2YC0A

Factor inhibiting hif-1 alpha in complex with r-2-hydroxyglutarate
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
349
structure length
349
Chain Sequence
MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The oncometabolite 2-hydroxyglutarate inhibits histone lysine demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
total genus 104
structure length 349
sequence length 349
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2011-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2yc0A02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2yc0A01
4JAAA 5JWPA 2Y0IA 2CGNA 1MZFA 2YDEA 4NR1A 1IZ3A 4B7KA 2XUMA 4QU2A 2WA3A 4Z2WA 1H2NA 1H2LA 2YC0A 3KCYA 2W0XA 3D8CA 1H2KA 3P3NA 2WA4A 3P3PA 2ILMA 4B7EA 4Z1VA 3KCXA 1MZEA 4AI8A 4BIOA 1H2MA 2CGOA 3OD4A 1YCIA
chains in the Genus database with same CATH superfamily
5FMBA 1HRV2 1N8RW 1G9CA 1C5HA 4DV4B 2P22C 2QQPA 1UY1A 5CKQA 4AGRA 1F23A 3CJIA 4GH4A 3TN93 1FD9A 3AG7A 4AFDA 2WLIA 1J3RA 4TUYB 1OCZB 1BEV1 2XTAA 2L9LA 3DKQA 1SEFA 1Q56A 5CG8A 4GIQA 4AQYO 2OYZA 2A3WA 3P3NA 2XHNA 3PUHA 1WLWA 4IV1C 1VF5B 3BKZA 3CPWU 1QCEA 3HMYA 2WSSG 4K35A 2VUDA 3PMSA 5A1LA 5AC91 3QVNA 3EYPA 3LA3A 2QNKA 4QX5A 4LBJA 4XF3A 1GLHA 5IE9A 1ND3C 1GZWA 1OH3A 3CD6V 1SLTA 3OCPA 3VBOB 5ITZB 1UKRA 2OUHA 1FV2A 4XUOA 2CDOA 2UWCA 2P6CA 5LXTA 3OY8B 2MEV1 5FYHA 3QG5A 4PHZA 3QCWA 4JCKA 5DAQA 5DN6G 3M8AA 1XHZA 4K20A 4HSLA 2QQUA 3S3XA 1IS6A 4TSVA 5IUQA 3RYKA 1PKXA 3G67A 4JI4O 1GNYA 1SPPB 2QTSA 3R4UA 1PD3A 1UMIA 2WLLB 4R8HA 1CEZA 2VW2A 5GLTA 2ZDIA 1AR5A 3QTCA 4PDVA 1CX4A 1UZVA 1CWPA 5D8AB 1SBFA 3AG2B 4FMTA 3OM3B 2EICA 5FFOC 1SCRA 3WHUA 4F4LA 1RJ8A 3BN6A 3L9DA 1RUD1 1S2KA 2PLV1 2YPDA 1C5IA 1JZ2A 3MICA 1P7GA 4I01A 4TOIA 5J2TA 4IEUA 1GTOA 1UYZA 4CDWB 3HKBA 2NLJC 4FFBA 2D6MA 2VZRA 5CA3A 4FZ1A 1IXBA 2WZ8A 3S30A 4OZOA 1Y66A 2HWC2 2XJSA 1UOBA 3UCSC 1RUG1 3ES4A 1PGSA 4HPKA 1NCQA 2D93A 2CNAA 4XDLA 4JI0O 2XAFA 2XOKG 1A32A 3RZKA 1VQPV 4UFIA 4IERA 2QM4A 4QGMA 2BOJA 5D21A 1HXS3 2V1DA 1IPKA 3JSLA 2RR12 4AQSA 3B2EE 5L73A 1W59A 2A9HA 1CR7A 1KS5A 5A9GA 2EAAA 5CG9A 1YXWA 3GBFA 4M3CB 4KWLA 3AG1C 2QWRB 1GICA 4LKFA 4F6RA 2F23A 4AW7A 3AKTA 3KCYA 4LE4A 2XVKA 1SQQH 3UJQA 5T54A 2OPWA 4CCJA 1VIWB 2Y33A 3LSEA 3AP5A 2JIJA 4Y5SA 2B7YA 1AR1B 3HWJA 2RMKB 5FY8A 5AC92 5C9AB 4MVOA 1OHHG 2IU0A 2R7EB 4JPRA 2B9UA 5G05L 1BEV2 4M0HA 4OHWA 3AXDA 3EHKA 3WVJA 1D2DA 2YPJA 4GD4A 3NNLA 2P3JA 3NJYA 3NJZA 1U0AA 3SYAA 2X5IB 3ZFGC 3M3CA 1BCXA 4GB32 3BCCH 5BNNA 2XASA 3A0KA 4R52A 3SYQA 3QOPA 1GN2A 1ZZ8A 3PNAA 1VBE2 4CUGA 3BABA 4Q6GA 4I50A 4LULA 3NAPB 5KXEA 4FLUA 3N9OA 3SQOA 3N2KA 4QPGC 1HJGA 1W6QB 4PBOA 3AEIA 4QXKA 4XDOA 2QQLA 4PIZA 5JQGB 1WWYA 1W8OA 3I2IA 4L9BA 4QQLA 3F5WC 4D7SA 4I4TB 1GKBA 1YQ8A 1RUE3 4QHZA 3PVNA 5CNAA 1GP6A 4ES8A 3U07A 3ACLA 4KHPO 4JI1O 1X8EA 2BW8A 2CWMA 4DR4O 4JTOA 1TZOA 3W20A 1SMVA 1AVBA 3T0AA 2DVDA 4M4RA 3I59B 4AI8A 3WFVA 3VBUB 2QKCA 1W05A 3LGRA 4AI2A 5F3IA 4YM0A 2VMIA 3N3HA 3I8TA 2YIBA 4R50A 4J7KA 1ZX5A 4HANA 4XXPA 4U7NA 1RXFA 1RINA 5C8YA 2CGPA 3BA8A 4Y20A 5D1IA 1RUC1 3MGUA 4P00B 3AG3B 5FZBA 2PQQA 1PK6A 5FRAA 3D36C 4X64B 5I8SA 2ZS6B 4XILA 3VV1A 4FTSA 2P7TC 4ZZ5A 2VOTA 1NCQC 3OSDA 3SCHA 1DZRA 3ZX6A 5GLWA 3W7XA 1VBB3 1R092 4IGPA 3OG2A 4FFKA 4Q4Y3 4MZUA 5I0UA 3ZO0B 4N7IA 1W2UA 5CBGA 2K0GA 1QJZA 1ZBE1 1ULPA 4HNAA 4ZHNA 3KWVA 3TEXA 3PIJA 4R9DA 1JYVA 4KGQA 1JH5A 2ZGTA 3GF6A 1N3QA 1DGWX 5CA1A 2BTQB 3HNBM 4LO4B 2UUCB 3HAGA 2ENRA 2ZR3A 5LA9A 3I2DA 4BH9A 2LW7A 4LA3A 1M56C 4CTEA 5FL7G 3KKYA 1LECA 2D40A 2JK5C 4RUFA 1WBFA 4IESA 4RS5C 4I0XB 1I6XA 1IKQA 1LOEA 4IHJB 3NVCA 4ZU7A 4ZS2A 3OW2U 4LFBB 5A2QN 4XJ8A 5FPBA 2RS11 4QPIB 4JQRA 2AC1A 2E26A 4IQPA 2FDHA 3RZGA 5H9CA 4JGYC 2V72A 3VZLA 2HVKC 2VQEB 4C8DA 2YSUB 3WG2A 1UO9A 4DV6B 2P37A 3IMMA 1AI6A 4P9GA 5IYDO 3WR0A 4NB5A 3NNMA 4FM2A 2ZGOA 3B7MA 2GUZB 5F2VO 4D7TA 4OMDA 3ZN5A 1W06A 3NMBA 4AEDA 1OVSA 1WD3A 1PIV3 1LESA 1J84A 3CWBH 5JAXA 1OZ0A 5BNOB 4XJ9A 3RYHB 5FXVA 4ZONA 2AR6A 3MV11 3DGEA 1X50A 2ARHA 2AW9A 1XDCA 5FR3A 5BMVA 1Q43A 4N7UA 3LPGA 4ABMA 3HKCB 2ZGMA 2NP0A 5CMUA 4AVVA 1A8MA 2Y8KA 5L3GA 4D6RA 4IEVA 4URAA 2EBOA 3IAQA 2ITDC 4QJFB 5IVEA 3ZMVA 1YIFA 2VQ0A 4ATEA 5F2WA 4B3SB 1XRUA 4AOCA 2F1MA 5T52A 1QR9A 4A44A 3OEEG 1VBC2 4YSFA 5A33B 3T4DA 5FZCA 3KV6A 2BWAA 5D8AC 3OGCC 2RHPA 5A7WB 2WNOA 4IEPA 1TMF3 2LTNA 3U75A 1SQBH 4FPHA 1C8M1 1F4NA 1Y43B 1DYOA 4RN5A 2WNUB 5F6KA 4I0XA 1NCRC 3ZMZA 1D5AA 3OT7A 2OT7A 4HKWA 2R32A 2WUHA 3SPJA 4X1IB 3CCMV 1IS4A 3D5OA 3MZHA 2ZHKA 1RUE2 4PD4F 3I3QA 4P9LA 1BSMA 4L11A 3HKEB 2R041 1JOPA 3VDDB 5CIRA 4MGQA 4OI0A 4HK8A 4HLTA 5FYVA 4LOSA 4TV9B 1CPMA 2P17A 2VH9A 2EXJA 1F4MA 1R6NA 4GYCB 4BQWA 3IPVA 3CJHB 1OCOB 1DQ0A 2PLV3 4L8JA 1ONAA 3JAMN 2PQSA 4P30A 4YFWA 5DMYA 2VVDA 2ADQB 4O4HB 5ACA2 3RZMA 5FWJA 3GB7C 4IEQA 1RUH3 2Q68A 2A06H 4BQXA 1V9PA 2JDZA 4Q4Y1 4GALA 5BMVB 3ZEDA 4TZDA 1W6PA 2YG0A 4LKDA 2PHRA 3EB7A 4LP8A 3APBA 2CL2A 3RYFA 5FPLA 3LUTB 1OPMA 1AJPA 4IL6Z 2WLIB 1RUI1 4CDXB 3AKPA 1ND2A 2UXNA 3WY6A 1HWYA 3PDQA 1RHI3 4EN8B 3VUOA 1W9WA 2G1MA 3CRMA 1KDKA 5F5IA 3VBBA 3OB8A 1K97A 5FYTA 4TLGA 3ABKC 4BIUA 3ES1A 4A42A 3JALB 2RDQA 2XJRA 2PI4A 3O0WA 2RR11 2YBPA 3TN92 3ZXFA 5JPMB 3D0JA 3W7UA 1N1YA 4TUYA 4PDWC 3WW3A 4D0QA 4AI1A 3AMMA 4JI2O 1LR5A 1JMKC 1BZKA 3ZFEA 1Q8IA 2FDKA 4LF7O 3AP9A 3RS6A 5FZLA 1M57C 1VQLV 5K9YA 1EY2A 3NRUA 3WXPA 1RPOA 4WM8B 2R042 1UCXA 1BCCH 3PVBB 2EULA 2GC1A 3IIAA 3UQ8A 1ULCA 2A71A 4OHVA 2XAGA 4JKLA 2VCAA 5B1BB 4QU1A 3CQOA 3I56V 3AMPA 3ZLIA 1TNRA 1T6BX 2CH7A 4MTOA 1JA8A 4L87A 1Z0HA 4AI9A 2QDNA 5LYJA 4GT1A 4DUZB 3TNPB 3FN9A 2ZEWA 1ZZBA 3N7MA 1RB8G 2XKPA 1E1RG 4NIAA 4FPKA 2DWRA 1KQRA 1UXXX 4OVEA 1YDXA 1N1TA 1AYM2 2XDVA 2EIKC 1OCRC 1EV13 1ENSA 3GDBA 3BALA 4XXAA 4DINB 3ZYHA 1EZVH 1GO3F 3MW3A 3JASA 1U97A 5FY9A 2HLEA 2QWOB 4XIOA 2DFCA 3N27A 4K3AA 1E5RA 4XE9A 5B1AB 2IXKA 4K0KB 3ETEA 3HQXA 1IQAA 4Q27A 1YF2A 5BR8B 2ZX0A 3HT1A 2J1EA 5IJ9A 2NLRA 1ZRFA 2VC9A 1MZFA 3E6CC 3SNMA 1LGBA 3GWKC 2YB7A 4AK3A 1PX3A 2YI8A 3TJTA 1ZSPA 3R0RA 3SPCA 3SJQC 4ARXA 4BW9A 2Z42A 1DP0A 1SLBA 3C90A 2DWDC 4AQ2A 3WNOA 2EA7A 4O2BB 2VOWA 4ISRA 1Q5OA 1R3LC 2ZE5A 1NKDA 1XOYA 3CCJV 1GN4A 4DV3O 4EWAA 2OT5A 2WFF2 1B06A 4LF8O 5BPXA 1X33A 2RS12 5C71A 5LRSA 3CCVV 5LL6Y 2ZX2A 3RQ0A 3N9PA 4LQRA 4NO4A 2A6ZA 3NV2A 2ES3A 1FXKB 1LUWA 2QFEA 1UD1A 5EYPA 2X05A 1C1FA 4N53B 1ZYBA 4FFFA 3DECA 1IURA 4CH6A 1CP9A 3P3PA 3JD4A 3AVRA 3VZNA 2W94A 1AVMA 2DVFA 1JZ5A 3OY8A 2PN5A 5EXOA 1R1A1 4IE5A 4CCCA 3TEWA 5FP7A 3T1MA 3AK2A 4L2NA 2HJFC 3WQBA 4UV8A 1FFXB 5DG2A 2BFUL 5FYYA 2W1QA 1K5MB 3LIGA 1UOFA 3I4IA 3RYRA 3JATB 1P49A 2JDIG 1FXVA 1LEDA 2L35A 1C57A 2JXAA 2GC3A 1G1XB 3PMEA 2B39A 5JUVA 1PZ7A 3SLIA 5FAXA 3HQRA 4JDOA 3TNQA 4DR2O 3L73H 2B42B 2WINB 1MS9A 1QLEB 1HB2A 3WU2Z 2PELA 1WNSA 1VLNA 4E4SA 4RAIA 4W50A 4QT6A 1RUC3 3LPFA 4I30A 4UFKA 3FBMA 1SCSA 1J1TA 5DZEA 5HFLA 3OEHG 3SEEA 3I2JA 2C4XA 1S55A 3UJOA 3IWZA 1ND2B 5KHJA 4E2QA 3E5UA 4OCTA 1HB3A 1R1ZA 2XWBB 1KUQA 1ENXA 1X82A 5G04L 3H8RA 5BNNB 2QM7A 2JIZG 4OUMA 1CESA 2R49A 4DOUA 2GTAA 1BBT1 1GM8A 1XU2A 4AHXA 4QDQA 2E76B 3HEIA 1VBE1 4IEXA 1QH6A 5GTHZ 4U2AA 1MZEA 1F51A 1LULA 1NKGA 3FLTA 2W91A 4K6BA 4CPBD 1UQXA 1XNKA 4R4XA 2Q7GA 3USUB 2FL4A 2FMYA 4MGKE 1O4YA 4Q5OA 5FV3A 4LT5A 3APQA 2WPDG 2B45X 3RJRA 3W9AA 2ZMNA 2NYYA 1AR71 1PZ9A 2RS33 1URFA 1WA8A 4XUNA 2WWWA 3KT4A 2XXZA 3DV8A 1UYXA 4YW4A 1R1A3 3K58A 2X6AA 4CCEA 3HN3A 1EN6A 4WBNB 3G6EV 4IV1A 3DPRB 1S0VA 1K5MC 3MHZA 1AYM3 4CDXC 2PHFA 5C5TA 2ADPA 3K03A 1NZIA 1DDLA 4NWVA 4BIZA 3FYEB 3B8NA 2MK3A 4CEYC 2TNFA 1W04A 1ZX3A 3FUQA 4OX9B 5L9VA 2P3KA 3OMNB 1AR61 2WS93 4JZRA 3E8BA 4YVWC 2HFEC 3BOWA 2E31A 2XT9A 4YHHB 4JGYA 4J11A 2G4IA 3IAPA 3K4DA 3WNKA 4XAEA 1HQNA 2JICA 1AL23 3B40A 4BJ0A 3V0AB 5L3BA 3JBG1 2B8MA 1O8SA 1A8DA 2H6CA 2PYTA 1GP5A 4I3GA 2EVXA 4M3CE 3VZJA 2DUOA 3ZFEC 5A80A 1V6JA 4AQTA 4O2AA 1SACA 1NTMH 3N9NA 5A3NA 1RUG2 1HR0B 5KX5B 1RGSA 1DF5A 1DFQA 1XXNA 2HWD3 2O14A 2Y34A 2DCZA 4NRMA 4BM8A 1K4DC 1XE0A 3UETA 1COV2 2RM22 1WP7A 2GSMB 4YXWG 2ZBJA 1RUJ2 2CAZC 3ETGA 1UU5A 5C8YB 1E5HA 2A6WA 2PLV2 3HKCA 2E7TA 3H9VA 1GZWB 2NQYA 1BJQA 4O4IA 4M4PA 1QDCA 4JKMA 1IBMO 5FZKA 1Y7BA 3KVAA 1SFPA 3WP4A 3RYCB 3B3QE 4NAMA 4ONUA 3FB5C 1EBOA 2E32A 5LXTB 3DTUB 1WUVA 2WNEA 2X8KA 4WFBV 3JZVA 1JJ2U 5EYPB 2QTWB 4YW3A 1BXHA 5A3PA 2HWE3 2CUGA 1DYPA 3BRCA 1MEC1 2Q67A 4HN0A 5IT6A 3POEA 2ZGQA 2W92A 3JCZA 4R7CA 2GBOA 3CZUA 5A7QA 5BYNA 2WZR1 2QUOA 5AG2A 2DYCA 2DQ3A 1Q81W 1XBFA 3LOIA 4YJ3A 3N35A 2AZ0A 4Y1UA 5FIXA 1D4M1 1SA0B 4LWSB 3U11A 1XQNA 2DYSC 1VQNV 3ZXAC 3H42B 5J09A 1AR82 4I7ZB 1QMJA 5KUMA 3CS5A 5EBMC 5TISZ 1FMD2 1QHTA 4GWJA 2VNGA 3M7AA 2XLGA 1U96A 1VR3A 4DXTA 2WO3A 4XZUG 3PJSK 1AI5A 1PNMA 1VMHA 1AR73 3AG4C 2W1SA 3T2TA 3RPQA 1R73A 1W8ZA 2HYKA 3WG7B 1G9AA 1JOJA 2XG3A 2FB5A 2JGUA 1CAUB 5DAWA 1YTFB 1UAIA 2NZ9A 4E2SA 1NS1A 4B3MB 1OXCA 1KEXA 1H0BA 4BZ4A 3WQ7A 2GMMA 3CCUV 3MPBA 1HRV1 5F5CA 1KQSU 4CP2A 2XPJA 2ZQMA 4AVTA 2GTSA 4UF0A 1IBLO 5JSRA 2IJIA 2GC0A 3MFAA 3FHIB 5FCCA 2R0HA 3LSQA 1F31A 1L8DA 1AL22 5LEJA 5FMOL 1VAVA 2EJ7A 2JDMA 1MZ6A 1XBLA 2P06A 3J4UH 4F3JA 4JRLA 1YYNA 5C3QA 1ULFA 3RVZA 4A3ZA 1XREA 3OUJA 3U78A 1Y67A 3F2ZA 1K5QA 2VQFO 1YHFA 2A6YA 3VD4A 3KF5A 3VKMA 2QM8A 5JLVA 1KDMA 2YY1A 2YU1A 3ZM8A 2ZZJA 3VBSC 4B3RO 5KC6A 1NTKH 2GH8A 4A4AA 1OOPA 4XAAA 2HWF1 1V6OA 3ML0A 2GV9A 4LBEC 3ASOC 4CH3A 2WN2A 4JI3O 1YVWA 4YGCA 5GZEA 3U4XA 4CXXA 2D6NA 5A7PA 2OYQA 4QQ2A 5DN2A 3K5LA 1FV3A 1MVQA 2HWE1 1S0IA 1AR92 1S0BA 4LC1A 1AUYA 2PAMA 2VGDA 4JI6B 3UO2A 1OPOA 1N1SA 1GU3A 4LBLA 1PO12 1TME3 3RVYA 3SYPA 2EIJC 5CN0A 2G9GA 3PUAA 4CCDA 2RS53 2OW4A 3WNLA 3U14A 2Y6GA 3RI9A 1PVC2 2CTPA 3CEWA 4EYUA 1RMU2 5GJ6A 3MUY1 4CDQB 2EJRA 4FFBB 3C2UA 5CB4A 2Z2SB 4AVBA 4PF5A 2QJVA 1T5EA 1SQPH 2IH1C 3VZKA 1XNRB 4RQPA 3KV5A 2UUCO 3JARB 3DF0A 1CZVA 2DCJA 3W21A 4COUA 1QQCA 3K06A 1PIV2 3H1HH 3SXWA 1UU6A 3HPLC 5C6CA 1AI7A 1VRBA 2FCTA 5EIBC 3THTA 3NXSA 2JWPA 3ZXKA 3FB7C 3ST7A 2SBAA 5FLJA 2OWOA 3WP6A 1VF6A 5ABJC 3B4SA 3VKFC 1TME1 3HIFA 4D3WA 1V0AA 2ADDA 1R1BA 4COYA 1ZRDA 1POV0 3PUQA 1LODA 1UX6A 1U5ZA 1AYN2 1GN3A 2ILMA 1W2NA 2VQFB 3T4HB 1N1VA 5H2FZ 1MABG 2BQPA 3RWNA 2ZXWB 4QDSA 1YI7A 4LF8B 3IZOA 3VBUC 4INDA 1K33A 4IGQA 4DXRA 2ZX4A 5J2UA 3ZFFA 1SHWB 2FD8A 3BY6A 4WVMA 1GNHA 5LP6B 3ZIXA 1JJOA 1PPJH 4DV1B 2LW1A 2WO1A 3JD0A 2Q7HA 3JSNA 2FDGA 2ZX1A 1BEV3 3N7LA 2ZGKA 3OUSA 4UUJC 4FLYA 1RMU3 4OHXA 4JDMA 2HBUA 4Y26A 1OCRB 2GN7A 3IT8A 3MIFA 2JECA 5K1PA 1NQJA 2ARCA 1AXZA 2Q5ZA 4OI2A 4NTXA 1OVPA 5FZEA 5FZOA 3UM7A 3N4MA 2O8OA 5FUNA 3ETDA 3MHSC 1VBD1 4AEKA 4FTBA 2WL1A 4I3PA 5LYJB 4Q29A 3E1F1 4XJUA 4MVRA 4K7JA 4M00A 4DO2A 2RE9A 4HSJA 3U37A 5SV5A 1VBB1 4ZBMA 4DK0A 1CAVA 1N34O 5E89A 1REDA 4A3XA 4JDNA 3UYJA 2UY9A 2G9ZA 2GALA 4YWAA 1MNGA 3WD5A 2EZOA 1FT9A 1LTEA 4QPJA 3M3QA 4B4PA 1NA1C 4NWWA 2VOXA 1TMF1 2Q1ZB 3RWKX 1RUF2 3MF9A 1POQA 5GM0A 3E8GA 4SLIA 1MPXA 2QBXA 2YXHA 1TVKA 5IK5A 4QXBA 2ARBA 4GMP3 4J9YB 3O12A 3WUDA 1ZRRA 2JB8A 5A7SA 4MHRA 1XEQA 3FD9A 2JJ2G 4BB3A 1QJY2 1OUXA 2AGSA 4FPLA 4DV2B 2KB1A 3WB1A 1NI8A 2DWEC 3E97A 1R083 4F7ZA 2TEPA 4B3RB 2ZA9A 4UWDA 5IAXA 4CCOA 1Z5WA 4LE3A 4HYOA 3PJQA 1ZBA1 2DMXA 1IG0A 2WNUC 4V2VA 4MVSA 3WUCA 2QTOA 3ZXJA 3FUOA 5FLHA 5K8SA 4K40A 1PO23 1OKOA 5GZFA 2WLJA 2BP6A 3LNNA 1LHOA 2CYFA 1BK1A 3VD7A 3I5DA 2P6HA 2WAOA 4BK5A 3QO8A 3OGJA 3M8LA 3C3SA 2UXCO 2YROA 2GDFA 3CRQA 4X20B 3D82A 3ZVXA 4FTEA 2X09A 4MX3A 2V5DA 4GZ9A 3H1KH 5F1RA 5C8CB 1S0GA 3C7GA 2GNMA 3GM8A 4JTNA 1Q90D 3GWOA 2CAVA 4J7ZA 4JGZB 1JX9A 4JYCA 4YYOA 4LTAA 3VQWA 2KSDA 5A7OA 5L3FA 1K73W 3Q4HA 1XMQO 4JI7O 4XF1A 3QACA 3KB5A 1EN5A 1BYHA 1DYKA 1XNRO 4O4HA 5EBWC 1JYCA 3D3AA 2C1FA 4HBNA 5HCFA 4HOOA 4N21A 1LJ7A 1JMUB 2JENA 1KFXL 2ZACA 1LENA 4X62B 1G6UA 4E8CA 2D6LX 3OGIB 1E5SA 2XOMA 2BYVE 3DXUA 4JQTA 3VHRA 1S0DA 4NHKA 2ZKNA 5IYCO 1CONA 1M1KW 1BL8A 3SGIA 3VN4A 4AHWA 2FCVA 1J5EB 4B8EA 3KLSA 3VHNA 5IYYA 4BQYA 4I9WA 3FMGA 4I0BA 4RO2A 1PGL1 4U3JB 3GJBA 5GZCA 4J42A 3B09A 5F39A 1JUIA 2WWJA 2XBO2 4QB1A 3AK1A 3KHCA 2Q30A 1VQ5V 1SFYA 4MSWC 1ZM1A 3AZZA 1O59A 2UUAO 2Y64A 3ZDSA 4RQEA 4K8FA 2VCMA 3E86A 1C8NA 2BBAA 5LB6A 1IKPA 1AXYA 3MD0A 4NIHA 2Z5UA 1AYN3 4XETA 1IG3A 4FOQA 1DGSA 4PDMA 5ABJB 4HXCA 3ZMSA 2W47A 2P4EA 5HCHA 1Z5VA 1KYOF 2VRZA 3H1MA 4FOYA 1WLCA 4QX0A 3DXRA 5ERLA 1YIPA 3GJAA 4EWEA 2R073 4QPYA 2TBVA 3DYPA 2YGLA 4Q0PA 1V6LA 4MGYE 3DPRC 4CU9A 4LORA 3ZIWA 4JI8B 2J42A 4XHBA 2JKBA 1OCCC 4Y5Z0 3OGGA 2X53S 4UFMA 1DCSA 4CP9B 2RS51 2ERFA 3KF3A 2JX9A 4XMAA 2WLKA 2EIMB 3HT2A 1GQPA 1SA0A 1GOGA 4X1KA 1H1MA 4GA9A 3K75B 5I93A 3TOJA 2VXRA 1CAUA 5L7OB 3S7EA 3NV3A 4ES9A 3OUIA 4LBQD 1H2LA 1OC1A 4JASA 4UW4A 4GX2A 3L70H 2OA2A 2VW1A 1OUSA 4NVPA 5IYZA 3RN4A 3I3DA 1HNWB 3H1LH 1QJEA 5LEKA 4K1YA 4QPWA 2DURA 4YW2A 4Y4RA 4LHLA 1OF3A 2J1TA 4GQ7A 3PLQA 4Q0SA 5EIYB 1K3EA 2LJ2A 1GMMA 3H0OA 4Q8LA 1MEC3 1O91A 5LOVA 1JR9A 1V9U2 3AL6A 1P84F 5ABJA 4ARYA 2QQJA 4XDJA 5FBJA 5IYBO 2BBVA 2HJDA 4OQ8A 3RMXA 1QJU1 1I5YA 1ENRA 4MHUA 4ICGA 5CA1B 2BGOA 4W8JA 3ILFA 3F7VC 1QOSA 4O7XA 4JGSA 3ZSLA 4LBQB 4WM8A 2VTFA 3SYOA 5FP4A 1N0NA 1E5IA 4I2OA 1CZSA 4X1YA 2JDNA 4LBKA 5E16A 1LOCA 4DUZO 1WCSA 3LSUA 1R3IC 3DXTA 2IVJA 1VQMV 2XWJB 4GKKO 1W8TA 5C8WA 2RS32 2RG4A 1OOPB 1XSRA 3K77A 1F35A 1KFUL 4BPZA 3R05A 5BNQA 4CUAA 1IVSA 1DLBA 3POGA 2XQXA 1GWMA 5L7OC 1JFFB 2YXLA 3AG4B 3GGLA 4DR6O 5IJ0A 3IM0A 2JE8A 1NJIW 4JYAO 2ITCC 4C0HA 4N53C 3EXAA 5DUWA 1BZWA 5JIAA 3LA7A 3WW4A 3DCQA 1I5ZA 1LUVA 4LBOA 4JAAA 3T1LA 1Z7S3 4LF9O 5LMUO 3M3IA 3MIGA 2FBEA 1H8HG 1H8EG 5DECA 4DUYO 1R3JC 5C3OA 1N3PA 1OLME 4LKSA 2QQIA 5A7NA 2PMWB 4LFAB 1V00A 1BBT3 1PP9H 1WZXA 3TB0A 3T0BA 3H1YA 1DHKB 3AFGA 3LDCA 3J7LA 2EIDA 3GCWA 2D5HA 4FIPC 3IBMA 4ZXEA 1H2SB 4FCAA 3SC7X 4FPFA 3J7NA 1W3XA 4YVSB 2WA4A 2Q1FA 4JI5O 2BGCA 3QNEA 5FPZA 1KP3A 5FZ7A 5FNVA 1HRI1 3WF0A 2WZEA 3BA9A 2ATKC 2BNMA 5IVFA 4KWJA 2RDNA 3W7SA 3N9QA 3PTRB 1DBNA 5ISLA 2A3QA 4CDUB 3T2PA 1Y4MA 1SQ4A 1S5LZ 4N43A 4DV3B 5JXJA 4CCMA 4QHOA 1K5MA 1Q6HA 5IK4A 1GN6A 3KMHA 1QBZA 1JYWA 4QDRA 1SLLA 5CBHA 3WCRA 2Z3YA 5EWSA 3E2EA 5FMCA 5A7WA 3N7KA 3OOXA 5BY5A 3MIDA 1RUG3 3LCPA 5LP6A 4JHZA 3LEIA 2YXYA 4MW8A 1MQTC 1PVC3 4JI6O 1FFXA 5FOBB 4DR5B 1OH4A 1YRZA 4AFAA 4FQZA 3BFRA 4NJ4A 5DDJ2 3L72H 5A3UA 3R4DB 3K79A 1NUKA 2R30A 1W9TA 2BNNA 2A0LA 3HKBB 2GUZA 1S3JA 1QQP2 4QM9A 3RBZA 5HFMA 1VAMA 4U36A 1YQ6A 2WWSA 3A4UA 3RZHA 2YXSA 1LOFC 1QQP1 3ZHQA 3ACHA 4AWDA 4Y22B 4DR1O 1BGYH 3CU7A 1WP8A 3JD71 1HW5A 2Y0IA 3GZEA 1TAEA 1NG0A 5DDJ1 1OURA 3NWKA 1H2NA 1CAXA 3FFZA 1RUF1 1W2TA 4ZKIA 4CUBA 4BQ2A 4OHZA 2HEVF 2LO1A 5LMNB 2HP8A 2AUYA 5J2UB 1ZL8A 3IDEA 4CSWA 2QQWA 1BT8A 4AYUA 4LH6A 2V7QG 1SETA 2Q73A 5FXZA 4Q4W3 5AFEA 2CY6A 2FQPA 2W6IG 3OYWA 4CEYB 4CP1A 5DPNA 1W8UA 5L19A 2R9IA 3IGAC 5AFBA 3S5AA 1S72V 5LP6C 1WW5A 3GBWA 4JZ2A 1GZ9A 4WV8A 3AG3C 1O8PA 2W0XA 5CFCA 2HWF3 3ZHRA 1W6OB 4X1YB 3MDSA 1GP4A 4QKNA 3THOA 1BK0A 2CSGA 3IKWA 4GXLA 5DUXA 4PBPA 1LRHA 1GH6A 1HRI2 3OUHA 2JDHA 1J83A 3E89A 2HR3A 4LKEA 2AGAA 1OI6A 4IETA 4CDUA 2YS8A 1J1LA 4TWKA 3HOBA 1YNAA 1V9U1 4XPVA 1D0GA 4RFRB 5JR2A 5EC1C 5D5PA 1VQOV 4H3WA 2HYXA 2AXTZ 1G4YB 4FLWA 5BXXA 4E4DX 5IVJA 4E8DA 4XACA 3VLBB 4WFHA 1PL4A 5KR7A 1QDOA 4MG2A 3MV01 2XAJA 1VPHA 2P34A 1W0KG 3V0BB 3WV6A 1IS5A 5FO9B 4JI1B 1FXHA 1LHVA 2W87A 2QDRA 4DEVA 1VMFA 4XABA 2HKOA 1D2SA 4JI3B 2VNVA 3VD3A 3ABKB 2A73B 1XNBA 4AZZA 2NNUA 4XQ4A 1G86A 3VBSA 4PDLA 1RSOA 4S2DA 5FYBA 2FZ1A 2QKAA 3V0AA 2UXBO 1LNQA 1H6XA 4XTPA 2F93B 3FLRA 3MAQA 1M56B 2XQRA 4XF9A 4OPHA 4ZY9A 4XOGA 1QJX2 1W8FA 3P5BA 1H6YA 5B1BC 4QPKA 1W99A 4IIJA 3THDA 5L3DA 5JVDB 4OUSA 3D36A 1QXRA 2RQ6A 2PA7A 4RL7A 4DQAA 4EEQA 2YBSA 2FMDA 2FHRA 2VJXA 3IFXA 2OXBA 1QHDA 2DBNA 2HLDG 1M4WA 3JQWA 4QQHA 4IE0A 4QKBA 1PNGA 2OUJA 2HWD2 3A0RA 5GW7A 4RHV3 4OYUA 1SERA 4COVA 2VNOA 3IB3A 3ELNA 2XJVA 5C9AA 2J22A 2VL4A 3JBG3 4FM0A 3LDEA 1H8TC 1JS9A 5FY7A 5E1AC 5JJJB 4CDWC 1XMOO 1MMMA 4GKYA 1GR3A 5J1XA 2ODMA 4YZ2A 1YI9A 4FPJA 2ZKOA 4C1XA 2Q7EA 3DXRB 2JJ1G 1P7BA 1KBHA 1ZREA 2X5IA 4A6SA 1Q6UA 2HWF2 3UT5B 2YU2A 4JF3A 1IBKO 4GKJO 2F66C 5LMUB 4XBLA 4QB6A 5A3TA 5EK0A 4NTYA 1THZA 1NA1A 2Y6KA 3WZ1A 5EIBD 3CF6E 3ZRWA 3D4KA 3U10A 4GJYA 4EJRA 2OCCC 3GYDA 2D2CB 4AGVA 4QMAA 2B5UA 1WW4A 2YIDA 2Y4TA 5E8AA 5FBZA 1UZZA 5A6ZA 4YW6A 1IOAA 4Q4X1 4DR4B 4B3NA 5F6LB 5C8CC 2N74A 1DF4A 3CRCA 3QD6A 2PFWA 5F8PA 3H8OA 3BUCA 2ZGPA 3J26N 1LOGA 1O3QA 1XNTA 3RMYA 1BQPA 3ENRA 4W6YA 4QX2A 3PU8A 3FB6C 4DV0B 3DGTA 4XBNA 4S2FA 2VUCA 1QQP3 4MOAA 2JE9A 5JXHA 3K5OA 5C33A 1SLAA 5A32B 4FFHA 2J1SA 3P30A 3WQ1A 1FJGB 2Y6LA 4DY3A 5IWAB 1MACA 1ODMA 3O5SA 1I7FA 1WMEA 4YGEA 1DLLA 1W9YA 2IFRA 5IK8A 1YJWV 1N47A 1D4M3 2A5ZA 1WCQA 3AK0A 1JZ8A 4I55A 3DEMA 2EILB 2BU9A 1AP6A 4NE9A 2VZTA 2EALA 1X4TA 1V6MA 1EV11 4CU6A 1V6KA 2D3OW 1SBEA 2CDPA 2YDEA 2UUAB 1NLRA 4PI0A 1HNXB 3CMGA 2R071 1SLCA 4XFCA 1HKDA 4QPGB 1NY71 2X5IC 2WZR2 2JG9A 3LEKA 3W7TA 5C3RA 2VTXA 4NHYA 3K46A 1CJPA 2OCCB 3BPZA 2QQVA 2CTRA 5KBFA 1EZJA 1FPN1 4MVMA 3SCFA 1F9KA 2CHHA 3WF3A 3RYPA 1GFF2 4W4LA 1RUF3 4MTFA 1FOD2 1FX5A 4B1LA 3ETQA 5T5OA 3OGVA 4HT1T 4DMIA 2KG7A 1SQGA 1ASJ3 2Q8VA 3VBRC 4UFLA 1I1EA 1ZTEA 1SF9A 1FPN3 2WAAA 1YFYA 1LHWA 3DYMA 4F8AA 3RYIA 4Y24A 2Q5TA 2IZWA 2RM21 2PZSA 3T2MA 3MIBA 3F95A 4TN7A 3X2QB 2DYRB 4XF4A 2DCKA 5B4NA 3STZC 5K1XA 2UWBA 2YEVB 5J98B 4PA3A 4IIJB 3ATGA 3M3OA 1WLDA 4TYSA 3I54A 1Y4WA 5FMDA 4PA6A 3MW2A 2EIKB 3BCWA 1V55B 1QGLA 5F9TA 4B7KA 5CVRA 5BNPC 3TK1A 4X66O 4HVOA 2WZR3 5A70A 3ZSJA 2V4DA 4E4HA 5KXBA 2ZZQA 5C4WC 3SHRA 4NAOA 5CBFA 1PX4A 4RR3A 4L8QA 1AX2A 4LBQA 5GLVA 2D98A 2WT2A 4RQPC 2VY0A 5FJKA 2HHHB 1VIBA 4C1WA 4HKOA 3FAVB 2VUAA 1A78A 2IM9A 1LGCA 4ZI7B 2BPA2 3ZN1A 2OCHA 4JAUA 3N2GB 2QWNB 4LFCO 3QH7A 4JGYB 1IQDC 4K21A 1HXS2 1Y74B 4BWOA 5CA6A 2QQMA 2XONA 2B5HA 4IYIA 3POWA 4QPIC 3JAKA 3IPVB 1RVF1 3T1YO 4GB33 1UY0A 1NT2B 3CCLV 2HEWF 4CA9A 4LF5O 4NXMO 4FVMA 2VZ3A 3GALA 2G9FA 4J6GA 2WBKA 4UB8Z 3O1PA 2VBDA 1LU2A 2D97A 1WKYA 5LWBA 3K9AA 4RHV1 2G38A 3ZFEB 4AQYB 4CEWC 5C3PA 1PMJX 3AC0A 3C8XA 2H94A 5K4LA 3ME2A 5I0TA 3H9AA 3SEPA 1VBB2 4YM2A 3UKVA 4QGNA 1PGW2 1GRJA 2V09A 1Q82W 4XFAA 1HIXA 2IXHA 3KT7A 2WQ8A 4I50B 3RYIB 4BLJA 3ABLB 4WZCA 3X2QC 1KP2A 5FY5A 4CH5A 1R6TA 5ANQA 2RDRA 4LIVA 3LEGA 4YGBA 3ZYGA 1RPRA 1GM7A 1S2EA 4JX0A 5JZGC 3ZXGA 2DVBA 1I08A 1EPZA 1ZL8B 1QLNA 1J58A 1UIKA 4RS5A 3RYCA 1RMU1 4JI4B 2OPKA 1N32B 3ZSKA 2CTWA 5E1RA 4KBBA 2AENA 5FPOA 3R65A 3K3WA 2VG9A 2BEOA 5FZGA 2H0BA 1N4CA 2RCVA 5K0UB 3SJAC 2JEMA 1R6KA 3M4FA 2R72A 5L3CA 3VKNA 1SS3A 5C7GA 1EAH1 4MVTA 3C3TA 1JI6A 2YICA 1RUH1 2QA4V 2Z5WA 4H55A 1AXKA 1JXNA 4CXYA 4J7JA 2P5OA 2PHDA 4KMQA 4I0WB 4A7YA 3AKSA 3ZFGB 3ACGA 3OAAG 1ACCA 5GLUA 1PK6B 3AX4A 4CEYA 1ASJ1 4OFGA 1SZBA 2FDFA 1DQ5A 4WVZA 1JZ6A 3ETPA 1Q8OA 2YV8A 4YJ3B 5HI0A 5HXVA 4YRDA 2LFRA 4ZXKA 4MGSA 1CPYA 4ASUG 1VRH1 2VU9A 1NT0A 4YW7A 5JOZA 3UK9A 4B4RA 1BHGA 1O3TA 3N7JA 2VD7A 4IE4A 3V56A 2QJ1A 2D6PA 3LSSA 1I5XA 5LBQA 4R9CA 2XUMA 3POBA 3LFIA 3W5NA 4D6SA 2VMFA 3KM5A 4IGGA 2RJKA 1WW6A 2R9RB 3K2OA 5DZFA 2E74B 2GNDA 4K8ZA 1YITV 3FBYA 3VZMA 1WW7A 4NXNO 2VZVA 4XDQA 1YSCA 3GXUA 4YARA 1HDJA 2XUEA 3DKWA 3ZHVA 3O65A 1GNZA 1CZTA 1ZZ7A 1XJAA 4DXWA 3NR7A 4QD2A 4RWUA 1HW7A 2VTXJ 4EN7B 3KCCA 4LNVA 4NOTA 4XIKA 4J25A 4PF1A 4ASLA 3KQRA 2EINB 3K3OA 2WDBA 4QWNA 1DQ2A 3GVMA 1UYYA 2R6QA 4AE2A 1UXZA 4QNHB 1ST8A 2W95A 5EJ3A 2FKXA 3VBUA 2EIBA 1HLCA 2ZJCA 2ZEYA 2JEXA 1I94O 3SISA 4G9SB 2ZT9B 4JV5O 2F4PA 2XBO1 1BMV1 2BSKA 4KG8A 4E27A 4IE6A 1UPSA 1PGL2 3LSDA 4MVQA 5JI7A 2LROA 5FZ9A 4FLTA 1Q86W 2AZ2A 3AMHA 5JZGB 1EYBA 1U12A 5GONA 1FXZA 1W2OA 2WC2A 1BQZA 2QKDA 1FYJA 5C9AC 3SMHA 3CC7V 2HEYF 2QCSB 3TXSA 4NPMA 5A33A 3PTYA 5B3SB 4CP0A 4COZA 4I5SA 5KHGA 1NVPD 5IT9N 5H9QA 2IU3A 4KWUA 1M9NA 2GP5A 2NM1A 4Z92B 5IFTA 4E9KA 4XBFA 1X9PA 2ET1A 2VWJA 5IHRA 4BQ4A 4G27B 2H6BA 1COV1 3M1HA 4QX3A 4P5HA 3LDKA 2ZNIA 4GLXA 1UN1A 1YQCA 2MNGA 1SBDA 3OTOO 2B4KA 1VF7A 3ZPOA 4DFSA 2CV6A 3NQHA 3O14A 2XJPA 3K4ZA 5DQ0A 1OA2A 4RGKA 5J9PC 3RGBA 3JAWB 5FY0A 2YI9A 1Y3TA 1JYXA 4GX1A 3ZXLA 3CLPA 1K3IA 1VEWA 4EN9B 3FHQA 5IY5B 4BXFA 5CAZA 1HNZO 4QGLA 3MDPA 1ZZ9A 3O1MA 4LR4A 2DCYA 3VQYA 3VOUA 4ZHQA 1O5UA 1S5HC 3J81N 2KA3A 2JS5A 1TNFA 3I7DA 2KQXA 2YMZA 1FS0G 3B5LB 1HR0O 2AEZA 1OOPC 3BTZA 2H3OA 5LHIA 4BDVB 4MUVA 5FDBA 1K5SA 5FJHA 2ZDIC 4TV8B 1HB4A 1KD7A 3IIIA 2Y6JA 4NKGB 2XR4A 2Q4PA 4X62O 3K59A 2D6KA 4OULA 4LBMA 3E8FA 1R093 5A6QA 2BOBC 3T30A 4XDPA 1RFYA 1KS4A 5CFDC 2BRTA 3CC4V 3WX5A 2VCCA 1OA4A 4FP2A 4GUNA 3L74H 1OF4A 1VBA3 1FATA 4YZ3A 1RITA 3VBHC 3OEAA 4O9GA 3H3ZA 1D5NA 4JI8O 4NTWA 4EROA 2WN3A 3KCXA 1RUJ1 1QXPA 2P6JA 1EUTA 1MS1A 4PV1B 1QF3A 4NHLA 2CH7B 2DF7A 5FLXN 2N04A 2ZXWC 1JFFA 1OQDA 3BEHA 2J7MA 1U5IA 1RXGA 2TUNA 1VQ4V 1T2XA 2CWSA 2WAMA 1S76D 1V6NA 2BV4A 3EXUA 2Q8OA 2Z69A 3EVKA 2VQEO 3T2OA 1C8M2 4QPGA 4W65A 5M0TA 1SZTA 5HCBA 4A7ZA 5IJRA 3PN1A 4DR7B 3UKMA 4KI5M 3BU0A 4UCSA 3JBG2 3KZIZ 3NAPA 2FDJA 2RV9A 4BU2A 1TVKB 2RMU1 2L6LA 4JRAA 1AP5A 1GKFA 5LA6A 5BNNC 3NL1A 3AP6A 3LDBA 3AMQA 1POV3 3K48A 2EIEA 1ZVFA 2PHXA 2ZCWA 5C8CA 4CE8A 3JXSA 3RVHA 3CNAA 4P9XA 2GH2A 3ACIA 1W0JG 2OIIA 3M70A 1UPGA 2RM23 1ZWIC 1XE8A 4O4LB 3VHPA 4JYAB 3MF6A 4DZGA 5FZ0A 3ALQA 2EXIA 1DQ4A 4XZPA 3L75H 4IGOA 5A3WA 5F3GA 4RR3B 1KU9A 2UUBB 2D5FA 1SRYA 1W6QA 3M7MX 4DR3O 1QNWA 2BJSA 1KRIA 2D3PA 3IDAA 3RFRA 2J1UA 4ZI7A 4AGGA 2I74A 3E83A 2F4VO 1PM9A 1BVVA 4J41A 2PHTA 2IC1A 1AL0G 4MT8A 5EFUA 1A34A 3IC9A 3ZRVA 1CD3G 2DU1A 1RTVA 3P6BA 1HN1A 5CA0B 4PA4A 4IV3A 2QDOA 2NN8A 1ZZCA 2VZOA 4JKKA 3JALA 4CDQC 3OBZA 4H13B 3MEPA 3CEIA 4NIGA 2PAEA 2XLFA 5JOXA 1W9FA 1BBT2 4BQ5A 4TV8A 4DV4O 4Y20B 4B08A 4D6TH 2VBBA 1AJNA 2CTQA 4NXNB 3SYCA 1KKCA 3ZN6A 3WDYA 3ABMB 1WD4A 3ROUA 2FDIA 2WFF1 1COV3 4DW0A 1GWLA 3WQ0A 4JI0B 2XAHA 1ZBE2 4UAPA 5H9RA 4Q4V3 4KBZA 3WNNA 3PURA 3NJXA 5CB7A 1V54C 1H2MA 3CJXA 4IHJA 1DF0A 1TUBB 1R091 4MVZA 2ATFA 4XBQA 4JV4A 3GHNA 3GZUC 4YG0A 4X20A 4EWDA 3NJVA 1O9GA 4ORFA 2GDSA 1SQFA 3NNJA 5JDBA 2MHFA 3AXEA 3WG3A 4IV3C 3OEBA 3BAAA 3PVOA 1RUC2 4EB6A 1QH7A 3EO6A 1NZ6A 1FAYA 3MBWA 3O9OA 4DIQA 4MXWA 2IVIB 3T0DA 2VW0A 2W08A 4URTA 2O0OA 2ZGLA 4LK7A 2ZCEA 1RSOB 1AYM1 3QLQA 4DS0A 2PI5A 1B35A 2KD7A 5JH7B 2LRPA 3QF7A 3OE7G 5FZHA 4JTAB 4R9BA 5B2GB 1R1A2 3K5MA 2A79B 1S2BA 2LGWA 4PLOA 3AMNA 4CC6A 3CCSV 1GZTA 1MR5A 2OQ6A 4ZS3A 5BZBA 4LCUC 1VMJA 2YUAA 4OI4A 1EFRG 3T1HB 3FC0A 1W3VA 4WF9V 2AEYA 1RUH2 4ZKTB 4OPAA 1PM4A 4V1PA 2ZPXA 2DYSB 3JATA 3ZHUA 1EAH2 1QJU3 1OKQA 1GOHA 1OCOC 2ZHNA 5FYUA 4A45A 5FZ3A 3MIEA 4FZ0A 4EZ4A 2B9VA 1Z78A 1PL0A 5LGTA 5T5LA 5C93A 3ZYFA 4JVAA 3ILNA 4CEWB 4NPLA 4J9ZB 4BOWA 5FPUA 2OKXA 3DUIA 3NSTA 3G4SV 1OA3A 1REEA 4FOWA 1H8TA 1RVF3 4AVSA 2PHUA 1NCRA 4ISQA 1I5PA 3CKHA 4LEJA 4P9WA 1NAEA 4PA9A 2BOCC 3FB8C 3R66A 2VMGA 3Q8FA 1RUOA 5CYYA 3OJBA 1FMD1 3NNFA 1UIJA 4AEDC 4PT6A 2E3CA 3TEZA 5K0UA 4FT8A 4MS2A 3UO3A 4D6QA 4WCEV 2QGNA 1M5IA 4AL9A 4YY3O 3OFNG 3C7FA 1XL6A 1RUI2 5BR8O 2GC2A 2ARXA 3PVEA 1UOGA 2J1AA 1QR8A 3MW4A 4NYKA 4B3TO 1SDWA 3WG4A 1OQ1A 3O0VA 4LF4O 1FAFA 3JCIA 3WT3A 1B04A 4X1KB 3RYHA 1NQDA 4MXWB 2K9ZA 3POIA 2NMOA 5FQ0B 3CDZB 4MADA 3ZSEA 5ACA1 5K0UC 4S2HA 5FK8A 2E5LB 3O7OA 1PNKA 4JYYA 3P1IA 5EJZB 2ZGNA 4UXAA 3HQUA 1HNWO 1C4RA 5CU1A 3VBOA 4IEOA 1PNLA 4O4JA 1WB8A 2WZPP 4ASMB 1XE7A 4IE7A 2ZAHA 3M2MA 3H7JA 3PJYA 4LXLA 4AHZA 2ZGRA 3ZCCA 3FHAA 2W6JG 2AH2A 3HPNA 4FPOB 3H8XA 3RWRD 1HNXO 1IHMA 1SZXA 3ZSMA 1X36A 1ZBE3 5KC5A 4E4EA 2QQOA 4DR2B 3K5NA 4B3SO 1IBMB 3NKGA 3RJ2X 3N9MA 2RMU2 3ZFFB 5KA6A 3CZJA 3INAA 2CU5A 4LPLA 4LO5B 1G9BA 2WABA 3TN91 4CBCA 2CGOA 1F5FA 1Q3EA 5FZOB 4BE3A 3U4SA 3V64A 2GNTA 1IX9A 1SKVA 1VBC1 2B46X 3NO8A 1ULOA 5FP8A 1F7YA 4WM7B 1F4AA 3I3EA 3K57A 3LWCA 4Q20A 4K8XA 3JYCA 2IWGB 4NRPA 3CMAV 3H01A 3ZYPA 4TV9A 4DV1O 5IDJA 1AR62 4DO0A 4PQQA 4XFHA 3DYOA 2DUQA 1NXD1 4I09A 2P1BA 4LBNA 5LRRA 3AFKA 1J3PA 4B7EA 2WO7A 2DE0X 3LA2A 3OTFA 2I45A 1N36O 2ZD9A 2DVGA 3ABUA 4JYBA 2EXKA 3LD8A 2CK3G 1VP7A 4AI3A 3N2KB 1AZDA 3H8UA 5T5JA 1VF6C 1WA4A 4Z1VA 4DV0O 2E51A 1FOD1 3IC7A 3STLC 1NE4A 3E5XA 1NR1A 4UF0B 1H2GA 2ORZA 4B1MA 1DU3D 5FYIA 3AP7A 1LGNA 1MS4A 3C7EA 3NNGA 4FK5C 2C6SA 5IVVA 3IJ4A 5C4WB 4QM8A 4YZ1A 3DL3A 1OCZC 1GV9A 4J1WA 3CXCU 5GALA 1N36B 3ILRA 4HAMA 1UJWB 2DYRC 4X64O 4CS3A 5IWFA 5FZ1A 2JE7A 4GH4C 1HDKA 3ZJZA 1XOUA 2NMNA 2YFUA 5E6HA 3F7YC 1MQTA 3B8MA 4OXSA 5EQUA 4LHSA 4XVHA 4RD7A 1N33O 4AF9A 4TLFA 3I55V 1GWKA 4QX7A 2ZTNA 3PU3A 4YNIA 4LA2A 2PUSA 5FYZA 3UT0A 4I4TA 3J7HA 4M3CF 4NRQA 4CVUA 4A41A 5H9SA 2ZM6O 4X88A 3D3QA 4CEWA 1W28A 1OLMA 1L3JA 1YFWA 5EYYA 4YG3A 4CDUC 2JS3A 4B4QA 1YJLA 4N23A 1FPOA 3NKTA 1YUDA 4GMP1 1ND3B 2J1RA 4ZHQB 2YFZA 4UOJA 2XVGA 4HZFA 2ZOEB 3N2GA 4UVCA 2VVFA 2UXDO 2W1WA 4CU7A 5JQGA 4OI1A 3VKOA 3ON7A 2AZ5A 1YJ9V 2HVJC 3HKDA 2JD4A 4FJCC 4L97A 4ZIBA 4QAWA 2VMDA 4FPPA 1L0LH 2VPVA 1ND2C 1R3KC 4D69A 2EAKA 2XMLA 4EV0A 1C28A 5D2AA 1HB1A 1GBGA 4E2GA 4BAYA 1QNMA 3Q8AA 1WB7A 4LFAO 3N9LA 2XBO3 2BZDA 3FX3A 3POSA 1IGOA 1YI2V 1H1IA 4NR1A 1BMV2 4FLXA 2DFBA 4XFFA 1JU4A 2UYBA 3OPZA 4DB5A 1NH2D 1EUUA 3MYXA 1NLQA 2C9KA 5T55A 5IY5C 3O1UA 3ZMTA 3PL0A 5FXXA 1COWG 3WCSA 3ASNC 4EKWA 2XLAA 5FWEA 5JCTA 3VDCA 2RN9A 1E1QG 1C3HA 2N05A 1N0JA 2VCBA 1MSWD 5HPOA 2DTYA 3I3MA 2W1UA 2WNVA 4QE7A 1X59A 2LFSA 1O3RA 4QXHA 4CUCA 4L99A 3FE5A 1QJY3 4OUEA 3OYWB 1DZQA 3KZ4C 4G2KA 3E6BA 1F4HA 3NV4A 1LNSA 3JD73 4XHXA 3BIWE 2PXJA 3KSCA 1A3KA 4X6QB 1ND3A 4XJZA 1YHQV 5LBCA 3ASIA 3K4AA 4W6XA 2IUWA 1X9TA 1QJX1 3WDTA 4Y3OA 1C1LA 4UCOA 4PQ9A 1SPPA 5FYSA 2XH6A 3WF2A 4DV2O 3JARA 3SH4A 3O1SA 3WDUA 4YY3B 4JAVA 4KL1A 1POV1 2QQNA 1Q8QA 2GNBA 4AQ6A 4RR3C 3JD3A 1JU3A 2ZGSA 1VRH2 2VXJA 1E57A 1RM1C 1REFA 2UXXA 1D2QA 1TVGA 1FNZA 4KGGA 1RYYA 5F37A 3ZYJB 2XNDG 1ENVA 2E33A 3CSXA 5FZMA 3AZWA 2Q4SA 5BUVA 1W2BU 5JVDA 1CAVB 2ZEXA 4DEQA 5DM6V 3B69A 4LO6B 1D0HA 3LF7A 5CBLA 2H8PC 2ZIOA 3ZR5A 4XC9A 2IJJA 5B1AC 3RRDA 1VARA 5JSOA 3BTAA 3POJA 3EMRA 1RVF2 4YW1A 3Q8BA 3JD2A 1FFTB 5BNPB 3LE0A 2CGNA 2HWC1 5FKCA 2WLHA 1MZ5A 1LOAA 2CTVA 4CS2A 4XEZA 1OBNA 1X8MA 3CJIC 1SFNA 4G4FA 4UVBA 4XCBA 4DR5O 1S0FA 4G28B 2WLPA 3G6BA 4DPNA 2I2SA 2Y60A 1OHFA 3WG1A 3BU7A 4A7KA 3HNYM 5HV4A 3MFCA 3WNPA 4IEZA 3SH5A 1RUD2 1VAKA 4QHBA 2OTLV 1ZRIA 4FO9A 4MXVA 4LH7A 1RC6A 3OGRA 5T3NA 3O1RA 5A32A 2R9AA 4BA6A 5EZWA 4YVSA 3RSJA 1XYPA 3VDDC 2OTJV 1JOYA 4E2LA 3ZYBA 2D6OX 1JYTA 2YC2A 3LZZA 3C3VA 4UXNA 1XSQA 2WSVA 2CAUA 2D3SA 2R0FA 3KV9A 3CB2A 1JZ3A 4AAXA 2UU8A 1AR4A 1PMHX 4WFEA 5EPAA 1J95A 4AHYA 2PYLA 1HP8A 4QXCA 2HH9A 4BIOA 5JVVA 1UU4A 1VBC3 4UT5A 1H9WA 4LFCB 5FYMA 3BOPA 4WFAV 2ID4A 4UI9L 4WVMB 4GULA 4J80A 3ZYRA 2UUBO 1NCQB 1JVMA 1XUQA 3JQXA 3JD72 4DUWA 2BNOA 1W6NA 3WINE 1OLQA 4BISA 1ULDA 1DK1A 1HJFA 2WFF3 4WBNA 3AYCA 4I02A 5FPXA 5AC93 2C26A 5FZ4A 1MS0A 1H4GA 4CDWA 1N3OA 2JDPA 4H37A 1WMFA 3CE2A 2OZ6A 3JASB 4DUYB 3CJHA 1ENQA 3E8HA 2P3YA 3AVSA 2FCUA 2CE4A 2EILC 2VAUA 4B29A 2Q8DA 1XQ8A 1SC5B 5F3CA 2BFUS 1H30A 5A3LA 4Z07A 5A3OA 5T50A 1QY4A 5DAPA 3VQVA 3O1OA 5JMOA 5EP9A 1AX0A 2W2IA 1IXMA 5L3EA 1MG1A 3JD1A 2DW4A 2ZE7A 3B93A 5JOYA 1BMFG 3VKLA 5F7UA 2EZPA 2FZ2A 2BTOA 4O4IB 5LCWL 1OLRA 1WAZA 4BXSV 4YM1A 1LHNA 5FUIA 2J1VA 1JPXA 3AG1B 1M90W 2QSAA 3PHMA 2K1EA 1YCIA 5I91A 1CXZB 3HR9A 4NIIA 4FXKB 2GU9A 1QKQA 3CC2V 4H2AA 2O1QA 2ORXA 1OQEA 1DGRN 2XVLA 4Q8KA 1AHSA 1H2KA 1IBLB 5CFDB 1ZUQA 3AK3A 4XJWA 1O3SA 3ZBHA 2YIBD 1NXMA 3OD0A 3VD9A 3HD8B 4DRXA 3IDCB 2F6BA 3URFA 2QR4A 2HBTA 1YWKA 1US6A 4G3YC 2BGPA 1YFUA 3WNMA 3D3IA 4I55B 2XL7A 3ZXDA 4YIPA 3WNXA 1MS8A 4HVQA 3I2GA 4GWMA 1GAXA 3KGLA 3MI8A 1TG7A 5L9RA 4D7YA 2WS92 2Y38A 3TETA 3K3NA 3TAYA 1YJNV 3FLPA 4UBHA 3OPWA 5C3SA 4FOVA 1FPN2 3IDBB 1UYPA 3SDLA 3MUZ1 1VBE3 5KAIZ 4C7UA 2QZ3A 2Y69C 3HJRA 2WYSA 3VHOA 4HNAB 1S1AA 5FO8B 2W68A 1YXBA 4Y4YA 3A0NA 1K42A 1NY72 2Q69A 1FOD3 5I0DA 3T2QA 3ZRXA 1BLZA 2Z4FA 2PYJA 1Y76A 2GZWA 5FY4A 4X89A 3VBRB 4PDWA 5AVPA 3MHHC 2UXBB 5B1NA 3NV1A 4Y1VA 2PAKA 1VBA1 2XJQA 1TEIA 3AKRA 1DQ1A 2QKSA 5FPVA 4EFEA 4H14A 2KXLA 3GZTB 1RP3B 2F95B 3HN1A 3QH6A 5J7MA 4E4ZA 3FZ3A 4Q26A 4K0KO 5BNPA 2IXLA 4OX9O 4CC5A 2A7AA 4PIYA 1U5YA 1K9MW 5CKNA 3VBFA 3UGHA 4R8CA 1XNDA 1QJX3 2UU9B 5FZIA 4IEWA 4UB6Z 3QO7A 3CXHF 1F2NA 5EHDA 4Q4W1 3KQ4B 5A1FA 1EP0A 4B3MO 3KVBA 3VBOC 4LUMA 1LKNA 1JUHA 3J8F1 3FJSA 2VECA 3AM2A 3TRSB 2W9XA 3THCA 3TBDA 4J1XA 3K9SA 4META 3LFMA 5A6XA 5KWRA 5FK7A 5J36A 4XYXA 3J7MA 2ZMKA 4M0NA 1UPIA 2VMHA 1DG6A 1LOFA 3CP1A 3VBFC 1KGYA 3WLUA 1US3A 2OX0A 4X65O 1UNBA 5AVAA 1W03A 2E7QA 2UURA 4GWNA 4AEMA 1WCDJ 4O65A 5K7PA 1I94B 3G7DA 2X10A 3D0SA 2GP3A 2LW8A 3T1YB 2RNBA 3OBAA 4FBFA 2WLQA 4YZ4A 2ETNA 1ZBA3 3U1XA 3LQCA 1CAWB 3OPTA 4FPGA 3B94A 1O7FA 3BVCA 4O61A 4LHNA 2KR2A 4IV1B 5APAA 1ASJ2 2AACA 3THPA 1OV9A 2WLLA 5L9BA 3WF1A 2E5LO 2VZPA 4W4ZA 5A6YA 2E63A 2WQZC 4X6RB 4DUVA 1M57B 2NPIA 1W6NB 1NA1B 2KM2A 5IAVA 2C9AA 4XUPA 2Y6FA 4JTDB 2QZ2A 3AL5A 4DNYA 2PHWA 2VOKA 3DN7A 3HKEA 4I0AA 1J59A 1MSDA 2RDCA 2Q6AA 3SPIA 4BW5A 3ZMOA 5LASA 4AXOA 4GB31 3H1WA 2UXCB 1VB2A 3VBSB 3AZVA 3JU9A 2GN3A 5JCOC 1VQ7V 4DV5O 2HWC3 1TUBA 2IXJA 4XFBA 5F5QA 3CRAA 4XTMA 2WT0A 5LW9A 2ZR2A 5JH7A 1Y6XA 1XNAA 2Y26A 3EHBB 1O4ZA 5GLZA 4P9PA 5FY1A 2M7WA 2NR5A 2ZE8A 2A70A 2IH3C 2JG8A 3POYA 1APNA 1PGW1 1JOBA 3S0MA 3TGUH 5CA0A 5DEDA 1QVGU 3O1VA 4Y1ZA 4LR3A 2JDUA 3JB8A 2BVBA 2IFWA 2P5BA 4HMZA 2WQ4A 1O9HA 2JGDA 2VS0A 4N8MA 4YVWA 4RHV2 1K8AW 2Y6HA 4OLLA 5C5UA 2WFPA 3D6EA 1NYWA 4NN0A 4JI2B 1S5JA 5FYCA 5FZ6A 3HNMA 3ZOIA 4Q0VA 1VE0A 3CO2A 4QU2A 1S4CA 2JG9B 2JG8C 3CIHA 5DDJ3 4BK4A 5DAXA 2ZGUA 3IAYA 1BHAA 1Y9MA 3R4SA 2Y0OA 4BHPA 5JIUA 1Q8SA 3K08A 2YZ4A 4DW1A 3FX7A 5EV7A 3HKDB 4UCRA 3RDIA 2Q9LA 2ZKLA 4P02B 1HXS1 2GHYA 5CFCC 4M3CA 4WFFA 2WYFA 3ASNB 5FZDA 5D8AA 5I8TA 2UWAA 1G7YA 2A75A 3KS7A 3C7HA 4FPYA 2YYOA 3Q4HB 3T4ZA 1W6MA 2DV9A 1OMIA 1HX6A 1H9PA 1SESA 2F4LA 3A7QA 1UZ0A 1G8MA 2F17A 2RJ2A 5J37A 2XL9A 2C24A 2E6VA 4YG6A 4LF4B 3H7YA 5J3UA 3ABMC 5FZAA 1NVPB 5EJ1B 4P9JA 3W59A 2MEV3 4LLOA 4P08A 1K34A 3S5QA 1J5EO 1AJKA 3KV4A 2OZJA 4LO8A 4JGZA 4F6EA 1HV1A 5J48A 4M01A 5IWAO 4Q4V1 5GONB 1PVXA 4TQDA 3A0HZ 1W0PA 1PMIA 4NROA 1P4RA 4UFJA 2ZM6B 5F32A 1JYNA 2MW2B 2RJZA 5EBLC 3LKJA 2MEV2 5IK7A 1Z7S2 1JW6A 2WNVB 5F3EA 5GZDA 1UOJA 1XYNA 4DXZA 3S57A 1LCLA 4MTGA 5JJNB 5HXMA 1E79G 1YO8A 2JDKA 3Q8EA 4GJZA 1LR1A 1L7RA 5JCOA 1ZA4A 5FXWA 3UESA 2RDSA 2ZEZA 4IEYA 4JV5B 4RGGA 4Z2WA 3ZHTA 2HWB1 4K8RB 5KXDA 1H1AA 1DGWA 4N43B 4DV6O 1HQWA 2JG9C 2E7AA 1OFSA 3GZAA 2FTKA 3F5TA 1NU1H 4K1ZA 1H8TB 2R16A 4AFMA 1RHI2 5JI9A 1JHJA 2SLIA 3E35A 3MIHA 3AJYA 2Z79A 4H44B 3K51A 2VWKA 4KU7A 4WVWA 1S77D 2IW5A 3JAKB 2A6XA 3ZFFC 4BIFA 2Z0AA 4LWSA 4O4JB 1OD3A 1LOBA 5FO7B 3OGSA 4XDKA 2JG8B 1DGRA 5I0RA 1WCKA 3H1JH 5JPNB 2HKXA 4PCRA 4UBGA 1AI4A 3ZMUA 2W5FA 2R072 4XUQA 4P14A 3ACFA 3DC5A 3V0BA 2DU0A 2WJSA 3UNPA 1EV12 1G6NA 1XMOB 2ZHMA 4MW3A 1VBD3 4A6OA 2D43A 4C91A 5T5PA 4AFCA 1NTZH 3BPSA 1N33B 1W6OA 2QVSB 2PF4E 2DDUA 2PHLA 2O57A 1UY3A 2D7FA 5IVCA 1L7QA 4DV7O 4NUBA 5KA5A 3KGZA 2ZE6A 1QJFA 2JJ6A 3OMIB 1XNQO 1PK6C 2JIGA 4BLIA 2P67A 4Z8BA 2PY5A 3VDAA 4KHPB 2X6CA 1ALYA 2WO2A 5LBBA 4DR1B 1K45A 1HNZB 1YJKA 4UCUA 2BERA 2VO5A 3CJIB 1UX7A 1GOFA 4X8AA 3P32A 2ZAAA 1W8WA 5L36A 2UXDB 5LGUA 1G8WA 2VQUA 4ITCA 3S7IA 4LLFA 2VM9A 4RS5B 4AILC 4JHTA 4CPBA 4CRQA 4DR6B 2Y4UA 4YZ5A 4FAGA 2B1GA 5CEHA 2DBIA 4C0BA 1PV0A 3GBGA 1VMGA 1NQTA 1MOFA 3A2FA 2QWQB 2WNVC 1MA1A 4I9QA 4S2GA 4Q4X2 1ULEA 2IXCA 3FWEA 3CX5F 4IL7A 5CB4B 3L2HA 4QPIA 1I3HA 5CZKA 4NHMA 1YTFD 5KAFZ 2RS13 4WM7A 2HEPA 5E79Z 3LDDA 2X7RB 3SJBC 4H0LB 3S3WA 1Q8VA 2VR4A 1AR83 3UGFA 2BUKA 1PO21 4O4LA 3WSOA 4EE2A 4RYDA 2ETEA 1JCHA 1CIWA 4YJ2A 4SBVA 3VL8A 2WA3A 2XHKA 1UZYA 3AYDA 1PNFA 1YEWA 1TA8A 2ZNJA 3MLJA 2A1XA 4LITA 4GWIA 2RS31 5LBEA 3IMNA 2EX3A 3BB6A 1YLLA 1NE6A 4X65B 1W9SA 4LFBO 5E88A 3SKJE 1KITA 3VB9A 2Y0PA 4AG4A 1YZBA 3K0DA 5GKAC 3V65A 1K7DA 1IDSA 2HWD1 1RL3A 1XU1A 2VVEA 4COWA 1W6PB 1MS5A 1O6UA 4YIOA 5H6RA 1WJZA 4KH9A 1QJU2 5CKMA 3VBRA 1GMGA 4DK1A 4TT3G 2ZXQA 5HBAA 4X1IA 4YW5A 4QB2A 1W6MB 5LK7B 4X8PA 3BYWA 2P4KA 4UCTA 1JTZX 4TSFG 4UFZA 3S6PA 4AAPA 5GZGA 4BYYA 4FFIA 1UKGA 4OZXA 3AP4A 1DQ6A 5KHIA 3UKTA 4P9YA 4ZZ8A 1VB4A 3WDXA 4MH0E 4MGZE 4BQ3A 5DUVA 4CCNA 5I8YA 2AHYA 3AZYA 3NAPC 1KXGA 4CU8A 2GAUA 4X8NA 1AILA 3OTOB 4BCUA 1M93A 2E75B 5HV0A 1YQ5A 3EJKA 4JZGA 4Z2AA 1QOTA 4KG0A 1W8HA 4RA0A 3K0GA 1RUD3 3SITA 3FL7A 2O8QA 3UL2A 4HETA 2HWB3 4DR7O 4QGPA 4EFBA 2WNUA 1L0NH 1OD5A 3SJCC 1GQHA 2VZSA 4XJAA 4K9SA 3MO4A 4UW6A 4LIUA 1GANA 1KMIZ 4XMIA 5ACA3 3ZFGA 1AL21 1NBMG 4LOTA 4FLVA 1K92A 2NN4A 3I2HA 3LNMB 2RS52 1RIRA 3BGAA 4LNUB 3QBQA 1VQ6V 5CFDA 2OVUA 3B00A 2VZUA 1WLEA 4MO3M 5LHGA 5J96B 4FPEA 1ZRCA 2H0VA 3ZIAG 2R062 1AR93 3ABLC 3ASOB 2BSKB 2ARAA 5IVYA 4DRVA 5FP3A 1Q6IA 1V9U3 3WF4A 1B35B 4MLOA 4Z82A 2HG5C 4DUXA 3M3EA 2XJTA 1QEXA 3ABTA 3JB4C 4L0PA 4QX1A 5H9PA 1XI1A 3GCXA 4L92A 4YJ2B 5KHKA 2EIJB 2VUJA 2GSYA 3CCRV 2JVDA 2WKKA 3I2FA 3AZXA 2LM3A 4FVVA 3ZN0A 3WDVA 2VZQA 2YC0A 4WM8C 4Y22A 1B3QA 1R082 1G9FA 2ADEA 5FP9A 3I2KA 1AX1A 4PLNA 1CGPA 1VQKV 3EBRA 1JBCA 5FOJB 2GMPA 2LGQA 3J9SA 2D44A 1CPNA 3HB3B 4KWKA 1MEC2 1L1FA 5JOWA 4P9IA 4U3JA 3ZHSA 1QJY1 3JAWA 4DRRA 1IBKB 4GKJB 1CAWA 1JZ7A 5KXCA 4AVCA 3G80A 2DCTA 3J7AU 1ULGA 5JXGA 2WT1A 4Q2FA 2BOIA 2Y48A 4UCVA 5EC2C 3UGGA 4FQ4A 2R061 3VBHA 3KHBA 1GYKA 2RJLA 1I9RA 3FAVA 4W4KA 3TEYA 2XAQA 3USSA 3I3BA 5JR7B 2ZHLA 2BE3A 4LO7A 4Q1PA 2BTVC 5LY1A 4JTCB 4OMCA 4UW5A 4ZU5A 4LF6B 2WRAA 4KP4A 1HRV3 5EZYA 4WVVA 4D8MA 2YEVA 4QX8A 1NCRB 1IPSA 5FZ8A 1PZ8A 1XYOA 1AB3A 1XL4A 4YM3A 2VZ1A 1N32O 5F5AA 4GX5A 3B9CA 4XQDA 3QO5A 1TUEB 4XUTA 4BMEA 4C90A 1WMDA 4UV9A 1XHXA 1QIQA 1GZCA 1O4TA 4HVRA 1YFXA 4O2BA 5ANNA 2B1IA 2VMEA 4WBBA 1KD1W 1W0NA 2VMCA 1LAJA 2VBPA 4FI9A 5C70A 3I59A 1KC8W 3E5QA 4CZSA 1ROPA 2W39A 3MLLA 5FKBA 1JQ0A 1HQLA 2XKOA 3E22B 2E53A 1D4VB 1JN2P 3ZR6A 2DUPA 3UKNA 4IYHA 1R081 1QLEC 3DC6A 2EXHA 3RNSA 3SPHA 3VGIA 1VQ8V 2ZMLA 1SG3A 3CMEV 3VD5A 4FXGB 1GUIA 4WFGA 4LF6O 1VRH3 3JUUA 1WMXA 5H5NA 3G6JB 1W0OA 4BR6A 2FMLA 1H38A 1CQ9A 1KJRA 4HKLA 4JI5B 2DVAA 3CBNA 4J10A 4KUMA 3VQXA 4CH4A 2XGXA 3H3LA 5BNOA 1BHBA 4Y33A 5LA1A 3ZMNA 1YQ2A 4N53A 4RSUA 1M4UA 1XNCA 4W6WA 3ORJA 3OD4A 4PJ0Z 2JDYA 3WB0A 5KLVH 2Q0AA 2Q0OC 1UMZA 4IUGA 1IS3A 1FI2A 3B77A 1BVP1 5L7OA 3BTXA 1RUNA 1UFIA 4DV7B 5HCAA 2DN9A 4UFHA 4YPJA 4N9IA 5B1OA 4CYDA 3A23A 3APOA 2P2KA 1TME2 1TMF2 4TQFA 2BVVA 3CRRA 5JSPA 4PIXA 4ATFA 4ZPIA 3JCUZ 1Y74A 3SPGA 5DAVA 4LNUA 5CADA 2QQKA 5CISA 1B09A 1JZ4A 5C4WA 2QE3A 1OFNA 3WB2A 1CIYA 1QXJA 1UWWA 4EN6B 4Q1RA 4XURA 1A6CA 3T4VA 1KB9F 5BV6A 1ZZ6A 1K4CC 4V2WA 3T09A 4P9OA 1VBD2 4DY5A 1PO22 1ZNPA 3LB9A 3LOBA 4PLMA 1WA8B 4AEJA 1XILA 3RZLA 2IBZH 1FXKA 2V5YA 3VZOA 4LMFA 5I0SA 3A22A 2JGDB 2DOSA 1JHNA 3BODA 4TWTA 4EQVA 1AF9A 4HFSA 4X66B 5DUUA 1PVC1 2LUWA 3LAGA 1O5LA 2VOVA 3SH3A 1XPWA 3K04A 2R043 1K12A 1V54B 4LF7B 1VJ2A 3Q8CA 2XHBA 3DSQA 4XW3A 5ITZA 4NPRA 2DQ0A 2AREA 5FUPA 3L9JT 4ZOLA 3UV9A 1J3QA 2HWE2 2Q1MA 3I97A 2A3XA 5KHHA 1YC61 2ET7A 4GH4B 4AFBA 3H1IH 3J8F2 3PUSA 3D8CA 1ORQC 1UMHA 4CP9A 4D94A 5LOVB 3KD4A 4GKXA 2YIAA 3R6SA 1SQVH 1X7NA 3I49A 1AYN1 5LGNA 5FTTC 3ZRWB 2B9ZA 2WWUA 4Y5TA 1H4HA 1HN0A 4R4ZA 3B01A 4JGZC 4PI2A 4AR2A 4H7MA 3W5MA 2Y69B 2ZINA 4N90A 4Z1MG 1DTOA 1BS3A 4FLZA 1Q8PA 4YVSC 3DPRA 1WN7A 1Z2GA 2X6BA 4XQWA 3LDRA 3BVOA 2RVAA 4UVAA 4Y1XA 4AHCA 4KFMA 3ZN4A 1PIV1 4HL0A 4N43C 4LUKA 1FJGO 1GQGA 5EYXA 5EZYB 1Y9QA 1OJHA 3UT5A 1M06G 4WZFA 4PDRA 4MSVA 1VALA 3ZS8C 1LB2A 3A21A 3OR6C 3VBFB 1Q7YW 3BTYA 2D3RA 2OQ7A 1CN1A 3O1TA 4UYBA 5FMOS 2Q8CA 2P4VA 1UY2A 1NZCA 1AR63 2WS91 2DTWA 1QWRA 4IXLA 1EN4A 3RZJA 1ZLZA 3L2YA 2PGGA 5LMNO 1PO11 1WLTA 1YIJV 2M6YA 4IDZA 5IFPA 5B66Z 4QQPA 5FPAA 5JMCA 1OT5A 2HWB2 3O0XA 1IZ3A 1MS3A 2I07B 1WCUA 3HBKA 1AR91 1NH2B 4RGAA 4ET7A 2UYAA 2VQTA 2IJHA 2VNRA 1F15A 1AR81 1FXKC 5A1AA 2LQTA 4HPKB 1IPJA 2QE7G 1UZWA 1D4M2 4DR3B 5B3SC 3RT3C 2XJUA 1RJ7A 1GSLA 5LA2A 1HV0A 3WG7C 4ZOLB 1CJDA 3ZX7A 4Q4V2 2K2SA 2BCCH 1W2AX 3T3YA 2EIGA 1CAXB 1R64A 2IJKA 1AJOA 5JJEB 4HN1A 4AI0A 4Q4X3 1S0JA 5KUKA 3A0BZ 4PDWB 1US2A 1WA6X 1S0CA 4ASKA 2OS2A 1I0HA 1W8NA 3AB0A 1SDDB 2WSUA 4IT5A 4QIWF 4NMIA 4R9AA 1WPXA 4FPCA 5DABA 2VQAA 1PO13 5IVBA 3CCQV 4GZRB 4LK6A 2VULA 5BY1A 2V4AA 1FKAO 4Q0UA 5IJ9B 3N36A 4WM7C 2JDAA 2FYUH 4CS4A 2ZIMA 2WLNA 4U3FH 3RW0A 3ZYIB 3OUFA 3Q9OA 1TQ5A 1BE3H 2R1DA 2YHJA 2JRIA 1H8VA 3FFQA 1NLSA 5KMGB 2G19A 3CL1A 4TTGA 5FNVB 1OCCB 2V4VA 3OBTA 2DJVA 5CFCB 3FYIB 1JODA 2LP7A 1V6IA 3AYEA 1XB9A 4K3UA 5KX5A 3A8TA 4XFGA 2UU9O 1DGLA 3U0ZA 5GTIZ 1QOOA 4R6ZA 3ZRSA 2R063 2JKXA 3ICXA 1ZAUA 1RHI1 5FQ0A 2A7WA 3IN9A 2X29A 4KQ7A 1EPWA 1VP6A 2GMEA 2YC4A 3WEZA 3H50A 1VQ9V 1UY4A 3SR2C 5SV8A 3C7OA 2BDRA 2P3IA 3ABZA 3EFFK 1B6QA 2PTMA 3HBZA 4YGDA 2RR13 1F5JA 4LHKA 2ZX3A 1U5XA 4FM1A 1SQXH 1Z7S1 5LY2A 1W90A 1ZBA2 2AHZA 3FKSG 3HR0A 4CCLA 3BI3A 1F8VA 4EZHA 4Q4Y2 3I2OA 1DIWA 5H6QA 3SKVA 2WR9A 4EN0A 2F43G 4CZZA 3B9IA 3NW4A 3AKQA 2JD9A 1AR72 3VDBA 3G71V 4RQFA 4OQ9A 4GAZA 4YLZA 3TCUA 4FFGA 4IW3A 2BWCA 4QKDA 4DXSA 1STMA 1UL9A 2JEUA 2XB6C 3AYAA 3W7WA 4XCAA 3OF1A 5LHHA 2BTQA 2R1BA 3AG2C 4MGTA 2JB4A 4QE9A 5KMGA 3OR7C 4CCKA 1LU1A 3PIGA 4YFZA 1RUE1 5A3MA 5F2SA 1UW8A 2W3JA 4B3TB 1S0EA 3MPPG 5JWPA 5IYZB 2OIGA 5FPRA 4GMP0 4ZU4A 4RUEA 3WP3A 1N34B 4XF0A 5B4XA 3H3UA 4YVWB 3WW1A 1EAH3 1AROP 4DV5B 3KG2A 1FMD3 2Q8EA 1RUI3 4YHHO 5BNOC 1P8JA 5LA6B 2AYHA 1T6GC 3GHMA 2V73A 4DYLA 1W39A 4DRXB 5LBFA 4JC1A 5D5QA 3RZZA 5LK5A 4AEDB 2C0ZA 4UW3A 4HK9A 4P5YA 3AJZA 1CX1A 1GM9A 3WDWA 4FAHA 3ZN6B 1ZA7A 5JXIA 4LJHA 4MYEA 3E6DA 1QU0A 4RFT0 4RQPB 3EQEA 4MVUA 5DXDA 3ITQA 1UF2C 1LEMA 3ZKYA 3OMAB 2W0FC 5DZGA 2C2AA 3CYOA 1B35C 4QQOA 3WW2A 4MTXA 3LEMA 1DLCA 3CCEV 1LHUA 1RUJ3 2EF6A 2YGMA 1PHMA 3J8F3 3LIHA 3T1CA 1CVNA 1WGPA 2EINC 1Y9GA 3HVDA 3ZDVA 2WLMA 4MGIE 3USUA 1PM7A 1GK9A 2LS6A 2X0LA 1KJLA 2MPFA 4FSJA 3POFA 4EB6B 2IXIA 1XC6A 2QEXV 3GNEA 1OSGA 2EIMC 5B5EZ 1V70A 3RI8A 2YUEA 2HHHO 2ZABA 2QWPB 4NIDA 3CHXA 1QU7A 3TWIA 3OBRA 1L7LA 3W58A 1NR7A 4H7LA 2K9PA 4CDQA 2P90A 2LALA 4OHYA 1XMQB 4JI7B 1URXA 1TE1B 2CDYA 2K46A 4AVAA 4LF9B 3L71H 1FNYA 3M99B 2YBKA 2RMU3 5FLIA 2A3YA 2W46A 5TSWA 1KECA 1AJQA 3X29B 2C5DA 3PUIA 5FZFA 3KT1A 2HJIA 4CDXA 1KKDA 4IV3B 2F4VB 4O9EA 4FP3A 4KU8A 4BQ1A 1NOVA 3J80N 1K5JA 2UY8A 2A6VA 4GCZA 3T1HO 4HZ3A 5LZ6A 4PA7A 4BMBA 1EM1A 3BIEA 4O2AB 1FYUA 3T08A 1QNYA 1MQTB 1HRI3 3RG0A 4BWAA 4PELA 4F6RB 4H33A 3VDDA 2N7GA 4X9QA 3TYJA 5JZGA 2W52A 1BQ0A 3WP5A 4QKFA 4NHXA 5LATA 4HONA 4XFIA 5IJ0B 3VBHB 1Y76B 5IATA 1C8M3 3ZPYA 3SCGA 1G9DA 1JYIA 2KKWA 5BXZA 1NX9A 3ECQA 1MVEA 2KG7B 4Q4W2 4U7OA 1QVFU 4TXWA 1D7PM 1ODNA 3WHTA 4CXWA 4KNCA 3TXQA 1RM1B 4N9HA 3ZXEA 4PJYA 3E22A 5J2TB 5FREA 4GX0A 3ZKUA 5IW0A 1BKZA 4LF5B 4NXMB 4F83A 3B02A 4HG6B 5LA0A 4GKKB 2VE1A 4A5UB 1XNQB 3RYFB 2E9QA 2R70A 1VBA2 3WOGA 4KXRA 5DG1A 3BHPA 3VL9A 4P2ZA 4MV2A 1WPBA 1WBLA 1DZTA 1TGOA 4Y1YA 4Q0QA 3MLKA 1V55C 4A2UA 2OIEA 1SLIA 2WIIB 4OGQB
chains in the Genus database with same CATH topology
5JZGB 1EYBA 1U12A 4JDMA 1FXZA 1HRV2 2A70A 1G9CA 2WC2A 1C5HA 4Y26A 2GN7A 3IT8A 3MIFA 2QKDA 2JECA 2JG8A 5C9AC 3SMHA 2HEYF 1APNA 1NQJA 2QCSB 3POYA 2QQPA 1PGW1 1AXZA 5A33A 3PTYA 4OI2A 3S0MA 4AGRA 3N4MA 4CP0A 4COZA 3CJIA 2O8OA 4GH4A 5KHGA 5H9QA 1VBD1 3TN93 4AEKA 4Y1ZA 3JB8A 2BVBA 2NM1A 4FTBA 4Z92B 4E9KA 4AFDA 2IFWA 4HMZA 1J3RA 2WL1A 4I3PA 2WQ4A 4Q29A 4XJUA 1BEV1 2ET1A 2H6BA 1COV1 4K7JA 1SEFA 1Q56A 4M00A 3M1HA 5CG8A 4YVWA 4GIQA 2RE9A 2OYZA 2A3WA 3P3NA 4P5HA 4RHV2 1WLWA 4IV1C 4HSJA 3HMYA 4OLLA 1UN1A 5SV5A 1VBB1 3PMSA 2WFPA 3D6EA 1NYWA 1CAVA 2MNGA 5E89A 4NN0A 1REDA 1SBDA 4A3XA 5AC91 4JDNA 2UY9A 2GALA 3LA3A 3WD5A 2QNKA 4QX5A 4DFSA 4Q0VA 4LBJA 1FT9A 2CV6A 1LTEA 3O14A 2XJPA 3CO2A 4QU2A 2JG9B 2JG8C 3M3QA 4XF3A 5DDJ3 4B4PA 1NA1C 2ZGUA 1GLHA 4NWWA 2VOXA 1OA2A 1ND3C 1TMF1 2Q1ZB 1GZWA 1RUF2 3MF9A 3R4SA 1SLTA 3OCPA 2Y0OA 3VBOB 1Y3TA 1UKRA 2OUHA 4BHPA 1FV2A 5JIUA 5GM0A 1Q8SA 4SLIA 2YZ4A 3ZXLA 4M27A 3CLPA 5EV7A 3RDIA 2UWCA 2ZKLA 4EN9B 3OY8B 5IK5A 2ARBA 2MEV1 5CAZA 4GMP3 1HXS1 4QGLA 5CFCC 3MDPA 1ZZ9A 4M3CA 3QCWA 4JCKA 3O12A 3WUDA 4LR4A 1ZRRA 2DCYA 5D8AA 4K20A 4HSLA 1O5UA 5I8TA 1JR7A 2KA3A 1IS6A 2UWAA 1G7YA 4TSVA 5IUQA 2A75A 3RYKA 1TNFA 3I7DA 3KS7A 1QJY2 4FPYA 2YYOA 2YMZA 2AGSA 3B5LB 3R4UA 1OOPC 1W6MA 4FPLA 4R8HA 2DV9A 2VW2A 1OMIA 4MUVA 5GLTA 1HX6A 1H9PA 5FDBA 3E97A 1CX4A 1R083 1OS7A 4F7ZA 5J37A 2TEPA 2XL9A 2E6VA 1KD7A 4YG6A 2ZA9A 1SBFA 5D8AB 5FFOC 1SCRA 3WHUA 3H7YA 4LE3A 5J3UA 1RJ8A 3PJQA 1ZBA1 4BHFA 4P9JA 3W59A 2MEV3 4LLOA 1RUD1 1S2KA 2D6KA 2WNUC 2PLV1 4OULA 4LBMA 1C5IA 1R093 3MICA 3WUCA 4I01A 3ZXJA 3FUOA 5FLHA 1AJKA 5K8SA 2OZJA 4IEUA 4K40A 1PO23 4LO8A 4JGZA 1HV1A 5GZFA 5J48A 4M01A 1KS4A 5CFDC 4CDWB 1LHOA 2CYFA 1BK1A 4Q4V1 1PVXA 2D6MA 1W0PA 1PMIA 3WX5A 3OGJA 3M8LA 1OA4A 4FP2A 3S30A 1VBA3 1FATA 3LKJA 4YZ3A 2YROA 2MEV2 2GDFA 5IK7A 1RITA 1Z7S2 3VBHC 1JW6A 2HWC2 2XJSA 2WNVB 3D82A 3H3ZA 4O9GA 5GZDA 1RUG1 3ES4A 3ZVXA 1XYNA 1PGSA 4FTEA 4HPKA 4DXZA 4EROA 1LCLA 4MX3A 1NCQA 2D93A 3KCXA 1RUJ1 2CNAA 5F1RA 5C8CB 1QXPA 1YO8A 1MS1A 1S0GA 4IERA 2GNMA 4JTNA 1QF3A 2CAVA 4NHLA 4QGMA 1ZA4A 4JGZB 4YYOA 1HXS3 2DF7A 4IEYA 4LTAA 1IPKA 4RGGA 1OQDA 2RR12 1U5IA 4Z2WA 2TUNA 2HWB1 4XF1A 3QACA 5KXDA 3KB5A 2CWSA 4AQSA 1H1AA 1DGWA 4N43B 1BYHA 1DYKA 5L73A 1VZ4A 1HQWA 2JG9C 2E7AA 1OFSA 1CR7A 3GZAA 1V6NA 3EXUA 1KS5A 2EAAA 4K1ZA 1H8TB 2Q8OA 2R16A 1JYCA 2Z69A 4AFMA