2YC0A

Factor inhibiting hif-1 alpha in complex with r-2-hydroxyglutarate
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
349
structure length
349
Chain Sequence
MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
publication title The oncometabolite 2-hydroxyglutarate inhibits histone lysine demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 104
structure length 349
sequence length 349
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2011-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2yc0A02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2yc0A01
3OD4A 2YC0A 3P3NA 2CGNA 2ILMA 4B7KA 1H2MA 5JWPA 1H2KA 4BIOA 1H2NA 3KCXA 2YDEA 4B7EA 2Y0IA 1IZ3A 4AI8A 1MZFA 3D8CA 1MZEA 4Z2WA 3P3PA 3KCYA 1YCIA 2CGOA 2WA3A 4Z1VA 4NR1A 2W0XA 2WA4A 1H2LA 2XUMA 4QU2A 4JAAA
chains in the Genus database with same CATH superfamily
4FVMA 1HB3A 5LZ6A 3H7JA 4JI5O 1M56C 4ZBMA 4S2FA 3ZFFA 2ZS6B 3I59B 4A7KA 1OZ0A 2VQAA 1U5IA 3FUOA 5IK5A 3VBHB 2RS11 3ZYIB 1W9FA 5L7OA 2OT7A 4BMBA 5E89A 4FPKA 2HWB1 2ZEZA 3ZX6A 5JJJB 4DQAA 2JS3A 3EBRA 4HSJA 4DYLA 1FD9A 4IGPA 5DECA 4W4LA 4Q4Y3 1SZTA 2Q0AA 3TCUA 4OUMA 3IC7A 5DXDA 3IKWA 4CDQB 5C93A 4OQ8A 2KM2A 1UZZA 3LAGA 5JVDB 3L72H 4X8NA 4EFBA 4TT3G 4FXGB 3KV5A 3AJZA 1W28A 2JEXA 2RR11 1GKFA 3HKCB 2AHYA 3TXQA 1BJQA 1R091 5D5QA 4RS5A 1WLTA 2RDNA 4O7XA 1H2GA 3BCCH 4MHUA 3K77A 4PHZA 1GOFA 1EAH1 4XDKA 4JAAA 3TNQA 3UT5B 1XNDA 4JC1A 1VF5B 5F3GA 3HQUA 3TBDA 3RYFB 2VCBA 3UKNA 4DB5A 4CDWC 4P9LA 2E51A 1Q7YW 2DYCA 2GNTA 3KT7A 3PUAA 2XL9A 1DQ0A 2Q8DA 2W5FA 1W06A 1E5RA 1FYUA 3LEMA 4FMTA 1VPHA 4NIDA 5JXIA 1PIV3 3ZYFA 3T1HO 3PLQA 3L70H 3G6JB 3VZNA 2G9ZA 1BLZA 4A2UA 3UL2A 3OPWA 3ZKUA 5AC93 3AZXA 1FNYA 3LFIA 4S2GA 1ZZCA 1CD3G 3IWZA 3JSNA 4OUSA 1WPBA 1PM4A 2P5BA 2OS2A 4OLLA 1VQ4V 4I01A 4JI7O 1XNTA 2A6VA 1JOPA 4MO3M 4ZI7A 4Q6GA 3RJRA 4C90A 2Q7GA 3E22A 4D7YA 3R6SA 4YLZA 2GC2A 5KC6A 1NVPB 4PF5A 4Z82A 3VQYA 1CVNA 4HKOA 2KG7B 4QPIC 2QKSA 1X59A 4BOWA 5EP9A 4BA6A 3PHMA 1QJU3 4HZFA 3ZXKA 4UI9L 4DV6B 1HJGA 1NVPD 3VHPA 4CCLA 1XNCA 4FPOB 3FL7A 3ACFA 1PK6A 1VBA1 4QB1A 5FLXN 1IS3A 4XOGA 2YBSA 5HFMA 5M0TA 1CAWB 3CCMV 3ZHQA 1IBKB 3GZUC 4DR1O 1Q6HA 3NSTA 2BNNA 1KS5A 2WLPA 4QX5A 3WW1A 2F66C 2JG8C 2R9IA 2QKCA 3VDDC 1J3PA 1RMU1 3CYOA 3M3IA 3EB7A 2LJ2A 3D8CA 4LUKA 2ORZA 4XF4A 1N4CA 2NPIA 4I50B 2WLQA 1ENVA 4JTCB 1ZA7A 2YEVA 2VNOA 4QPGB 4FCAA 4MGQA 3DC5A 4YG0A 2CWSA 4AFBA 2WKKA 1DIWA 3KCXA 1GN6A 3NJYA 5BNQA 4F83A 3RT3C 3Q8AA 4UFLA 4GA9A 5C71A 4WZFA 3LSUA 4QT6A 4QU1A 2GSYA 1J58A 4BW9A 1G86A 4NVPA 3HIFA 3FMGA 1QNYA 3GXUA 2BTOA 1OA4A 2R1DA 3MIDA 1W0OA 2ADPA 4GQ7A 1BK1A 4B08A 1JCHA 1GQPA 1AR73 1TZOA 4N53B 2Z5UA 4GKXA 2Q69A 5A7WB 5LHHA 1L7LA 4QPIB 5J7MA 3W7TA 4YRDA 1D4M3 1ZRDA 3SYPA 4YGBA 4H55A 5BPXA 3ETQA 2ATFA 4FTBA 1QLNA 3P32A 1SERA 2ID4A 1RVF2 4Y33A 4LF7B 2VTXA 5F3EA 2BUKA 3WINE 1UMHA 4P14A 1EZVH 4MADA 4FM1A 3C7HA 4P9XA 5HBAA 3T1HB 4OI2A 1PX3A 4TN7A 1QU7A 2B46X 4L0PA 2WZR2 1PGL2 2DVFA 2W3JA 1UYYA 2DFBA 1JYVA 4CP1A 4UAPA 3GWKC 1N3OA 1KS4A 4EZ4A 2UUBB 2Q67A 4JI7B 4HFSA 4IIJA 2K9PA 4YVSC 4X65O 3BTYA 5F5IA 4H14A 1C3HA 5J3UA 1YJLA 2QZ3A 1CIWA 1RUG3 2EIBA 3NNFA 3LZZA 2IXLA 3G80A 4CCOA 4BQYA 4XEZA 4OYUA 1LGCA 4P9YA 4X6QB 2A6ZA 4ITCA 2UURA 4KI5M 2R7EB 1OV9A 5EK0A 2D2CB 4QB6A 1VRH3 4Q4W2 5CN0A 4JV5B 3NW4A 5JMCA 3TEXA 2H8PC 1QJEA 1B35C 3O1TA 1MZEA 3CHXA 3ZFGA 4DR1B 3C8XA 3K5MA 1L1FA 2R0HA 3GJBA 3ACHA 1RITA 3BKZA 2QE3A 4LF4O 2VVFA 3B40A 3I3QA 2VZPA 2AREA 1HP8A 2ZX2A 1J3RA 4RN5A 2XAHA 3OD0A 5KHIA 5AFBA 5J1XA 4UFJA 1M57C 2JECA 4E4ZA 1AR4A 4DK0A 4R7CA 4YW4A 3H8UA 4LKEA 3MUZ1 3H8XA 5GZEA 2V1DA 1VQNV 1HV0A 1MS4A 1W3XA 3WUCA 4Q0UA 4H0LB 4QJFB 4QKNA 1DGRN 2C9KA 2D3PA 4PDWB 2Z4FA 4WZCA 4HANA 5LA0A 5FMOL 3M1HA 2VZOA 2I2SA 1K5JA 1O8PA 4K40A 4RGGA 5DABA 1YQ8A 1Z2GA 3LB9A 2IW5A 1PIV1 4YVSB 1NE4A 3TYJA 3ZXAC 3T4VA 1FXHA 1Y4WA 4ORFA 5LBCA 2YU1A 1IKPA 4F3JA 2JG9A 1Q8SA 1S3JA 1KUQA 1LB2A 5F1RA 1G9AA 3TEYA 3SLIA 2O57A 3BA8A 2OTJV 2PMWB 2W1QA 4NWVA 2V4DA 4WVMA 1TQ5A 1V6OA 4X1YA 3SEPA 2QJ1A 4BJ0A 4EEQA 2R32A 4FXKB 3OMAB 3U14A 3V65A 1P7BA 2QJVA 3I3BA 2WBKA 1ND2A 3OBTA 1B6QA 1WMXA 5ITZB 1CONA 3SXWA 4BCUA 1H2MA 2V09A 2Y6JA 1WPXA 4QQ2A 2EZOA 4XJAA 3WB0A 1YSCA 4FPLA 5A3UA 5TISZ 4X1KB 4J11A 5CA3A 4LBQB 4X65B 1YITV 3CZJA 5LGUA 1WW4A 1K5MA 3T0BA 5B1OA 2L6LA 2A06H 1Y9QA 4IV1B 1AILA 5LP6A 3KSCA 4IL6Z 3JAWB 1AL22 4MLOA 1O6UA 1YQ6A 4J9ZB 4LBQD 4J25A 4B29A 4OVEA 5AVAA 3VD9A 4GX0A 2ZZJA 2PTMA 5GKAC 3E8BA 4JGZA 1LUWA 1MVEA 4QDSA 4AGRA 1XE7A 2GSMB 3I55V 3DPRA 4XBQA 1FJGO 4AVCA 1VE0A 3E5UA 2JJ1G 1QMJA 2Y4UA 4OI1A 3WR0A 1BBT1 1WCKA 3HEIA 4LF4B 1FPOA 3TGUH 1DBNA 4WM7C 2RV9A 4XFIA 5DAXA 2GC3A 2J1EA 1AXKA 3RYHA 1XSQA 1JZ6A 2WS93 2PLV3 1AR71 3ZFFC 1FAYA 2PQQA 3RZGA 3QO5A 2XAJA 5C8WA 1GP4A 3MDPA 3WHTA 4OHYA 4TV8B 1FT9A 1XDCA 1GANA 1GM7A 2QQOA 1BQZA 5DEDA 1SQPH 4J9YB 1PO12 2NMOA 3WEZA 1UZWA 1XI1A 1RUI2 4Y4YA 1ZWIC 1SPPA 4HK8A 2WLLA 3UQ8A 2F4VO 4QQPA 2B1GA 2DTYA 4DR4O 3CXHF 2PELA 2OWOA 4PDVA 1K12A 2BFUL 4TLFA 3FHAA 4MX3A 1IPKA 1OA3A 1GOGA 2YIBA 3OBAA 3OBRA 3T1CA 2WAMA 1FXKA 3I7DA 3ZYHA 4RGAA 3VD5A 2WLKA 4RS5C 3ALQA 3ZYBA 1WW7A 4H3WA 2WLIB 4AFMA 5GJ6A 2VS0A 3POGA 1OURA 1IDSA 1ORQC 5CISA 4PI0A 4N43B 2C26A 3P30A 5FAXA 5JOWA 1RUH2 1AI5A 4UVAA 4DUZO 3OUJA 4O4IB 1VBE3 2WT1A 2ILMA 2YGMA 4DXWA 1CX1A 3SITA 4QX7A 1Q90D 2CE4A 4GH4B 2WWUA 1T2XA 2LO1A 4LORA 3HKBA 5F3CA 5FFOC 3ZHSA 4UT5A 4NXMO 4RUFA 1RUE3 5IK8A 1BZWA 3AJYA 4WM7B 2JJ6A 1VRH1 3HAGA 5GONA 3AP6A 3L2YA 3I2KA 1RJ8A 4FO9A 3W5NA 2WLHA 2RS52 4PLNA 4JDMA 4YJ3B 4LO7A 4MSWC 3BRCA 5L7OB 4BLJA 4XCAA 4AGVA 2XLFA 2WWWA 2VCCA 3H3UA 1NZ6A 3ZN1A 5CEHA 4QQHA 1COV3 1S5JA 5JPNB 3X2QC 1LOBA 2CUGA 4TOIA 3FX3A 1SHWB 1AX0A 3DN7A 2Y64A 4K20A 1FJGB 5KHHA 1LEDA 1PK6C 3DYMA 4IGOA 2DCKA 2X6CA 1MS0A 4G2KA 1AR62 1ENSA 1Q8OA 3OPTA 2DBNA 2KSDA 1I5XA 4GB32 1U5YA 2IU3A 2LFRA 2D5FA 4IUGA 3VZOA 1RM1C 2XWBB 3ZRXA 1EFRG 1R64A 3AMNA 4AAXA 2AC1A 4I3PA 4MVZA 3WVJA 4FPFA 1NH2D 1JOYA 1S1AA 4YGDA 2VQUA 5D5PA 2ZGNA 4HVQA 4JYYA 1WW6A 1QF3A 1SBEA 1AL0G 1U12A 2XL7A 1REDA 3K57A 1W8OA 3CQOA 2VVDA 5A3WA 1Q8IA 2F4VB 4DR4B 5BR8O 1OCOC 3VBUA 4CP0A 3I2HA 4JHZA 2JGDB 1Y7BA 2ZE8A 2B9UA 4WM8A 5L36A 2Q1ZB 3IZOA 5ISLA 1SETA 1H38A 5DZFA 4KH9A 1YQ2A 5JCOA 2QSAA 1UF2C 2H0VA 2HWE3 2ZOEB 2UU9B 2WLMA 1IHMA 3WNMA 2R042 1AR82 1QQP2 3LA3A 5JIAA 1RUF3 5IHRA 4F4LA 4UCVA 3EMRA 3M8LA 1W0PA 2VZ3A 5BXZA 2MK3A 3VD3A 3T2TA 5DUWA 1LNQA 1W8HA 2WUHA 4RQEA 2GP5A 5IVEA 1TUEB 4NXMB 1WKYA 2XJUA 3UESA 4DXTA 1Q8QA 4JRLA 5K7PA 1QR8A 2D97A 3K51A 5JZGA 2R073 2B9VA 1BT8A 4ATEA 4CXWA 5FOJB 1I1EA 2PF4E 3EJKA 3K48A 5IW0A 3MF9A 1O3RA 3THDA 3E5QA 1K8AW 4DZGA 3V64A 3WDYA 4BXFA 3ZLIA 5JVVA 1IS4A 4OHWA 4KU7A 4AI3A 2ZGUA 3O0WA 4ES9A 2XR4A 4YZ1A 1O4ZA 1W99A 2YEVB 3SPCA 3QF7A 5DPNA 3B9IA 1XE0A 4NHLA 3N9NA 2PLV1 4DXRA 1JUHA 2WFF2 1HKDA 1XYOA 4PBPA 1RUJ1 1OCOB 1RSOB 1AR5A 3V56A 4H44B 3HQXA 4ASLA 2P17A 1JYCA 1MABG 1DQ5A 3HQRA 5FPXA 4S2DA 4G27B 4MGIE 4I9QA 4PBOA 4Y1VA 4URTA 5ABJA 2HP8A 4KUMA 4EWDA 3JD71 4WCEV 4XAEA 3RI9A 3ZFGC 4B3SO 3UJOA 3QO8A 3WG7B 2ZGKA 5FZHA 1WLDA 2RMU1 2ARAA 3LSSA 3KF3A 3FHIB 3ABZA 3J7MA 1PO21 3RYCA 3GJAA 1NCRA 1DZRA 1W39A 1RJ7A 2QVSB 4FFFA 2NNUA 1RL3A 5LY1A 2RG4A 3B77A 1RUD2 1EV11 1CAXA 1LU1A 1POQA 2DURA 1GM8A 1R081 3HVDA 4CU7A 1DLBA 1AUYA 4ZIBA 3ASNB 3M8AA 1Q8VA 4CRQA 3HNBM 3N7MA 3KCCA 2IH3C 2XJRA 3A0HZ 1WCQA 3VBBA 1RUE1 1C1LA 4QHBA 2CTRA 5L19A 2IU0A 2DUPA 5JR2A 3LEIA 3CL1A 3CJIA 4HNAB 2WZ8A 3FB5C 4MVSA 2FDIA 5EZWA 2FDKA 1NE6A 4FAGA 3T0DA 1XNBA 4L99A 4LMFA 3BU0A 5A3TA 1NBMG 1JHJA 2JG9C 4DV2B 2BSKB 4N7UA 1LR1A 2JXAA 5FZFA 3CMAV 1SZXA 4P5HA 1PZ7A 1WCDJ 1WAZA 3RYIA 1KC8W 1DGRA 1U5XA 4ARYA 1OKQA 1VIBA 5JJEB 5LGTA 5GZGA 2E53A 1DP0A 4JDOA 5L9VA 5JI7A 2QKDA 2J22A 4PDRA 1COV1 3ZFGB 4FPGA 4XDOA 3CF6E 4YM0A 1ND2C 3J7NA 2BERA 3BEHA 1JYTA 1RGSA 2ITCC 4GX2A 2AH2A 2BJSA 1WA6X 1QLEC 2E74B 1F4AA 4F6EA 3C7GA 2CGNA 1KQRA 1PMIA 1J5EO 1NA1A 2WSVA 4R9AA 1VQMV 1K7DA 2YDEA 1JXNA 1NX9A 3VKOA 4EN0A 2WYFA 5FMCA 1K5MC 2CHHA 1QEXA 3K4ZA 3RQ0A 5H5NA 2F17A 3B00A 4DR2O 1YIPA 5LP6C 2W6IG 4O65A 3WD5A 2HR3A 3STZC 2JEMA 4QE7A 1Q81W 4XURA 1D5AA 1MEC1 2XG3A 2DYRC 1UXXX 2VO5A 3HT2A 3A7QA 1XBFA 3OCPA 1IURA 1YJ9V 4JGZC 1R73A 2E7QA 2WO2A 1UKGA 3SJBC 1D0GA 3DPRC 1I7FA 2RN9A 4B3SB 2VMFA 4X66O 2VJXA 3ML0A 1UKRA 4QKDA 1ROPA 2HKOA 3MLJA 4F6RA 3WDUA 1BL8A 2WWJA 1POV3 4JV4A 3RRDA 1AR92 4IHJA 2HWE1 1EN4A 2D6MA 1NKDA 3APBA 1R1ZA 4QHZA 3N9LA 1W8WA 4CTEA 4UCSA 2UXXA 3VB9A 1RUF1 4UBGA 3K5OA 4ARXA 4XABA 4Q8KA 4BLIA 4XBFA 4ZHQA 5HV4A 1DYOA 4CUCA 4UFMA 4PQQA 4IT5A 5A33A 1GWMA 4MGSA 1JZ3A 3Q8EA 2B9ZA 1W03A 4U7OA 1GSLA 1YWKA 1PGSA 3H1MA 1Q56A 2BGPA 5CBFA 5KUKA 4IGGA 2ARHA 3LOBA 3CNAA 4FPPA 3OR7C 3RWRD 4LQRA 1JI6A 3OT7A 4I0BA 2R071 1ULCA 2A75A 2VUCA 1AB3A 3MHSC 1RVF3 3ZPOA 5T5OA 4NIIA 4XETA 1FXKC 1G9FA 1FV3A 3TB0A 1KXGA 2WNUB 4CP2A 1GNHA 1YHQV 4D0QA 2EINC 1GNZA 4COWA 5HCBA 1QJX2 2IUWA 4ONUA 1VF7A 5IYZA 4PLOA 2YBKA 1R6NA 4I2OA 4RR3B 4TQDA 4AFDA 3MHZA 4OGQB 2A70A 3EVKA 2WZR3 4JI8O 3A0BZ 3JD3A 2R9AA 5LHGA 5A7SA 2UXCO 5FZKA 1H4GA 1SLIA 1R6KA 1LHUA 3Q9OA 2QQMA 4GWJA 1SZBA 2E5LB 1RPRA 3OUIA 4YSFA 1JFFB 3DPRB 2DQ3A 3LOIA 2JIJA 2XWJB 1JODA 5T55A 3CRQA 5IVCA 5B3SB 1I5ZA 1CPNA 3NAPB 1QR9A 1CN1A 2BWAA 1G9CA 3G6BA 4UV8A 2VQFO 3AG4C 2E75B 3HN3A 3RYHB 1HQNA 5FUNA 3FYEB 3JD2A 3DF0A 3ZN0A 5CVRA 4ZXKA 1BZKA 1ULFA 4Q4W3 5L3EA 2QWPB 2YXSA 4XMAA 4D6SA 1A3KA 3MUY1 4RQPA 4J6GA 1W6PA 4YWAA 4FOQA 4Y5SA 3R0RA 1JMKC 1H1AA 2XLGA 5B4NA 1GMMA 1YI9A 2F4PA 1OQDA 1SFPA 2CNAA 2RR12 4NPRA 4FJCC 4QKFA 1R092 3VZMA 2RQ6A 5GW7A 4XE9A 3X29B 5FPLA 2OCCB 1LULA 4MVMA 5T5JA 3ZHVA 1VBB2 2QWOB 5FP9A 5A80A 4AR2A 5L3CA 3A23A 2JEUA 4XW3A 3VZKA 3OEHG 3M3EA 5FY9A 2EINB 1XMQO 2OIEA 1UN1A 3U07A 3J8F2 3ZR6A 2HWF2 2YIBD 4CS4A 5BNNA 4B7EA 3AZWA 1X4TA 4B8EA 5LK5A 4W8JA 2ZNIA 4ASKA 2EF6A 2WQ4A 4COVA 1ZM1A 1SG3A 4QGLA 4EJRA 3VZLA 3ABLB 3F7YC 5FL7G 5EJZB 4XDJA 3QD6A 3QOPA 2A3YA 2OZ6A 2EILB 3MIFA 3MYXA 2XOKG 2P2KA 4K8ZA 5FK7A 4AVBA 4AFAA 2LW8A 3AFGA 5FV3A 3AG4B 4DV1O 5F5QA 3ZFEA 2ZT9B 3VBUC 5JH7B 3T4ZA 3ILRA 5C3PA 1YHFA 1Q43A 1JJOA 2ZA9A 4WM8C 1QNMA 4YYOA 4DUVA 5IUQA 1N32O 1ZZ7A 2UXBO 3K3WA 1PVC2 1V6KA 5JCOC 4XCBA 1W9YA 2LW1A 1OHHG 5D21A 4A5UB 2Q5ZA 1URFA 2XQXA 3N35A 1F8VA 3ZMTA 2UXCB 1HJFA 2CK3G 2HH9A 4CU9A 3MIHA 3M99B 5FZEA 4XF0A 2OX0A 1CZTA 3AZZA 5JZGC 4FLUA 3R4UA 3T4HB 2QQNA 5FZ6A 4HL0A 4O2BA 2VQFB 4U2AA 1AL23 5I0RA 1WA8A 2BPA2 3SCGA 3GHMA 3VD7A 2EIDA 3F5TA 2O8QA 5FPBA 5A3OA 4HAMA 1GR3A 1WUVA 1HDJA 2Q4SA 2XKOA 1R1A2 1VMFA 2O0OA 1YI7A 3B2EE 4EV0A 4GCZA 4QM9A 1C8NA 4O4LB 2VL4A 4CCMA 2ZJCA 1K3IA 2YPJA 2VPVA 3BVCA 1DQ6A 2QTSA 3MW3A 4YIPA 1XYNA 4J7JA 4X20A 4NUBA 4KU8A 1MS5A 2R70A 2EJ7A 4JPRA 3VBUB 2Q7EA 2PYLA 1F35A 4UCOA 4IDZA 2HEVF 1KECA 4EWAA 1I6XA 4UCUA 3ZHTA 2NZ9A 5LBFA 4R9BA 1XMQB 5KBFA 3K03A 1FNZA 4DY3A 1X8EA 1EUUA 1GQHA 3SMHA 4FFIA 2OXBA 1PO13 3EHKA 3TAYA 1RUI3 3PMEA 1GM9A 1UX6A 4ZKTB 3KM5A 4DR7B 3NJXA 2YFUA 1VB2A 2ZR2A 1NCRC 2X09A 1YUDA 1IG3A 5BNPB 3OPZA 4EN7B 3GWOA 2QTWB 3JAMN 1PGL1 2UWBA 3IIAA 5LA9A 4YW6A 4DV1B 4TV9A 3W21A 1VIWB 2EJRA 1GP5A 2VECA 4DR3O 1RUH3 3K46A 3CMGA 4Q2FA 3WP3A 2ZINA 1Y74A 3ZHUA 2FCUA 1UCXA 3USUA 4I02A 4CH3A 5FZBA 3J4UH 2XJTA 4Y26A 4HPKA 1AYN1 4ZZ5A 3I2JA 2VG9A 5F5AA 3CJIC 5C3OA 5CFCA 4WV8A 2JDUA 2D44A 3GZEA 4J1WA 5FP3A 1L3JA 3EHBB 1D2SA 4NAMA 1SCSA 4DS0A 3DXTA 3GF6A 2QM4A 1S0GA 2F6BA 2A7WA 4Q4W1 1LODA 4Y24A 1OFSA 1AF9A 3Q8FA 5JXJA 1PL0A 4BHPA 5EJ3A 1EYBA 5F39A 2VU9A 2EIJC 2RS53 1U0AA 3JALB 1IGOA 5ABJB 5LK7B 5FBZA 1UYXA 3LA2A 5IY5C 1US3A 3ES4A 2AZ2A 1HQWA 3MFCA 4ZU4A 3ZCCA 4PIYA 4RAIA 3O65A 2KXLA 5FYZA 3RYCB 1NCRB 5JI9A 1NA1C 2N7GA 4KWUA 2Y38A 2Y48A 5HPOA 1K3EA 3H8RA 1W2NA 1AR63 5IJ9A 1CAXB 2J1SA 1WNSA 2VOVA 4GB33 3I2FA 3PVEA 1YNAA 4R8HA 4NE9A 3VKMA 3E8HA 1WWYA 2ADEA 3ILFA 1E5IA 4OHZA 4IV3B 1RINA 2UUCO 2BE3A 4HKWA 1G9BA 1G9DA 2ZIOA 4DXZA 1ZRFA 5E88A 5FYVA 2LQTA 3QNEA 3K79A 5B1BB 3PTYA 4AK3A 1N1SA 1UO9A 3SC7X 4AXOA 4AHWA 4LFBO 3I3EA 3W20A 5C3SA 5C8YB 1TEIA 4XBLA 3M7MX 3JATA 3B5LB 3WDXA 4TSFG 1BHGA 4R52A 3CRAA 5I0UA 2EIMB 3ZMSA 2R043 1AR83 2JIZG 2FHRA 1QQP3 3CJHB 4LWSA 2VWJA 4GMP1 4PDMA 2R062 1QXJA 5LHIA 4N9IA 1I08A 1BEV2 4Q20A 1NA1B 2IFRA 1OLQA 1YFYA 3VDCA 1XE8A 3AYAA 3OGSA 4LLFA 3IT8A 2DMXA 4QKBA 5KX5A 1HNXO 4LHKA 3HKEA 5IVVA 1B09A 1O59A 3WF0A 1VARA 3LCPA 4LUMA 3AXEA 1GO3F 2ZXWB 2Q30A 4IE0A 4OX9O 1QJY2 3IIIA 3ZN4A 4COUA 4AILC 5GLUA 1BBT2 3J7LA 1N1VA 1P8JA 1V55B 1XHXA 2Q6AA 1JH5A 4RHV2 2EULA 1D0HA 2QQUA 5CA6A 5A32A 1QY4A 1X33A 2RM22 3ASIA 1JYXA 1QOOA 2HLDG 5FYTA 4YVWA 3L73H 4WVVA 5FZAA 1L7QA 3S3WA 5C9AC 3K0GA 4AI2A 3KG2A 3IPVB 4D7SA 3POFA 4I30A 4DOUA 2WFF3 1TME2 3VBRA 2LFSA 2X5IA 4NIHA 4LE4A 1VBC2 4IHJB 2Y6GA 1VRBA 2EIKB 3H9AA 5FZMA 2CU5A 3S3XA 1XL4A 1GUIA 1QJZA 2B39A 2F93B 1PO11 1NCQB 1W6MB 3FAVA 4RFRB 1EPZA 4RQPC 3WNKA 1DZTA 3OUSA 5FKBA 5DUXA 1IS5A 3OB8A 2N05A 5I0DA 3SYOA 3M70A 2EALA 2VW1A 4FZ0A 1MACA 4QX8A 2YYOA 3UETA 4AG4A 2WRAA 1D7PM 3ENRA 1NS1A 2Y0PA 4JTAB 5FXVA 2UUCB 1F7YA 2D98A 1W90A 2J1TA 3KD4A 1FPN2 3KT4A 1I9RA 4XJZA 1Q8PA 5HXVA 4FOWA 1RUD3 3AVSA 1RUH1 2VAUA 3B02A 5IYZB 3LKJA 3J7AU 2L9LA 4LFBB 4XF3A 4Y3OA 4XXPA 4AI0A 2HEYF 3WF1A 5BNNC 3KGLA 2FYUH 4D8MA 4WBNA 3KHCA 4LO6B 4QQOA 2EXIA 4AQYO 1NXMA 3LE0A 3RVYA 2GTAA 1DF0A 4MTXA 4EB6A 5H6QA 2CAVA 4CZZA 3PTRB 2AUYA 3JQWA 4Y1UA 1JU4A 1JOJA 1WMDA 2ZEWA 3KT1A 2RS51 4LLOA 3SEEA 1IBMB 1MR5A 1W3VA 3ZFEC 3O1SA 3DCQA 1GZWA 1ASJ1 5CA1B 4CXYA 3K3OA 1TVKA 4LO5B 2W1SA 1KDMA 1GN3A 4KP4A 2EX3A 1HNXB 3DKQA 3ZSKA 3RZHA 1O3QA 3BI3A 1W6NA 5JSRA 3WB2A 1PNKA 3MI8A 1XXNA 1EM1A 3D3IA 3W7UA 5A6QA 2IC1A 2VMEA 5EJ1B 5IAVA 4A6SA 1AR61 1DQ1A 5F9TA 2ZX3A 4LITA 4JASA 1ODNA 3UKTA 3WNLA 2WIIB 4GB31 4QPYA 1ZRIA 3IJ4A 4AVAA 2YXLA 4GJZA 3JU9A 3UJQA 1GH6A 1IZ3A 1OD3A 1L7RA 3THCA 2YUAA 4JZGA 4LR4A 1FXZA 1D2DA 3BCWA 1W9TA 2XVKA 1KEXA 3ZMNA 1IPSA 1V54C 3E5XA 5BNNB 2GH2A 1M93A 5HI0A 5BMVB 1THZA 3HOBA 4OQ9A 3QBQA 5B5EZ 4B3TB 3KF5A 5LXTA 4TUYA 1HRV2 2OYQA 1U5ZA 4B4RA 4E2GA 1UD1A 3AKRA 3S7IA 2FBEA 1AR93 2AR6A 3CB2A 3CWBH 3I2GA 1NR7A 1QCEA 2WWSA 2D43A 3GBFA 1Z5WA 1AR81 2WT2A 5DAPA 4UW3A 1LGBA 3D3AA 4J42A 3ZVXA 3WLUA 3A8TA 3ST7A 2RJZA 4YZ5A 2ZGRA 1N3PA 5A7PA 2JIGA 2ZGOA 2YSUB 4X64O 2ZKLA 1ZL8B 5CG9A 2BCCH 1DCSA 2BGOA 1K73W 4YZ4A 1HXS1 1LJ7A 2JDKA 4M00A 4DINB 4FLWA 1YJKA 4A3ZA 1AROP 4LR3A 2FCTA 5IK7A 2AXTZ 4XJUA 2XVLA 4K8XA 1QOTA 2HVJC 4XUOA 2XLAA 4AQYB 4P2ZA 1RXFA 2JS5A 1RUC1 2LGWA 5DMYA 3FWEA 4M3CE 4AZZA 4PF1A 3T4DA 5FP8A 4Q8LA 3VBFB 3CCLV 4AEDA 1Y76A 2CGPA 1QJX3 5IVBA 4O2BB 2PA7A 5KXBA 5J9PC 3M7AA 1VMHA 2ZTNA 3PJYA 1WA8B 2AGAA 4JVAA 2IXCA 4KBBA 3DECA 1XNRO 2XAQA 2WL1A 2VW2A 4GKJO 5FUPA 4F8AA 1XU2A 1N34O 2Q4PA 1J3QA 1K45A 1QH7A 2QUOA 4D6TH 2Y0IA 2BRTA 4C1XA 2X29A 2WFF1 5CFCC 1H1IA 3DXUA 1O4TA 2I74A 2CH7B 5FQ0A 5LL6Y 4M0HA 1U97A 3CMEV 4L11A 3NKGA 5B2GB 4X20B 2HFEC 2VBDA 1HWYA 3K06A 5GM0A 1MNGA 5FKCA 4Y5Z0 2KB1A 2CTQA 2BVVA 3M2MA 5EZYA 4IYHA 3JD72 3SH5A 5KMGB 1UY1A 3WB1A 3HNMA 1ZAUA 3T1YO 1RYYA 2VUDA 3K04A 5H9QA 1MZ6A 3WW4A 2RMU2 1ND3A 2EXKA 3G6EV 1NR1A 3S0MA 5EFUA 2CYFA 4NHYA 1DGSA 1MZFA 1S4CA 1UJWB 1PNFA 2PHDA 4LFCO 4DV3O 5A2QN 4DV0O 3JASA 1A8MA 1VP6A 2RR13 2J1UA 1R093 2C24A 1EV12 2XASA 3WP5A 2ZDIA 4BQ1A 5IWAO 3RVHA 4MXWA 1LU2A 1RUD1 5ACA1 1R082 1QNWA 1VBB3 2EBOA 4Z8BA 1VMGA 1M4WA 4N8MA 1LR5A 5DDJ1 1D4VB 2RNBA 2ZNJA 2QZ2A 1VB4A 3J8F3 1TUBA 3W9AA 3AG7A 2HWF3 3WF3A 4FLZA 3WSOA 1RXGA 1H2LA 2Z69A 3O14A 1Y74B 3USUB 2Z0AA 2HBTA 3BUCA 5FY0A 2ZGMA 4ZHNA 3KQ4B 2C5DA 5CFCB 1SQBH 3C90A 3FB8C 2RJLA 1PVXA 3AKTA 4X64B 4ASMB 2GUZB 2VZ1A 1LUVA 3ORJA 4O61A 3BTAA 4AI1A 3D36A 5FMDA 2HEWF 4GX5A 4CPBA 1V70A 5DG1A 2VE1A 3LDBA 1ENXA 4OZOA 3PVBB 4MH0E 4ICGA 1MS1A 1HB2A 4UVCA 5G05L 4DV7O 4LBNA 2A3QA 1NY72 2VZQA 1MG1A 2YICA 4D3WA 2PHXA 4JGYA 2FDGA 2Q0OC 3BFRA 4FQZA 4YGEA 3ON7A 1PVC3 1CEZA 3FX7A 4O2AA 1C57A 4CH5A 5CIRA 5FMBA 1FAFA 2DCJA 3BB6A 3OY8A 3HPNA 2RMKB 4HONA 1LOGA 1XNRB 5CA0A 4DY5A 4JI6O 4QGNA 4HKLA 3F7VC 2UUAO 1AJQA 2VQTA 3CIHA 2H3OA 3FBMA 2K46A 4CU6A 1Y9GA 1NZCA 1Y4MA 4Z1VA 2WA4A 1HB4A 1MEC2 2WABA 5IJ9B 3JD0A 4JI1O 5EQUA 3V0BA 4QMAA 5DUUA 5E6HA 1O8SA 4NIGA 2J42A 1IG0A 4LKFA 1ULDA 2K2SA 3RZMA 2QGNA 3T1YB 1O9GA 4CEYB 1PV0A 5DAQA 1QBZA 3VDBA 2IH1C 1R1A3 5LWBA 1HLCA 1VF6A 3H1LH 3LPGA 2DTWA 4QXCA 4YW5A 2OIGA 3APQA 4YVWC 1AI7A 1G8WA 4LFCB 4DV3B 4JQRA 4CSWA 4TWKA 4DV0B 1CWPA 2CWMA 1VQOV 2VR4A 2HWD2 1QWRA 1OSGA 5D2AA 5J2UA 5IWAB 3VBRC 2X5IC 2ZM6O 1AP6A 1M9NA 2SBAA 2QE7G 4MT8A 2R1BA 3JATB 2W92A 4LBLA 4D94A 3EFFK 4NR1A 3DL3A 5EV7A 4FPYA 5I8SA 3LDDA 3AG3C 1BHBA 1PHMA 1X82A 4AYUA 3UKVA 4JX0A 4M3CF 1N0JA 2G38A 4HT1T 3VBOB 2MNGA 4LWSB 1G6NA 4HYOA 1G8MA 3AKSA 3OUHA 2XHKA 4NKGB 2RDQA 3FUQA 4B7KA 3IAQA 3ZSEA 2VUAA 2CDPA 3ZMUA 5T50A 4RO2A 4G4FA 3ZSMA 1QJX1 3MIGA 5FR3A 1Z7S2 4C0HA 3APOA 4IERA 5J2TA 2JX9A 2K1EA 3VQVA 2ZCEA 1LCLA 4MW8A 4LBEC 3B09A 3GYDA 1UOJA 1L0NH 2BU9A 4P9IA 4DV7B 2WNVB 4LEJA 2R30A 4X8PA 3PURA 5A32B 2R9RB 4LC1A 5LYJA 1O5UA 3POYA 4R4XA 5GZFA 1L0LH 2BTQA 5JQGA 4WVZA 5KHKA 2Q9LA 4B3NA 4Q1RA 4BQ4A 5CG8A 3AFKA 2Z79A 4Q1PA 4JI6B 2WN3A 2D40A 2UUAB 3C3SA 5FZOA 1JTZX 3EXUA 3HKDB 4QQLA 5EXOA 1HX6A 5FBJA 4OUEA 4DRRA 3WF2A 4KWJA 3LIHA 3RYKA 2DW4A 4Q4V1 2I07B 1GN4A 1NG0A 3AG3B 1J1TA 1K4CC 1YZBA 3OGIB 4AE2A 3RJ2X 3AP9A 5LBBA 4JI1B 1PKXA 4BPZA 2PUSA 1DU3D 3CCEV 5FYSA 1ZNPA 3O1PA 5C33A 1DGWA 1VBB1 3V0AB 2DWEC 1YXWA 3FYIB 1AYM2 1J1LA 3QH6A 4LNUB 5FYBA 1NUKA 3SH4A 2LM3A 2N74A 3RNSA 3CBNA 5FNVB 4P9PA 3J8F1 1M90W 2HWF1 2CY6A 4XTMA 4ZXEA 4MV2A 5A7NA 1FFXB 4JCKA 4FLYA 3WXPA 2XVGA 3WDTA 4JI0O 1W04A 5CU1A 3RPQA 4QAWA 2P3KA 3WNNA 2ZM6B 1GWLA 2TUNA 5KA5A 3ABKB 2IJJA 3CU7A 1OPMA 4WBNB 1M56B 3RYPA 2YC4A 5CZKA 4IE5A 3E97A 1PGW2 4R50A 5DZGA 3NWKA 4EB6B 2W47A 3BVOA 3LDKA 1JYWA 3OGCC 4OFGA 5FCCA 4H7MA 3E35A 1HNZO 2VOTA 3RWKX 2ZACA 4LE3A 1JBCA 2XTAA 5IE9A 1T6BX 1GZWB 2JGUA 2PXJA 1PVC1 1TVKB 4GUNA 3MLLA 1TVGA 4IEXA 4OHVA 1GMGA 2QQLA 3ZRWB 2C2AA 1ODMA 4GYCB 2VVEA 1W6NB 1JUIA 3ZYPA 2A79B 1PM9A 3OTFA 1CPMA 2R063 1S0IA 5IYBO 1ZX3A 3N2KA 4JI5B 3MW2A 1BEV3 2IXIA 5FO8B 4CDWB 2RVAA 3KVAA 5B1AC 4DUWA 4B4PA 3P1IA 4TXWA 4FM2A 2O1QA 3F95A 4FK5C 4JI2O 4I4TA 2GZWA 4IXLA 4FBFA 3CDZB 2CTWA 3H1KH 5JJNB 1WBLA 4AEDC 3FKSG 2D3SA 4EKWA 4NRPA 1W8TA 5IJ0B 1NAEA 1R1A1 1QJY3 4YW1A 5ANNA 1IQDC 4JTDB 1BBT3 1CZSA 3JSLA 3ZSJA 4XJ8A 1R3IC 4RHV3 3ACLA 3EO6A 4E4HA 2RM23 1LKNA 3KWVA 5LXTB 1ZYBA 3FLTA 1VAMA 3ILNA 1XMOO 5LOVA 1BQ0A 3IN9A 3OOXA 2GNDA 2F1MA 5FYHA 1S2EA 3LD8A 4RFT0 1TME3 2X8KA 4IETA 5F32A 5KA6A 2VULA 1LESA 3IDEA 2PZSA 1VBC3 4NJ4A 4HLTA 3THOA 1DF4A 1XJAA 4K3AA 4HXCA 1UY3A 1ND3C 2OKXA 5FY7A 4Y20B 1W9WA 2ETEA 4JI0B 5CB4B 2QFEA 3AL6A 3QACA 3B9CA 4DNYA 3TNPB 5LEKA 4FLTA 4TWTA 3POBA 4MVOA 3CXCU 2AZ0A 4AL9A 2QTOA 4Z92B 2HJFC 4XIOA 2SLIA 3VBHA 2QWQB 2ZDIC 2JG8B 5B1AB 3HD8B 3VDDB 4FP2A 4DR6O 4QHOA 4QXBA 4KWKA 5LMUO 3WDVA 5HFLA 2ET7A 1Z78A 1FPN3 2E76B 1AYN2 3SHRA 4CDQA 2IZWA 1IX9A 5APAA 2WFPA 1ZREA 3T2QA 1DGWX 2E7AA 3IFXA 2OA2A 3TN92 4A7YA 1HN1A 3BIEA 2VZRA 1O3TA 1DYKA 1W6QB 5BY1A 4FM0A 4FP3A 1S0BA 2WLNA 4XZUG 2AEYA 3ETGA 2QDOA 2DYSC 2HJIA 5FMOS 2VZTA 4Q0VA 5BV6A 1GKBA 3PMSA 1HB1A 2P3JA 5C6CA 3QTCA 3D36C 1NLRA 2MEV1 1MQTA 3OE7G 5EZYB 1OH4A 3T09A 1OPOA 2O14A 5K4LA 4XZPA 2IVJA 4QX1A 3K9AA 4MGKE 2ZMKA 4JI2B 3EQEA 4RSUA 2VGDA 4OZXA 1PP9H 2XXZA 1YIJV 4GX1A 4JGYC 2GN3A 5FZ3A 5KXEA 4E8DA 5J98B 3JASB 2XDVA 1PL4A 5FJHA 4KBZA 3LA7A 3RYRA 1HR0O 3I49A 2UXNA 4MXWB 1X50A 3WW3A 4GALA 4PIZA 2O8OA 3CCQV 1UL9A 1W6OA 2QEXV 2WO1A 2ORXA 1V6JA 2Y26A 1GQGA 3JB8A 1GZCA 1PNMA 2MHFA 1UIJA 1XMOB 2KG7A 2TBVA 4QE9A 4AFCA 5C7GA 1UOGA 2XAGA 3PUSA 1PNGA 3NR7A 3H01A 1I94O 3K4DA 4FPJA 1BQPA 2ZX4A 1LHWA 2D93A 3RMYA 2OUHA 4K1YA 1FXVA 1VF6C 1NQTA 4J80A 1B35B 5T3NA 3SCHA 4NWWA 4IE4A 3NV4A 1HRV3 3WNXA 2EXJA 4I0XA 4XUQA 1JZ7A 5F3IA 1BCXA 3MPPG 1FMD1 4KNCA 4MHRA 4CU8A 3R65A 2ZMNA 3FC0A 1R3LC 4DR6B 2P6CA 4I50A 2J1VA 4M01A 1M57B 4KWLA 5F2VO 1CJPA 3N9OA 3E89A 4QPGA 3BU7A 4Q27A 5LEJA 1AP5A 2ETNA 2BVBA 1YCIA 1UYZA 3IGAC 4CPBD 5EPAA 5IDJA 2VBPA 2R061 4O2AB 4Q29A 4OHXA 2QWRB 3IMNA 4I55B 3OY8B 1BEV1 3ZDSA 4EQVA 1F4HA 4X1IB 1BMFG 5IYYA 2VXJA 1S76D 4YJ2A 1KFUL 3C3TA 4NHMA 5EIBC 1DHKB 1XRUA 1US2A 1KBHA 5FYCA 1JN2P 1NI8A 2F95B 1GRJA 4YFWA 4CH6A 5FZCA 2V72A 1CXZB 2P3IA 5A7WA 4DIQA 1QJY1 5LMNO 3T2OA 4FFHA 3FB6C 2BFUS 3V0BB 4RHV1 4BU2A 1LHNA 4MW3A 1H4HA 2RM21 4BK4A 4Q0SA 4KGGA 2ITDC 3H3LA 2XBO1 2VMIA 2WYSA 1RUJ3 5DZEA 3RBZA 4PV1B 2W6JG 2VQEO 1TME1 4XYXA 1VBC1 3H1WA 4TTGA 3OBZA 3LDCA 4E9KA 3FFZA 2GMPA 2WA3A 1ST8A 5J2UB 4HG6B 5BYNA 4QX3A 1HR0B 2ZMLA 3JD73 5JSOA 4YHHO 4IE6A 2FZ1A 2B45X 2HYXA 2LROA 1S0JA 2RMU3 3CD6V 2YC2A 3UCSC 5FYIA 4BXSV 4XILA 1PO23 4AF9A 1CPYA 3RN4A 1ZA4A 2JE8A 1XL6A 4NOTA 4LP8A 1I94B 5LGNA 3OSDA 3AMHA 5EYPB 2ZE6A 1EV13 2JD4A 4K1ZA 1FPN1 5K9YA 3CEIA 1R083 3TWIA 3L74H 4EYUA 3SJCC 3LNMB 4NB5A 2BBAA 1VQKV 4KL1A 5J2TB 4ASUG 2ARXA 4Y22B 3U37A 2BNMA 4K6BA 3UNPA 1L8DA 5F37A 2OPWA 2LGQA 2PAMA 1N47A 5BNOA 5E1AC 1OCCC 2H0BA 3CC2V 2DCYA 5D8AA 3AM2A 3ZFFB 4JTOA 1Q82W 3KV6A 3ZOIA 4CS2A 4NTXA 1ASJ2 1S5HC 4PDWA 4XC9A 5IVYA 4HSLA 2FMLA 1HRI2 3KV4A 5FZOB 2WNEA 2V7QG 1OCZC 4XIKA 5LB6A 4FZ1A 4E4SA 2XB6C 4DK1A 5CFDA 1IXBA 5LBQA 2XJVA 3AK3A 3NXSA 3WW2A 3C3VA 5LMNB 4RS5B 4Q4X2 4GT1A 3E6DA 4CCNA 2HHHO 1WLEA 4YG6A 5BUVA 1NH2B 2PAKA 1FYJA 3AEIA 3DTUB 1KQSU 4E2SA 5IATA 2J1AA 2EZPA 1F9KA 1K5QA 2QR4A 1PMHX 4R9CA 1H8TA 2YS8A 5JIUA 5KAIZ 4KXRA 1BVP1 4LHNA 3AL5A 1N0NA 3AYCA 3IMMA 3UO2A 1MEC3 4ZOLA 5F8PA 1UY4A 5J48A 3B3QE 4AVSA 1SQGA 1ZBE2 5JUVA 4RD7A 3SYCA 2VD7A 3MIBA 3OTOO 2YZ4A 2NLJC 2VWKA 4X1KA 4DV5O 4IEVA 4YHHB 3OEAA 4E2LA 1VALA 3JXSA 1OCCB 3AYEA 2YHJA 3OEEG 3GALA 2FDFA 2ZQMA 4I0WB 1HRV1 4IEZA 2G9FA 5F2WA 2RDRA 1EN6A 1B04A 1PM7A 5FDBA 4IV1A 3H1HH 1VQ8V 5FYYA 3G71V 4ZI7B 1AZDA 3B7MA 3EYPA 2OT5A 3E22B 3IDAA 1IQAA 2Q1MA 1Z0HA 1XNKA 2Y8KA 2HWD3 1S0DA 4XFGA 2QQVA 3CC7V 4FVVA 3M4FA 5B1NA 4DUZB 1OCZB 3K4AA 2VMCA 1N3QA 4EN6B 3ABMC 1COWG 3X2QB 1WN7A 2JE7A 1JYIA 4C91A 4CCCA 1HXS2 1DG6A 2X10A 3BTZA 1JZ4A 1OXCA 4UB6Z 3N7JA 2A3WA 1X36A 5T5LA 2XJSA 1PK6B 3LEGA 4FFBA 4WFHA 2JB8A 1GTOA 3H0OA 1DGLA 3KV9A 4BR6A 4ISRA 3ROUA 1J83A 1RUC2 2DE0X 5C8CA 1RM1B 4XJ9A 3I54A 1UPGA 5SV5A 4Z2WA 2AHZA 3VBHC 1K5SA 4LK6A 1ZTEA 1JVMA 3SPHA 3N3HA 4TV8A 1UX7A 3VUOA 3O1VA 3D3QA 5HCHA 3GHNA 1UMZA 4LKSA 4BIUA 1Z7S3 5DQ0A 3T2MA 2W91A 4CUAA 5FZ0A 5JXHA 3SH3A 5GLVA 4YY3O 3RG0A 5C3QA 3E83A 5E16A 2IJIA 2L35A 4LF6O 4WFGA 5KHJA 2CDYA 2DCZA 4CDQC 2W1UA 3D82A 2QQKA 2OZJA 2B8MA 1NTMH 3POIA 3E8FA 3ETEA 1EY2A 4ZPIA 3H9VA 5KAFZ 3H1YA 5J09A 2WLIA 1UY0A 3WV6A 1NZIA 1E57A 2ZHNA 4N43A 3DEMA 1VBD2 3CP1A 3AXDA 4J41A 2IXHA 5LOVB 5F2SA 1V9PA 1GLHA 1MQTC 4IEOA 3HBKA 4XFBA 2Z5WA 4GH4A 1OLMA 1S2BA 4GULA 1F51A 2W0XA 4MXVA 5I93A 4XXAA 5IFTA 5CADA 4PI2A 2GP3A 2ODMA 2JWPA 3NNJA 4H13B 2XNDG 2WNOA 3CC4V 2PHTA 2F4LA 3CX5F 4J7ZA 3PJSK 1IBKO 1XNQO 3E6BA 5ACA2 2ATKC 1X9TA 4NIAA 3OTOB 4DV5B 3MV01 1REFA 3KGZA 5BR8B 3UT0A 4YM1A 4X62O 3N9QA 3JBG2 4GLXA 2FD8A 3L71H 1AYM3 4AW7A 5EBLC 4YJ3A 5DDJ2 4YPJA 1ZUQA 1BS3A 2JDAA 2V73A 5FUIA 1GOHA 3AG1C 3BPSA 3ITQA 4UXAA 5EYXA 3RVZA 4IIJB 3I5DA 4H37A 4O9EA 1K92A 1R3JC 1YQCA 2QCSB 2GC1A 3ZS8C 3DYPA 1DLLA 3JYCA 4CEWA 3OUFA 2BBVA 4INDA 5LW9A 2PGGA 1VQ5V 5FP7A 4DPNA 2LS6A 3TEZA 3K5NA 2CGOA 4RUEA 1SLCA 1PZ9A 2YV8A 2ZR3A 1O9HA 2XHNA 3LQCA 2VW0A 2HWC2 5A1AA 1C5IA 4PT6A 4QNHB 1Y9MA 3L75H 1GWKA 3POWA 1MQTB 1KB9F 1NY71 4IGQA 4XJWA 3O0VA 2G4IA 2ERFA 2YGLA 2PYTA 2ZD9A 3NNMA 2P37A 1B06A 4OPHA 1H8VA 4LF7O 1UYPA 4QPGC 2NLRA 4BIZA 4YY3B 3POEA 2ZHKA 3THPA 1LTEA 4LF6B 1WB8A 2QQJA 3OAAG 3J81N 2JGDA 4EN9B 5HCAA 1VAKA 4BDVB 1Z5VA 2UUBO 4NTWA 3RZKA 1DK1A 4CE8A 3P5BA 3PVOA 4FPCA 3AG1B 1W0NA 1XUQA 4MTFA 1DQ4A 1W6OB 5GLZA 4Z1MG 1WD3A 3PIGA 3KLSA 1F4MA 4N53C 3BPZA 3AZYA 3PUIA 4CUBA 1C28A 4FFGA 1RHI2 2LW7A 1QDOA 3C7EA 4GIQA 4CZSA 1RFYA 3CCSV 2A1XA 3VD4A 2R49A 4DUXA 3BA9A 2JG9B 3F5WC 1RP3B 2X05A 1CAUA 4Q0PA 1V9U2 1KU9A 4E8CA 1Y67A 3PJQA 5LCWL 3USSA 4QX2A 1SLLA 1SF9A 4JV5O 1LOCA 4X6RB 3QG5A 1VEWA 4UYBA 1TMF1 2P4KA 3WG4A 3AK2A 4WVMB 3A21A 4X1YB 2HWD1 1CZVA 1XNQB 2B42B 1DZQA 1DDLA 5FPZA 4I0XB 4X62B 1ND2B 2K0GA 1XILA 1AVMA 1W2AX 4Z07A 2OQ6A 1W2UA 3ABTA 1O91A 4KFMA 2ET1A 3ZM8A 1OQEA 3POSA 1QLEB 2W52A 2ZAHA 3I2IA 1UFIA 2GMEA 1P84F 2B7YA 4LULA 5ERLA 3FN9A 2N04A 4N7IA 2GNBA 3K08A 4BIFA 5H9PA 1K5MB 4JF3A 1W0KG 4I0AA 3H50A 4PLMA 5L73A 3NL1A 5KWRA 3BOPA 2GHYA 4XTPA 4L8QA 1ZRRA 3MICA 1RSOA 1YFUA 5A9GA 5LP6B 4PIXA 3L9JT 5H9RA 4YJ2B 1Z7S1 2DYRB 3RW0A 3MBWA 4OI0A 3CKHA 5FK8A 1OCRC 2BYVE 2UYBA 3Q8CA 4JGZB 2WQ8A 4JKMA 4META 5C70A 1B3QA 3BAAA 1UU4A 2QM7A 3L9DA 3ECQA 5C9AA 1G6UA 1OLME 1AYN3 3O1MA 2LUWA 3PIJA 2D6OX 2A5ZA 5F7UA 5FO9B 4IYIA 4QU2A 4W65A 2ZPXA 3ELNA 1BK0A 5BNOC 2D3OW 3TN93 1ULEA 1J5EB 4Z2AA 2PHRA 1DYPA 3S57A 1VMJA 2EAAA 5D8AC 1K34A 1KMIZ 1SRYA 1SEFA 3OW2U 2ZIMA 4DEQA 2AENA 3SCFA 2XT9A 4XF9A 4PDWC 5EBWC 4N90A 4DR2B 5C5TA 3ZO0B 2H6BA 4YIOA 4Q4V2 1G7YA 1HN0A 1QGLA 3LWCA 5HXMA 2LP7A 1SLAA 1SPPB 4CC6A 2WLLB 4BW5A 4HNAA 5CFDC 4P9JA 3AP4A 3DGEA 5JPMB 3RDIA 1FXKB 1CESA 2HYKA 3NV3A 2BSKA 1AYM1 4X66B 3OYWA 3AX4A 4QPKA 3ZSLA 3UK9A 3O7OA 3E86A 2QQPA 1NYWA 1IVSA 5K8SA 2YIAA 1VQ7V 2DU1A 4PA4A 5FP4A 3E1F1 1H8TC 3MFAA 1POV0 2BOBC 4LF9O 1OCRB 1UWWA 2ZBJA 4Q4Y1 4WBBA 1URXA 3EXAA 3W59A 3MDSA 2R0FA 5KC5A 5A3MA 3HKBB 1LOFA 3CO2A 4BYYA 1GZ9A 1BSMA 3U78A 3WUDA 2JKXA 3LUTB 3JZVA 3I3MA 1QHDA 1LEMA 3ZDVA 1NJIW 1K33A 1YQ5A 3C7FA 5BNOB 5GONB 5FZIA 2FL4A 1H8HG 3TOJA 1PGW1 3ZIXA 1DLCA 3NQHA 3MW4A 5D8AB 3T1LA 1UW8A 2FDJA 3N9PA 2QWNB 1FOD2 4IV1C 1IS6A 4AEMA 4P5YA 1JJ2U 3RMXA 4AHXA 4RGKA 1S0CA 2JRIA 3OGGA 3ZMZA 4DW1A 2HVKC 4JI8B 5E79Z 3RZZA 1XSRA 5CFDB 2RHPA 2WQZC 5AC91 2IM9A 4GMP3 5D1IA 1YVWA 1R1BA 5FY5A 3WCSA 5JDBA 4AQSA 1N1YA 3OGVA 4QXHA 4RWUA 1HQLA 3VQXA 3IAPA 2Q8VA 2XPJA 1AVBA 3L2HA 4XDQA 5C8CC 1NKGA 3RFRA 4EFEA 4HVOA 3I4IA 1H8TB 3D4KA 1Q6UA 3IDBB 4MUVA 4NROA 5FPUA 3LGRA 1QJU1 4GAZA 3K75B 4ZOLB 5IAXA 2WINB 4MOAA 3OGJA 3O12A 3W5MA 1H9WA 2C9AA 4FOYA 1LOEA 3D0JA 5IWFA 4MGTA 3Q4HA 2HG5C 2E31A 1LNSA 4ZKIA 4FFKA 4ZS3A 4WM8B 4UBHA 1P4RA 4YW7A 1YFWA 2WNUA 5H6RA 2D6PA 2C6SA 4ZZ8A 4B4QA 4M4PA 3ES1A 2A6XA 4MSVA 4AVTA 5CBHA 4N43C 4RR3A 3ME2A 2WT0A 1JS9A 1A8DA 3ZXGA 1W8FA 4UWDA 4D69A 4QIWF 1ALYA 3HT1A 1E1RG 1MS3A 4W4KA 1V6NA 3UYJA 2A6YA 3VHNA 4LF9B 4GH4C 2OUJA 1JFFA 4YFZA 2ZEXA 3ZYJB 2PHWA 4OXSA 1UNBA 4ZY9A 4OI4A 1X7NA 3UGGA 4FFBB 5FZDA 3NAPA 5FLHA 3G7DA 5JZGB 3H7YA 1DQ2A 5C8CB 2DUOA 4UUJC 4R4ZA 2PI4A 5AVPA 3PUHA 4LXLA 3TEWA 5L7OC 2VMDA 2XQRA 2JK5C 1N32B 1D4M1 3H1JH 3WFVA 1ONAA 3H42B 2UXBB 3I8TA 3JARA 3WP4A 3S5QA 3VHOA 2AACA 1EBOA 2C1FA 2DFCA 2YROA 5A3NA 3IAYA 4SLIA 3TN91 2VNGA 3DXRA 1OMIA 1KGYA 4KQ7A 3BABA 3KKYA 1JQ0A 2YY1A 2DOSA 4CEWC 3URFA 4XUTA 3ZX7A 3SQOA 1Y43B 2FMDA 3ZRVA 5T52A 2ZCWA 2EVXA 5FPRA 4GMP0 2YI8A 2MEV2 4NO4A 3AK1A 3GZAA 4OMDA 2UU9O 4BM8A 4GWIA 4JDNA 3U75A 1ASJ3 1CIYA 1VQLV 4QM8A 1UZYA 5FY8A 5BY5A 5LRSA 1MS9A 4JZ2A 1HRI3 5GALA 2IFWA 1RUG1 1H2NA 4W4ZA 1CP9A 4XBNA 2WLJA 2WZEA 4BH9A 4H2AA 2ES3A 1OF3A 5A3LA 4DXSA 2ZE7A 4AVVA 1SCRA 1KP2A 4HMZA 3IBMA 2TEPA 3W58A 4V2VA 3FZ3A 1E1QG 2VTFA 2PHUA 2PN5A 4Q4X3 5KXCA 2WAAA 4XUPA 3K5LA 3SKJE 1IBLO 3UM7A 5JH7A 2YBPA 1XEQA 4LF5O 3C2UA 3B94A 3FE5A 1TA8A 5LY2A 2XUMA 4XQWA 4GKYA 2M6YA 2E32A 3RGBA 2JDMA 3AG2C 2NR5A 4CDXA 4MTGA 1K42A 4UB8Z 1KJRA 4NTYA 3G67A 3ZEDA 2K9ZA 3CJIB 2JDZA 3KMHA 2ZGTA 2DBIA 3AZVA 3HNYM 2ZZQA 1M5IA 1ZBE3 5C3RA 1DF5A 5GZCA 3NNLA 1GK9A 4MTOA 4CEWB 3LDEA 4FLVA 4LBMA 2Z2SB 1HNWO 5I8YA 2LRPA 4A41A 3RYIB 4CUGA 3VDAA 2EIJB 3ZN6A 2CAUA 1QXPA 4CDUA 4D7TA 1ZX5A 5EHDA 1XU1A 3Q8BA 1FMD2 4J7KA 2P67A 2UU8A 3WT3A 5GLTA 4QDQA 5IY5B 3ACIA 1H6XA 3H8OA 2UYAA 2Y0OA 5CKNA 4DR3B 2FMYA 3RS6A 2FCVA 4O4LA 4J1XA 4W6WA 2IXKA 3OMNB 1HXS3 3QVNA 4AQ2A 4BMEA 1YC61 4LKDA 2DF7A 3TJTA 4QGMA 4LBJA 1FFTB 2ADDA 3S7EA 3DUIA 1XPWA 1RPOA 1OLRA 4XHXA 3J80N 4FTSA 4AI8A 2LTNA 1RUC3 2Y69C 4NRQA 3ZYRA 2A73B 1TNRA 3KS7A 1AX1A 2E33A 4BQXA 3CS5A 3AG2B 3K3NA 2ENRA 2W0FC 3JUUA 1RB8G 3K9SA 4IEYA 4Y1XA 4IE7A 3CCVV 2XGXA 3DC6A 2WR9A 2XJQA 2XBO2 4YM3A 3WG7C 4DV2O 2X7RB 1U96A 5CAZA 5IYDO 4O4JA 3GBGA 3CRCA 5JWPA 1ZZ6A 5A70A 1CAUB 4M3CA 4DRXA 5IJRA 4F6RB 3A4UA 1YJWV 3PU8A 4A4AA 3KQRA 5BNPA 2XMLA 3THTA 4CBCA 1OI6A 3ZXLA 1E79G 1SA0A 1J84A 4URAA 4AI9A 4MGYE 1SQVH 1BYHA 1Q3EA 1MS8A 3MAQA 1SQXH 1FI2A 2GALA 1OF4A 1IBLB 4UFHA 4LF5B 1VBD3 2G19A 3ASNC 1YYNA 3VOUA 4ZHQB 2HKXA 2E9QA 5A33B 1UU6A 2RS32 1AJNA 2Q68A 4L87A 4IEUA 3BTXA 2LALA 4SBVA 1OT5A 4XQ4A 1QVFU 3AB0A 1YO8A 3B4SA 3GCXA 3WP6A 2ARCA 1XQ8A 1FKAO 3WOGA 5I91A 2EIGA 2AGSA 2WS91 5EC1C 3QH7A 5AFEA 1WLCA 3SYAA 2GU9A 3JD4A 4CP9A 3VKFC 4IEQA 3I56V 4BQ3A 5ACA3 1A6CA 1SBFA 2ZEYA 2Y69B 1VAVA 3S5AA 1HNWB 5L3DA 1XC6A 4L9BA 3WDWA 3ZXFA 1W2TA 2W95A 2Y6FA 3JBG3 5FPVA 5GTHZ 3LDRA 3G4SV 1C8M2 5DDJ3 3JALA 5DM6V 4MGZE 2VNRA 5FO7B 4EZHA 1UZVA 2Q73A 2GDSA 3LIGA 4AEKA 3OG2A 3FLRA 5JAXA 4JYBA 5CNAA 4IL7A 3R4DB 1LOFC 3WQ1A 2P90A 1SS3A 5C9AB 3N7LA 3AKPA 2ZHLA 2ZGSA 3HPLC 4XDLA 4RYDA 3KB5A 2Q7HA 4JAUA 5DAVA 4BQ5A 3POJA 3C7OA 1ZVFA 3SNMA 3VZJA 5LASA 3MF6A 2KR2A 2D5HA 4L8JA 4D6RA 4S2HA 1VBE1 2WN2A 2J1RA 1W05A 1HRI1 5FXXA 3ZN5A 3OFNG 4RQPB 1WP8A 1W6PB 1BGYH 2HWC3 4FT8A 3RSJA 4X9QA 4OX9B 3ZIWA 1RTVA 5ANQA 2Y6HA 4LA2A 5DUVA 3LSDA 1PX4A 4IV3A 1A34A 2FB5A 5AG2A 4Q4X1 3LSEA 3SPIA 2AZ5A 3FFQA 5CYYA 3WCRA 5F5CA 3PDQA 4BAYA 2Y4TA 2W94A 5IT6A 2RDSA 5LRRA 5LA6A 3OYWB 5K0UA 4CCEA 1R3KC 5KHGA 2ARBA 2YI9A 2NN8A 4BQ2A 4L97A 2G9GA 3LFMA 1XOYA 2JDNA 4IESA 5CMUA 5C8YA 2ZGQA 3P3PA 2W2IA 1H6YA 1N33O 4X8AA 2V5DA 4UF0A 1W8UA 3IDCB 2UY9A 2E5LO 1WLWA 1MSDA 1BMV2 1ZBE1 4D6QA 2IJHA 5F6KA 3N7KA 1JX9A 3CJHA 4UW6A 5JXGA 3VKLA 5FZ7A 1UU5A 3FJSA 4JI3O 1RHI3 3NRUA 4ZU5A 2VOKA 2VZVA 3LPFA 4CCDA 2XHBA 4Q0QA 2DWDC 4P00B 1Y66A 5DG2A 1V9U3 1CQ9A 5I0TA 3JCZA 1S0EA 4LIVA 3ZFEB 5B4XA 2VMGA 5LATA 3P6BA 3HR9A 5FZ1A 3JQXA 2QKAA 2WNUC 3FLPA 2YC0A 1LECA 3AVRA 5FY4A 4I09A 1V0AA 2XONA 1CJDA 3VV1A 2VXRA 4RR3C 4PJ0Z 5JCTA 3DYOA 4JTNA 4E2QA 1QVGU 1KITA 5SV8A 1OQ1A 3NNGA 1AI4A 5A3PA 4P02B 4ISQA 1QHTA 2X6BA 3VQWA 2XOMA 2B1IA 1MOFA 4ZS2A 3OMIB 1WGPA 3ZRSA 1YEWA 1WMEA 2YUEA 1V6IA 1SKVA 5B3SC 3WG1A 3IPVA 1OBNA 4PQ9A 3NAPC 3RI8A 5C5UA 2EA7A 3SR2C 2A6WA 4XUNA 1GFF2 2JKBA 1UPSA 4QXKA 1US6A 2PYJA 4YARA 3NV2A 2VC9A 4DMIA 1V54B 3AMPA 4YZ2A 3CRMA 1NCQA 4GWNA 3WU2Z 1W6MA 2VH9A 3A22A 4MVTA 1VQ6V 4DEVA 1ZBA2 2VOWA 2IJKA 3JAKA 1FATA 3MZHA 3S30A 3JD1A 4CXXA 2PI5A 5DAWA 1S2KA 3BOWA 5JOYA 4UVBA 5JR7B 5KLVH 4CA9A 4AOCA 5FLJA 1BXHA 1RIRA 5H9SA 4QD2A 2OCCC 1CAVA 2E6VA 5EIYB 5FZ9A 1F15A 2DCTA 3Q4HB 1RUOA 4E4DX 3SJAC 1XHZA 2R72A 1W8NA 4JHTA 4COYA 3FBYA 1GBGA 1VBD1 1VQ9V 2TNFA 5IK4A 1UIKA 1JZ5A 4Y5TA 1YIFA 1PZ8A 1Q86W 1JR9A 1REEA 3ZMVA 4WF9V 1BVVA 5FREA 4UCRA 1A32A 1T5EA 4XFAA 2ADQB 4BK5A 4O4HA 1F5JA 5FWEA 4Q4V3 3BYWA 1N33B 3ABLC 1RUNA 1AX2A 4AAPA 3O1OA 4WFAV 1IKQA 4LHLA 2EILC 3UGHA 1WA4A 3LEKA 5L9BA 4JI3B 4XQDA 1KDKA 3JBG1 2RS12 4JKKA 4LOSA 1P49A 2NM1A 2RJ2A 2HWB2 5CA1A 4TV9B 2GAUA 1NLQA 4FPEA 3MEPA 1ULOA 3WQ0A 2QNKA 3OR6C 4CDXC 1QXRA 3WNPA 2DVAA 1OHFA 4LFAO 1CX4A 2BZDA 1F23A 1GYKA 1GU3A 4HOOA 4UW5A 4DV4O 3JARB 3B8NA 4HPKB 4LCUC 3ZJZA 2NMNA 2Y60A 1ULGA 1O5LA 4KHPO 5FWJA 2BWCA 4IEPA 3DXRB 5FIXA 1STMA 2UY8A 4EROA 1A78A 2W9XA 1UZ0A 4V2WA 2NP0A 3GDBA 1EAH2 1KJLA 4PJYA 1OKOA 1WP7A 3BALA 4JZRA 1IOAA 1C4RA 4BISA 3SDLA 1ZZBA 1DFQA 2VUJA 1JU3A 2HWC1 4P08A 1OA2A 4CDUC 1FOD3 5A1FA 1I0HA 4QGPA 2JDIG 1XYPA 2PHLA 1XQNA 3IB3A 5BMVA 2X0LA 5FLIA 4DR7O 1MA1A 4GKJB 4BE3A 3BGAA 1N34B 1JOBA 3D5OA 5HCFA 4PCRA 4OMCA 1LGNA 2KKWA 2VCAA 4K8RB 1DTOA 4K9SA 2P34A 2DVBA 3SPGA 3I2DA 1SC5B 1KP3A 3N36A 3SKVA 1GN2A 4E27A 1W2OA 1R6TA 3O9OA 1RC6A 3J26N 3ZBHA 1OD5A 2GN7A 2IWGB 2P22C 4XAAA 2CTPA 4CDXB 1JMUB 1G4YB 3NJZA 4U3JA 3ZHRA 1RHI1 1D2QA 2XUEA 2EAKA 3CPWU 3GGLA 1Q6IA 3AP7A 4G28B 1ZL8A 4X88A 4YXWG 1VBA2 2V4VA 4M0NA 4U36A 1V9U1 3MO4A 3RWNA 4Q26A 1TMF2 4AHCA 5L3FA 1I5YA 3U0ZA 3ZYGA 5C4WA 4OULA 1PNLA 1GP6A 2A3XA 3TXSA 5HV0A 5IYCO 1LOAA 5BNPC 1AJOA 3ZMOA 3ZN6B 3WQ7A 1RMU2 3VLBB 1AI6A 3VBFA 1AXYA 4CDUB 4I5SA 2FZ2A 3O1RA 2ZX1A 5A6XA 2NN4A 2PFWA 2HEPA 1SFYA 1NTKH 4K7JA 2QM8A 1SDDB 2KQXA 2YG0A 3SYQA 1WW5A 4LTAA 5JOXA 4GWMA 3N4MA 4LFAB 2JDYA 4C7UA 1OUSA 4M4RA 2Y6LA 4DV4B 1OVSA 4CYDA 1JYNA 3BN6A 1NLSA 1SFNA 1Q5OA 2CH7A 1POV1 4KHPB 1NQJA 3AKQA 4I3GA 5KX5B 1GV9A 2IVIB 3UKMA 2G1MA 3HKEB 1SQFA 1I5PA 3H1IH 5H2FZ 2BTVC 1H0BA 3F2ZA 3RZLA 4EE2A 5KMGA 4LOTA 2QA4V 3CCUV 3B8MA 2VM9A 1NTZH 2HJDA 4XFFA 2JDHA 4U7NA 1YDXA 2E7TA 2EXHA 2FDHA 3CSXA 2BNOA 3QLQA 5ABJC 4TZDA 1OFNA 5L9RA 1EN5A 4LNVA 5I8TA 4MS2A 2Q1FA 3U11A 4N23A 3N2GA 1S55A 3HMYA 4B3MO 4YVWB 1MVQA 1SBDA 1RVF1 2Z42A 1YXBA 4O4JB 2JJ2G 1BE3H 4M3CB 4DRXB 1F5FA 3DGTA 4LF8O 3T30A 5FZLA 4KG0A 1PPJH 3VBRB 2X5IB 2XJPA 2UXDO 3JB4C 4UXNA 3CEWA 1GZTA 1VR3A 3RZJA 1SA0B 4YW3A 4KGQA 3VHRA 3NKTA 2WZR1 2MEV3 4MG2A 2MW2B 2JICA 1OJHA 2B5UA 3DKWA 4YZ3A 3FAVB 4LH6A 3WZ1A 1WJZA 1QKQA 4PA7A 2GNMA 3UO3A 1GAXA 1BKZA 2ZGLA 1H9PA 4IV3C 4YG3A 3PVNA 1ENRA 2GUZA 4YW2A 3VBSA 5KR7A 4QDRA 3T1MA 5FZGA 4LBKA 1QIQA 4AWDA 5DN6G 3UV9A 2NYYA 5A6ZA 4CP9B 5B1BC 1WCUA 2CAZC 5K0UC 3ETPA 5LBEA 2WC2A 1MZ5A 4LK7A 4Q4Y2 4JAVA 2VMHA 2P1BA 2GC0A 2GMMA 2GTSA 5E8AA 1YJNV 3ZR5A 1KKDA 2OW4A 4CH4A 3KZ4C 5LA1A 4P9OA 5FZ8A 1WBFA 3J9SA 5J36A 2EIMC 1UY2A 1OC1A 4A7ZA 5J37A 4DR5O 4LO4B 4C8DA 4H33A 1KYOF 1VLNA 1G1XB 4GD4A 4UW4A 1HW5A 3ZKYA 4WVWA 1FOD1 3I3DA 1NU1H 1IXMA 4GZRB 1S0VA 2Z3YA 5FPAA 5T5PA 1MMMA 1FMD3 1PIV2 1V6LA 2AW9A 3WG3A 1D5NA 2ZXWC 3K59A 2E63A 4QB2A 5AC92 3GB7C 4XDPA 3PNAA 4CEYA 1V55C 2Y6KA 1SQQH 1N8RW 2ZE5A 1WCSA 5JSPA 3INAA 4Y4RA 2VCMA 3DV8A 2AYHA 3NMBA 4B3MB 2ZGPA 5LA6B 3OGRA 4P30A 5K0UB 1EPWA 1OOPA 4LF8B 3BODA 2DQ0A 4WFEA 3KHBA 1F4NA 5FXWA 1QJU2 3QO7A 4HVRA 2UXDB 4ZONA 2EIKC 3D0SA 4BWAA 1S5LZ 5A7QA 5GZDA 4UF0B 2KA3A 5T54A 4N21A 4QWNA 1QDCA 3ZXDA 1ZSPA 5K1PA 3KCYA 4A3XA 1NCQC 2YFZA 3VBOA 2OQ7A 2WJSA 4JRAA 2CL2A 4A44A 5A6YA 3LF7A 4TUYB 2XBO3 4NPMA 4LJHA 2YMZA 1JPXA 4XACA 1IBMO 4J10A 2WAOA 4FIPC 4JKLA 3E6CC 3IC9A 4JYCA 2C0ZA 3CE2A 1VQPV 1XOUA 4TYSA 1K4DC 3T08A 2GH8A 2YXYA 5FZ4A 4C0BA 2DJVA 1AL21 4BB3A 1YF2A 4JGSA 3WQBA 3NV1A 1XBLA 3FD9A 2D6NA 1V00A 3BHPA 4HZ3A 3GZTB 5BZBA 1X8MA 1QOSA 3OJBA 3AC0A 1W9SA 4ATFA 2R6QA 1TGOA 3KZIZ 2ZABA 3J7HA 3A0RA 3A0KA 1MPXA 2DVGA 2WNVA 2DWRA 1AR1B 5F6LB 4FPHA 2XH6A 2RS33 3I59A 4FSJA 1JZ2A 3CLPA 4WFBV 1TAEA 3O5SA 3HR0A 3H3ZA 4EN8B 3SPJA 3JCUZ 1AR72 5JMOA 5A7OA 4DR5B 4OCTA 3MGUA 1YFXA 3WX5A 3OM3B 5JLVA 2DVDA 3E2EA 1MSWD 4XF1A 1D4M2 3HKDA 4AEDB 5BXXA 2F43G 3SJQC 2D6LX 1JA8A 1Y76B 2PY5A 1HNZB 3SISA 4UV9A 4K35A 2FQPA 3I97A 2IXJA 5IT9N 5JVDA 2JD9A 3N27A 1NXD1 3TRSB 1C8M3 1UOBA 2YB7A 4PA3A 4DO0A 1NOVA 1RUI1 3HKCA 4B3TO 2D7FA 5K1XA 5IVJA 3K2OA 2KD7A 3M3OA 2DV9A 1ZZ9A 3JAKB 1YTFB 3A2FA 2PHFA 3V0AA 3CCRV 3NVCA 4GZ9A 2P7TC 2CV6A 3B01A 3WNOA 3UT5A 5FQ0B 1TNFA 2YXHA 3VN4A 4LNUA 1EZJA 3RYFA 5CKMA 4CCJA 5CBGA 1CAVB 3HBZA 1WMFA 1SQ4A 1Y6XA 3E8GA 5FNVA 2WPDG 1JW6A 1YTFD 4ZU7A 1ZZ8A 1FFXA 4R8CA 3WG2A 4CC5A 4TSVA 1H8EG 5FY1A 3PU3A 1RUG2 4IW3A 4OPAA 1N1TA 1F2NA 1ND3B 3HN1A 2GBOA 4DRVA 3VL8A 3CCJV 2E3CA 4DFSA 4O4HB 1J59A 2P4VA 2QQWA 2ZKOA 4W50A 1M4UA 2GV9A 1VRH2 2NQYA 1N36O 3OEBA 3CZUA 4NPLA 4XFCA 2BQPA 3ACGA 3CJXA 4P9WA 4LIUA 1SLTA 3MIEA 2Y33A 4KG8A 1QJFA 1YI2V 2C4XA 1JHNA 4NHKA 3B69A 2P3YA 1TUBB 2MPFA 2B5HA 3ZXJA 1H30A 4FAHA 3LNNA 2F23A 3ZRWA 4MYEA 1WZXA 3AK0A 1S77D 2VZUA 4MVRA 4LBOA 3NO8A 1CAWA 5LA2A 2WDBA 3VGIA 1O7FA 1AJPA 2OVUA 2DYSB 5KXDA 2M7WA 3ABUA 3KVBA 1H1MA 4CVUA 2WO7A 4Y1YA 4PD4F 2QDRA 1UMIA 1ENQA 4Q5OA 2VY0A 4TLGA 4CDWA 5C4WC 1EUTA 2P6JA 2OCHA 2QQIA 2OPKA 4U3FH 4CS3A 5LMUB 3VBFC 1KFXL 4JGYB 4MVQA 1J95A 5IJ0A 4LH7A 1UPIA 4QPJA 1SESA 2VTXJ 1H2KA 2VNVA 2H6CA 4QX0A 4A6OA 5CA0B 3MPBA 4FOVA 5KUMA 1QQCA 2DU0A 1HW7A 3K0DA 4WFFA 2W39A 1CGPA 4B3RO 4YNIA 4NRMA 5EBMC 2OTLV 1LENA 3NJVA 3O0XA 2W08A 1S72V 3JCIA 4L2NA 2V4AA 4N53A 4PELA 2VQ0A 1T6GC 4QPIA 4BZ4A 5A1LA 2EICA 2E26A 1WD4A 2W46A 5G04L 4RQFA 4UOJA 1HDKA 1E5SA 1TE1B 4HBNA 2R041 1NQDA 2Q8EA 1QQP1 2RCVA 4K21A 5FYUA 4U3JB 4Y20A 4C1WA 4ABMA 5CB4A 1SACA 1FV2A 4A45A 1S0FA 1ZBA3 3D6EA 1V6MA 2BW8A 2PQSA 1APNA 4GXLA 2RE9A 1YLLA 4BIOA 3B93A 5IFPA 1VJ2A 4I7ZB 2JVDA 1KRIA 2DDUA 3N9MA 1H2SB 3HJRA 2JG8A 1XREA 1N36B 4HN0A 3U4SA 3VDDA 5C4WB 2VZSA 2A7AA 2ZHMA 1W59A 3GVMA 3U10A 1TG7A 3BIWE 4L92A 2D6KA 1IPJA 1VP7A 4UCTA 4XMIA 1LRHA 2BGCA 2P4EA 4XPVA 1P7GA 5FPOA 4P9GA 4PDLA 4BQWA 3T2PA 2RS31 3U1XA 2VOXA 4JQTA 3WHUA 1OVPA 3AP5A 5EWSA 5FXZA 4UFZA 2WS92 1W6QA 1EP0A 3CRRA 1NT0A 2J7MA 2PLV2 3M3CA 4JYAO 2W1WA 4GKKO 1RUJ2 2WO3A 3HB3B 3ZXEA 4ES8A 5CB7A 4AQ6A 2DN9A 5CBLA 3OD4A 3VBSC 4LT5A 4TQFA 1HV1A 2WZPP 4UFIA 3FHQA 2OYZA 1UXZA 2RS13 2VBBA 3I2OA 4JI4O 1C8M1 3K58A 1E5HA 2IBZH 1F31A 5TSWA 2X6AA 2W87A 2HWB3 3GBWA 5EIBD 1QU0A 2QDNA 2YPDA 4NYKA 5L3BA 2HLEA 3W7XA 4I9WA 3GM8A 5EYYA 4XFHA 1UAIA 1JZ8A 2H94A 3PN1A 3MV11 4AEJA 1PO22 4Y1ZA 5LYJB 1O4YA 1C1FA 1GICA 4GJYA 3N2GB 2BTQB 4K0KO 1M1KW 5JQGB 4IQPA 2Q8CA 1WB7A 4O9GA 1UQXA 1AJKA 2VRZA 3OF1A 2JB4A 3GCWA 3ZIAG 4LPLA 4X89A 1VBE2 1EAH3 3M3QA 4B3RB 4YVSA 4FQ4A 3O1UA 3R66A 1RUE2 1FX5A 3ICXA 4COZA 1SLBA 2BV4A 2JE9A 2DUQA 5L3GA 2FTKA 1O3SA 1SMVA 3VKNA 3WF4A 4PA6A 4LHSA 4NXNO 2UWAA 3ATGA 2Q5TA 3P3NA 4R6ZA 4CEYC 2B4KA 1XNAA 2A9HA 5FJKA 2XAFA 4W6YA 4PA9A 3W7WA 3PL0A 4G3YC 1B35A 1KKCA 3VBSB 4B1MA 4EWEA 3MHHC 1K97A 1YRZA 2EIEA 4K8FA 2VQEB 5E1RA 5ITZA 4AHZA 3S6PA 3AMMA 1OOPC 1COV2 3W7SA 5FRAA 4BWOA 4N9HA 3PUQA 2X53S 4KMQA 1BMV1 4DUYO 5DN2A 3ZPYA 3AYDA 2XKPA 4MVUA 3SGIA 2RJKA 3VL9A 4LBQA 4RA0A 3GNEA 1OH3A 5B66Z 4NHXA 1QH6A 4HK9A 3QCWA 1LHOA 2BEOA 5CKQA 1ZRCA 2W68A 1W8ZA 3VBOC 4I55A 3ASOC 1CR7A 2OIIA 2JENA 1VBA3 3HWJA 4NAOA 4X1IA 2HBUA 4LA3A 3JAWA 2BOIA 1TMF3 4JYAB 1K9MW 4GKKB 1I3HA 2A71A 4FLXA 2R16A 1SDWA 4B1LA 4AHYA 2WSSG 3AMQA 3U4XA 1W0JG 1X9PA 3R4SA 1W2BU 1AXZA 3T0AA 5FOBB 1GNYA 3T3YA 5J96B 5FTTC 4F7ZA 3LSQA 2Y34A 2D3RA 2PAEA 4V1PA 1RMU3 2WSUA 4AGGA 2A0LA 3A0NA 2BP6A 1LHVA 2ZAAA 4JI4B 2RDCA 5IVFA 3WY6A 1HIXA 1KD7A 4ET7A 2ZKNA 2YIDA 4XHBA 1UOFA 4FTEA 4W6XA 1XB9A 2WNVC 1FS0G 1ZLZA 4DO2A 4MZUA 4YGCA 4K3UA 4XVHA 2V5YA 4IEWA 3N2KB 1AHSA 1C5HA 3MD0A 2HWE2 1OUXA 4DW0A 5GTIZ 3IM0A 1AR91 4R9DA 4K0KB 3DSQA 4I4TB 3TETA 1RUF2 3TK1A 5GLWA 3ETDA 2CDOA 4AQTA 1OOPB 2JDPA 2CTVA 4CCKA 3R05A 2I45A 4NN0A 1NT2B 2BOJA 2FKXA 1KD1W 1ZBA1 5H9CA 3BY6A 2YU2A 2P5OA 2ZXQA 4A42A 5JOZA 2R072 3ASOB 2P06A 3STLC 1PMJX 1BCCH 4NXNB 2HHHB 2ZX0A 5FYMA 1M06G 4FI9A 5EYPA 2Q8OA 2UWCA 2AEZA 1ACCA 4UFKA 4E4EA 1PD3A 4O4IA 4G9SB 1Y3TA 2GDFA 4LO8A 2QBXA 3ABMB 4RL7A 4DV6O 3UGFA 4HN1A 4NMIA 2P6HA 1ULPA 4Y22A 1BHAA 2BOCC 2CSGA 5I0SA 4WM7A 5EC2C 4H7LA 1LAJA 4HETA 4QPWA 3ABKC 2BDRA 4DUYB 3FB7C 4YM2A 3MLKA
chains in the Genus database with same CATH topology
3MPPG 1FMD1 4KNCA 3ZIWA 1RTVA 3H7JA 4S2FA 2ZMNA 3FC0A 4LA2A 2HEVF 5DUVA 3ZFFA 3LSDA 4EWAA 2ZS6B 3I59B 4A7KA 1I6XA 4IV3A 2VQAA 1U5IA 3FUOA 4M01A 4Q4X1 5IK5A 3LSEA 4KWLA 1CJPA 3VBHB 1OIJC 2RS11 4QPGA 3ZYIB 3BU7A 4Q27A 5L7OA 2NZ9A 5LEJA 4BMBA 4R9BA 2AZ5A 3FFQA 2BVBA 1YCIA 5KBFA 1GVGA 3WCRA 5E89A 4FPKA 4C8RA 1FNZA 2HWB1 5IT6A 1DS1A 2R061 4DY3A 1X8EA 5LRRA 1GQHA 3SMHA 3OYWB 4Q29A 5K0UA 3EBRA 4DQAA 4OHXA 5KHGA 2ARBA 3IMNA 4HSJA 2NN8A 3OY8B 4L97A 1BEV1 1PO13 2G9GA 3EHKA 3TAYA 3ZDSA 4Q4Y3 1RUI3 3PMEA 2Q0AA 4IESA 4OUMA 5DXDA 3IKWA 1UX6A 2ZGQA 4CDQB 4ZKTB 3P3PA 3KM5A 2KM2A 1UZZA 3LAGA 1VB2A 4X8NA 1OIKA 1KFUL 3IDCB 4FXGB 2UY9A 4NHMA 1NCRC 3AJZA 1DHKB 1XRUA 1WLWA 1YUDA 1BMV2 1ZBE1 2RR11 1JN2P 1BJQA 4RS5A 1R091 5F6KA 3N7KA 4YFWA 5BNPB 3OPZA 4EN7B 1WLTA 2P3IA 4FFAA 4UW6A 1PGL1 3VKLA 1UU5A 3FJSA 1QJY1 1RHI3 1EAH1 2UWBA 3IIAA 4JAAA 4ZU5A 2VOKA 3TNQA 2BFUS 1XNDA 3V0BB 1VIWB 4JC1A 4Q0QA 2VECA 4RHV1 3TBDA 5DG2A 1RUH3 1V9U3 4Q2FA 1LHNA 1H4HA 1CQ9A 2RM21 5I0TA 3UKNA 3WP3A 4DB5A 1S0EA 4CDWC 4CWDA 3ZFEB 4Q0SA 1UCXA 3USUA 2VMGA 4I02A 4KGGA 4P9LA 2XBO1 2E51A 3J4UH 2XJTA 3HR9A 2VMIA 4Y26A 1VZ5A 4HPKA 1AYN1 2DYCA 2VG9A 3JQXA 2GNTA 2WNUC 1RUJ3 2YC0A 1LECA 3CJIC 3FLPA 3KT7A 5DZEA 5CFCA 4BHFA 2XL9A 1DQ0A 4I09A 4WV8A 1CJDA 1FYUA 2D44A 4J1WA 1TME1 1L3JA 1D2SA 1PIV3 3VV1A 2VXRA 4RR3C 1SCSA 3PLQA 4DS0A 3GF6A 4XYXA 1VBC1 3G6JB 3H1WA 3VZNA 1S0GA 2F6BA 4A2UA 3UL2A 5JCTA 4E9KA 4Q4W1 4JTNA 1LODA 3AZXA 1FNYA 4S2GA 4Y24A 3FFZA 4E2QA 5AC93 2GMPA 2WA3A 1OFSA 1ZZCA 1CD3G 1KITA 3IWZA 5BYNA 2ZMLA 1AF9A 4OUSA 5SV8A 1OQ1A 3JD73 5HSXA 5JSOA 4BHPA 4ISQA 5EJ3A 1EYBA 4OLLA 2VU9A 4I01A 1OIJB 2RS53 2A6VA 1U0AA 2FZ1A 2B45X 1WGPA 3RJRA 4C90A 1WMEA 1IGOA 1S0JA 5ABJB 2RMU3 4D7YA 2YUEA 5LK7B 1V6IA 3R6SA 5FBZA 4YLZA 2GC2A 5KC6A 3WG1A 3IPVA 4PF5A 4PQ9A 3NAPC 4Z82A 3LA2A 4XILA 1PO23 4AF9A 3RI8A 1ZA4A 1CVNA 2EA7A 3ES4A 4HKOA 1HQWA 2A6WA 3MFCA 4QPIC 4NOTA 1GFF2 2JKBA 1UPSA 4QXKA 3AMHA 4ZU4A 4BOWA 4YARA 4PIYA 4BA6A 3PHMA 3NV2A 1QJU3 2KXLA 4HZFA 4DMIA 1EV13 3ZXKA 2JD4A 1NCRB 4K1ZA 1FPN1 3AMPA 3VHPA 5JI9A 1NA1C 2N7GA 5K9YA 1XNCA 2Y38A 4FPOB 4YZ2A 1PK6A 1VBA1 1R083 1NCQA 3TWIA 4GWNA 1W6MA 1IS3A 4XOGA 2VH9A 4MVTA 1ZBA2 2VOWA 1CAWB 1AR63 1FATA 3MZHA 1CAXB 3S30A 4KL1A 1OIIA 3GZUC 1S2KA 3BOWA 5JOYA 2ARXA 4Y22B 5JR7B 3NSTA 2BNMA 2VOVA 4GB33 2BNNA 4K6BA 1KS5A 5FLJA 2WLPA 1BXHA 2PAM