMU1 3SPHA 2AGSA 3KGZA 3N3HA 1VF7A 5F3CA 2ZHNA 4MO3M 1UIJA 2VZ3A 5T5JA 1V0AA 2EXHA 2HWB3 3WZ1A 5B1BB 3KWVA 5C3PA 3E8FA 4MOAA 4L2NA 1ZNPA 5A3PA 3OUJA 3ZHSA 5JWPA 1NCQA 2I74A 1REFA 1K5QA 5DN6G 1KYOF 4OI2A 1HKDA 4AQSA 1RUF2 3MBWA 5C8CC 3N2KB 1KJLA 2ZDIA 2RS32 3APQA 3UKVA 2YGLA 5EIBC 4LF4B 4J7JA 4OQ9A 2H8PC 4LIVA 1E57A 1RTVA 5FMOL 2H0VA 2JDHA 4Q0QA 1IG0A 4X6QB 1YWKA 1QR8A 4BE3A 5A7PA 5JDBA 2ITCC 3U11A 5FXZA 2Y33A 2GHYA 3O1SA 2J1RA 4LT5A 3SYCA 3KB5A 4PT6A 3KCYA 3LOIA 1AJPA 2XUMA 1NVPB 2RG4A 3ITQA 1WMFA 4CEWA 3BY6A 4CCCA 1UL9A 1L7RA 1SPPA 3F5WC 4FM2A 1IBLO 2VL4A 3HNYM 3LQCA 2QQIA 3LDEA 1NA1A 1COV3 2YI8A 2BZDA 2OIGA 2CGNA 4B3RB 4HOOA 4QPGB 3AKSA 2V7QG 1HR0O 1YQ2A 3GBFA 2PHLA 4LWSB 5JCOC 4UAPA 3H1KH 5FY7A 3IGAC 1EAH1 3SMHA 4L92A 1GKFA 4H37A 3K5MA 1M90W 4I30A 2C4XA 5LP6A 1J5EB 2Y34A 4XXPA 2UU9B 1NCRA 1PM4A 4JI4O 4LO6B 2WYFA 2X0LA 5H9RA 3DEMA 1R73A 2GC3A 4A7YA 1J3QA 4LNUA 5EC1C 1KGYA 2HWE2 3RVHA 3WDXA 4ZZ8A 1QGLA 2J1UA 4BXSV 2BWAA 2EIDA 2UXCB 4XEZA 2ZE7A 3JAMN 4Q4W3 1XHZA 2L35A 2BQPA 3RYRA 2ZX1A 2XGXA 2Q7GA 1GP5A 3FBMA 1GTOA 4XBQA 4ZY9A 3KQ4B 3B77A 3A22A 5C4WA 2FMYA 1NZIA 3TK1A 4NTYA 4LFBB 2NZ9A 1SFNA 4N9HA 5B1BC 2VOXA 4YM3A 5A6YA 3T4VA 1BCXA 5CBLA 2UUAO 4ISQA 2GP5A 1K3IA 1YC61 3R6SA 3AL6A 4DV6B 3AFKA 5J3UA 1KB9F 4N7IA 5KC5A 4QHOA 4OPAA 2ARBA 2ZXQA 5F5AA 1WKYA 4PJ0Z 2AZ5A 5FP8A 4TV8A 1WW4A 3POGA 5FZDA 5DAXA 1RVF1 5CFCB 1EZJA 5LXTA 2R042 4O2AA 2RDSA 4Q4X2 1IBKB 2VVDA 4QJFB 1BQ0A 1TMF2 2PF4E 4NMIA 4DW0A 3WDVA 4ITCA 3BVCA 3JBG2 3Q8FA 4HN0A 4UW3A 4I50B 1IS4A 1KQRA 1H9PA 3IM0A 5FYTA 3E6DA 5LBQA 5I93A 2VMFA 2LQTA 4DIQA 2QQKA 3AMNA 2EZOA 3BTYA 4S2FA 1C8M1 2W1UA 1SBFA 4YVWA 1UMZA 3ZN6A 4QPGC 2ZE5A 2Y6JA 3ZN0A 2V4VA 4UVAA 3RWRD 2DUQA 3OSDA 4EFBA 2A3QA 4LF8O 1ULDA 4TWKA 3LDBA 5A3NA 1PNMA 1AP5A 1XBLA 4DR7O 2MHFA 3IN9A 4X62B 4GALA 1ORQC 5K1XA 2MNGA 5BPXA 5CBGA 2JE9A 4TT3G 4JGYB 5JH7A 1HRV2 2ZACA 1OHFA 3BB6A 3AP6A 1E79G 1CJPA 4V2WA 2E74B 1W3XA 5H2FZ 2C24A 1N1VA 5LMUO 1W2UA 3JZVA 5FQ0B 3M3OA 1UMIA 1IPJA 3DECA 2VZPA 1PO21 2BEOA 1RHI2 2WAAA 3I55V 3USUB 1D4M2 1QOTA 3UKTA 1LNQA 3ZMTA 3KV4A 4E8DA 2ZTNA 2XAFA 3IDAA 1QY4A 4YYOA 1G8MA 1A3KA 2XDVA 4O2BB 2M7WA 1IBMB 3DV8A 2DYSB 4JX0A 5F9TA 2OWOA 1VBE2 4NIAA 4JI7O 4IDZA 4UBGA 5LMNB 2ZCWA 1JOJA 4UFIA 4ARYA 2GZWA 1F5FA 4Q1PA 1AR63 3KVAA 4EFEA 2UURA 1OFSA 2WLMA 4XCAA 4BOWA 1DIWA 1VQ5V 1OD5A 3QACA 5CFCC 2G38A 4UCVA 4CH3A 3PMSA 4PLNA 4DXZA 3HN1A 4LKDA 1QVFU 3ZDVA 4GH4B 3VBFB 4H33A 5IJ9A 4Q20A 4J41A 3GZUC 3NMBA 5I0DA 1VMGA 4QU1A 4H7LA 1QDOA 3FB8C 2R30A 2PUSA 4XDPA 1YQ8A 3K57A 2D6LX 4JI3B 1FFXB 1W8HA 1XYPA 1UY3A 3JB4C 1N1SA 2K1EA 3HKCB 4DV0B 2HWF2 4FTSA 5JOWA 5T5PA 2PHTA 3SYAA 2WO7A 3P6BA 3B69A 1MZFA 2R7EB 3LEIA 2DU1A 3A0BZ 1QH7A 1YFUA 1HJFA 2ZM6B 1O5UA 3WF3A 4X64B 1I5XA 1KC8W 2A6WA 3EYPA 3SCHA 1CAWB 2ZGQA 4K7JA 1M5IA 2V09A 2H6CA 4JGYC 4BPZA 4OHWA 2HH9A 1XC6A 2JG9B 4XETA 4DUZO 4EN8B 2E33A 4E4ZA 5E8AA 1PNKA 1B06A 4ZS2A 1UYXA 2AEYA 2WZPP 5A1FA 3FZ3A 2WWJA 2DYSC 3WP4A 3POIA 5GLVA 3POEA 2AHYA 4XDOA 1O3RA 2EX3A 4ZBMA 4B7KA 4NOTA 1LHOA 3MW3A 2HJIA 2A79B 4A42A 1NLSA 1NQTA 2CTVA 3TBDA 3QG5A 4XE9A 2IVJA 3SNMA 2QQJA 4D6TH 3BALA 1JW6A 5IWAB 2P2KA 5A3MA 3HIFA 2VD7A 1T2XA 4XW3A 2JEXA 4HNAB 4F8AA 4KXRA 3W7XA 1EPZA 2WLNA 1M56B 1O4ZA 1T6GC 3X2QB 5LA2A 2RMU1 3VDDB 2OKXA 4WM7A 4GH4C 3VBFC 2QTSA 2Q67A 1Q8PA 1HB3A 2W1SA 4NHXA 4GB31 4QGMA 4R9DA 5FYUA 2FCTA 2UXBO 3HR0A 1J5EO 2GN3A 4J9ZB 1RUE1 1J3RA 4RQEA 1GUIA 5BNPA 4FJCC 1KRIA 3VUOA 2I07B 2Q4SA 3ZRWA 1JMKC 1QJX2 3ILFA 3IC9A 2JGUA 4QXKA 1RUG2 3ZXFA 3B8MA 1W05A 3ZS8C 2HHHO 2GTSA 2CHHA 3AZVA 3PIGA 1TEIA 5IT6A 4B1MA 4ZKTB 2ZKLA 2CTRA 2VMHA 2VY0A 1G9FA 4IEOA 3H1JH 3I3BA 2XAQA 4Q27A 1O3SA 5C9AB 2JG9C 3OBTA 1GOHA 5A32B 4XC9A 2QQVA 4CA9A 1DF0A 4H14A 5CKNA 1NBMG 5CVRA 3ECQA 1W2TA 1CX4A 1M06G 5FZ4A 3IWZA 3ZN4A 2WLLB 1VRH3 3JQWA 3AJZA 4CP9B 3CJHA 3GALA 1RUF1 2BBVA 4YIOA 3VKNA 2RS31 2ES3A 3NNGA 3A21A 4ZI7A 1IBKO 2YFZA 5EC2C 4MZUA 4DUYO 1W8NA 3E5QA 4K8ZA 1N36B 2JS5A 3DUIA 4YZ3A 2A6VA 4DYLA 2Y8KA 4AVVA 3JD71 1VE0A 4B3TB 1AI4A 4BQ2A 1UD1A 3EBRA 2PI5A 1BEV3 2ARXA 1J84A 4CEYA 2NYYA 5LGUA 3UKNA 4RGKA 3BGAA 4LP8A 5KAFZ 5AFBA 4B4RA 4HKWA 4BW9A 1M56C 2A75A 3MEPA 5FZGA 3X2QC 2CWSA 2OZ6A 3WG4A 4A44A 5FR3A 4NVPA 3VDDC 1R1A3 2GU9A 3I8TA 4FI9A 1THZA 1Y74B 4Q8LA 4M0HA 1U0AA 1XNQB 2E51A 3ZKYA 1XEQA 1VB4A 3LDRA 5H9QA 4XZPA 5JQGB 1M4UA 3MLLA 3SISA 2ZEZA 5F3IA 3WDYA 4TLGA 5C8WA 5LASA 2W95A 2YXYA 2B8MA 2BBAA 4QDRA 3T4ZA 4FZ1A 3O1UA 1ZRFA 2PLV2 3M2MA 4R9BA 2BRTA 3ES1A 1QLNA 3G6EV 1LJ7A 1KDKA 2EXIA 4GWMA 3WG1A 1ZTEA 5GLWA 5EZWA 3HPLC 3OMAB 4UFHA 5L3CA 5C9AC 3FL7A 3ZCCA 1V6MA 1YI9A 1TAEA 4A3XA 1VIBA 2WC2A 1U12A 4BMBA 5BY1A 4YIPA 4CH4A 2Q7EA 1POV0 3PURA 1CR7A 2MEV2 1JHJA 4RWUA 4B3SB 4GB33 3GF6A 5F5QA 2E75B 2CH7A 1K9MW 4MVOA 3AVRA 1CX1A 3UETA 3OPWA 2ENRA 4IGQA 1VF6C 1DQ0A 3RBZA 1O3QA 2ZAHA 2W1WA 4CS2A 2C9AA 4YW6A 4E27A 2R041 5T5OA 1JOPA 2WFPA 3N7LA 3TGUH 4Q4X1 2GC1A 2K2SA 1TMF1 1MEC3 4E8CA 1W90A 4Q1RA 5LBFA 4KP4A 1JBCA 3ZMUA 1AYN3 4C8DA 4I0BA 3H7YA 4U36A 5FL7G 5ABJA 4X1KB 5FXVA 3OEHG 2VNOA 4DO0A 3JBG1 1FNZA 5FREA 2WSUA 3CCVV 5DECA 1D5NA 2AC1A 5BZBA 2RR13 4J10A 1AX1A 2Q8CA 2YU2A 1HNWO 5KX5A 1LHVA 4P5YA 3E6BA 1T6BX 2Z3YA 4XZUG 2WNUA 2G4IA 2MW2B 5IVCA 1FATA 1RUF3 2ZM6O 2W5FA 4F6EA 1O4YA 2CU5A 2ZX2A 3LOBA 2YC0A 1UO9A 2W0FC 3T4DA 1MOFA 1W2OA 1GICA 3K9AA 2BTVC 1X36A 4PCRA 5DAVA 1R6TA 1HRV1 3D3IA 4JI2B 5E1RA 3DXUA 3HB3B 3ZMNA 1SCSA 4B1LA 4IUGA 1CPYA 3MDSA 4H3WA 3WQ1A 1LEMA 3ORJA 1RHI1 5FYMA 3OGCC 1D4M1 4UVBA 4SBVA 3H1YA 1YEWA 1SZTA 3JARA 3RMYA 2DMXA 4TSVA 4HETA 2GNBA 4OMCA 4LKSA 2G9ZA 3IFXA 5GZEA 1RUI3 3MIDA 4WVVA 3L2HA 1O8SA 4XDQA 4YZ2A 4CS4A 4CZSA 3FUOA 1KEXA 5JVVA 1NXD1 4I0AA 3AG1B 3N7JA 4AK3A 3FBYA 5FPOA 4ASKA 3T1YO 4EZHA 1QOSA 4FOYA 5IWAO 2FYUH 3GJBA 2FDJA 1JOBA 2XQRA 4HN1A 4AGVA 4G28B 1MS5A 2E7TA 2XMLA 3EVKA 1Y4WA 4MVTA 2QKDA 4KFMA 1BHGA 2HWE3 1GM9A 4FCAA 1UU4A 2K9ZA 4YHHB 5A6XA 2UUBO 2WT0A 4JI1O 1DQ5A 1H4HA 2GNTA 1H2GA 3AK2A 1IKQA 2ZGKA 1REEA 2DUPA 4C7UA 3ZR5A 4GULA 1S72V 4R9AA 1AJNA 1WLCA 1HXS2 4QKBA 5IW0A 4HONA 4IXLA 1BJQA 4JI5B 2DVDA 5CB4A 4TV9A 1N3QA 1FX5A 1OJHA 1AXYA 3FYIB 3JALA 1VAMA 2FBEA 3ROUA 3BFRA 4LH6A 1WLWA 3NNLA 2NQYA 3E22A 3CMGA 2WQ8A 2R043 3NV1A 2YG0A 3DC6A 1CN1A 4Q4X3 4QXHA 3TAYA 1UZYA 4NPLA 1SBDA 1A6CA 1UZWA 5A6QA 4IHJA 3NL1A 3NAPA 5CAZA 3OEEG 3KGLA 1GZ9A 3B94A 1H4GA 4QPIB 3W9AA 3ZR6A 1YFWA 4YXWG 4YARA 5F3GA 1AR1B 5JOZA 2VOKA 4YGEA 1S2EA 3GWKC 5K1PA 5FMCA 1OKOA 3VL9A 3CEIA 4FO9A 4D3WA 3ZPYA 4W6WA 2Y4UA 2QA4V 3CC7V 5I0SA 3MDPA 1U5YA 4PDWA 3ILNA 1MR5A 2ORXA 4Z1MG 5I91A 3AG1C 5F39A 4LLOA 1K5MB 5FY5A 4WBBA 1QQCA 4MVZA 5KHKA 5FDBA 3S0MA 1IQAA 1AYM3 1SCRA 3HKBB 2IC1A 4TXWA 3BUCA 4DFSA 1RUH1 2QQNA 4MTXA 3MHHC 3K2OA 4GD4A 1W28A 1D4M3 1R1ZA 1UZ0A 1UX6A 2GC2A 3ABZA 1RUC2 3RWNA 2EAKA 2BSKB 1PD3A 2JDMA 3ALQA 2VTFA 1SETA 2UXDB 2A7WA 2VVFA 4L99A 1R3LC 4HZFA 4Y20B 3THDA 2YS8A 1VBE3 4LBEC 3FHAA 3U4SA 4DK0A 1NT0A 4QMAA 5HCAA 1N47A 3K3NA 4B3MO 4K6BA 1W9FA 1CAXA 2RJ2A 2BNOA 3WQ7A 2FQPA 2W46A 2LGQA 1UX7A 3VHPA 3LA7A 3THTA 2B9ZA 1YITV 1HW7A 1QJX1 3HVDA 1R083 1RUG1 4L87A 5LHHA 3CZUA 1YQCA 3WINE 3CMEV 3HAGA 5CFDB 1OVPA 3NQHA 1B09A 1O4TA 4DY5A 3U4XA 5SV5A 1QR9A 1WA8A 2ZKNA 2OUJA 4QPIC 3GXUA 3NJYA 2V1DA 2CNAA 5T3NA 2EIJB 4Q4Y2 2D40A 1AR72 5B4XA 4P2ZA 4DPNA 4IIJB 3CDZB 3OY8B 3FN9A 3OEBA 1BZWA 1GYKA 4J42A 1HQNA 1W8UA 2Y60A 4XFCA 5DG2A 3MIHA 5CBHA 4WFAV 5FYHA 4YPJA 4RQPB 3RGBA 3MPBA 5DABA 2HWF3 3K0GA 3SPGA 1YQ6A 3K46A 3ETQA 4KWJA 4DS0A 3C3TA 4OULA 3DYOA 1UOBA 2JIJA 2KKWA 2VO5A 4EYUA 1K5MC 3JCZA 4XUTA 2HVKC 3IBMA 3CF6E 1Q3EA 3FB7C 4LQRA 5FPZA 1XYNA 1Y9MA 1TVGA 2AW9A 1RSOA 1IVSA 2X8KA 3OTOB 5LHGA 5L7OA 2DURA 4KUMA 3KT7A 3FFQA 2WR9A 2WZ8A 1IS3A 2ZAAA 5JLVA 3GVMA 1QWRA 1JCHA 5JSOA 4F6RB 2Y0OA 1XNAA 4FPYA 1G86A 4AVTA 4CYDA 1W9WA 3SPJA 2IXHA 1QU0A 2WNVB 1EN6A 5DZGA 4YFWA 2V4DA 4NXNB 3OYWB 5L9VA 2P6HA 4AI0A 1E5SA 1MVQA 1NQDA 2DBIA 1OV9A 2W91A 2RDCA 2UY8A 4LULA 5APAA 4MYEA 2PLV1 4FFKA 2WQ4A 3IT8A 5LZ6A 2RS12 4KU8A 4A7KA 1W6MB 3ATGA 1EUTA 4QKNA 1WBFA 3BAAA 3GGLA 4DRXB 4LBOA 5CFDC 3USSA 5F32A 2ZGRA 5JSRA 3V56A 3OMIB 5FOBB 4WFBV 1EPWA 3WQBA 2GAUA 3AYEA 4OPHA 5BY5A 4BWAA 5DQ0A 2ODMA 1BYHA 3W59A 1DU3D 2P3KA 2EIJC 3T1HO 2HEWF 1RGSA 1NE4A 1PGL2 2JEMA 2MEV1 1HRI1 1QDCA 1W6NA 5LBBA 1CWPA 4AFMA 4Q6GA 2FMLA 4R52A 2ADQB 4PA6A 2XH6A 1AF9A 4U3JA 4RQPC 4AFCA 3J7AU 5CKMA 4E4HA 4H13B 3EO6A 5EYYA 1QJX3 4IYHA 1L3JA 2LRPA 3FHIB 1C5IA 5FP7A 4FLTA 1IPSA 4XMAA 4YHHO 5LA9A 3JD2A 4P9WA 4CP0A 2UXNA 5DN2A 2G9FA 1HW5A 1GZCA 2O1QA 1LENA 2RS51 4AHZA 4BK5A 4NHKA 5LGNA 1MSWD 4XUNA 4PIZA 5FO8B 1UYZA 1W8OA 3WDTA 2JX9A 1X7NA 1LUWA 1QQP2 4O4IA 5JJJB 1SEFA 1VP7A 1Q6UA 4CCNA 2XWJB 1GFF2 2C6SA 4BQ5A 4YG0A 1UXZA 5L3BA 4CUAA 4LFCB 2PY5A 5IVYA 2N74A 4XIKA 3Q4HB 5JCOA 4IV1A 3S3XA 4OX9B 4M3CF 2WNVC 4I5SA 1JI6A 3A0RA 2H0BA 3BHPA 5IUQA 4FTBA 4KL1A 3T2MA 4C0HA 2UUCO 5BMVA 4KHPO 1CIWA 1US2A 2UU8A 3B9IA 3AZZA 4JV5O 5LY1A 3AG4B 3ASIA 4Q0SA 1TUBB 4XJWA 3F95A 4MGKE 4Y5SA 3N36A 4O4LB 4YVSB 1KFUL 1RXFA 3F5TA 2QGNA 3R0RA 1I1EA 4NXMB 3VOUA 5F5IA 1C5HA 2C1FA 2IBZH 2VPVA 2JXAA 4PBOA 4Y1YA 1XE8A 3C7GA 4FAHA 4DK1A 5BNQA 2DQ0A 4NKGB 4RYDA 4FFIA 3B09A 2P7TC 5EZYB 1VARA 1P4RA 2G19A 3Q8AA 4GZRB 1DQ6A 3CCEV 1JA8A 1ALYA 1XMQB 1JQ0A 1ND2B 1LOFC 2QJVA 3U75A 1DTOA 3VZJA 1H8VA 1SLLA 3S7EA 2XHNA 3LA3A 3P1IA 4FT8A 3O0XA 2DVBA 2LS6A 3B93A 1V6IA 2QTOA 3D3QA 4OUSA 4J7KA 3SCFA 5DMYA 4HSJA 1NOVA 4KGQA 3M99B 4EN7B 1S5HC 3S3WA 3LGRA 3WNMA 4ZXKA 3KT1A 3VBRB 4DEVA 3L72H 1PK6B 4NUBA 2FZ2A 3SH4A 4LR4A 3VBBA 1J59A 5EFUA 2PQQA 2MEV3 3MD0A 2A5ZA 1SRYA 5FZIA 1PZ7A 1HXS1 3MLJA 4OI1A 1AR4A 4QPGA 4X89A 5KC6A 2RM22 1Q8VA 2QFEA 1C1FA 3ZEDA 2NMOA 4MGYE 2IVIB 1NT2B 3KLSA 4AYUA 5JAXA 3TETA 5LA6B 3AL5A 2WLJA 1GQGA 1OA4A 4JI0B 1H9WA 5FJHA 4A45A 2C9KA 1OQDA 4PELA 4HFSA 5FPRA 3KCXA 2DDUA 3AG4C 1PNFA 4XMIA 4Y1UA 3KT4A 3CMAV 4YVSC 3BTXA 3QO5A 1NVPD 1YHFA 3OM3B 1WCKA 3AZYA 5FFOC 4BIOA 2HYXA 4RAIA 3KV9A 4XIOA 4LHNA 1AHSA 3JB8A 4UFKA 2FB5A 4M3CB 3RW0A 1FYUA 1HLCA 4GT1A 4X9QA 4GKJO 3HN3A 3DTUB 4FFGA 3ZXAC 1K7DA 1ND2C 1NLRA 4A2UA 1F4MA 2WPDG 2EALA 3J9SA 2ETNA 4NROA 1RYYA 1H1AA 4W50A 4XYXA 1WP8A 2WO2A 3G71V 4CXWA 2Z5UA 5JMOA 2E63A 2QQMA 3WOGA 1LU2A 2E7QA 3OGRA 2RJZA 1JUHA 2BDRA 4EWAA 2DTYA 2LGWA 3ELNA 1LESA 2FHRA 1UOGA 2D2CB 1Z7S2 4JV4A 3VBRC 1RUC1 1PK6C 1EY2A 4ZOLB 4JZ2A 1CPMA 4LUKA 3MI8A 5K0UB 4NR1A 5AC93 1AJOA 3SYOA 3CCLV 1WNSA 4IE4A 2D7FA 1JZ2A 4RQFA 4A4AA 1ENRA 3VKLA 1DP0A 4P9XA 2OYZA 2VS0A 3VQYA 2BOBC 1ZA4A 1COWG 4DR1O 5C71A 3K3OA 4PLMA 3AKRA 1FOD3 1FMD3 4IL7A 3E89A 2YPJA 4LF7B 2HFEC 4B08A 4OMDA 4ARXA 2PGGA 2ZE6A 1VB2A 3ABTA 5LK5A 3GCXA 1XNBA 1Q7YW 3D36C 2OT5A 1DZRA 1ULPA 1LOGA 3K59A 4RSUA 3VBSA 4YFZA 4Q4Y1 1DGLA 4X6RB 3N2GB 1AR71 2TUNA 3L71H 3USUA 4JCKA 1E1QG 2XHBA 2C2AA 4FFBA 4I55A 1SHWB 3B7MA 1Z0HA 1LHNA 3Q8BA 5C3SA 3H1LH 3P3NA 1O7FA 4O2BA 1NU1H 2VCMA 4COYA 2YEVB 1SS3A 1RL3A 3RZMA 3WV6A 4Y1XA 3PDQA 4RA0A 2OT7A 4IV3B 2GC0A 4FPKA 3K48A 1W3VA 1MPXA 1K4CC 3TYJA 4DOUA 1QU7A 1W9SA 3CIHA 4X1YB 1XNDA 5DAWA 2VXJA 2ZX4A 3CCQV 2JIZG 3KZ4C 4LO4B 1SZXA 4IL6Z 5B1AB 1Y43B 2P1BA 4TYSA 2VOTA 4K35A 4FXGB 1COV2 1BL8A 3U1XA 3H01A 4OZOA 4RR3B 4K8FA 3LDKA 3KV6A 3OF1A 3AMHA 4GH4A 4OHXA 5A70A 1K33A 3VBFA 2YIAA 2XVKA 1HNZB 5FYYA 5K0UC 1LR1A 2R0FA 2L9LA 2Y0IA 4XJZA 3VZKA 1WPBA 2VQFB 4UFMA 1FFXA 2IM9A 3BPSA 2HP8A 4NE9A 3HKCA 1VQOV 4X66B 3RPQA 1DHKB 1GM8A 2ZIMA 1LB2A 3J8F3 2RN9A 4TUYB 4DR2B 2O0OA 4WBNB 2RS11 4SLIA 4CRQA 2EIKB 3PVNA 1YVWA 1CAWA 4ORFA 4DV2O 1S0JA 2YC4A 1N32O 2F1MA 3ZBHA 2GV9A 2QZ2A 3NVCA 5FUNA 1RUC3 3WW1A 4WV8A 2WRAA 2WLKA 1S2BA 3CRCA 1Y76B 5J96B 4ZHNA 1PGL1 1WD4A 4Q0VA 2P17A 1JFFA 4YWAA 5LBEA 2F4PA 3FFZA 2LTNA 3HPNA 3VBUA 3LZZA 5F3EA 3HR9A 2EJRA 1OH3A 1IQDC 3T2PA 4IGOA 3HJRA 3TEWA 2DCZA 2ZCEA 2LJ2A 2BFUL 4MADA 1U96A 3E5XA 3HKDA 3PU3A 4MVRA 4IV3C 3J7NA 3CRQA 2FCUA 5FK8A 5E16A 5FY1A 1GZTA 2IJJA 1NZ6A 4GJYA 3V65A 1RUJ3 3LDDA 3UO2A 5B1AC 2Q8OA 1H2SB 1XREA 4HNAA 3ICXA 5EJ1B 3E1F1 1WWYA 3ZYPA 1AR73 1QQP1 1BSMA 5JVDA 4RR3C 3ABKB 4XF4A 3S5AA 4HMZA 3BN6A 3VDDA 4DR4O 1PGSA 1L7QA 1N1YA 2VZSA 1FXZA 1SQPH 1YJNV 4LBNA 3C7EA 3ZHTA 1MQTB 3KG2A 1TVKB 3LPGA 3K06A 3B5LB 2W6IG 2WLIB 2JJ2G 5KHJA 5BR8B 1VP6A 4HYOA 2JIGA 5BNOB 2RQ6A 2Y6LA 1LULA 3N9LA 2PYLA 5E89A 2BGPA 1GP4A 3ZXKA 3K5LA 3LB9A 5HV4A 1SQQH 3CQOA 3BPZA 4FXKB 1UPIA 2EIKC 4XTPA 3HNBM 1PP9H 5LGTA 1LAJA 4OLLA 2WNOA 4BHPA 4G3YC 4E2GA 3OG2A 4A6OA 3AG7A 3WSOA 5A32A 1I94B 4D6RA 1QJU3 4QX5A 1V55B 2AGAA 1AR62 4K0KO 5IYZA 1JXNA 2WYSA 3RZKA 3PUAA 4D69A 2LW8A 2DWRA 3B00A 3SJAC 3MUY1 2QDRA 4CP9A 2CE4A 3VBHB 1NCQB 1VQ4V 3WNXA 1VF6A 3CYOA 3I2KA 1S5LZ 1DLCA 4AR2A 5FY0A 2XUEA 5KUKA 3AP9A 1AL23 4EB6A 5IDJA 1OC1A 4TLFA 4OGQB 1UAIA 1UPGA 3VHRA 4JTNA 3N9PA 3UNPA 2F23A 2PHFA 1YI2V 4L0PA 2HVJC 3GWOA 5FZ6A 5ANQA 2IXLA 5IT9N 3ZFGA 4EWEA 2XAGA 3IKWA 3ACHA 3LFMA 4JF3A 2BUKA 2XR4A 2VXRA 1EZVH 2VUDA 3BI3A 1VQMV 4R6ZA 2W52A 2C26A 3ABKC 2VUJA 5FLXN 5IJRA 4CEWB 2JJ6A 5C6CA 4LLFA 5A7NA 2AZ2A 4FLWA 3CBNA 1SPPB 2BU9A 4GMP1 2NMNA 1R3KC 5IVEA 2RM21 1JYWA 2HEVF 5CA0B 3UGFA 4KU7A 5I8TA 1J83A 1NR7A 3OUSA 1LOBA 4JI6O 5JQGA 1PVC3 4JYCA 3LEGA 2WT1A 1Y66A 1GN3A 5BNOC 3O1RA 1MMMA 3TJTA 1DGSA 3TRSB 3JAWB
chains in the Genus database with same CATH topology
1NCRB 2CWSA 2OZ6A 4V1PA 3UL2A 3WG4A 3FUQA 4NVPA 3VDDC 5DZEA 1R1A3 1WCDJ 3WXPA 2GU9A 3I8TA 4CP2A 3WX5A 1QF3A 2ZZQA 3PJYA 4BQ1A 1ASJ3 5JCTA 4Q8LA 4M0HA 3LWCA 1U0AA 2E51A 4XJ8A 4FQZA 1NQJA 1QQP3 5HBAA 1YIPA 4OFGA 4RGGA 1BQPA 4XFAA 4DRRA 1DYKA 4E2SA 3BOWA 3PMEA 1VB4A 3TOJA 4Z92B 4QQLA 5H9QA 3MIGA 1XU1A 4NHLA 2QNKA 4XZPA 2IFRA 1DBNA 3MLLA 2ZABA 3RYKA 1HIXA 3SISA 1UU6A 3TN91 4PJYA 4FVVA 5DXDA 4N43A 1DQ1A 3WDYA 2DVGA 1J1TA 4HKLA 1PMIA 1UIKA 5C8WA 1V6KA 2D97A 3VBOB 2I45A 2QCSB 2B8MA 2YY1A 3GZAA 5C33A 3BOPA 1PO11 1RMU3 3QOPA 3TWIA 1AX0A 1UPSA 1ZRFA 2VNRA 4COZA 2PLV2 1VBD3 4MXWA 2ZGSA 3M2MA 1QH6A 4R9BA 1O5LA 3ES1A 3VBHC 2H6BA 1NCQC 4YRDA 1LJ7A 1UF2C 1KDKA 3CO2A 2EXIA 1ENXA 4J1XA 4E4SA 2HWB2 2WNVA 4URTA 4GWMA 3N7MA 2R063 3JCIA 3WG1A 1G9AA 1WUVA 4XBLA 4P9YA 4KNCA 4YNIA 5GLWA 4JDNA 5EZWA 4F7ZA 1GSLA 1O91A 3POSA 4L97A 5JZGA 4AF9A 5AVPA 2B46X 4Y0EA 1W6PA 2MPFA 5C9AC 1OMIA 4QQOA 1PZ8A 2W39A 1V6MA 1YI9A 2BNNA 5T55A 4A3XA 4FPEA 5LEJA 4N43B 2WC2A 3S30A 4OHYA 1YUDA 2WFF1 1U12A 2E53A 4BMBA 3H0OA 1RUD1 2W68A 1ULFA 4JRLA 1POV0 1CR7A 1Z7S1 2MEV2 5ACA1 3HD8B 5BNPC 1CPNA 4GB33 1FV3A 3D6EA 4M2IA 3ZIWA 2QUOA 2FZ1A 3GF6A 4RHV1 1HXS3 4XTMA 3URFA 5F5QA 1N1TA 1W6MA 4MXWB 1PVXA 3H1WA 3UJOA 4Q0PA 4COVA 1QJU2 2XLAA 1KJRA 1I5ZA 2ENRA 1ULEA 1OKQA 3FX3A 1MS1A 3ZYGA 5DDJ3 1DQ0A 4IEUA 1BKZA 3H3ZA 1O3QA 2ET7A 3O14A 2ZAHA 2XJUA 2ZGMA 2ZGTA 2C9AA 2OUHA 4E27A 2D98A 4CEWC 4IEYA 2CY6A 2R041 3MYXA 4IEXA 5T5OA 1BBT2 2E6VA 4Q4V3 4C91A 1Y0ZA 2DCYA 4BM8A 5JZGB 2WFPA 2DF7A 3N7LA 5GALA 4Q4X1 1PGW2 2Z79A 4O9GA 4C8RA 2PHUA 2GC1A 5AFEA 4ASLA 1AXKA 3VBSB 2K2SA 1TMF1 5F6LB 4MGIE 2XBO3 4KG8A 1MEC3 2VG9A 3AMMA 4N53A 3ZSLA 4YVWB 3WHTA 1VALA 4Q1RA 1JR7A 4PBPA 1X8EA 2A7AA 2YZ4A 1JBCA 2PELA 1ZZCA 4P9GA 4RL7A 4CP1A 3CLPA 5K7PA 3NSTA 1AYN3 4WVMA 4AI8A 4I0BA 3H7YA 4U36A 4Q8KA 5ABJA 5KXCA 1ZRDA 1WLTA 1AL22 2ZGLA 2BW8A 2VNOA 3JBG1 3IDBB 1FNZA 1PHMA 5FREA 2WSUA 3CNAA 4M27A 3JU9A 2HWC3 2RR13 2HWB1 1AX1A 3VHNA 4RS5A 3ZFEA 3T1LA 1G9CA 2UWAA 2WJSA 1LHVA 1AX2A 4P9LA 4YG3A 4BYYA 3E6BA 5KBFA 4MV2A 2A6ZA 1LODA 1Z78A 1NCRC 1VZ4A 2OIIA 5IK5A 2WNUA 3J4UH 2VMGA 2G4IA 4QM8A 1VRH2 4B29A 1EAH3 1GLHA 2Q1MA 2IXIA 4BIFA 2ZHMA 1FATA 2WS92 4QQPA 1RUF3 1WLDA 2ZJCA 1O4YA 3WDWA 2O8OA 2P34A 5JPNB 1MS9A 2ZX2A 2ZS6B 4S2GA 2GH8A 4FP2A 1ULCA 3LOBA 4CDXA 2YC0A 2D6PA 3TNQA 4A7ZA 1EV13 1GICA 5KHHA 3ENRA 4AEM