2YC0A

Factor inhibiting hif-1 alpha in complex with r-2-hydroxyglutarate
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
349
structure length
349
Chain Sequence
b'MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
publication title The oncometabolite 2-hydroxyglutarate inhibits histone lysine demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 104
structure length 349
sequence length 349
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2011-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2yc0A02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2yc0A01
3KCXA 1MZFA 2WA4A 4JAAA 1H2NA 4QU2A 3P3NA 3D8CA 1IZ3A 4AI8A 4NR1A 1MZEA 2ILMA 2CGNA 1H2MA 3P3PA 2CGOA 1H2KA 2WA3A 4BIOA 2Y0IA 4Z1VA 2W0XA 1H2LA 5JWPA 2YC0A 3OD4A 2YDEA 4Z2WA 1YCIA 3KCYA 4B7KA 2XUMA 4B7EA
chains in the Genus database with same CATH superfamily
5BPXA 4I0WB 4NOTA 2GAUA 1MS1A 1P84F 4DRXA 2Q8EA 1GBGA 1YIPA 3J7NA 4Y4RA 4ZZ5A 1RUG2 3OPTA 3CIHA 2LRPA 3UO2A 2P67A 4PA9A 1Q8PA 1P7GA 4FVVA 3CJHA 1L7QA 2OPWA 3WOGA 2GN3A 4MO3M 5IFTA 5KHGA 2ZGPA 3ZSMA 1DFQA 2VU9A 4FM2A 2HP8A 1OLME 2VECA 3GYDA 1JYNA 1ND2C 3W7WA 5JVDA 5FYIA 2DJVA 3N9OA 1J1TA 1XXNA 3JBG1 3F5TA 3VBHB 1PO11 2ZPXA 1APNA 2JENA 2B4KA 1JR9A 2JJ2G 2FCUA 1D4VB 5B66Z 3ZDVA 2WAAA 1IS4A 1S0BA 2QQWA 4E4SA 4OYUA 2VQTA 5CBLA 1N0NA 4CCKA 1I9RA 2PAMA 1W8HA 1D7PM 4G3YC 3ACIA 4JRAA 4CCMA 2Q68A 1W3XA 1POV3 3QTCA 2QQLA 1OCOB 4BQ3A 2I74A 4AOCA 4O65A 2AH2A 3AZWA 3AZXA 1SPPB 4Y1ZA 3BTYA 4AEDA 2RR11 4CDUC 4YW5A 4P9IA 2BCCH 3NWKA 2IH1C 2FMLA 1OHFA 4WFAV 3JAKB 4O2BB 1V9U1 1FYJA 1AYN1 3GBWA 4UCOA 1W3VA 4P14A 3ZXEA 3ACFA 3ABKC 2XOKG 1W06A 4YW1A 3LSDA 4GA9A 4IIJB 2PQSA 4CU9A 2TUNA 5B4XA 5JJEB 5JLVA 4M01A 1CIWA 4ZBMA 5FREA 1N3OA 4DY5A 2EIDA 2BGOA 2LJ2A 2BU9A 1JBCA 4Q4Y3 1DQ1A 1M1KW 2Z79A 3FN9A 3I3MA 5FK7A 2JDKA 4NKGB 4QB6A 2P6HA 2F4VO 1HDKA 5DQ0A 1HNZB 4DXSA 4E4HA 3JCIA 4BQ2A 2QZ3A 3R6SA 1CQ9A 2PHDA 5B1NA 3ZXAC 3LEKA 4HFSA 1KECA 5C93A 2QR4A 2CHHA 3MV11 5I8TA 1Q3EA 5J2TA 2GNMA 3I2KA 5LOVA 3WHTA 3THPA 2H94A 1R6TA 4JHZA 1QQP3 3D0JA 5E89A 5LBBA 3W21A 1LR5A 3DSQA 3J7HA 4CDQC 4RFRB 1ULEA 2OCCC 2B8MA 3HOBA 5C8YB 2NNUA 2E76B 1YTFB 4JI5O 3AMPA 4JV5B 5LBQA 1CAVA 1NKGA 2WLLA 4TV8A 1W2AX 1HXS1 3RGBA 4B3NA 1XU2A 5JCOC 2VNGA 3J8F3 2YY1A 4DQAA 2AXTZ 4XAEA 2ORZA 1B35C 5J9PC 1X7NA 3D4KA 4WVMA 4LF6O 2ZGMA 3APOA 4QQHA 4ZPIA 4J9ZB 3DGTA 1Q56A 1FPN3 4LPLA 2RDCA 2RM22 3OUSA 4XCBA 1O4TA 1P49A 1NX9A 1XE7A 4IHJB 2JK5C 4F4LA 3ABMB 5EIBC 4QB2A 3KWVA 4N90A 4RGGA 4I50A 1QVGU 3FLTA 3FKSG 3NO8A 1UXXX 2Y34A 4CPBA 1H8TA 4CU7A 4NIDA 2IJJA 4IL7A 1LUVA 4YY3B 2QKAA 5CEHA 2BSKA 3O1VA 3NXSA 2DU0A 1QIQA 2XLGA 3OM3B 2EIGA 1HLCA 3RNSA 3M8LA 5LBEA 2VJXA 2NLRA 1IS3A 4Z2AA 1AJKA 4ARYA 3TEYA 1L1FA 2UYBA 2DVAA 5K8SA 3FBMA 4EZ4A 4LFCO 3DTUB 1XNTA 2V4AA 4QWNA 4CC5A 4KI5M 5FAXA 2VQEB 3WDYA 1YIJV 3ML0A 3U4SA 2P7TC 1FMD3 4NROA 4CZSA 2WT2A 4DXTA 4RHV1 3AP7A 1N36B 1PNLA 5KXEA 2RE9A 2OZ6A 4AWDA 4IEUA 3AKSA 3RWKX 4CDXB 2XLFA 1M56B 3O7OA 4XFCA 4XHXA 4LMFA 4UF0A 2JS3A 4YM3A 4QQ2A 4A6SA 1GICA 3WQ0A 1T6BX 2W6IG 5HPOA 2AZ5A 3CF6E 3VDDC 3G6EV 3VGIA 4B4PA 5F2WA 1OPMA 5C4WB 5A3MA 4MW8A 2EJRA 1PGW2 1FFXA 1SACA 1MZFA 2DUPA 2ZEXA 1VQ6V 4YVWB 2WLIA 1GN2A 1HQWA 1YQCA 2XJSA 1TQ5A 4MVZA 2PHFA 1WJZA 1Z0HA 3H7JA 1F4AA 5L36A 4JGZB 4EB6B 1GWMA 1M90W 1BEV1 3ICXA 3I3BA 1N8RW 2WLNA 4WF9V 4JTOA 5EWSA 2D97A 2FDKA 3VBRB 4LHLA 2E7QA 4NUBA 1SQ4A 2I07B 5LY1A 2XB6C 1LJ7A 3LA3A 2X09A 4L87A 1NG0A 1P8JA 1V54C 3WQBA 3JB8A 5J96B 2ZGRA 3H8UA 4NTXA 4F6RA 5HV0A 3ABLC 2YU2A 2YFZA 3GDBA 1FOD3 3OUFA 4HANA 2OXBA 1K5JA 1ASJ1 4YJ2B 2QQOA 1AX1A 1G8WA 1FS0G 1EV12 4RA0A 2CGPA 5EP9A 4IV3A 1OT5A 4J80A 2JB8A 4L92A 1RXGA 4OQ8A 4P9YA 1VQMV 3B8MA 1L3JA 1VIBA 3J9SA 4GB32 3LUTB 4DR6B 3K2OA 3DPRC 3WEZA 3FZ3A 4KMQA 3B01A 5D1IA 3ZKUA 2FYUH 1O9HA 3WFVA 4D0QA 1NKDA 4E4DX 3ZFFA 5IK5A 3OGSA 1LB2A 2YUEA 3CJIA 1PK6C 2Y69B 2P17A 1J1LA 3SH3A 2Y6HA 2VG9A 4UW6A 4RS5B 1W99A 4X6RB 4FLXA 1MVQA 3T3YA 4AAXA 1UMHA 4FAGA 1LUWA 2VZVA 4R9DA 3CMEV 1GO3F 1M93A 2IUWA 3S5AA 2VOTA 2K1EA 5IDJA 3VBSB 1YF2A 3H8XA 4OVEA 3MYXA 5FOBB 2QWPB 3HEIA 4XOGA 2WWWA 2LUWA 1PM9A 1ZTEA 4KNCA 4FQZA 3STZC 1A8MA 1YHQV 1MVEA 2XL9A 4XBNA 2BEOA 2Q5ZA 2A71A 1J3PA 1BJQA 3RZMA 4IV1A 4EWEA 4FBFA 2VQ0A 1Q81W 2FD8A 4NWVA 3A21A 4P08A 5B3SC 1S5JA 1W6OA 5LEKA 2VW1A 3ETPA 1NA1A 3HNMA 2JE9A 1S5LZ 2JG8B 1EN5A 2YIDA 2GSYA 5FKBA 4GJZA 4P30A 5LY2A 3ZN6A 1B3QA 4MUVA 2C6SA 4BOWA 4B3SO 1K5MA 4LBNA 1OLQA 1MMMA 5T5LA 1TE1B 3H50A 3T2MA 5FNVB 5EYPA 5FMOL 3MIHA 2LFRA 4EWAA 1PVC3 1Z5WA 2YXLA 4DXWA 4LWSB 2FKXA 3W59A 4LP8A 3IC7A 4RWUA 4ITCA 5JQGA 3KT7A 1SLIA 3ZHSA 5LRSA 4B29A 4Q4V3 2QDRA 1N33B 3VQXA 5A2QN 4DV3B 1X50A 4MLOA 3OPZA 4ZI7A 1A3KA 4W4KA 1GZTA 2ZE7A 4J1WA 3EHBB 3WDXA 3HQRA 4TWKA 4OXSA 1MS8A 4B3TO 2V5YA 3RYPA 1AR92 3BB6A 2V73A 1KU9A 4NRPA 3VKMA 1VP6A 3LSQA 1Y7BA 3I2FA 2RG4A 3H1HH 1JOBA 3EXAA 2JDAA 2NPIA 3JD4A 2VCCA 5A7NA 4E8CA 1RVF1 4IEQA 4QX3A 2GP5A 4UB6Z 4DRXB 4COWA 2FDJA 5KXCA 1SLLA 3OEBA 4OHVA 3CPWU 4TXWA 1QU7A 4CXWA 3CJHB 4RQEA 2QQJA 4LJHA 3VKOA 4QDRA 5IVJA 1E1QG 3PTYA 3ZFGA 1NT0A 2ZX2A 5JIUA 3HT2A 2ARXA 1SCSA 2XJRA 3LSEA 2WRAA 3RFRA 5KHKA 3CCMV 3G6JB 2K46A 2EALA 1YXBA 1TMF3 5DDJ3 3W7TA 2ZQMA 1XE8A 3N7LA 5A7SA 4DV0O 1BSMA 1G9DA 2ADDA 2NZ9A 4WM8A 3WDWA 1GR3A 4RYDA 1CAUA 3ELNA 3ZRWA 4JV4A 2VWJA 4XF9A 1POQA 3C7HA 4JKMA 2EINC 2X8KA 4U7OA 5FXVA 4HG6B 5HXVA 3QH7A 1IXBA 4AXOA 3EMRA 2VXRA 3LGRA 1C8M1 4Q6GA 1RUC2 4FPHA 2ATFA 4LF4B 1JPXA 4LA2A 2ZA9A 4CUBA 4G28B 1AR61 3VN4A 4NPMA 1PP9H 4AEKA 5FBJA 1NY72 3JB4C 4MGQA 2YEVB 1BKZA 3SPHA 2W0XA 4IEPA 4LITA 4CXXA 1YI7A 1N1TA 4IE0A 4OHXA 3D6EA 1PZ8A 4FCAA 3AG1B 4GWJA 1MQTC 1PMJX 1BQ0A 3J4UH 3D8CA 5AVPA 2DV9A 4KWJA 4QX2A 2P3JA 5A7QA 2RS32 4LFAO 5JOYA 3URFA 3AK2A 2FDGA 5GZEA 4U7NA 5G05L 1ZZCA 1JZ7A 1ZRRA 2ZBJA 5EHDA 5LP6B 3C3VA 2W1WA 2E7TA 4YM1A 5C6CA 3MPPG 1VQ7V 3W58A 4G2KA 4LF7B 3B3QE 5ERLA 4CTEA 5LYJA 5LGNA 1ZZBA 4FPPA 5CVRA 3G67A 4MVMA 2VZ3A 1K5QA 5L3GA 2O8OA 1TA8A 3D82A 4FFHA 2LO1A 4YZ2A 3VBOA 1C3HA 4I0AA 5EJZB 5B1AB 4FFGA 2VCAA 3JD3A 1IHMA 1TZOA 1DQ6A 1DHKB 1LHVA 2NN8A 4FSJA 5BNOB 3NV4A 2WFPA 3ZXDA 1W8ZA 2AEZA 2WFF3 3RRDA 1CD3G 1JYVA 3JD0A 4PA6A 4D3WA 1VBC3 2VD7A 1V0AA 3OD4A 2QTWB 4PA3A 5GONA 3VZOA 2WLLB 5FY1A 4NXMB 2RJKA 2ZAHA 4MGKE 1W6PB 4CEYB 3NV3A 2OS2A 1LGCA 4JDMA 4NIAA 3CKHA 3E2EA 1D5AA 2D5HA 4LLOA 4QKBA 1ZUQA 3POIA 3M99B 4ZKIA 1H30A 1COV3 5H9RA 4DV1B 3LCPA 3LNMB 3CSXA 3EHKA 2XOMA 2NYYA 4PA7A 4V2VA 2BP6A 2EULA 2XHNA 4B1MA 2XAGA 3KCCA 2GZWA 4DMIA 2ZINA 1HRV2 2JVDA 2F23A 2P90A 5CA0B 1NXMA 3BYWA 5IVYA 2XKOA 2CDPA 4DR3B 2XVGA 2F6BA 4ZXEA 1H8VA 5BNQA 1OD5A 1GWKA 1UD1A 1OFSA 5KHJA 2Y33A 5C33A 3OMNB 2PTMA 1VQOV 4QPGC 1D0HA 2WN3A 1G1XB 2E26A 2BSKB 2J1TA 3F2ZA 3D36A 4GZRB 1R1A1 1SMVA 3JAMN 1QHTA 1WCKA 4PV1B 2VQFB 5ACA1 4MGIE 1QH6A 3HKCA 5DEDA 3ETQA 3TEXA 2IBZH 1RUG3 3ZRXA 1C5HA 1BK0A 5LMUO 4JTCB 3M4FA 5KAFZ 2H6BA 3O65A 4YHHO 3RWRD 2R9RB 1H38A 3BUCA 1Y74A 1C28A 1K42A 3WNPA 2BOIA 3I97A 5CG9A 1VF7A 2VBDA 3UNPA 3O0VA 1ZYBA 1NCRC 5E6HA 1FD9A 5LW9A 1AP5A 1KJLA 5LGUA 2JD4A 1WAZA 1VF6A 4LFBO 1OXCA 3T1MA 4QJFB 1S0EA 4UF0B 4LR4A 4IYHA 3VBFA 1OURA 5LA0A 2XVLA 2XHBA 2GH8A 1MS4A 4XPVA 3B00A 1CJDA 4XJZA 4P9LA 2A3WA 1YO8A 4X66O 2VZSA 5FXWA 2DCZA 5FY9A 4LBJA 3GHNA 3N7JA 5T5JA 4GWNA 3ZXGA 4AHZA 1W6MA 3B8NA 5A3LA 2FZ2A 1M57B 4GH4C 2Y48A 2XJUA 1RUF1 4IW3A 2BWCA 5HCAA 2D2CB 4HOOA 4MXWA 1Z5VA 4NJ4A 4UFIA 1RUD1 3PTRB 5D5PA 5IJ9A 3NAPB 3E22B 2OUJA 3LFMA 4NIGA 2IM9A 1T5EA 1VBD2 4UOJA 3IKWA 4NRQA 4GWIA 1SQVH 4COUA 3CMAV 4M0HA 3VZKA 3R66A 2VUCA 3BA8A 4CCCA 3VKLA 3IAPA 1JODA 1RUE1 2WABA 3FHQA 4YJ3A 3ILNA 5F3CA 1LTEA 2BPA2 4ASKA 1U5XA 4CPBD 4IV3B 4LBOA 1D5NA 4A5UB 5FMDA 3LOIA 4HVRA 4DV2O 3VBHC 1O3SA 5LGTA 2EXIA 3J80N 2X7RB 4AQTA 4JI8O 3UM7A 3ZIXA 2R70A 2CU5A 1YDXA 2BFUL 1N1SA 4WZFA 2YS8A 2XASA 2KD7A 1R3KC 5J2UB 1TUEB 4BW9A 4CCNA 1OQ1A 1XDCA 2LGWA 3PVEA 3LDKA 1GZWB 2Q6AA 2ZR2A 3HKDA 1IZ3A 4DUYB 2CGNA 3LD8A 2I45A 4AVBA 4EN9B 4FAHA 1M4WA 1G6NA 2ETNA 2QE7G 4LO6B 2ITDC 3WG1A 4XDJA 3FYIB 4RHV2 4HN0A 1W0PA 4IETA 1B06A 2LS6A 1EPWA 3BEHA 2YG0A 2HWE2 3USUA 4O9GA 2FL4A 2JKXA 3WG7B 3KV9A 2UUAO 3BVOA 5I91A 1R092 4FM1A 3ZHQA 3DGEA 3CDZB 1FAFA 4K20A 1TVGA 1Y9GA 1KFUL 5FIXA 1I94B 1HRI2 1LEMA 1XBLA 1W6OB 1QEXA 4UVBA 4Q1RA 4JZ2A 2WSUA 4CH4A 1NA1B 4XUNA 3TNPB 2QWQB 5CKNA 1W90A 1NAEA 2RM23 4JGYC 3LSUA 1AF9A 5H9SA 4R50A 4CUCA 3KZ4C 2Y4UA 4LF9B 4IEYA 5C3SA 1AP6A 4DR2O 1CGPA 3OT7A 3RYIB 2VNVA 2IW5A 3POSA 3KGZA 1WCUA 3CZJA 2BJSA 5EYPB 4XUQA 2IJHA 1IS5A 5FO8B 2RMU2 1NH2D 1URFA 5F1RA 2CAUA 4QNHB 5EV7A 3S30A 1SLAA 4WBNB 1AVMA 2UU9B 4FOWA 3POJA 2Q7EA 4GMP1 1LOFA 4X65B 2R0HA 3IM0A 3A23A 5IYYA 2WZPP 1LU1A 3Q8FA 1WCSA 2C26A 3RZJA 2PZSA 3D5OA 2E51A 4XF3A 1SBDA 3DEMA 1OA4A 1W2UA 5B2GB 1PD3A 4KQ7A 3WY6A 2ZDIA 4X89A 4FLVA 3RS6A 1R3JC 5IAVA 3HPLC 4FLYA 1IQDC 3BHPA 4LULA 4PI0A 4TV9B 2JB4A 4NB5A 4BK5A 3NV2A 1RJ8A 5IYZB 3MDSA 1EYBA 2JX9A 1W05A 3HR9A 5FZ4A 2VCBA 5I0UA 3BA9A 1K73W 2J42A 3AL6A 2E75B 1XRUA 4CEWA 3TXSA 2WIIB 2E31A 3H42B 3SPIA 3IC9A 2W91A 2UUBO 3FX3A 2R072 2XTAA 1XYNA 2OA2A 4QT6A 4BYYA 1KBHA 2VE1A 5JOZA 4TZDA 1KP3A 3BFRA 4Q4X1 2A3XA 3OPWA 4EKWA 1DDLA 2RDNA 5CYYA 2YIBA 4K1YA 2E53A 5A6ZA 1NQTA 2ZOEB 4DFSA 2OIIA 4YW4A 3NKTA 3QBQA 3T1CA 3VZMA 1VQLV 1SA0B 2R061 2Y60A 2EVXA 3JALB 3ZN0A 1NS1A 1PK6A 3TAYA 1SF9A 1FFTB 2A3YA 1BHAA 1KQSU 2Q8CA 1I5YA 4LIVA 5JOWA 5A70A 4QXKA 2QTOA 2VMDA 2D3PA 3N36A 2XAQA 1IBLB 4O4LA 1EV13 1UWWA 1NQJA 3I2OA 3T2TA 1X33A 2YICA 1LULA 4P2ZA 1JZ5A 4RUEA 5DN6G 3THTA 1WLWA 1E5IA 2ARCA 4CDXC 4GB33 3CEIA 1Q8QA 3AK0A 4WM7B 3U0ZA 3M3EA 4COYA 2DVGA 1XL6A 3MLKA 4MZUA 2N05A 4EN6B 1CPMA 3VBUB 1YCIA 1O91A 2LM3A 3KD4A 4CDWB 1I5PA 3WDUA 1HW7A 5C4WC 1CX1A 4FPLA 4YARA 4MVRA 1FXVA 5H9CA 3Q4HA 3G4SV 1UY1A 4ZONA 1REDA 1PNKA 1XOUA 2ZZQA 4YVWC 2RMKB 2JG9C 1ZNPA 1S0CA 1UOBA 3C7OA 1VQNV 1F2NA 1QVFU 4JGZC 1W39A 2UXCB 1RUH1 5JR7B 1BQZA 3ATGA 2VUAA 3VBRC 4X1IB 2VMEA 5LMNB 2GBOA 4AFDA 2EZOA 3HPNA 4BE3A 3MAQA 2DFCA 4OI2A 2MK3A 4MTFA 4FTBA 1ENSA 4L9BA 1BHGA 4AZZA 4YLZA 2GMEA 2ZXQA 3WNMA 4GWMA 2ZNIA 3NNFA 1NTKH 4XF0A 3FL7A 5T3NA 1SHWB 4PIXA 3E6BA 1YJKA 4ASLA 4YIOA 1S4CA 1YQ6A 2QQUA 3HBKA 3TBDA 1UYXA 2UWCA 4A2UA 1GKFA 5F7UA 2A1XA 4PDWB 4DY3A 5CFDC 1VQ4V 2UXDO 4IYIA 5GONB 2BBVA 4EN7B 1MG1A 4CP2A 3T2QA 4Y1VA 1NU1H 4Z1MG 5FOJB 4OHZA 2CUGA 1DF5A 4ORFA 2Q8DA 1YWKA 5LASA 2BTVC 5J37A 3OTOB 5BNPB 4M0NA 2Y69C 1HN0A 1Q6UA 3ZR5A 2H0BA 4LQRA 3P5BA 3H3ZA 3RI9A 2YUAA 5FZAA 3E86A 4GX0A 1PM7A 2NQYA 3NJXA 4NO4A 3APQA 2L35A 1X9TA 5EBWC 4UV9A 1NE4A 4Q4W2 3N9NA 4NTWA 2WNUB 4B8EA 4JVAA 5IYBO 2DYSB 1AR62 1D4M2 2C24A 3ZIWA 3S5QA 3VBSC 3D3QA 3U11A 2GNTA 2Q5TA 1NYWA 1AR93 2EILB 4SLIA 4ZY9A 4H37A 3N2KA 2DYRC 1X82A 1W0JG 3NQHA 2O1QA 1LHNA 4BW5A 4KP4A 3UJQA 2HG5C 4BCUA 5C7GA 4O7XA 3H1MA 3GALA 3K0GA 4N7IA 1VBB2 1OCRB 5CBHA 4ZOLA 3ZHUA 2XVKA 4YZ1A 2BGPA 1PMIA 2VVEA 2D6KA 4B3RB 4Y22A 4X8NA 2XWJB 2ARAA 3I4IA 1XOYA 1IKPA 3I2JA 4MX3A 4DR7B 2JG8C 2BYVE 2N04A 2XT9A 1YFXA 3PJYA 1XHXA 3L9JT 5H9QA 3SHRA 2N7GA 2YPJA 4AHCA 1Y9QA 2ZHLA 4Q29A 3ZPYA 1HV1A 2QDOA 1ZAUA 5F32A 3PL0A 1Q90D 5FY4A 4NWWA 1JYWA 4YG6A 2ODMA 3N9LA 3AG4B 4X64B 3IT8A 1Q8OA 5FO9B 3Q9OA 3A22A 4LTAA 3RQ0A 1NT2B 1ULPA 5LZ6A 3WB1A 3CC4V 1DYKA 3S6PA 3BRCA 1XQNA 3U07A 5EJ3A 2HWD2 2Y6LA 1SC5B 3SEPA 5GJ6A 1KKDA 3KSCA 3T4VA 3ZXKA 2R041 3VBFB 1QXJA 2YBSA 3CYOA 1RHI2 3K5LA 4N9IA 2UUCB 3TXQA 1K3EA 4LLFA 5L3CA 1EP0A 4J11A 4LR3A 3RG0A 4X20A 4FOVA 3CHXA 3K79A 2C9KA 1RUC3 3DECA 3OFNG 1SZBA 5IJ0B 4RGAA 5FZ0A 5JDBA 1E5HA 3NR7A 1XNQB 5FZ8A 3E97A 2PHUA 5C8CB 1IPKA 1YJ9V 2VZUA 1CAWA 2H0VA 5F3EA 3THDA 4COZA 2HR3A 1L8DA 4YVSB 3M70A 2IU0A 1VARA 2ZHMA 4C1XA 3KF3A 5FYHA 1JMKC 1LHOA 4YJ3B 2E7AA 4CC6A 3FUOA 1NLRA 2RS33 2WQ4A 5FZHA 2PLV1 4XZPA 2H3OA 2P3IA 3RW0A 4CP9A 4P02B 3WP3A 4QQPA 3B02A 4QXBA 2IXCA 3LQCA 3OGIB 2X5IA 1CAXB 4DR1O 1QH7A 4YWAA 1UU6A 5FZIA 3UK9A 3WB0A 1KGYA 1ALYA 1DYOA 4AVVA 3GZUC 5LBCA 1NLQA 1XNBA 3E83A 3IFXA 5ITZA 1NCQB 1WA6X 2EIMB 4K8FA 2WS91 2PAKA 5EYYA 4WFHA 1JUIA 1FXZA 3E8FA 4DK1A 5DUUA 2EBOA 1PNFA 2BNMA 1C57A 5FZKA 4AEDC 3AL5A 1AYM2 2HLEA 5JH7A 5J36A 1RMU1 3K06A 1MS5A 4OMCA 1ZA4A 1LENA 1VR3A 2EICA 1MEC1 5K4LA 2XL7A 1AR82 1WZXA 3KV4A 3DUIA 3I3EA 2OYQA 3AZYA 1W2OA 4U3JA 3HNYM 1MA1A 2JDNA 4M4PA 3AG1C 5K7PA 4HNAA 1LCLA 4HKLA 4SBVA 1LOGA 3T1HB 1WD3A 4IE7A 5A1FA 3QNEA 4S2DA 2OQ6A 4TQFA 4W4ZA 4AQSA 4LNUA 3EJKA 2JEXA 4QDQA 1S2EA 4J7KA 1DIWA 3ZN4A 2R72A 1HRV3 1X4TA 4CS2A 2WJSA 5LP6C 1B04A 1RUF2 4IT5A 1OLRA 2O8QA 5LXTB 1H8HG 2E32A 3AP6A 1SS3A 4Q2FA 2CGOA 3ZN5A 4AGVA 4AVAA 3POFA 1VQPV 4PLOA 4LBQD 2PYJA 2QCSB 3MF6A 3KG2A 1FXKB 3SLIA 1DGWA 2AGSA 3RN4A 1QU0A 3VBBA 2IXLA 2C1FA 2XUEA 4RD7A 1D2SA 5FZMA 4A6OA 1BBT2 1L7LA 2ZTNA 5EQUA 4KBZA 4HYOA 3UL2A 2WNOA 4R7CA 2LFSA 2BE3A 1J84A 4PQ9A 1POV1 2WNVB 4GH4A 4FFKA 1UYYA 2WLMA 4D6RA 2GN7A 2ZGSA 3GM8A 1HIXA 1RUI2 4UW5A 5LA9A 3BCCH 5SV5A 1N34O 4DUVA 5IYCO 2P06A 1JUHA 1GM7A 3CD6V 3SYOA 2DCYA 2XAFA 3OE7G 4QIWF 5FLXN 2G1MA 1UW8A 1IX9A 4JI5B 2GNDA 1SQPH 4BQYA 3TN92 2QQVA 1PZ7A 3JSLA 2RQ6A 5EIBD 4GZ9A 5JR2A 2WWUA 5A32A 5GLZA 4N53B 5GLUA 2HWC2 1MS9A 4DUZB 1RL3A 4Q4Y1 2VAUA 5L7OB 2ETEA 1H8TC 5LA2A 2AGAA 1JA8A 1P7BA 4KUMA 3VBHA 3GWOA 1OBNA 1AR72 3WW4A 4Q27A 3MW4A 4HONA 4HXCA 3TNQA 4DR4O 3EVKA 4IUGA 4FJCC 1JVMA 1OCZC 2P37A 4Y3OA 4L0PA 1YI2V 4UFZA 3NJYA 1GQHA 3ALQA 1VBD3 3DKQA 1SFNA 2VOWA 2J1SA 3VB9A 3O5SA 4BQXA 3TRSB 3RYFA 2QKDA 5LEJA 4FLTA 2FZ1A 2KM2A 4PBOA 1HNZO 3L75H 2V4DA 3OB8A 1H2NA 1SPPA 4C0BA 1DQ0A 1J59A 1M5IA 4LHSA 3D3IA 3IAQA 5H2FZ 4ZKTB 4XFBA 1QQP1 1T2XA 4F83A 5CKQA 2DWDC 5FZDA 1CZVA 3JAKA 4O2BA 2GC1A 4EQVA 3G6BA 4LKSA 4Q20A 1GQGA 1XE0A 3M3QA 1THZA 2YIAA 4BZ4A 3ZMOA 2WO1A 5CBGA 4BK4A 1ZL8A 2NP0A 1H4HA 4ABMA 1XUQA 5CBFA 3P30A 3J8F1 3THOA 2RV9A 4YGEA 1N0JA 1SCRA 1DGWX 4YM2A 4AHXA 1B6QA 4CCJA 4Q1PA 3IWZA 3WCSA 1RIRA 2RHPA 4JDOA 3L2YA 3NW4A 2HVKC 4JV5O 4E4ZA 2WQZC 1M57C 2JS5A 2YYOA 4BISA 1NH2B 5CA1A 2J1EA 1SETA 2XR4A 4AW7A 1EUTA 4LBMA 2VC9A 4DB5A 1WD4A 2C9AA 3JASA 2P22C 3NAPC 4R4XA 2DWEC 4FPCA 4Y33A 4RHV3 4AILC 3T09A 5KC6A 2EZPA 4NRMA 3ZFEB 2ZMKA 1NI8A 3FFQA 3I59B 4H33A 3UKTA 4AG4A 2P5BA 3FFZA 1IPJA 1U5ZA 3DYPA 4W6YA 2A6ZA 4DR5B 1HRI3 3U1XA 3WSOA 2WYSA 3ZIAG 3DYMA 1QJEA 5I0RA 2CTVA 4JYAO 1G86A 2IXHA 3NL1A 2W2IA 5BXXA 3WNNA 3SYAA 2W94A 4IV3C 2V5DA 3QG5A 1VQ5V 1VLNA 4YY3O 4UCTA 1RPOA 1SG3A 5LHIA 1UX7A 5L9VA 3GCWA 1K9MW 1RC6A 3CNAA 1VRBA 1W9SA 1HB1A 1FMD1 2JE8A 2VZRA 1S0FA 2R062 2RMU3 3ZFFC 4XDKA 3CJIC 4JTDB 2BRTA 5J1XA 3ZYIB 1K7DA 3IBMA 3N3HA 3MUZ1 2Y6GA 3POEA 5DM6V 4XJAA 4DUWA 4UW3A 4X9QA 3VUOA 2VQEO 2ORXA 2RNBA 1YFUA 4WFFA 2WLQA 3LA2A 1YQ8A 4IHJA 1JU4A 4PHZA 4CVUA 3DXRB 4QE7A 3VZLA 2WKKA 4XC9A 2VTFA 3RI8A 1N36O 1OJHA 1KDMA 3UT5B 3AYDA 4CP1A 3HJRA 2PHXA 1QLEB 3N2KB 4G4FA 3UESA 2A3QA 3WG7C 2XNDG 3TK1A 3K5MA 1RUJ2 2DVDA 1UJWB 3S7EA 4IV1C 5IWFA 4ZOLB 3GBGA 4QE9A 3BABA 1Z2GA 5JIAA 2CAVA 1JJ2U 4S2HA 3AXDA 1R081 3UGHA 1RTVA 1NA1C 2KG7A 2D3SA 4ZZ8A 2Z2SB 2Q67A 4K6BA 2B7YA 2RJ2A 5KR7A 5FUIA 5KXBA 1DK1A 4PELA 4YGDA 3ZMUA 4JDNA 2R073 3LDCA 1K5MC 2X29A 3JD2A 4B1LA 4DRVA 4OPHA 2QKCA 5LK7B 3PDQA 4EFEA 4WFEA 1WMDA 3KV5A 1F23A 3ZYJB 2EJ7A 3OGVA 3BGAA 2D6OX 3KHBA 3PVOA 3A0BZ 3X2QB 2P34A 3UQ8A 5C5TA 3BPZA 3IN9A 1WCDJ 2YI8A 5FPXA 3ES4A 4CRQA 1G6UA 1PM4A 4Q8KA 2QGNA 2LP7A 4OULA 4X20B 1E57A 3HVDA 1UZZA 1TMF2 1WB7A 1RSOB 4EB6A 4XFHA 4Y1XA 2DQ3A 4QMAA 1SKVA 5IVCA 2WO7A 4H7LA 2DDUA 2ZS6B 2XBO2 4GCZA 3ZR6A 4OFGA 4UVCA 3BPSA 1AR5A 2JGUA 1CAWB 3M7MX 1N32B 1REFA 1UKGA 4H3WA 3CCRV 2YROA 1CEZA 3T08A 4ES9A 1AX0A 3K3OA 2VNOA 1W0KG 2VW2A 3JXSA 3ZFGC 1F7YA 3OTFA 2HBUA 2EIBA 3W20A 3K48A 3U75A 1J95A 4UAPA 3HT1A 4CP9B 3CC7V 4GMP0 1EPZA 1QLNA 2X5IB 2GTSA 1O4YA 3QH6A 3LDRA 5GALA 1WMXA 2UXXA 5FPOA 5LWBA 3NMBA 1SQXH 1YNAA 1DZTA 1SFYA 5IY5C 4IXLA 4AEJA 1RITA 3LFIA 1YQ2A 4E27A 4JASA 3T4DA 2B39A 1W6QA 5ITZB 1ZLZA 4JTNA 4RS5A 1XILA 3C3TA 4DV0B 4X1KA 1PVC1 1OD3A 3WU2Z 2FB5A 4MTOA 5FYZA 2Q7HA 4ZU5A 1W0NA 1Q8VA 1H0BA 4Q4V1 3K51A 4I02A 1AUYA 4E2LA 4JHTA 5JH7B 4DV4B 3VBSA 4CCDA 3JAWB 3ZO0B 1E5RA 1GSLA 3AMQA 3USSA 5DABA 1JYXA 5KUMA 4D6TH 1HX6A 1SEFA 2ZCEA 5FJKA 1WA8B 1CVNA 1BYHA 3TCUA 3VBUC 3NVCA 3ZM8A 4DYLA 2VNRA 3CL1A 4HNAB 2PI4A 1N33O 4CDWC 1H2KA 1R1BA 4DV3O 4GX2A 5FL7G 3V64A 1DLLA 2UY9A 4QKNA 3BOPA 1SRYA 1JQ0A 1UY4A 1XJAA 2BNNA 1BMV2 1W03A 4Y20B 4NVPA 3RYHB 4Q4W3 1BXHA 3JD1A 4WCEV 1LRHA 1AR63 1D4M3 4XW3A 2Y0OA 5JPNB 2JDMA 3CRQA 4FXGB 4JF3A 3WP6A 4DK0A 5FNVA 2TNFA 2FMDA 2JICA 2DCKA 5DDJ1 1VPHA 1Q82W 2Y0IA 2ZEZA 1ZX5A 5K0UB 5C9AA 3H1WA 1VBB3 3DC5A 5T5OA 3JD71 1HB4A 2JDIG 3WD5A 1I0HA 2HHHB 4D94A 2VO5A 1NR1A 2QKSA 1YITV 2QWNB 2PLV2 4YIPA 5FPBA 2VTXJ 4A7YA 1F4HA 5FPZA 4C91A 3F95A 3P3NA 3H01A 3K5NA 1OC1A 4B4QA 2JDHA 1PV0A 4UCVA 1CR7A 2P1BA 1O59A 4AI9A 1CESA 2GDSA 3T1YB 3BODA 5F8PA 1GOHA 1KD1W 4LO5B 2BUKA 2ZM6B 1LNSA 3WUDA 1ACCA 2DW4A 1JW6A 4N21A 1EAH2 1VP7A 3JARA 1K4CC 2QWRB 1QJU2 5F5CA 4COVA 1GLHA 2BWAA 4ICGA 2HWD3 4Y24A 4XTMA 1ENRA 1KQRA 1H2LA 2B1GA 4OI4A 2A9HA 1RHI3 2WSSG 1RYYA 4LF4O 1KKCA 3CMGA 4HVQA 2CL2A 2ITCC 2DYSC 3BY6A 4OX9O 3ZDSA 2XQXA 1UFIA 4K0KB 2QM7A 5E16A 5A32B 1BT8A 4J42A 2EILC 4KG8A 4YM0A 2PI5A 1RINA 3VD7A 4P9GA 3E8GA 1QCEA 3MIFA 1X8EA 1J3QA 3VQVA 4N8MA 3HR0A 1US2A 2GU9A 3D36C 3OY8B 4X6QB 1WCQA 1R3LC 3KQ4B 1BK1A 1TVKB 3I55V 3CCSV 4CDUB 5IFPA 3LB9A 1CWPA 3EQEA 2Q0OC 4DV6B 4P9WA 1HNWB 4C1WA 2VZOA 5B4NA 3LEIA 1XQ8A 3BCWA 3GVMA 1UYPA 3RYFB 4UW4A 1GKBA 4C0HA 1UL9A 3IAYA 3M1HA 1KC8W 4WVWA 3MW2A 3DCQA 4CCOA 1ZWIC 4FXKB 4LCUC 4BWAA 4MVQA 3OR6C 4ZS3A 2BOJA 3SYCA 4LF7O 4MGTA 2HJDA 4ISRA 2YEVA 4JI3O 2YGLA 2WFF1 1VF6C 1VBC1 4LBKA 4ZU4A 3ZYHA 5CZKA 1DGRA 1U12A 4JI4B 1U96A 1YZBA 1ZL8B 1PGSA 1R1A3 2QNKA 3WNKA 3VBFC 3AKRA 3ETGA 1RP3B 3L72H 4AI8A 5KX5B 4YG3A 3AVSA 4JGSA 4XAAA 3RVHA 2VMCA 3RZGA 2R30A 3AP5A 1JZ2A 4KXRA 4G27B 2OTJV 1VRH2 3UV9A 4DO0A 1LR1A 3KCXA 2PUSA 1COV1 4M3CA 4I30A 1Y67A 4EROA 1AR4A 2XHKA 1L0NH 4OPAA 3BTZA 4NXMO 3LKJA 5CA1B 4JI1O 5LP6A 1AYM3 3N7KA 3UETA 3LOBA 4RQFA 3JASB 2E33A 5BNNA 1BS3A 5FZBA 1UO9A 4MSVA 3JCUZ 1UU5A 2G38A 3JATB 1ZA7A 4BM8A 2OCCB 1AR83 1F31A 2CE4A 3GGLA 2F43G 4YVSC 2Q9LA 3O0XA 3OG2A 3F7VC 4X1YB 2D3RA 1JX9A 5ABJB 3KMHA 4HK8A 2ZEWA 4GLXA 1FNYA 5BXZA 2VL4A 1PX4A 1AL21 1LU2A 1WGPA 4DR3O 2ZGOA 5BNOA 1B35B 5F3GA 1HV0A 3I5DA 1RUG1 4U3FH 2PN5A 1HQNA 1H4GA 2FTKA 1RUF3 2HEPA 3C3SA 4CBCA 2NMOA 3GXUA 1W6PA 4CEYA 4ZHQB 1G9AA 3KVAA 3UJOA 2VQFO 3P6BA 3FLPA 4OLLA 1OV9A 4V1PA 2RN9A 3BOWA 3W5MA 4D6QA 5DAVA 4B3MB 2RS52 5AC92 5A3OA 4P9PA 4YXWG 5DZFA 3N4MA 4AHYA 1Y4WA 2EAKA 4HKOA 4K3UA 4CP0A 1RUE3 4YSFA 2PHRA 3VZNA 3M2MA 1QOOA 2FCVA 5CA0A 1BBT3 3JYCA 1UMIA 2YXHA 1QNYA 3P1IA 3O1MA 4XQDA 2CK3G 1W8UA 1AJNA 1Y43B 1NLSA 4HL0A 3OAAG 1RUI3 4URTA 1VQ9V 3WG2A 1FT9A 2JXAA 1XI1A 3PIJA 3ZYPA 1SDWA 4EYUA 1PX3A 5HFLA 3K75B 3J7AU 1NR7A 1QKQA 3FAVB 1TNRA 1MPXA 3X29B 4LK6A 3TN93 1B09A 5CB7A 4YW3A 2KG7B 5D21A 4O61A 4XCAA 1YFWA 1I1EA 4MVUA 2G9ZA 1IDSA 4LORA 4K8ZA 4Q0QA 3SYQA 1QMJA 2HWC3 4MW3A 3H1LH 2C2AA 3MV01 2VULA 5FPAA 2XWBB 3ABTA 1EZJA 1AR73 4NN0A 3E5XA 2WLKA 3TETA 4Y26A 3S3WA 2HEVF 4CCLA 1MS0A 5FP7A 4AQYB 1H6XA 4LOTA 5FPVA 5F2SA 4DEQA 4J25A 4DR2B 3R4UA 3QF7A 4TT3G 4UFKA 1I5ZA 1LOFC 3Q8CA 2IH3C 4XUPA 1YTFD 1OA2A 1ZZ8A 2ADQB 1NTZH 2OQ7A 3Q8BA 3C8XA 2QM8A 1QJY2 5FYMA 4MV2A 1W8TA 3ZXJA 2VXJA 5FP9A 2ZXWB 1EN6A 2OZJA 2ZDIC 3A8TA 1OHHG 3CLPA 2CTQA 1AJQA 4JTAB 3NAPA 3E22A 1H8EG 1SZTA 5FFOC 2LROA 4QX7A 2VMGA 1V6MA 5JZGB 1GUIA 3POGA 3N35A 4A3ZA 2J1RA 2PHTA 4DUYO 4LF5O 3OEHG 4LF8O 4IERA 3LDBA 4Y4YA 2W1QA 1XSRA 3B93A 4CEWC 1GU3A 1W9TA 1IBMO 4GMP3 2UWAA 2RDQA 5CB4A 2BGCA 3AFGA 4GKKB 2JD9A 3N7MA 4JAUA 2DBNA 2ZGLA 4N53C 3AKPA 4GYCB 4O9EA 1LOBA 4XDPA 2M7WA 4TOIA 2GTAA 1Q6IA 3VL8A 4NMIA 2RM21 2Z42A 5AG2A 4I3PA 5LB6A 4FLUA 2HWF1 3IDAA 5IK4A 4M4RA 5L3EA 1XB9A 3PHMA 2X53S 1OH3A 2LALA 4IGPA 1HKDA 2ARHA 4K21A 4Z92B 1POV0 3NKGA 2BOCC 3DXTA 4EWDA 5FWEA 1W6QB 5J2UA 1XYOA 4NPRA 4XBLA 2RS12 4P00B 1GZWA 4X1KB 5J3UA 1HB2A 5FP4A 4LF9O 2GV9A 4L99A 1PIV2 5D8AA 3CC2V 5JMCA 2YXSA 4XEZA 2TBVA 3WCRA 1ZVFA 4BU2A 3DYOA 2F66C 4XE9A 4LHKA 1Y76A 4HLTA 3SISA 3M3CA 3WZ1A 1OOPA 4UFJA 2V72A 4E4EA 2CWSA 4GT1A 5BR8B 2X0LA 2WA3A 2KA3A 1FKAO 1AJOA 1HNXB 4BXFA 2UU9O 5JAXA 2IWGB 5KHIA 2R063 2ZX0A 1VBE2 4CA9A 4NXNB 4HZ3A 2PHLA 4MTXA 1SQBH 3MHHC 4FTEA 2A6YA 2D44A 5JXGA 3CXHF 3ASIA 2ZX4A 4HPKA 4LH7A 1X8MA 4UUJC 3KF5A 3EYPA 2CWMA 2WC2A 1UN1A 2DMXA 3WNLA 1IPSA 4H7MA 3PUHA 4OGQB 1K97A 3RYIA 5B5EZ 5A9GA 2JDUA 2GH2A 4B7KA 1QJX1 1PGW1 1Z7S2 3B94A 3ZFEC 3K4DA 4DIQA 1UX6A 2QSAA 2BZDA 4AYUA 3PUAA 4HMZA 5FRAA 3OW2U 1MR5A 1RUJ3 1S0JA 3AG3C 4AQ6A 1CZSA 5C9AB 3ILRA 1HB3A 2JWPA 4FMTA 5IVBA 4WBNA 2E6VA 1CP9A 4DV7B 1H1AA 3TB0A 2ZABA 1NVPB 2DURA 1OQDA 5KBFA 4XJ8A 5FMCA 5ANQA 1JN2P 4L97A 4HN1A 2PYLA 3I54A 3ASOC 2A79B 5CU1A 3U78A 2F1MA 3FHIB 4JYBA 4I2OA 1ORQC 3S7IA 5JOXA 2MEV2 3ZSEA 3AX4A 1EV11 4P5HA 4LHNA 3FUQA 3M7AA 1DCSA 1SLTA 5KA5A 3SQOA 3SPGA 3JARB 4TV9A 3VHPA 4GB31 1D0GA 2CSGA 3OD0A 5IYZA 2AZ0A 3K3WA 3WG4A 2HH9A 5FJHA 2KQXA 1IBLO 4FP3A 2B9VA 2KXLA 3HKBB 2AACA 4UI9L 3Q8EA 1BCCH 4I9QA 1GP6A 2EINB 4TLFA 3WQ7A 3KZIZ 1CIYA 2WLPA 3WNOA 2XGXA 4MGSA 5DAWA 4HETA 4KH9A 1QLEC 1V6OA 3GF6A 4FP2A 3OGRA 5A80A 4DPNA 3BTAA 4I09A 2EIKC 2D3OW 2KSDA 5DZGA 3AKTA 4LO4B 4EN8B 2WZ8A 4QHBA 2XBO3 1G8MA 2G4IA 3C7EA 4P9OA 2Q8VA 2HVJC 1SA0A 1HWYA 1ZBE2 4PDVA 3AK1A 4I9WA 4DXZA 4RAIA 4O4JA 3JALA 1VEWA 4MVSA 1WW6A 3TEWA 1K33A 5DAXA 2W95A 2YHJA 3B9IA 4IEOA 3E8BA 3NJZA 2ZGTA 2GHYA 2ZGNA 4QX8A 4H14A 4PDRA 2UXCO 4E2GA 3NSTA 2PXJA 1MQTB 3OCPA 1TME2 1GM9A 2JKBA 5LMNO 2NMNA 3THCA 2EIJB 2ZACA 4EV0A 4AHWA 3CJXA 3IJ4A 4HZFA 4KHPB 4WM7A 2ET1A 2MW2B 4OCTA 2AEYA 3AMMA 4YGCA 1OQEA 1VAVA 2VBBA 4MTGA 3UKNA 3JCZA 2Y8KA 1SQFA 3VBUA 3JD72 3WV6A 1WLDA 3GHMA 5A3NA 4TSFG 1UPGA 4X62B 4CDWA 1A32A 3JSNA 3QO8A 3B69A 1NTMH 3E6CC 2WZR1 1YUDA 5A3TA 3E5QA 4GKXA 3MZHA 3IDCB 3GCXA 4M3CB 1AXKA 2BTQA 3L70H 4TQDA 2WR9A 1VBA1 1YSCA 2GC0A 1SFPA 4QQLA 3KB5A 5BV6A 1QOTA 2VVFA 1YJLA 3ZSLA 2QJ1A 5B1BC 3AJZA 3ZSKA 2JDYA 4JI6B 4X1IA 5BNNB 2EA7A 1ZBA2 3FB8C 3CEWA 1EFRG 1N3QA 3ZYGA 1AR91 3T0DA 3K9AA 4BLIA 3IIIA 3ZYRA 4AFMA 3SJCC 1ZX3A 3MIGA 4YZ4A 5HBAA 1GMGA 2D6MA 2GMPA 2ZT9B 4LNVA 2IC1A 2X6AA 4O2AB 3E8HA 5TISZ 3WHUA 4FFFA 1DQ2A 3LE0A 5FYCA 3K04A 4PDWA 3HB3B 1HW5A 1VQKV 4CUGA 1AXZA 1IS6A 3JBG2 3CCJV 2QM4A 2X5IC 5FZ1A 1PO12 2CAZC 5EC2C 1VJ2A 2E3CA 1YRZA 1SLBA 3I56V 5KWRA 3OOXA 4B3RO 2W87A 4D6SA 1I08A 3LDEA 3IDBB 1O3QA 1Q43A 2CTPA 1S2BA 5BNPA 3P32A 2UXBB 2HYXA 4Z07A 1PMHX 5JI9A 1V6IA 5T54A 2DUQA 2VWKA 2WN2A 4IE5A 1F4MA 5LBFA 2QFEA 1TUBA 3RDIA 2WNUA 2F95B 1UOGA 2PLV3 4XXPA 2RR12 1F15A 3CB2A 3GB7C 3S3XA 3T30A 3H0OA 4BA6A 1W9FA 2WINB 5AVAA 3QD6A 1V9U2 1AILA 3B7MA 1AYN2 1RUC1 4XQWA 4LIUA 4UFMA 4QQOA 3AVRA 4UBGA 4BH9A 3FHAA 2L9LA 1JU3A 1NY71 2UUCO 1EAH3 1AZDA 5IVFA 2FDIA 1QJU3 4FPKA 2E5LB 4UWDA 3ZMTA 2YFUA 4QPIA 2R32A 2NM1A 1HR0B 2A73B 5FZ7A 4PT6A 5E79Z 2C0ZA 5A7WA 3ACLA 3QACA 3SCHA 2VQUA 2WDBA 4HSJA 2AUYA 1XNQO 4A3XA 4AVSA 1MZ6A 1C1LA 1VMJA 2RS31 3VV1A 2JRIA 5B1OA 2OX0A 2VY0A 5F5IA 2M6YA 2QVSB 1X59A 4QU2A 1G9FA 4XF1A 2HJFC 4YW7A 2VH9A 3NRUA 3OJBA 3RZKA 4RR3A 1S1AA 1V55C 1XMOO 4G9SB 5I0SA 2JE7A 3UKVA 1AL22 4XF4A 1KEXA 2Y64A 4B08A 1CJPA 2Q7GA 4MS2A 2HWB1 4YRDA 5IJ0A 4N23A 1RGSA 4Q0VA 4M00A 3N2GB 3IPVA 1WWYA 1HXS2 5C8CA 1WLCA 3VHOA 4I0XA 5C70A 5CFCA 3JZVA 1D2DA 4AAPA 1URXA 4FI9A 1OMIA 2K0GA 5BYNA 1YJWV 1EZVH 2YGMA 2JEMA 1GOGA 4FO9A 1S55A 5GLVA 3OGJA 1WKYA 2R1DA 1PO21 4YVSA 2SBAA 4FTSA 1G9CA 3PN1A 1WLTA 3R05A 4K8RB 2EAAA 3WF4A 3AP4A 2W47A 4YNIA 3ZXFA 1OI6A 1N34B 1TAEA 5TSWA 4OI1A 2D5FA 4BQ4A 1RUNA 5CB4B 3OGCC 3H3UA 1VRH3 2XAHA 2VZTA 1J58A 1OCCB 2DN9A 2IFRA 3CRAA 3ZCCA 4XFAA 1KDKA 4FVMA 1V6NA 1CAXA 1HRV1 5E8AA 3ZX7A 5KC5A 4LUKA 3T1HO 1QQCA 1QJFA 5C3RA 1FJGB 1NCQA 4JI2B 1G7YA 3MFCA 2CV6A 2F17A 3CXCU 3WLUA 2W0FC 1W59A 4HKWA 2W1UA 1OCOC 1EUUA 5D8AB 5IK8A 4DR4B 2QZ2A 5DMYA 3RZLA 3NV1A 4BPZA 3KHCA 1F9KA 1AI4A 4BIOA 2GALA 4XQ4A 1Y76B 1GAXA 3STLC 5KUKA 5G04L 1OOPB 1XEQA 5IJRA 2ZIMA 1OH4A 4JGYB 3AP9A 4ZIBA 5EFUA 4DXRA 1O3TA 2OT5A 2Q1MA 3C7GA 1F5FA 2WWSA 3M3OA 2PF4E 1LOAA 4ZXKA 4JAAA 2RS53 3ZLIA 5AC93 4MOAA 4XZUG 4IGGA 1XMQO 2YBKA 1Q86W 1W8FA 3HQUA 3ZMSA 5I0DA 5FZOA 5A3PA 4HPKB 2WT0A 5C3PA 3JU9A 3UT0A 3ME2A 1LODA 3QO5A 5D2AA 1LGNA 3KVBA 4ET7A 2OCHA 5LXTA 4QGLA 1BEV2 5A33A 2P5OA 2WL1A 3RYRA 3WVJA 3GZEA 4L8QA 2WAOA 4GULA 5F2VO 4KGQA 3ZMNA 2PMWB 4CZZA 3ZMZA 1W2TA 2XONA 5EC1C 1ZZ6A 2RJZA 3UCSC 2BQPA 3CE2A 3FLRA 5ABJC 1JZ4A 5EIYB 1I5XA 1FXKA 4K1ZA 3JQXA 4YG0A 3MUY1 1ASJ2 1KS5A 4BIUA 1NQDA 1JTZX 2PGGA 4OQ9A 4MHUA 1VBD1 4KG0A 3SCFA 1AR1B 4DUZO 4TN7A 5EXOA 3SCGA 4BQ5A 3QLQA 1UYZA 3CWBH 4MH0E 1GZ9A 2VVDA 2WNVA 4D7SA 3KCYA 1QXRA 5FYBA 4YW2A 4MHRA 3TYJA 1UPIA 2HWF2 4DZGA 3SJQC 1XNRB 1MACA 4UT5A 4QKDA 4BHPA 4JYAB 1J83A 4UXAA 3FB7C 1JFFB 4XFFA 3MIEA 3G71V 1ZRIA 2WWJA 3FB5C 5APAA 3NNMA 5GTIZ 1ST8A 4BIZA 4FOYA 1QXPA 2CDOA 3V0BB 1LOEA 5BY1A 4J9YB 4LA3A 2YBPA 1VALA 1Q7YW 2O57A 5DAQA 1PL0A 3ABMC 1W0OA 4OHWA 2XDVA 3C7FA 5FQ0B 3ZRVA 1IBKO 3B4SA 4GKJB 1QJY3 2ZAAA 4N53A 4JPRA 5EPAA 2QBXA 4GALA 5L7OA 4QPWA 2D93A 1RXFA 3DC6A 4B4RA 5T5PA 1BVP1 5FPLA 1GP5A 2FDFA 1S0DA 2UYAA 4CH6A 2ZHNA 2VS0A 2PY5A 3AJYA 1OUSA 1PGL1 1U5YA 1YYNA 5EJ1B 2UWBA 1MNGA 2XJPA 4Q5OA 4O4JB 3SH5A 2HWE1 2X6BA 1ZSPA 4NIIA 5E1AC 3W7UA 4QGNA 1JH5A 2IFWA 1R091 5HCHA 3UGFA 2RJLA 1FAYA 5A3UA 2YU1A 3ZX6A 1QBZA 3SNMA 1WMFA 3OBTA 4AL9A 1HRI1 4IQPA 3K58A 2OPKA 2XMLA 1KJRA 5A6XA 3OBRA 4XHBA 4XIOA 4Z2WA 1QJX2 3N9PA 1XREA 4OHYA 1JYIA 4E8DA 4FFBB 3FE5A 1M56C 1OUXA 2JG9B 1H2GA 5FUNA 1FNZA 1UKRA 3FX7A 1KB9F 4DR5O 4NYKA 2HLDG 4XTPA 4CCEA 1IG0A 4GX5A 2R6QA 3UYJA 4IEXA 3KLSA 5JSOA 4JI0B 1R083 2RMU1 4FZ1A 5FZ9A 5F6KA 2RS13 3H1IH 1DQ4A 3BIWE 4TWTA 1PIV3 2BTQB 2ZXWC 4JKKA 1R1ZA 2JIGA 4JYYA 1K4DC 3VQWA 2WZEA 1ULCA 1U97A 2JECA 3R4DB 4AVTA 5DUXA 4GKYA 4H13B 3T2OA 3ZFEA 4K8XA 4JX0A 1P4RA 5DPNA 4JZGA 4D7YA 3RVZA 1RVF2 5JZGC 5FLJA 3I59A 4DV5B 2ZEYA 3PIGA 4XVHA 5CFDB 3CCQV 2WPDG 2P4KA 2R1BA 5CISA 2W9XA 1GH6A 1I6XA 1VBE3 1N1YA 1GNHA 2B1IA 4UFHA 4PD4F 3KGLA 2YSUB 4M3CF 3K4ZA 3OUIA 2DYCA 4LH6A 1VMHA 3J7MA 1ZRFA 4FLZA 3GZAA 2WO3A 3AFKA 4S2FA 1VAMA 2R071 1Z7S3 5F5QA 5LATA 1GP4A 4QXCA 3MBWA 4J7JA 1J5EB 5CN0A 1BVVA 2KB1A 1LAJA 1GV9A 2H6CA 4ASMB 1JI6A 3ZPOA 3PLQA 2DYRB 5FZGA 1NJIW 4RS5C 1XBFA 3MLLA 4FPYA 5H9PA 1N47A 2JDPA 5K9YA 1C8M2 1VMGA 2AC1A 4LE4A 4I4TB 4I55A 4AK3A 5LK5A 1PPJH 1TUBB 4FT8A 3DXRA 4YFWA 3QOPA 2DQ0A 5T50A 3UT5A 5FY0A 2N74A 1IVSA 2BW8A 5BMVB 3IDEA 5FY5A 1ND3A 2A7WA 3OMAB 1E79G 2MEV3 2AHYA 2GC3A 2Z69A 1WP7A 3I2DA 4R9AA 3L71H 1DU3D 3H7YA 4QX0A 3G80A 5DECA 4XJ9A 4QPIB 2D6NA 4K40A 4DEVA 5C3OA 2WZR2 2YPDA 4JRLA 3LDDA 3LIGA 1BZKA 4JZRA 1Q6HA 5A7WB 3ZEDA 1VBA2 1AROP 3CX5F 4MXVA 4XFGA 4HBNA 1W8WA 4PJYA 3TGUH 3HNBM 4BMEA 1N32O 1UXZA 2ZJCA 1KFXL 5KAIZ 5C9AC 1JHJA 1NUKA 1BGYH 1GNZA 5JVVA 1HJGA 4KWUA 1SLCA 2VOXA 4LXLA 3RYKA 1NZIA 1ZBE3 4RR3B 3LPGA 5EZYA 2JGDB 1A34A 5FY7A 3RT3C 3HWJA 1COWG 2PAEA 2C5DA 4PBPA 2IVIB 4RSUA 3V0AA 5HCFA 1QR9A 1DGLA 2DE0X 3TJTA 4JI7B 4META 3PUQA 1UF2C 4P5YA 4N43A 1RSOA 4BIFA 2IXKA 4RN5A 1BMFG 4R4ZA 1TME3 4X8PA 1Q8SA 3IPVB 4Q0SA 3L2HA 5F9TA 4I0XB 5CFCB 1ZM1A 2Q8OA 4OZXA 4XIKA 5JVDB 4NHXA 2ERFA 4X88A 4WBBA 3O14A 4FFIA 3LPFA 2OYZA 3JD73 4AE2A 2ZCWA 2JIZG 3GJAA 5IWAB 1MSDA 4A4AA 5GZDA 2VR4A 4DV4O 1C5IA 1OLMA 4PF5A 3NNLA 3VQYA 2YXYA 3WB2A 1IXMA 5L73A 5FUPA 5FBZA 4NAMA 1IURA 2HBTA 4AI3A 4Q4W1 1C1FA 2OW4A 1ZBA3 5DUVA 1D4M1 4DOUA 4OX9B 1HDJA 4AEDB 1R1A2 3H1KH 2A5ZA 5F37A 3C90A 3A0RA 5ACA2 3K46A 1KXGA 1WN7A 2IZWA 1PHMA 5C3QA 1YXWA 1JXNA 3K9SA 4IE6A 2DF7A 3FWEA 1VBB1 2XJVA 3ACHA 3H8RA 3HN1A 4Q8LA 3F5WC 3AZZA 4J10A 4BWOA 2ID4A 4UYBA 2GNBA 4HVOA 3JAWA 2EIJC 4H55A 5FPUA 5EYXA 5T55A 5C5UA 4NHKA 2JEUA 4W65A 2QUOA 3PURA 3JBG3 2CH7A 3CCLV 4MGYE 2W5FA 1PO13 3E6DA 2VQAA 1A8DA 5J98B 4RQPA 1WA8A 4AQ2A 1QR8A 4O4HA 1DF4A 3ON7A 2VMHA 4L11A 2PHWA 3CCUV 1WLEA 2HHHO 5FLHA 5GZFA 2CTRA 2WNEA 1K45A 4GAZA 4D69A 4JI3B 2YI9A 4KWKA 4W4LA 3AK3A 5J2TB 5FZOB 4Y20A 3RYCA 2Q4SA 2HWD1 4BDVB 1YVWA 1SDDB 3RYHA 5LOVB 1LOCA 2HWB2 3T1YO 1I7FA 1RHI1 3AXEA 1CZTA 4BQ1A 3VDBA 2ZM6O 1VE0A 5BNNC 4QX5A 2RR13 5A33B 2D40A 2W08A 1RUD2 4L2NA 2VZQA 4TSVA 4IGOA 4QM9A 1V9U3 1AYN3 3QVNA 2VUDA 1NE6A 5K0UA 1CAVB 2X6CA 4TV8B 1PO22 3PMEA 1JHNA 4HT1T 4AFBA 4DW0A 2F4VB 3LAGA 1W9WA 4JI1B 5B1AC 2TEPA 2VZPA 3MF9A 2MHFA 1DP0A 1RUE2 3CQOA 3OEEG 2XG3A 4K0KO 5BNOC 4E9KA 3VZJA 2V7QG 1UCXA 3PMSA 4WVMB 2FQPA 1FXHA 4CH5A 4IEWA 1EBOA 4XMAA 2XKPA 4R6ZA 4GJYA 4CEYC 1C4RA 5DXDA 4MYEA 1UMZA 1QY4A 4DV6O 1ND2A 5I8SA 1HNWO 4I50B 3K57A 1LECA 4BLJA 1DBNA 1H8TB 2H8PC 3GWKC 2Z0AA 2BVVA 1OCZB 1AL23 1OSGA 3HQXA 5LA1A 2HEYF 2EXKA 2A6WA 1D2QA 2A7AA 4LF6B 1W28A 4PCRA 3DN7A 4GX1A 1FV3A 1NZ6A 5DUWA 1QDOA 2K2SA 1HXS3 3IMMA 4JI4O 2Y6JA 2W52A 4F8AA 3I7DA 3K5OA 3OY8A 5FZ6A 3OBAA 1Y4MA 1AYM1 1TVKA 2ATKC 4CDUA 1NZCA 2W3JA 3OSDA 3O9OA 3QO7A 3K77A 1AR81 4YYOA 4UB8Z 1IKQA 1AB3A 4IESA 1K34A 1GN6A 1AI5A 2XH6A 5JJNB 4W6XA 3AG2B 3DKWA 1UOFA 2B5HA 1AHSA 1WPBA 4PDMA 4QU1A 2WAMA 4M3CE 1FFXB 2D6LX 3W9AA 2DTYA 2WLIB 4LFCB 5A7PA 1V6LA 5GLWA 4JCKA 5FMOS 2VTXA 4CXYA 1H6YA 1SQQH 1SBEA 5KX5A 3WF1A 1RPRA 3SPJA 4KL1A 3EB7A 1MZ5A 2ADEA 2Y0PA 2ZZJA 2W1SA 5F3IA 5DZEA 3WR0A 2VMFA 1QHDA 5BUVA 2IVJA 5KMGA 4NIHA 4W50A 3NNJA 4WVZA 2HKXA 2AYHA 2PFWA 4MADA 4F6RB 3H3LA 3ZBHA 4LBQA 1FPN1 3WXPA 5IVVA 3VHNA 3AC0A 4WV8A 4Q0UA 4QDSA 4A45A 1BBT1 5HXMA 4CDQA 3JATA 4B3MO 1OKOA 3SJAC 2BVBA 2RDRA 3O1PA 4KFMA 5JCTA 4AVCA 4I5SA 3OYWA 5FZCA 3FD9A 2VGDA 1BQPA 2JIJA 3A7QA 4X1YA 1RUI1 4UCRA 4UBHA 5ABJA 2DFBA 5JCOA 3ZHTA 3TWIA 1S5HC 4EEQA 1OCCC 1B35A 4AF9A 2J22A 3ZFFB 3CJIB 5GM0A 2YIBD 1X9PA 4CS4A 3SXWA 3TN91 5FWJA 4Q4X2 3J81N 1JOPA 2XPJA 3WP4A 2IJKA 1JS9A 4LF5B 4QHZA 3BI3A 4ATEA 4EZHA 4LF8B 2B9UA 1BEV3 3VD5A 4ZHQA 2QQMA 1IBMB 1XNDA 4RFT0 4PLMA 4O4IA 1HP8A 1W8NA 4DRRA 1PGL2 2XXZA 2HWC1 4YGBA 2WYFA 1FATA 3MGUA 5DN2A 3WDVA 2VUJA 3SMHA 1AR71 1WW7A 3ORJA 2ZHKA 2VMIA 1DYPA 4UVAA 5D8AC 1S0GA 2ZNJA 5H6RA 1ASJ3 4IV1B 3I3DA 4I55B 5ISLA 2JDZA 2D7FA 3SH4A 5IAXA 5AFEA 1HQLA 1OOPC 2DVFA 5I93A 1I3HA 1PKXA 1UY3A 5FO7B 3ZMVA 1ND3B 1BCXA 3ZN6B 4AQYO 5FP3A 2HWF3 1CXZB 4ATFA 1GOFA 4MVTA 3L73H 1QNMA 1K5MB 3O1RA 2WLHA 4FM0A 2AREA 3U37A 1ENQA 3FAVA 1V9PA 1K8AW 1XSQA 4LBLA 3OBZA 4LO7A 5LL6Y 2OTLV 5FYTA 4CE8A 4CYDA 3HIFA 3ZJZA 1S0IA 5JQGB 3N27A 4GD4A 1FOD1 3BALA 4Z82A 3I2IA 3WINE 3AG7A 2YC4A 2QTSA 3KT4A 4XBFA 1RUH2 3VDDA 5JPMB 2QE3A 4AR2A 1SQGA 1AX2A 1GMMA 1YEWA 4ZI7B 1US6A 2A06H 4HK9A 1H9WA 1LEDA 2Y26A 2VPVA 4R9CA 4NHMA 3FYEB 1SERA 3WW1A 3H8OA 4I7ZB 1OVPA 4B3SB 3AYEA 3C2UA 1G9BA 5EZYB 3O12A 4GKKO 4CSWA 3I3QA 2PQQA 3S57A 5IK7A 1ENXA 3D3AA 3GZTB 2DCTA 3V0AB 2W6JG 4F6EA 2AW9A 5K1PA 1UIJA 2J1AA 1Y66A 4DR6O 4N43B 5EZWA 2FBEA 3SGIA 3CRRA 4A7ZA 2QQIA 3POYA 2B45X 1AI7A 2V4VA 3H9AA 2IXIA 4BJ0A 2X10A 2LW8A 2DCJA 2G19A 4KGGA 3ZFGB 1PNGA 5F39A 2WLJA 1QJX3 5FZFA 1JCHA 4Y5Z0 3BKZA 2KKWA 2Z3YA 3AB0A 5FCCA 5JZGA 4IDZA 3AMHA 4B3TB 1WPXA 2ZKOA 4WM8B 2YC2A 2GMMA 3AYAA 2Q4PA 4MGZE 1CAUB 4PF1A 1XPWA 4QHOA 3RSJA 3ZRWB 3DPRA 4XJWA 1F51A 3K03A 1MS3A 3PJQA 1DF0A 3WNXA 1O4ZA 5IY5B 3ZVXA 1GRJA 1UZYA 5KHHA 4XMIA 5BR8O 2G9GA 2XUMA 3ZHRA 2BBAA 2BDRA 3ETDA 1HNXO 5F5AA 1GANA 2EXHA 1JZ3A 4RL7A 3IGAC 3SYPA 3MO4A 4NPLA 4NXNO 3ASNB 1RVF3 5JXHA 1UPSA 4H2AA 2MPFA 2B42B 4XDOA 1OF3A 1H2SB 1RUJ1 2ES3A 1O5LA 3HMYA 2G9FA 3R0RA 2EF6A 4IEZA 4OUSA 4J41A 3WX5A 5JMOA 3SR2C 4MG2A 3B09A 2CH7B 4WFGA 4WM7C 1GTOA 3J26N 4RQPB 2QA4V 1VB2A 4C90A 4DV7O 3ZOIA 4O4HB 3A0NA 5CA3A 4V2WA 4FZ0A 4NHLA 2R042 4QXHA 1WA4A 1W9YA 4QPJA 4UCUA 5LYJB 2CTWA 1R6KA 1RM1B 4XFIA 1C8M3 3VBOB 3RYCB 1GFF2 4CH3A 4QD2A 4GXLA 4UXNA 2VCMA 4W6WA 1IG3A 3MPBA 3PNAA 1WBLA 1T6GC 3RJ2X 3MEPA 2VOKA 3NJVA 3CRMA 4Z8BA 4JAVA 1QF3A 1IOAA 4NR1A 3OMIB 2YZ4A 3MDPA 2SLIA 4LFAB 3SPCA 4NE9A 1TMF1 3UKMA 5HV4A 2AENA 2ARBA 3WQ1A 1XNAA 2YMZA 5IHRA 3GBFA 2A6VA 3AM2A 3KM5A 1K5SA 4LO8A 2XBO1 3MD0A 2ZE5A 3KS7A 1DQ5A 4XYXA 5HCBA 3L74H 5GW7A 2WZR3 2OIGA 4ASUG 3ZSJA 3PJSK 4PDWC 3I2HA 3OF1A 3EXUA 4Q26A 1VBA3 2YV8A 2BV4A 5GLTA 2Q69A 1N1VA 1UY2A 4CS3A 2R0FA 1VIWB 3E35A 4Z1VA 3K08A 4WZCA 1DLBA 1OVSA 3IIAA 5J09A 3WF3A 3ETEA 1OF4A 2FMYA 5BNPC 3LIHA 5A3WA 4QPYA 1ND2B 5C71A 3MW3A 3O1OA 1W2BU 1XL4A 1SBFA 1GK9A 2EX3A 4XXAA 2FCTA 2BFUS 1W04A 3SC7X 4GQ7A 1NXD1 2WS92 4AI0A 3B40A 2WNUC 1EY2A 3HKBA 3T4HB 2OIEA 3AEIA 3HKCB 2GUZA 3O1TA 1RMU2 4XDLA 4IEVA 1DZQA 4KHPO 2Q73A 1MEC2 4OMDA 4F3JA 4LK7A 3AZVA 3BTXA 2Q0AA 5FP8A 5H5NA 1OCRC 1Y74B 1IQAA 2PELA 3FJSA 2F4LA 4X62O 2IU3A 1VAKA 5I0TA 2UXNA 4K35A 4QPIC 5L19A 4AFCA 1RFYA 1PL4A 3RZHA 5FPRA 5LCWL 1UZ0A 3G7DA 3PVNA 1O9GA 1US3A 3ABKB 1L0LH 5D5QA 4CU8A 1LHUA 4QAWA 1MQTA 1S2KA 4JI6O 1ZZ9A 3TOJA 5CA6A 4IL6Z 1FX5A 1A6CA 4K7JA 3AG4C 3ZS8C 1VMFA 2CYFA 3M8AA 1ODNA 2UURA 1V00A 1BMV1 5LMUB 4J1XA 1W6MB 4TUYA 2ZX3A 1H9PA 4YHHB 4LC1A 4RO2A 3T1LA 5CKMA 1WB8A 3L9DA 3SKJE 4DW1A 4LUMA 4RR3C 5JI7A 4MXWB 3RJRA 2QDNA 4XABA 2RCVA 3HAGA 5K1XA 5ACA3 5IJ9B 4FPGA 4CU6A 4D7TA 5BY5A 2IXJA 3WG3A 3EFFK 4LFBB 5J48A 4ARXA 4R8HA 1UQXA 1W6NA 1V6JA 1OA3A 3POBA 2VBPA 5KMGB 4FIPC 4XJUA 1H2MA 4LBQB 2DWRA 1FYUA 3ACGA 1AI6A 1XMOB 5C8CC 5A7OA 5CFCC 1F5JA 3EBRA 2JJ6A 4U36A 3MFAA 4B7EA 1S0VA 2DU1A 3AMNA 4CDQB 2LW7A 2UXBO 4X66B 4DV1O 4N9HA 3H9VA 3SJBC 2W39A 4KU8A 4FPOB 4A41A 5FV3A 3HKEA 3OYWB 1STMA 4AI1A 3A0HZ 4AFAA 2NN4A 1JOYA 3WDTA 2QQKA 1EAH1 3U14A 4CUAA 4O2AA 2A0LA 2X05A 1QJU1 4LBEC 4LE3A 5L9BA 1AL0G 3N9QA 1JZ6A 4Q4Y2 2HWB3 1TGOA 5FYSA 5CMUA 3HKDB 1GWLA 2CDYA 1Y3TA 3LSSA 4QGPA 2P2KA 1ODMA 2B9ZA 2P6CA 3D0SA 4FLWA 1RUD3 3LEGA 2L6LA 4O4IB 1XYPA 5M0TA 5L9RA 2E5LO 1JYTA 1MABG 2DTWA 1JJOA 3MLJA 3RMXA 1HR0O 3ENRA 5AFBA 1NCQC 2EIMC 1PO23 4KBBA 4RUFA 4FOQA 4HSLA 3USUB 1REEA 1BL8A 4DV2B 2V09A 4QPGA 3E5UA 4R9BA 2W92A 3K59A 3F7YC 2GDFA 2LTNA 4JI8B 3WT3A 2VRZA 3MICA 5L3FA 1QQP2 5LA6A 3BN6A 1C8NA 3R4SA 1X36A 3B77A 5IE9A 2ZGUA 1WW5A 4URAA 5EBLC 4J7ZA 3SEEA 2YDEA 5IT6A 3LF7A 5SV8A 5IW0A 1DTOA 1OZ0A 1R64A 1NCRA 2VW0A 5A1LA 3MI8A 1KMIZ 4UFLA 3VD3A 5EBMC 5FYVA 3J8F2 3IMNA 4N7UA 3FB6C 1KRIA 1F8VA 2V1DA 4OZOA 4WFBV 4Y5SA 3A4UA 4OUMA 3UO3A 1MOFA 5E1RA 4AEMA 3WF2A 5KA6A 2UUAB 3ES1A 5JXJA 4L8JA 4ISQA 3VKNA 1FPN2 2P4VA 3VDDB 5JSRA 1VRH1 2RDSA 1XMQB 2Z5WA 4BAYA 2J1UA 2F93B 2HFEC 2PYTA 4HAMA 5HI0A 1GQPA 2A75A 3IB3A 4K9SA 3MIDA 1FXKC 1NOVA 2WSVA 5DG2A 2K9ZA 1KUQA 4NAOA 5A6YA 3VL9A 3PU3A 2XQRA 5IYDO 3DXUA 4YPJA 4XACA 5FYUA 1H1MA 3KKYA 1IGOA 4DS0A 1V54B 1DGRN 1FI2A 4C8DA 5ANNA 4Q0PA 2WNVC 1K3IA 5FZLA 3ABLB 2R9AA 4OI0A 3N2GA 5IATA 2DUOA 1LESA 4CEWB 1K12A 2EIEA 1WNSA 1KP2A 1TNFA 1OPOA 3H1YA 1QWRA 3I8TA 2ZX1A 4OUEA 3AKQA 2O0OA 1FMD2 2ADPA 1JOJA 1FJGO 1BZWA 1LGBA 3BIEA 3APBA 4I01A 1WBFA 4JI2O 3V56A 5FK8A 2LQTA 2RVAA 2XJTA 4I0BA 1PNMA 1XC6A 5L3DA 2AHZA 2WT1A 1JMUB 4Y1YA 3DPRB 3EO6A 1TG7A 5FR3A 4BR6A 1UNBA 1ZRDA 2BNOA 3CP1A 5IT9N 2RS51 5AC91 2E9QA 4ONUA 4IGQA 5CG8A 5F6LB 1PK6B 2ZE8A 5L7OC 3U10A 2DVBA 4E2QA 5A6QA 2XAJA 2R9IA 5FYYA 1VB4A 4XBQA 2QJVA 1GN3A 5C8WA 1M06G 4O4LB 3LEMA 3MIBA 5BZBA 3HN3A 3W7SA 1I94O 2UUBB 2AZ2A 4LKFA 2BTOA 3I2GA 1IBKB 1UZWA 2HYKA 1SESA 5KLVH 1Y6XA 2WUHA 4R8CA 1R082 3RWNA 2W46A 2O14A 4UV8A 5JJJB 3AG2C 3J7LA 4EN0A 4DO2A 1N3PA 1PZ9A 2BERA 4IIJA 3LZZA 3S0MA 1CPYA 4PIZA 1FOD2 1ROPA 5I8YA 5E88A 4FPFA 5B3SB 3SKVA 3ILFA 1JZ8A 1EM1A 2KR2A 4Q4X3 3RZZA 5LHHA 3Q4HB 3RPQA 4D8MA 2ILMA 1PVXA 1YQ5A 5FDBA 4Y1UA 2XJQA 3VOUA 3CCEV 5J7MA 4JGYA 4QKFA 4IE4A 1YIFA 4FQ4A 2WBKA 4GUNA 1ENVA 3OEAA 4INDA 3T4ZA 1CONA 1O3RA 3M3IA 3VD4A 4X65O 1GN4A 1W2NA 3ZN1A 1YFYA 3GNEA 2HWE3 1R73A 4XURA 5FZ3A 4ES8A 2DOSA 1ONAA 1R093 3AG3B 2LW1A 4XUOA 2IJIA 3INAA 1XNCA 3E89A 2DBIA 2EXJA 3SITA 3FBYA 2VM9A 3OR7C 2VZ1A 4KU7A 4BXSV 1G4YB 3O1SA 1XNRO 1TEIA 2FDHA 4JC1A 3PVBB 2W68A 1XNKA 1AJPA 3RVYA 4LEJA 5C8YA 1QJY1 3DF0A 4PIYA 3ASOB 2OKXA 1V70A 4AGRA 5CIRA 1HN1A 1DGSA 4QPKA 1R3IC 3CZUA 4LOSA 4LKEA 1YC61 3LNNA 3T0AA 1DZRA 4WVVA 3BU7A 2R7EB 5DG1A 5T52A 4GKJO 1QNWA 5FMBA 4DNYA 3LWCA 2GC2A 4P9JA 4PI2A 3W7XA 1DG6A 3KQRA 4RGKA 3POWA 5DAPA 1AVBA 1XHZA 2UY8A 3JQWA 2ZKLA 1RUH3 1S72V 1F35A 3OUHA 1MSWD 1GNYA 2B46X 1S76D 3HD8B 4QB1A 5H6QA 2Q30A 4MT8A 2QWOB 2B5UA 3WW3A 2ZGQA 2Y38A 3B9CA 4PJ0Z 1JFFA 4P9XA 1JYCA 4YFZA 2WQ8A 2P3YA 2XLAA 1K92A 2Y6KA 3ZYFA 2UXDB 3OUJA 2EIKB 1FV2A 3V0BA 1PVC2 2MNGA 2NR5A 4X8AA 4MSWC 3BVCA 5JXIA 4DINB 1OFNA 3MHSC 2QEXV 1Z78A 1QOSA 1XU1A 1BE3H 4Q4V2 4QGMA 4TYSA 5FQ0A 4Y22B 2PA7A 2GUZB 1ULGA 4A42A 4YZ3A 2ZR3A 2RS11 4K3AA 1N4CA 2GSMB 1BHBA 4AI2A 1O5UA 1ND3C 4A44A 1PIV1 1E1RG 3WP5A 2VOVA 3WF0A 4EE2A 3OGGA 2AR6A 1ZRCA 4Y5TA 1CN1A 4YW6A 1S77D 5LHGA 2R16A 1ZZ7A 2CNAA 4JI0O 1WUVA 2ENRA 3PU8A 4LKDA 2D43A 3A2FA 1O8SA 4W8JA 1L7RA 4CDXA 2Z5UA 3CBNA 2Z4FA 3T0BA 2OUHA 2D98A 3NNGA 3AYCA 3CU7A 1VBE1 4F7ZA 4TLGA 3TEZA 3ZRSA 4JQTA 5FTTC 1ULDA 5CNAA 3ZHVA 2WO2A 4H44B 5C4WA 1KD7A 2WA4A 1LNQA 5GTHZ 4DV5O 4FFBA 1MZEA 1UOJA 4YVWA 4TUYB 5DDJ2 3VHRA 4PDLA 2JG9A 4R52A 4EFBA 1NVPD 4JGZA 2D6PA 3X2QC 1V6KA 2Y6FA 5EK0A 2OT7A 2Y4TA 3ROUA 3FMGA 5B1BB 3VBRA 3W5NA 2JJ1G 1Z7S1 3V65A 4PLNA 3FC0A 3P3PA 3Q8AA 2HKOA 2P3KA 5IUQA 5L3BA 2P6JA 1ULFA 4QM8A 4PQQA 1W6NB 1GYKA 2QQNA 2ZIOA 3GJBA 4N43C 1UAIA 3ST7A 3ABUA 3HBZA 1ZREA 4EJRA 4JYCA 5LRRA 4YJ2A 1WMEA 5A1AA 1J5EO 3PUIA 2YB7A 3OTOO 1H1IA 1GM8A 3KT1A 5FXZA 4FK5C 1UIKA 4ZS2A 3WUCA 1VQ8V 4BMBA 3O1UA 1M9NA 3R65A 3WW2A 5CFDA 2K9PA 1KS4A 4WM8C 3HKEB 4XETA 2C4XA 2MEV1 2R043 2ZMLA 1A78A 2ET7A 1EN4A 1RB8G 4AGGA 3H1JH 5JWPA 4U2AA 4UCSA 2E63A 4I3GA 2J7MA 1SZXA 5FZEA 2OWOA 3K3NA 1LHWA 3SDLA 2I2SA 3ITQA 3LA7A 1CPNA 1WW4A 3B5LB 3B2EE 2ZKNA 1FPOA 4C7UA 3RBZA 2QQPA 2FHRA 1CX4A 3VDCA 3JUUA 3MHZA 3CO2A 5JSPA 2Q1ZB 2J1VA 3T2PA 2ZE6A 2HEWF 5FKCA 1HJFA 3ASNC 1DLCA 1E5SA 1VF5B 4BB3A 4E2SA 5GZCA 3BU0A 4H0LB 5JUVA 4DR7O 5KXDA 4LT5A 2CY6A 3BAAA 1Y9MA 5HFMA 3ABZA 2ZD9A 4QPGB 3QCWA 4U3JB 1LKNA 2R49A 4NHYA 5FY8A 5GZGA 4I4TA 4DR1B 4XILA 4DUXA 1ZBE1 2HJIA 1O7FA 2A6XA 1YLLA 4KWLA 4BQWA 2YC0A 1S3JA 2F4PA 1UZVA 4X64O 3CRCA 2P4EA 1KITA 5CADA 5BMVA 5LA6B 2E74B 2JG8A 2Q1FA 4XDQA 3I49A 3UGGA 2WFF2 2ZMNA 1KYOF 4LNUB 1QDCA 1VBC2 1AXYA 4RQPC 1W8OA 1QGLA 1O6UA 2NLJC 3E1F1 3ECQA 5IVEA 2OVUA 1TME1 1M4UA 1BLZA 1QJZA 4PA4A 1GZCA 3U4XA 3ZXLA 1NCRB 4MVOA 1ULOA 1Q8IA 5GKAC 1RJ7A 3CS5A 3VDAA 2WS93 5FLIA 1RM1C 1NBMG 4JI7O 4A7KA 4LWSA 5CAZA 3VBOC 1COV2 4JKLA 3RMYA 1YJNV 4ZHNA 1R6NA 3ZYBA 3DV8A 4JQRA 3CCVV 3ZKYA 4TTGA 1V55B 1UU4A 4XUTA 1J3RA 1RMU3 1O8PA 4S2GA 4FPJA 4NTYA 4ZU7A 3O0WA 2ZGKA 4YZ5A 3KV6A 1UY0A 1MEC3 3K0DA 3PUSA 5FXXA 1Q5OA 1YHFA 3VLBB 2GP3A 5K0UC 1RUOA 4GIQA 3K4AA 4GH4B 1WP8A 2UU8A 1F4NA 1OKQA 1U0AA 5IWAO 2BOBC 4FPEA 4J6GA 1U5IA 2A70A 2LGQA 3N9MA 1YI9A 3VD9A 1ZBA1 3DL3A 2JGDA 3IZOA 3A0KA 4QX1A 3VKFC
chains in the Genus database with same CATH topology
1PM7A 5BPXA 2NQYA 4HLTA 4I0WB 3SISA 3M3CA 4NO4A 4NOTA 1V6LA 3WZ1A 1OOPA 2GAUA 5GLWA 1MS1A 4JCKA 5FMOS 1GBGA 1YIPA 1NE4A 1SBEA 4Q4W2 2CWSA 2WNUB 4B8EA 4JVAA 1RUG2 2WA3A 4KL1A 1MZ5A 1AR62 1D4M2 2KA3A 1Q8PA 3ZIWA 2ZZJA 4FVVA 3VBSC 1AJOA 3U11A 2GNTA 2Q5TA 3WOGA 1NYWA 5DZEA 1AR93 2GN3A 5KHGA 3WR0A 4SLIA 5JAXA 1X82A 2IWGB 2ZGPA 3ZSMA 1DFQA 2O1QA 5KHIA 2R063 2VU9A 1LHNA 1QHDA 2ZX0A 5BUVA 1VBE2 4WVZA 3UJQA 2HKXA 2AYHA 2PFWA 2VECA 4BCUA 2PHLA 3GYDA 4LBQA 1FPN1 1ND2C 2WBPA 3WXPA 3H1MA 3GALA 4N7IA 3VHNA 1VBB2 4FTEA 2A6YA 1JR7A 2D44A 1J1TA 1XXNA 4WV8A 2XVKA 3ASIA 3JBG1 4Q0UA 4YZ1A 2ZX4A 4HPKA 1X8MA 1PMIA 2VVEA 1BBT1 2D6KA 3VBHB 1PO11 2ZPXA 4CDQA 1APNA 2JENA 2CWMA 4Y22A 4X8NA 2XWJB 2WC2A 3I4IA 1UN1A 2BVBA 1IKPA 4MX3A 4H7MA 2JG8C 2BYVE 1D4VB 5JCTA 5HSXA 1YFXA 3PJYA 4AVCA 3L9JT 1IS4A 3V17A 2GH2A 3OYWA 1S0BA 2VGDA 5H9QA 1BQPA 2N7GA 4B7KA 2YPJA 1Y9QA 2ZHLA 3SHRA 4E4SA 1QJX1 1PGW1 1RUI1 1Z7S2 3B94A 3ZFEC 4Q29A 4UBHA 5ABJA 2DFBA 3ZPYA 1HV1A 1UX6A 5CBLA 1I9RA 2PAMA 4AYUA 4G3YC 4HMZA 5FRAA 1MR5A 1RUJ3 1S0JA 4NWWA 4AQ6A 4JRAA 3TWIA 1POV3 4YG6A 5C9AB 3ILRA 1B35A 4AF9A 3ZFFB 2I74A 2E6VA 3CJIB 3IT8A 1Q8OA 5FO9B 5GM0A 1H1AA 3TB0A 2AH2A 3Q9OA 2ZABA 3AZWA 3AZXA 2DURA 1OQDA 4LTAA 4Y1ZA 3RQ0A 3SXWA 3TN91 5KBFA 4XJ8A 4Q4X2 2XPJA 4AEDA 2RR11 1DYKA 3S6PA 4CDUC 1OIIA 3WP4A 4YW5A 4P9IA 1XQNA 3U07A 3NWKA 4ATEA 5EJ3A 2HWD2 2B9UA 1JN2P 1BEV3 4L97A 4HN1A 5GJ6A 1OHFA 3I54A 1V9U1 3KSCA 5CU1A 1AYN1 3ZXKA 2R041 3VBFB 1QXJA 1XNDA 3GBWA 1RHI2 4RFT0 4PLMA 4N9IA 3FHIB 4DRRA 4P14A 4I2OA 1PGL2 4LLFA 2HWC1 3ZXEA 4YGBA 1EP0A 1FATA 3MGUA 3RG0A 4YW1A 3S7IA 2VUJA 3WDVA 3LSDA 4GA9A 3SMHA 5JOXA 2MEV2 3ZSEA 3AX4A 4FOVA 2TUNA 5JLVA 1AR71 4M01A 1WW7A 1CIWA 1EV11 1RUC3 4LHNA 3FUQA 4P5HA 3M7AA 5FREA 2ZHKA 1SLTA 2VMIA 1N3OA 4DY5A 1DYPA 5D8AC 1S0GA 4RGAA 1ASJ3 4IV1B 1JBCA 5JDBA 4Q4Y3 1DQ1A 3VHPA 2Z79A 5C8CB 2JDZA 2PHUA 3E97A 4GB31 1D0GA 3OD0A 2D7FA 3SH4A 1IPKA 5AFEA 1HQLA 1OOPC 2DVFA 3WG4A 1HDKA 1I3HA 5I93A 1CAWA 2H0VA 4M27A 4COZA 4FP3A 5FO7B 2KXLA 4YVSB 3JCIA 1ND3B 2QZ3A 1BCXA 3R6SA 1CQ9A 3ZN6B 2PHDA 3ZXAC 3M70A 4TLFA 3WQ7A 2ZHMA 4HFSA 2WLPA 4C1XA 2HWF3 4ATFA 4MVTA 2XGXA 4HETA 4KH9A 1V6OA 1LHOA 1K5MB 3GF6A 4FP2A 5I8TA 1Q3EA 2E7AA 2GNMA 3FUOA 4DPNA 1NLRA 2RS33 3BTAA 2WQ4A 2AREA 4I09A 1ENQA 3WHTA 5DZGA 2PLV1 4LBLA 3AKTA 4LO4B 4EN8B 4XZPA 4LO7A 4QHBA 2XBO3 2G4IA 3THPA