2YC1B

Crystal structure of the human derived single chain antibody fragment (scfv) 9004g in complex with cn2 toxin from the scorpion centruroides noxius hoffmann
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
108
structure length
108
Chain Sequence
SEIVLTQSPATLSVSPGERATLSCRASQSVRSYLAWYQQKPGQAPRLLFSDASNRATGIPARFTGSGSGTDFTLTISSLEPEDFAIYYCQQYRYSPRTFGQGTKVEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Neutralization of the Major Toxic Component from the Scorpion Centruroides Noxius Hoffmann by a Human-Derived Single Chain Antibody Fragment.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/toxin
molecule keywords SINGLE CHAIN ANTIBODY FRAGMENT 9004G
total genus 28
structure length 108
sequence length 108
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2yc1B00
4JY6A 5FO9A 4KZEL 2A83A 5GZOC 2CO7B 4LRNH 3VWKD 5CGMA 3FO2A 4NZTL 4JJHA 2YMXL 1Q94A 3KR3H 5DQ9B 3AVEA 3QIUC 3RWEB 5AZ2H 1P1ZA 1R5IA 5BOZG 1G1YA 5DMIL 4P3DB 4KXZH 3FFCE 4WO4D 3KYMA 2E8ZA 3CXDH 1J8KA 3U0PA 1HI6A 1JPSL 3ARFB 2BDNH 5EPMA 4QRTB 3WSQH 2GJ6D 4PBXA 3AS3A 3GFUA 3HZVB 2CIIA 4ZQKA 3GSRA 5I2IA 2QEJA 2AXGA 4MXQC 4HCRH 4PRPA 1FVDB 4CJ0A 3WNPA 1NDMB 2BCKA 4CMMB 4C4KT 5EO1A 2Q76A 3RIFK 3KPRE 2XZAH 4RNRB 3WFHB 1JUFA 3SKOA 3TO2B 3VG0L 3EO0B 4S1DC 3W0WD 2R8SL 4NFBA 1MCJA 4NC1E 4OZHB 1H3UA 2CDGB 2Y1VA 4CVXA 2OR9H 3BQUB 2AGJH 3VWJB 3LQAC 1EBPA 4JFDA 3MV9A 4NM8L 1YQVL 2JJSC 3QUYA 1BVLA 3ZDZF 2F8XC 4PY7B 3BPCA 1O7VA 4OZ4B 5E6ZA 4JRYA 1MCSA 4NQDA 3GM0A 2XWJB 2VH5L 2ADIB 3JV0A 4ZYKB 5I8CB 3NPZB 2N56A 2F54D 3CK0L 3F5WA 1JGDA 4XBEL 4G6AC 3PWJA 3IKCA 3WFDH 1UACL 5CGYD 3ARFD 3E8UL 4CBPA 1TTFA 5A2LH 1T7VA 7FABL 3NCYP 1NGPH 3Q3GB 2D31A 5D9SA 2OXGA 1JHTB 1F6AB 1OLLA 3O2WH 3OKKA 2P8LA 3FFDA 4WTZA 3WUWA 1KG0A 4MNQE 3PHQA 5I1DB 4F8QA 1YY9D 1AFVH 4P2QD 3E6HB 4ZUWB 5F9WC 3RVXC 4Y16C 4CRPA 3EOAB 1MAKA 4OSUL 4IRZH 1ROWA 4JRYD 4X0KA 3GMMB 4S0SD 1GGYA 4X9BA 4RGNC 1KENH 5IG7A 4GW1B 5KSBB 4KRLB 3WLWD 3D2UB 4FZEH 1YC7A 1VDGA 2CRIA 1C5DA 1JTTA 5D7KE 5ABDE 4RGNE 1K4CA 3BWUC 3W9EA 4XCFH 5KANI 5DQDL 4DGVL 4QXUH 3T1FB 1S7UA 4B41A 1K9TA 2HVJB 5KJRL 1J18A 5EC2B 3TBTA 3CSBA 3X11A 3AREB 1KB5L 3QXTA 5J13B 1J0JA 1FE8L 3MJ7A 4WNQA 2PW2A 2FB4L 4XBPB 2IPUG 4H26A 4MNHA 2J8UF 1HQ4B 4HJ0C 2YRZA 2DYPD 3GKZA 3NN8A 4M7KH 4MA3A 5DD6B 3FB6B 3JVGC 2W0KA 4Q9QH 5F88A 1CICC 1VGKB 1SVZA 2XFXA 4MSWA 5I66B 1L0QA 5LGHL 4NWUH 1OL0A 1KEMH 5D7LA 3WHE0 3ARBA 3EZ8A 4HUWA 4TVPL 3R06A 2NY4C 5I15L 3RAJL 2IQAB 1URLA 3OXSA 4BKLB 1YEKH 4GSDH 2D03L 1KTDB 4JRYB 43CAA 4MMZC 3U1SH 4HGMA 4LPCA 4FQHA 2Y9RT 4GUPB 4Z7WE 1NAMB 1YEGL 2NCMA 1MFCL 2ZPKH 2LQRA 2NY6D 1MVUA 2CKBB 1BJMA 2AXFA 2G5BB 4NKMB 1XR9B 4P4RA 1NBVL 1Q9OA 2CLZA 4PJXA 4RA3A 3UYOD 2JIXB 2VWEC 3QUYB 1P6AB 4XAKD 4GMSH 1QEWB 1SEQH 2J5LB 3FRUB 3TBWA 1AGCB 2DI8A 1MHEA 1NBYB 1EUUA 4YGAB 4PGJA 4O5LL 3QI9C 2BY2A 5CLTA 4RAVB 5HDOA 3UAJC 4YDVB 3B83A 35C8L 5FYLL 3TVMD 1WBYA 4KUZH 3AS0A 2H2SC 4GRMA 5DHVB 3CCHA 2J88H 4P2CG 2R1YB 4HWEH 4F7EB 1MIML 3WDIA 2YC1A 1IL1B 1MJUH 1I9RH 2OL3H 1KBGL 3DPBA 2K9UA 5D2NE 1C7SA 3LZFL 3JTTB 2YD3A 3B9VA 4OQTL 4PV8A 1JRHH 4FNLH 3MRBB 5HGAA 3WJJA 1W0WB 3CMGA 1RZFL 1XEDA 1ZLVH 5D5MA 3B43A 3MV8A 5FCSH 4P23A 1YEJH 3K2MC 2QSTA 1J8HB 3RIAK 4LASH 3N85L 3ZZ1A 1I3GH 1T1YB 1U8KB 4U1IA 1DBML 4HZLB 5HHNB 4LCUA 2FX9H 1K2DA 1QRND 2W65B 5JOEA 5FM5O 3NFSH 4AG4H 1XCTA 4EUPB 4MDIB 3FT3A 3TBTB 2V2XB 1NMAH 4S0TD 2W0FA 1WITA 1KB9J 5IROC 4LEOA 5CP7B 4OCWL 1A5FH 3FCTA 4DKFL 5L88H 5BRZB 3JBG7 4K3DL 2A9MH 2PUQT 5IR1A 4LRIC 3BIAX 4JFXB 4XX1E 3QHZL 1J8HE 1JNJA 3U48A 1CXIA 2XKSA 4JZJA 4NO3B 1MH5A 5E8OB 3WNMA 3LB6D 4RFOH 3UROR 2NY0D 3UTTE 1DDHA 5D6CB 1WF5A 5DUMH 3TNMA 4ODSH 5ANMB 3HMWH 4NYLA 3ETBF 3HC3L 4Z77B 5EFIA 25C8H 3KLDA 3WO4C 3RWJA 3PGFL 1GGCH 2CR6A 5DQJA 1MCBA 4WWKD 5GGRA 3NGBC 2D0HA 3HI6L 4LCWB 4YPGA 4F9PA 4DEPB 3V4PL 5F7KC 3HE6A 1I1FA 2O26U 1ZVSA 2P24B 4G7VH 2BSSA 4TPRL 2OR7A 5D2NC 5FK9A 4JRXE 4NM8H 4Z5RA 5E4EB 1HSAB 1LK3H 5FGCB 5A16A 3P73A 2YPLA 5HGDB 5HI3D 3EO0A 4EI5A 5GS1C 4PREA 4TUJB 3OAZK 5IV2A 1ADQL 5L2JA 2DQUL 4ZOEA 1FFPA 4CVXB 1UCBH 2EDEA 4MQ7B 1R5VA 3V4UH 4ODXB 2HFTA 3ARGD 4YFLI 5E2UL 3ZO0A 2FJHA 4I3RH 2CJUL 2NW2A 5EU7C 5GGTL 2F54B 1CL7H 4HT1L 4YE4L 1OAQL 2EYTB 1UENA 1YQVH 4UU9A 1LO4L 2KUTA 2PF6A 2XQBH 2WBWB 3BHBA 4G6AD 4HPOL 4U6VL 3TIDB 4BQ9A 2B5IB 2BHUA 2F53A 3MUJA 3I6GB 1CLZH 4YNYA 4LF3A 4D9RE 5KVEL 2FO4A 1MFAL 1A7QL 1J0ZA 4U1HB 4PJIE 3KWWA 4KJYB 4PRHA 4M62H 2YD9A 1CVSC 1MCHA 5E9DB 4Z7OF 3OKYA 4KJQD 4NRYB 4NHCH 3S37L 3CPLB 5DVKA 3G08B 3VA6A 4HUWB 4ZPTA 4LU5L 2VXVH 5DMKB 2GCYB 4JO1L 1CQYA 2CRYA 4I3GA 5EUOA 5TFSH 4EI5D 4POZC 3LEVL 4XBPA 1IGMH 1IQDB 2IAMA 5KJRH 3KR3L 4YBLB 3GSUA 2DM7A 2UVEA 3CFDB 5ANMA 1P4LA 4HT1H 1A9BB 2ZG1A 2C4XA 1QLRB 2JJSA 3IDJB 5I74B 5C0RH 3F58H 1S5HB 5JIHA 4LLDA 3VH8A 5HD8C 4KY1L 1CLZL 1T1WB 5DRZA 3O6ML 3P9WB 2P5EB 5B38B 5IB4B 1EMTL 3V5KB 1MFBL 1X5FA 2D7NA 3CMOH 4F7TB 2FWOB 4NM4L 4ZNCD 1AC0A 1EPFA 1R3HB 1EEZB 4WU5B 5AD0A 2NW3B 2X9XA 2YA0A 4LBEA 4X7CC 3TVMC 1B0WA 1MWAH 3LMJL 3KG5A 3ZHLA 5DJ6B 3S3SA 4JFEB 3C6SB 4I0PD 4XC3L 4KTEL 2BOCB 5ISZD 2WUBL 3U0TA 1JGVL 1J8HD 4PV9B 5CGTA 4M1DH 5E08L 2OJZL 1SVCP 3C2SA 1JGLL 5E8EB 5KZCB 5L2KA 3JWOC 4X4XA 2DF3A 5C0DB 5IMMA 1XGRB 2KBGA 1JNHA 3ES6B 4IRSA 1RSFA 2HJKA 4KRPC 1A6WH 3S36L 4JY4B 3WUZA 5D7IF 5IJKA 1BAFH 3B3IB 2W9DL 4YGVB 1UYWL 4OCXL 1QEWA 3SDYL 3U4AA 3HNTL 3QWOB 4YBLC 4ZUTA 1WCBB 3HLAA 2AJXH 4DTGL 2F58L 4PG9B 3CMOL 1IAOA 1UM4H 4F3FA 2YK1L 4XCYB 3FO1B 1WIOA 3MV8D 3N06B 1FRGH 2RCSL 3GUTB 4AEIL 3DOSA 3HB3C 4OV5B 1E28A 3QHZH 1AXTL 2PO6B 2ZCHH 1RZKC 5IJVB 1OAZH 1ITCA 4RWHA 3C60B 4NIKB 4QOKE 1J9CT 3NCCB 4Y5YA 5IF0B 3KJ6H 4NZUH 1U8LA 5LXGL 1IKNA 3I9GL 1MFEL 3FT3B 1A64A 4D8PA 4YR6B 3VDBA 3D9AL 1VFAB 4X80H 5AZEL 4Z77A 5A40E 3NN8B 1A22B 5B38G 1KEGH 3MOQA 1YN7A 2MHAA 2JCCE 3RWDB 4ZNEA 5F9JA 3MBED 3V6FA 2GK0A 3BPNB 3S4SG 2EIBA 5AZEH 2DWDB 1CDIA 3QCVL 3ECBA 5CKAA 1N6QH 1QFPA 5I8KL 4HIIB 1QBBA 3EDEA 4QXTB 3ZTNL 4GG6E 1TFHA 4J3UA 4NPYA 4LNRA 3WDHA 4LVNC 2VDNL 4QOKB 3C6SA 3BP4B 3LCYA 2W0LA 4ZPVB 3BZ4B 4Y2DB 4TNVF 4D0BB 2SEBA 1ZLSH 2BNUB 3RP1A 3WN5B 5TF1L 1CFTB 3BP7A 4NZRH 5E2UH 1GYAA 1K3ZA 1BFTA 1BX2B 4A2MA 5EO0B 1EJ6A 1DVFD 2WWMD 5JNYB 5GGVH 4FXGB 4NDMB 4X9HA 3CX5J 4WENB 3TT3L 5TH2A 2X4UA 5B39G 4YJZL 4QNPF 4NC1C 4L8SC 1MFDH 3WXVL 3RA7L 1MFCH 4PJ8C 2UY6A 3TN0C 1SYSB 2FHCA 1NGPL 2HT2C 3MFGB 3L5XH 3TO4A 4LCWA 1VENA 7FABH 2DKUA 3QA3A 1MRCL 3AFLA 4JPKH 1X5IA 1AGDA 5DLMH 1QSEE 1F45A 1WBZA 2BVTA 2ZZUT 4JFFA 1T5XB 3EDDA 1OY3B 4KKCD 3G6DL 4LRIA 1R0AH 5FUZL 1VPOH 5ACMA 3QDJB 4N8VB 3BPNC 2E6PA 4U7MA 1YEKL 4GSDL 2GTWA 2V7HA 4UT9H 1ERNA 1G6RA 2F19H 3V8CA 3ZKXC 2NY1B 3PQYD 4I77H 4L4VA 5EULV 1S7VA 5IW1B 4XCNB 3LKNB 1BBDH 4ISVA 1I1YA 3GSWB 1HHKA 3KHQA 4XC1L 1OTUD 4RISL 2FB4H 3OAYK 5MEPB 3NCYS 3N9GH 4HZLA 3QQ4A 1KB5H 2PO6C 3DIFB 2AK4A 4KHTH 1NGWB 4WFED 4ORZC 1FYHB 3MBXH 4JB9H 4UDUB 5FA3A 1N6VA 2XZZA 4NNPH 3UJIL 1DLHB 1AE6H 4K07A 3BRFA 2AV1B 1FJ1A 2DMBA 2XV6B 4NHCL 3S37H 1FC2D 2C26A 1C5BH 4YZFE 1INEH 2EIZB 1HEZA 2BC4B 4K7FA 4NC0B 1NLDH 3FKUS 1MHHA 4PS4H 3OKLA 5FOBB 2X4PB 2APXA 4HXBL 3LEYH 5J4MA 1OPGH 4Y88A 1H3WM 3SDCB 4H5SB 5FA4A 5HI5D 4WHYG 3MFFA 2DLTA 4BZ1L 3EGSB 5MERB 1EXUA 1SEBB 1QP1A 4G9FE 5EOCL 3VFRA 5ELIA 3DVGA 2EDLA 4NQVA 5CBEA 4BH7B 1MLCB 3KPPA 1IE5A 4JQVC 1AO7E 3E3QE 4LSQH 2XOTA 4YIQA 5BS0A 4YPGB 3VI4E 2G75A 4XTRC 4Y4FC 5K9QG 5A1AA 4XXDA 2WK2A 1JGDB 3MR9B 4PRPD 2MPAH 3B6SA 3IDJA 1S7WB 4HJJL 2WIIB 3KYNB 1BOYA 3VG9C 4OLXL 4JG0H 3QEGL 2H26A 4IDJH 5IR1B 4J12A 5EH1A 1XR8B 3MRIB 5C0AE 1DBBH 2BVQB 5TQ2L 3E1F1 4Y16B 2DB8A 1NL0L 3V4PH 2R0WL 1NGXA 2YXFA 4HIEA 1EK3A 2ZJSH 2WUBH 4QHLB 1INDH 4IHOA 4HS8L 3E6HA 2CK0L 1YMME 4ZAKC 2OJZH 4J3VA 4FFWD 3R8BB 2B20A 3U36A 5EOQL 4YFLF 3MLTB 1T6VN 4ZO9A 5F70A 4C56B 3OR7A 1R3LB 1DL7L 3DXAB 3VG0H 4D0CB 4J8RA 4ORGB 2BERA 2VJXA 4EEEA 5EO9B 5TJWK 2IBZX 3NVQA 5GGRB 4JKLA 5J13C 5CIPH 5GIRB 2OR9L 5KW9H 4QOKD 4NQCD 3I02A 3W39A 4BFGA 1I1FB 5EU4B 3WHXA 4TSAL 5ITFA 2X4SB 5GS0C 4J1UB 5D6DC 4PJ9D 5DXWA 4S1RL 3L5WA 4PJCB 3CVHA 2VDQL 3NA9H 1HHGB 2LAGB 1ZHBB 1HQ4A 1PKOA 1A6ZA 3I75B 1NLBL 3MPCA 5DMIH 1FVEA 2OS7A 2DQDL 2CGRH 1LE9A 3CC5A 2XZCH 3L3DB 4X9GA 4C56E 1EZVX 4ONGL 3QUMH 3X3GH 2Q6WB 2YMXH 4JO1H 1S7TA 2XY1A 2A73B 1YJDH 4H88H 1LO5A 4MAUL 2ZUQB 5J1AA 2ZOKA 1I85A 2BNQD 1GGIH 1LEGA 3H9SA 3SGJA 4FNLL 4Y4FA 3ALXA 5KVMC 3E3QC 5TGBA 1VFOA 4G42B 1KN4H 2O5XL 4JFZL 4K2UH 3G08A 4I0CC 1VPOL 1KIPB 5D5MF 4RGND 1B0GB 4M5YH 1SEBA 4CVUA 5ID0A 4ELMA 1WISA 5INDB 1A7RL 4HD9A 4PY7A 1ZS8A 3IS0X 4OAWA 4Z7VA 1P84J 1MLCA 2WZPD 2J4WH 4I77L 1ZXQA 1UM6H 3F62A 1FCCA 3FB7B 4WFEE 4N9OB 4JG1H 3KXFD 2CMRL 4AL8L 2GSIB 4TUKH 2E3VA 5FHBH 1CICD 4IRJD 5MHSD 3VXRA 1AY1L 2QQKH 2XYCA 4PGDA 3ZSTA 2PXYB 3NPSB 4GO6B 2WWMC 2VL4A 4BA8A 1CXHA 5D1XA 2FD6L 5EU5A 3O0RH 5AUMA 3RVXD 3MV7D 3WXVH 3MLXH 4JDZB 4KMTL 2HG5A 5DUML 4TSBL 3JV4B 5IMOB 5EC2A 2WUCL 1CK0H 4Y1AB 5D2LB 3QFJA 3QDJA 5D72L 1D6EA 1P69B 2RQ8A 1G0DA 2R2EB 4R90L 2YZ8A 1YUHB 1QRNB 1WZKA 1SJXA 1Z0NA 3LQMA 2EDQA 2VMFA 3D0VB 3E0GA 3B9KD 3SHSA 3FRPA 5LJYH 3KLAA 2IPUK 3WIIH 1QG3A 4GT7A 3VXQA 2VXTL 5EU4A 3WHXB 1HHKB 5FYLD 4LAJH 1HH9A 1U8MB 1DEEA 1PG7L 3B3IA 1UH2A 4OGAD 5SX5K 3O6KL 5JZ7D 4Z7UE 5IIEB 3ARQA 4L3AA 1A7BA 4XNQA 4RMUA 1A7NH 2P4AB 2I24N 5T1KA 1D5MA 1GHFH 4FP8L 4JKPH 3FOLA 5TPWH 1CYGA 4GLRI 3ARTA 4C4KO 1G7MB 1XH3A 2IPKA 4LDLB 4OI7A 4FP8H 1N3NB 5MEQB 4ZTOL 5I19L 1TZIA 5J89A 4EDXB 3FT4B 4NPYB 2A0LC 1ZLWH 3TN0D 1P6FA 1GJIA 1TJHL 4J23A 3QFDB 3ARDA 4QGTA 3VXNA 4UQ2A 3QPQD 1WTLA 5SV3A 4OUOA 2WLYA 3ARSA 1DUZB 4FFYL 4LQFL 4F80A 5D1QB 2VXTH 3KJ6L 1U95B 2Y7QB 3TYFA 4TVPD 1S7QB 2AJZB 5BXFA 4YHOH 5E2WL 1I7TA 3KJ4C 1R3IL 3NIDF 2IQAA 4PJ9A 1MEXH 3LQAL 2FZ3A 1GGBH 3QDMD 3LN4B 4FTVD 4P2RE 4N1CA 4YEEA 3WFHA 3WE6A 5MEOB 3X17A 2PCPB 5IBLC 5IMKB 5IVOA 1MVFA 2K3TA 4EBQH 5E1HB 3FZUC 3ULSB 3JV6B 3EDFA 4NJAL 4AEHL 1UWXK 4XI5C 5E2TH 1RPQA 5IQ9A 3EYFB 3VW3H 3GMQA 4MAYB 1MFDL 1RZ8A 3HPJB 4KTEH 4IOIB 2VLJE 1KIQA 1ZV5A 4X7SL 2XWJA 1ORSB 5F89B 3RZCC 3LPGA 2QQLH 1OAXL 1WZMA 5HYJB 5T3ZE 3MNZA 2VLKE 2ZUWA 4LSSH 6CGTA 2ADIA 4KROD 1F5WA 2EXWD 1KGCE 2F9BT 32C2A 1U8HB 1WBXB 4ONFL 5EWIL 4NKOB 1ORQB 5L9DL 3HMXA 1OTTD 5T1DH 4OM0H 5BS0D 1OGAD 2BVOA 3DXAD 3Q0HA 2IANE 3CXHK 4OTXL 5IHUH 3VD9A 4O2CA 3VXUD 3HI5H 2AVGA 2HLAA 3PABB 2OTUB 1G9NL 4Q6YA 3BX7C 2XNAB 1F4HA 5FGBC 1S7SA 5EU3A 3VFPB 2B5IC 1J5OL 1EEUA 1H3PH 5IJKC 4UQ2B 1MCEA 3KPMA 3K7UA 2X1PA 1OAZL 1B0GA 4JREC 2AEIT 4H26B 4MNHB 8FABB 2W92A 1DUZA 3VXSE 1P4BH 3W39B 4EXKA 2DQDH 2X6MA 4IRJC 4OLVL 3ILPB 1TTGA 3NCJH 4O02H 4P9ML 3RWCB 5FO7A 4MA3B 1JN6A 1HWGB 1JI2A 1JV5B 5D6CA 1HSBA 1NMBL 1YMHA 4NRXB 5IKCA 4NOFA 4MA1B 1CDGA 3UBXG 1AFVL 1KJVB 5T1DL 1TZIB 4X4ZA 1A3RH 3ROLA 1ZMYA 3GSNA 5DI8A 4ZXBD 2FJFA 4JFXA 4QRPE 2EC9U 3V52H 4WI3A 2AJYH 5BOPA 1RMFH 5I75C 3F7PC 2OI9C 5A2KH 3PUCA 4H1LG 7CGTA 4YAQA 3B5GA 1HDMA 3U46A 1MRFL 5E8OA 2XTJD 4ENED 3I84A 3JV6A 3WYRA 1KB5B 1NJ9B 5E94A 1S3KH 3SCMD 5FUOL 3UDWA 5I18H 3V0VB 3B9DA 4CVWA 1J1XL 4EDWL 1S7TB 3M8OH 4L4VD 3GBML 3PQYA 5IBTL 5F1OB 4XPHH 3I6LD 2H1PL 4RFNB 3P9MA 1QPXA 2Z92B 5F7EL 3TH4T 3LS4H 3JV5A 3QH3B 1NEZA 2DQIL 4WI2A 2FYYB 5LG1A 5IMLB 4YNYB 3W11C 1I8KB 2DQUH 4M02A 3FFCA 1AGFB 1CZ8H 1I1AA 3RUGA 3STBA 2ICEA 3MRDB 4ODHL 3D3VD 4TNVK 4LCWD 1X5LA 4KC3B 4YC2B 1Q72H 3LB6C 4PJCE 4UUJB 2MNUA 4AENB 2MCPL 4TTGA 1YN6B 4QY8A 4LSQL 3O6FA 2W91A 2GCYA 2VERN 4PY8J 3IFLH 4UINH 3QFJB 4LCIL 4Z8FH 3ULVL 3JTTA 1U8OB 2R8SH 1LP9F 3KPRA 3FL7A 2EH7H 4NRYA 4ZFZA 3MCLL 5FYKE 1SM3L 3B2UC 3MLYL 3LKSB 4KZDL 1C08B 3B4NA 4JB9L 3KPLA 3O4LE 4WW2C 3RDTC 5CEYA 4CAGA 4PJIA 4JFOA 4R3SA 5D7KD 3RWHB 3LKPB 5FV1L 3MACH 1A5FL 1MJ8L 4LVNB 4N0UB 2B39A 4RMVA 5JOPD 2F8OA 1A1OA 5DVMA 1P5VA 1XF2B 4JGMA 5KSAB 2VXUH 3ZKSD 3V4VH 3LPWA 4L4TE 4M7LT 1EEQA 3TCLA 3JUYA 3BT2L 4L3EB 2CDEA 4BSWB 1J86A 1JF1A 3VFTB 5K33A 5F97E 5C86A 5IHZA 2YRPA 4U0QB 3EDKA 1RUAL 3VGBA 4PG2A 4YHPB 3QXVA 4O2FB 43C9A 1NSNL 1P7KB 4KUCD 1YPZB 2Q8AL 4XGZB 1QSFD 3WL9B 3ZKMD 1XGQA 3ORJA 3K4DA 3T2PA 3WEXB 2JTDA 2JB5L 3O2DH 5FYJU 1UJ3B 4XCCH 2NY2C 1LE9B 1FCGA 1S7QA 4G8GA 3QQ3A 4KJQC 1YNLH 4EUPA 3LKQA 4GAGH 3OR6A 3GBNH 5JMOC 3PV6B 4JZOB 1I8KA 4ELKB 3L3KA 5F6IB 1B4RA 4GG6B 4CNIB 1QQDB 1UKTA 3SDDA 1H5BB 3T1WA 1Q9LB 4P2OC 1M05B 2Y72A 3ISWA 1SMOA 4PYHA 5GHWL 1ZTXH 4JZNB 3MOBL 4HEPG 5FHAL 3BW9B 1UYWH 4OCXH 1T0NB 2X4NB 5M7QA 3BGMA 4QEGA 4MXVE 4R4NC 5FO8A 4IRSD 4XNMA 4QHMB 2PTVA 5FGSA 1FNGB 5CMAA 1A0QL 1LQSR 1MCWW 1QR1A 3WS6A 3BEWA 2UZIL 3WS3A 4QO1A 1VEOA 3GSWA 3BKML 3AC0A 4XNXH 5ID1B 3H3BC 2E9BA 4M93B 5INCB 4YHNB 4EI6A 2JIXD 4P46B 5I0ZA 2G2RB 3MO1B 1EVUA 3ET9F 4Z7QE 1KLGA 1S7XB 1NAKL 5IB2A 1CE6A 4P3WA 1ZLUK 5T3ZD 2J8UB 1CDCA 3DGGA 4RZCB 3TA3A 5FYKL 3GEWB 1QLFB 1D5BA 5LAXB 5IKCB 4DUXA 1A2YB 1HXMA 4BSWA 3OJDA 4GRLD 3ZHKA 4ZUSA 1KEGL 1U2HA 5KVGL 5K9JH 4LLWB 2JLLA 1OGAB 3DWTA 2ADFH 4ALAH 3GI8H 3QCVH 4HV8A 3V0WH 2XA8L 2EH8L 5C08A 2DM2A 1BD2B 5HGHA 3NFNA 3OQ3B 4J3WA 2EO1A 4FTVE 4NQVB 3HAEA 4G7YL 4HUMB 4MLIA 1NCDL 2K1MA 4Y19B 4HPYH 3QUZC 4QXTA 5HHVH 4D0BA 1IGTB 2FJGA 2BHZA 4OF3A 1X4XA 4PRHD 1MI5E 2R56H 2ZCHL 3G9VA 2DM4A 3MZTA 3MRDA 3GMPA 4KI1A 3QQNA 1H3GA 4OCNC 1WSST 4F33A 2F53D 1S9XB 4RX4D 1MQKH 3K2UH 3NPSC 1H15A 1X6NA 3IDNB 2E7BA 3O2WL 1S8DA 3DBXA 5F7FA 1OAQH 3VRIA 4XAWL 3WLWC 5DJZB 4Z95H 5GGSB 3MLTA 4OLUL 5IFJB 1JGEB 4X6CE 3BRGC 4KJPC 3QPXL 3O8XC 1LNUA 1WUNT 3LKNA 2DLGA 4LCCA 1OF2A 1QFUH 3GBMH 4FZ8L 3PIQA 1TQCB 5EBLA 3IKKA 3T65B 3A6OA 2G2RA 2WANA 3MO1A 3GMLA 1VKXA 2ZWLT 4OLWL 3TYGL 3OXRB 2X4NA 4Q9RH 5EU6B 1MAML 3EFFB 2R2BA 3T1FA 3X12B 1PGRB 3TNNA 1OTUC 3WFEL 2GEEA 4TULH 3LN4A 3SE9H 3L3IA 4DKDC 1GGBL 1PD6A 4MS8D 4HJGB 2EXYC 2ARWA 3GKWH 4O9HH 1LEIB 5CLWA 3FO1A 3CAFA 4DEPC 3BP5A 4XNYL 3P30H 4XP6H 1FN4B 4NQCB 1FH5H 3P0YH 5F6HI 3X3FL 2EYSA 4IIQC 3SDDC 3EZJB 4Z18A 3AGVA 2AK4B 1SY6H 2ADJA 4HCRA 2DRUA 2Z8SA 4HUVA 3BPOB 4JY4A 3MUGB 1XF3B 3I3EA 5DHXB 5FA4B 5IQ7L 1BEYH 2C3XA 2VIRA 4ZAKD 3IDGA 3PWLA 4P48A 1W8NA 1GIGL 3T8XB 3VGHA 1MREH 1INEL 4XHJC 5C0JA 4ODUB 1TZGL 3GSXA 3OKMB 4QRPD 4S1QL 3RZCA 4RWYH 5D1ZA 3HZMA 5B39A 4PLKC 4XB8A 3C60C 3HCVB 1H3PL 5KTEH 2P8PA 3L9RB 5FF6B 2GK0B 5HHXL 2XNAA 5I75B 2VDLL 4R9HA 3VA2C 5DD5L 2D7QA 1AE6L 1Z6JT 1KJ2H 4I5BA 1A8JH 2VDMH 1ZWIA 3HMXL 5GGVY 3G5XA 4PRIE 1FL5A 1RU9L 4LHUG 3FB8A 5IHZB 5JW4R 2Q87A 3P30L 4XP6L 4J3TA 4XP4H 3T0BA 3LKPA 2DL2A 1PX3A 1AGCA 4JVWA 4KPHL 4PY8I 4IRJB 2ITCA 4FMFA 3T4AB 4L29A 3BP6B 1BGXH 3QUKA 1KCVH 4CDGC 4XBGA 4ZO6A 4NRXA 2FL5A 1NFDE 4NQEA 3WHE1 4WW2A 4LSSL 5EIVA 2P48B 3RDTA 2R9HC 2X10A 2APWA 4PRHE 3TBSA 4GG8B 2HJLA 1F3RB 5BS0E 4I8DA 2CLVB 1KBGH 5EO0A 5JQ6L 4M4PA 4FQJH 2GY7B 3T3PE 3ZYOA 2X9YA 4LIQL 4QWWD 3V7AG 1F11A 5IW6A 2VABA 1XGTB 1BMGA 1OAYH 2ZCKL 3WMSA 4MNGE 1RK0B 1JHKH 4BJLA 1EHAA 5C2UB 3UBXI 5DTFB 5CWSB 3CDGA 4W4NA 1QBMH 1DFBH 5I1AB 3BW9A 1OP5K 3K8KA 5FV2A 3RU8L 3D18B 2DQEH 2ORBL 3P9LA 5J57B 1D5IH 1VFBB 2HA1A 3GHBH 5J06A 1XIWB 3FHQA 1I4FB 3IDIA 1AD9B 3HZKA 3VDCA 2HVJA 1W0VA 2R0KL 5D8JL 3SGEI 3WS3B 2NYYC 3OJMB 2X4SA 3HG1E 2B1HL 3H0TB 2J3SA 1T0MB 1DBKL 1KPRA 1NCDH 5LGHH 4KI5D 1FGVH 2A9ML 4HPYL 3EJYD 3MCKB 4J4PA 2J8OA 3W9EB 4HKJA 3BZDA 2HMIC 1X5KA 2NY4D 4QRRA 1PG7W 3ARBD 1Q0YL 3GI9L 5D7LD 3NCJL 1D9KD 1UEMA 2YR3A 1FNLA 2ZSVA 4O02L 4CADB 4LSUH 1CG9B 1SHMA 2FRGP 5DEZA 1QLEH 3Q3GA 1CD9B 1KCRL 3G5ZA 4P46A 3MJ8A 4HIJA 5CP3A 3CSYB 4NKDA 4H20L 4HH9B 5EUOF 1YEJL 3S36X 3S9DB 3MXWL 3L1OL 1DBAH 2P1YA 2PTTA 2P47B 1FORL 5DS8B 3TZVD 2PXYD 3SJVE 1TCMA 3LOWA 3SDCC 2G60H 3LDBC 4FFZH 3X3GL 1YPZA 1RUQL 2EDBA 2MOVA 3L3JB 4NYLB 5EU6D 1PZUB 4DN4L 2NLJA 3DUUB 5FYKH 4YO0B 1DP0A 4KXZI 3KPLB 2MSPA 5GJTH 4BH7A 2UY7A 3DX9B 3V5DA 4EI5C 5KSBF 1GC1H 2E5EA 3F7VA 3S6CA 1BFSA 3MQIA 4QF1A 3L3KB 4QHNA 3SDCA 1RZ7H 5CEZL 1IT9H 2L7UA 4JFDB 1F6FB 3OJVC 4P2QA 1WQVT 3M1BA 1D5XA 1SBBA 2I27N 1SYVA 1I7UA 1WFTA 4Z7VE 3DX8A 3BD3A 5ACLA 4XVJH 1NAMA 4Y2DA 1VFBA 4GW5A 4M1GH 1JUFB 3SKOB 4P46C 4OLYL 4JGJA 4QTHB 4YPJA 2HAZA 4ZS6D 5DO2D 1I7ZA 4KRNA 1OSPH 5C2BL 4RMQA 3VRJA 2ERJB 3MRBA 3O8XD 5HGAB 5LCVH 2VYRE 3SDAA 4YHKH 2F54A 4TUKL 1RK0A 4X6DF 1CD1B 5D5MB 3MRJA 4OM1L 4Z5RB 4WI6A 4NQDD 2ED7A 3ESVF 2O93L 4JFZH 3CCHB 4P0DA 5IFAL 1V3MA 5M94B 2ZNWA 2PYEE 3D0VA 1FNSL 4YDVA 1BM3L 4YQXL 2LTQB 1GVIA 4OGAC 4MD0A 1T22B 4LPYA 4MQXC 4NZRL 4PRID 5DVLA 2CR3A 4F37F 3RJQB 4KKBD 1KELH 1RU9H 2YPKB 3INUH 2L4OA 1RUAH 5CILL 4BQ8A 2AKRB 5C0BB 4V1DA 1DQQB 3CVIL 3O4LB 1EFXD 3QUZD 4WDIA 4F2MB 5AAWA 1NKRA 4KI5F 5JW5A 1N5YH 4GRLB 3DUHA 3BKYH 4K9EH 1U8NB 2IPTH 2O5ZH 4P23C 3LEVH 1KYOJ 4F7CB 2VXUL 3CXDL 4ODWA 3UZVB 4X6FB 5F9AC 3MRHB 1QRKA 4G8EA 2P8MA 3ZYJA 4NQDE 2GJ6A 4M7KL 4WRLA 1T66C 1L7TL 4W4OC 1AGEA 1PDKA 5FYLE 3FCTB 3IXTA 5DURD 4DVBA 3G5ZB 4WO4A 1BIHA 4UV4H 5CD5C 5K9OB 3BE1H 3QRFM 4L8BB 5ILTH 3X3FH 4MSWB 4OI8A 2GT9A 1ACYH 4H8WL 1LEKA 3ZSSA 4JZJB 4NO3A 4Y5VA 3BI9X 5CILH 3D85B 3HNSH 4U1KA 5BVPL 1DZBA 1A1MA 1WCQA 4LCYA 3RZCB 3X14A 1BEYL 3OKNB 5EOQH 4OCYH 3VGFA 4WVRA 4OI9A 4LVHB 4GMTL 1DEDA 4X98B 3RJDA 1IGCL 1U92B 4PJGA 1AD9A 1PVHA 5DD3L 1UWGH 1RULL 2AJVL 2DQFA 4MNQB 2R1WA 3C9NA 3RWIA 15C8L 3CUPB 1JI1A 1ZK9A 5C0CD 4O58H 5L6YH 3SJVD 3HI1B 1QA9A 2QQLL 4TUJA 4UILL 4UT6H 4UQ3B 1JZ8A 3L6FA 1F3JA 4LSVL 5CZKA 4EBQL 3TFKD 1E6OH 4NC2B 4TN9A 4L8CB 2CUIA 4OT1H 4YDJA 1ZT7A 2MFNA 3DO3A 3HC0A 1J0IA 5AUMB 4PJ5E 4WTWA 2AV7B 2AJUL 4G80A 5CSBA 5I1AA 2MQCA 3RHWF 1NC2D 5IB5A 5BV7B 1SY6A 3MYJA 3VXRB 2YD6A 5ADPH 3S98A 1LO2H 3KVQA 5ISZB 2ICES 3TM6A 2WMPA 5FDWA 3QXWA 2DQTH 1Y6KR 3DSFH 4PJDB 1I7RA 3GBNL 5DMKA 1KGCD 4P4KA 4F7PA 1TNMA 3FQNA 3DRTA 1Z9SA 2OTPA 5KSAD 5GGSA 1OHQA 1RZIB 3NACH 2J6EA 4DK3A 3LQZB 1CLOH 1YY8A 4TRPL 1HSBB 4UOW1 1GOHA 5A2IH 3DJ9A 4B0MM 1T1ZA 1A7OL 2W9EL 3HG1D 3ARPA 3PL6C 4LF3B 4LEXH 3F7YA 3D18A 3P9LB 2NX5A 3ARVA 3JSSA 3GGWA 3OHXA 5DK0B 3R0NA 2WBJC 4PJXE 3RNKB 4D9QD 4PP1D 2WSKA 4PV8B 4J7RA 5FF6A 5F1IA 4ZFGL 1HOCA 2NW2B 5SWSA 3RGHA 3TWCH 2IALB 4XX1G 2XACC 3NIDE 4UTAH 1XCQA 1JZ6A 2EICA 1HYRC 1YMMA 2BCKB 1WZLA 3MGOB 3CLFL 1QSVA 3PWLB 3QDGE 3N85H 3T8XA 4XPAH 5DZLA 3MSPA 3QB7C 5JOFA 4FTVB 1AQDA 4YE4H 4FQLH 1ZGLP 5F96H 2YD7A 4X80L 2BX5A 4MJ6B 3AREC 1W72H 4AG4L 1G6RL 5DVNA 4GG6A 4XVSH 1EEZA 3WIHL 4Q0XL 4NBXB 3RY6C 1ZA3A 3TZVB 3A0OA 4E42B 4Q9RL 2W38A 3EYVA 4UIKH 4NUJB 3O3AB 5I16A 1JIBA 2BZDA 5IFAH 4HUXB 2IADA 1KACB 5GZOD 3UTSD 4PLJC 5F6IC 2NNAB 4UT9L 3H2WA 5C0GB 1Q1JH 3VU2A 1YEIL 3PL6A 4YWGH 4JPWL 1MHPL 3H9HA 4PB9L 1X5HA 2JJWA 1M71B 5GJSH 4GKNA 1RZJC 3MLSL 5FIEA 4GW5B 2D4FA 4JFHD 4D94A 3MLXL 4JO4L 5GSRB 5F93C 2DQJH 1GGCL 3D39A 2AJSL 5KSUA 1NUDA 4MXQD 3QQ4B 1HKLL 2EKSA 3ARGB 4LMQE 4ONHA 1YEDA 3PDOB 5IBUG 3P11H 4OJFH 1QSEA 3EOAA 3IFOA 3VXSB 3MLRL 1KPVA 4FQ1L 4ISVB 5SWZB 2A9NH 2V7NB 4JDVA 3ZKMC 4H0HB 4NSKA 4HS6B 5TDNB 1UXWB 3ARRA 3MLZH 4WHTB 3MRRB 3UTTA 3ZTNH 2FCBA 3UO1H 1N4XH 1IGIL 3TC9A 2HTLC 1MCLA 1I7ZB 2VC2L 4PIRF 3ZL4H 5JDJA 4L8BA 2RHEA 2CH8A 1E4JA 4JO3H 4KDTC 4U7KA 4PTTB 3RI5K 2R0LL 3QT2A 5EUKA 5B22A 2DWEB 2VDRH 2ADGA 3C6LC 3V4VL 1IARB 2YS4A 2H8PA 1I8MA 2XIDA 3T08A 1C5BL 2LFGA 2Z93A 3O4LA 3MJ8B 4HBCH 2YD5A 2DTMH 4GH7B 5KVDH 3VFRB 3GSVB 4JM2B 5FOBA 5BVJA 1XF5B 5B4MD 4PJEE 5EBMB 4PGBB 2JKXA 3IFNL 3WN5C 2YPLE 5BO1H 4O4YH 1T2QH 2EEDA 3PP4H 4ZTPH 4E5XA 2FGZA 1HH9B 2WQ8A 2EO9A 4V1DB 1FVCA 2QHLA 4WFGE 1M1SA 4HIXH 2JF1A 2DDQL 2CIIB 5FYJL 4M6AA 1N59A 5DD1L 1NAKH 4LLVB 1OOAA 2VDOL 3QIUB 4MA1C 1CDJA 2OL3L 2VO5A 2EIZA 4Z76A 3MLWL 3UZEA 3FQXB 5DRWA 4FZEL 1TLKA 4WO4C 3GIVB 1TNNA 2GSGB 3O2DA 3PHSA 5JORB 4XPBL 3AS1A 4PJAA 4U2ZA 3V0VA 5TE7L 2VKXA 2Y23A 3QXAB 1FG2B 4RA0C 1F3DH 1A6TA 4M7LH 5CZXC 1QSED 1WICA 5T5NF 3BH8B 3MOAL 5F3BA 3U46B 2EYRB 1MRDH 3DSFL 1V8HA 3IFPB 4Y4HC 3ZKQD 1HNGA 5CZVH 3NCFB 5HVFB 3FN0H 4GW4B 1YYLL 4JFQA 1GOFA 2CRZA 1QBML 4LNVA 1Z0MA 3V5DB 4OZGF 1EV2E 1LEKB 2L7JA 4KTDH 1GXEA 2OQJA 1BIIA 3RY5A 2GI7A 1F90L 3FQNB 3NCMA 4D0DB 2NLJB 1JFQH 1D6VH 1I7TB 2MCPH 2F5AH 5EUOE 2LE9A 3QUMA 5TQ0L 1TQBB 3QULA 4TQEL 4AIOA 1BJ1H 1AGFA 1I1AB 1UWGL 1V7NH 2HVKB 5H8DA 3S37X 4S2SB 1BZQK 3IXAA 4OZFH 5GIRA 5C07B 4YDKH 1IZJA 4XP1H 5E5MB 4PRNB 3REVB 3CH1B 5CCKL 2F5BH 3ULVC 1BD2D 5F72S 5E08H 3QEUB 4PJ5D 5FM5M 3ESUF 4A6YH 1NDGA 4HS3B 4GBXD 4RIRA 1OP9A 5F8QC 3KPSA 4U31A 4PJHF 5LVEA 5T3XE 1KLGB 3HPLA 2I9LB 2IGFH 1BQHB 2BDNL 5HY9B 2FEDD 4N0CC 2ZOKB 3PWPD 3QDME 1GGIL 3D2UA 4P2RA 1YMMD 3V52L 4IMKA 1DJSA 3QUML 2AEQH 3C08H 2Q6WA 5JXAL 1WAAE 5T3XD 2ICWB 3SQOL 3NH7L 4W6XB 3K3QA 4GKZB 1QZ1A 5FKPB 1JK8B 2P8LB 3FFDB 2H3NA 3BIBX 3KJ4B 3O3AA 3LD8B 4LGSB 4P5TA 3T2OA 3JWDC 4GKSA 5F9OH 5CBEB 4ALAL 5FB8B 5F8RC 4L3CB 3U4EB 1P9MA 1JPSH 4JRXA 3IGAA 2CUHA 1J5OH 4R0LB 1DBMH 2OK0L 4Z6AT 4KZEH 2EE6A 3N1QC 2J8HA 2HFGH 2CGRL 2V2TA 4MCYB 1VERA 4G43B 2NY1C 3FO2B 5KSAA 4K7PH 4D8PB 4G3YL 1C08A 2ZG2A 2IFFL 2BY1A 3HE7C 1TZHB 1UJ3A 2IPTL 3QG6A 5E9DD 1AKJA 2DQGL 2MQ0A 4U1SA 2MKWA 4I3RL 1B0RB 1UACH 2ARJB 5SWSB 3WL9A 3R06B 1EHLL 1M7DB 4X7FC 2GSIA 1JMZA 1QBAA 3BUYB 2ESVE 3SGEH 3BZFA 1HCFX 2X5PA 3NZ8B 3ARED 4NT6B 4ZFOA 2QHRH 1H8NA 5CWSA 4ELME 1FZMB 1YEFH 5IM7A 1QBLH 2V2WB 1CF8H 3PNWB 4JFDE 3GMNA 4G6FB 5A16B 1PYWA 3HNVL 4PBVC 3BGFC 1QFOA 1ZA6A 4FA8A 5E8PA 5DGQA 1KJMA 3QEQD 2WIMA 4TTDD 3TBWB 5ITBL 1JGEA 4XNXL 4OM1H 3UPRB 2A6KB 2WIIA 1G7JA 4OZHF 2AXGB 5DJZA 1AGDB 4Z95L 4TNWK 1KTKE 2GUOB 3OGCB 4JPVL 3HI6H 4PJIF 5IB3B 4KVNL 2GITB 2PYFA 4XVJL 4NUGH 1VFUA 4YZFF 4TPRH 4HHAA 2APVA 2PR4L 3WLBB 4G6JL 4KDTA 1JZ3A 2H41A 1KN2L 2BVPB 1XF5A 2G9HB 2CKBH 1S7XA 5IB2B 1MJ7H 5TDOB 5HDQH 4G6MH 2IANB 1XF3A 4YDIH 1MCRA 4NKQB 5DEFA 3RHWK 3CFCH 4KK5C 4XXCC 5MEND 4RAHA 3KPSB 4LARL 4DFHA 3GRWA 3MRMB 4M5ZH 1NSNH 4TVSa 4LSPL 4Q6IC 5CJ5A 1BVKA 3VXPA 3VXME 3B8SA 2KQNA 4JQIH 4YDJB 2EC8A 3I75A 4PTTA 4U0RB 4U6TA 5BRZD 4AIXA 4XNMB 3U0WH 1RUKH 4M1CC 3V5HA 2AABH 3HZMB 3IDMA 4P99A 4BSVB 3IKCB 3VWJD 1UCTA 1XGYL 1XCTB 3C5SB 4Q74A 3FQTB 4WHTA 4K3GA 2N1KA 1F58L 4HZAA 2D0GA 1XGYH 4KKNA 3RUGE 1T1WA 5DRZB 2NYYD 2VDPH 4LASL 3QQ9C 4G8IA 3T4YA 3ULUH 2DKMA 4B53A 5KVDL 5IBLD 4J1UA 4NN6B 3GJFA 3TA3B 2P42B 3T2QA 1A4KA 1MY5A 3OKDB 4JVUA 4PJXF 1RZKH 3AY4C 4X0KB 1FGNL 3U6RB 3HAEB 4PJ7F 3SDXA 1JHLH 2VB5A 4I0KA 5KS9E 4W81A 3B9AA 4Q2ZA 5ESVB 3WKNA 3PP3K 1HIML 2I5YL 3KNBB 4X7SH 4PJBB 3OBAA 3RTQC 3S96A 3ARDC 4A6YL 1GOGA 3GIVA 3SKMA 3TBSB 3NGBB 1G7JB 4PRAA 4WEMB 4Y4KC 3T4AA 2ZNXA 4V2BA 2ENYA 2COQA 4IIQB 2IH1A 4OSUH 1FG2A 2GITA 3S3JA 4JRWA 4EVNB 4Y1AA 1H8OA 1Y6MR 4OGXL 4QRUB 1NCCH 2EE9A 2ZSWA 4KI5E 4LKXA 1EO8L 3GMNB 5C71A 2C9AA 2APBA 3W2DL 2DQEL 2ORBH 4YWGL 3BHBB 3EO9L 5AYUL 1A0QH 5KS9F 1K8DA 4P9HH 1NCUA 3LN5A 4JEGB 2G75B 1UB6B 3MLSH 1ES0A 2A6DB 2ITDA 3U7YH 2NY5C 4JHWH 1A47A 1KB9K 3VGGA 3MNWB 2DQJL 5GHWH 3O3DA 3GMQB 4MAYA 3MRMA 1GC1L 4HK0B 4WFFD 5JHLL 3HE7B 1HIMH 2I5YH 4XP5L 3QYCA 4XVTL 1MY7A 3LMJH 5HJ3A 1PX4A 2VLKA 1L9NA 3LKRA 4KFZC 3RKDC 1A7RH 1Q1JL 3BGMB 3D0LB 5I1KH 4LLMA 1TVBB 1S9YA 4TOYL 4GAGL 5IVXA 4LOUD 1RK1A 1NCAH 4G3YH 4X5XB 4HUNB 4WUKH 4P5KA 4HLZH 4L1DA 2R2CA 1AO7D 1MCIA 5K9KA 2E9JA 3MRCB 3RAJH 2BY3A 1QKZL 2VZSA 3I2CH 5DYOB 4F15C 2C3GA 3ARDB 3VXNB 1VA9A 5HYJD 2VL5A 4YHIA 4LLDB 4P9MH 1AI1H 2V9RA 4P46D 2X40A 1A6VH 2GKIA 3QO0B 1JTOA 3BAEL 3TNNB 4CKVX 2BNRD 3EYSH 4Z7OE 1MLBB 3DGCR 5J9PA 4YX2H 4XP9L 4DN3L 4QRQB 4WFFE 1ZVYA 1KENL 1R3HA 4M03A 3QNXA 2H32B 3EYUL 2NY4B 3GO1H 2FR4A 5IM7B 1U3HD 3T0XA 3IJSB 4XCFL 3MV11 4YO0A 4HF5L 4D3CH 5MEOA 3IYLW 1T1XA 2PETA 1IGYA 4ZFGH 1YEEH 4Z0BH 2W65A 1AD0B 1CBVH 4I2XA 4WW1B 1XGUB 2Y07L 5DS8A 4ZMAT 5T3XL 1A9BA 3KPNA 5DJCA 5JXAH 2VN4A 1U6AL 5BQ7B 4K23L 3FO0L 2GAZB 3OGCA 2DQFB 4MNQA 4Z78A 4X6BA 4ZS6C 1XFPA 2VWEE 4U49A 4PGZA 5EUOB 5K59F 1T3FA 4PJ8A 1HILB 3OMZA 3GKWL 5E03A 5GGTH 1Q0XL 3EFDH 1MJ7L 1MPAH 2NW3A 5CD3A 5C0AD 2BVUA 4UINL 1IGTA 1YY9C 5C07E 3CJJA 2B0SH 3P0YL 2V2WA 1JWSB 3S36H 5JNYA 3SKUD 3DUSB 4OGYH 1BZ9B 1UB5B 4XCEA 1I9IH 2X4QA 2EC9T 3K81A 1SBSH 3T0EC 1INQB 5HGDA 1UXSA 5DEGB 1E4KA 4N5ED 5D1QD 5C6WH 4XC3H 3HAEG 1N2RB 2HWZL 1SBSL 2AGJL 2HLAB 1A6AA 2F54E 2XWTA 32C2B 3MRNA 3HE6B 1EHLH 3CVHH 1FPTH 1NCBH 3SGKC 4P2YA 1F4WL 4FOMA 4NGHH 1JF5A 4APQB 1QVOB 4PLNC 5JTWA 5HVGB 2CDFB 4EUPH 1HHJB 2ZP0T 3VD4A 1B9ZA 2IBZY 2ZCLH 5IEHA 1UQSA 4U3CA 4ELMF 2OSLA 5GGQL 2G9HA 5AYQA 5FUCE 1WT5C 4ZDHA 4NP4H 5IGXL 3C5JB 1YNKL 3A67H 5EZOH 1IC5L 3WFBL 2FGWL 3PE9A 4Z7WA 3EW3B 3R1GH 4QHKI 4XNUL 5DQ9A 4PJHE 5ESVA 4JR9H 1JMXA 2VDLH 5EZOL 5HY9A 4UV4L 3RL1A 1IGML 2YKLL 5KOMC 2E27H 4JJ5B 1C5CH 5C0AA 3DMMD 4DZ8A 5HHQA 3FN3A 3DV6A 4JPIB 5LQBL 4KJYA 4PRHB 4HIJB 1KOAA 3N1GC 3ROLB 5HI5C 3K0WA 4PJEB 2DTML 3OV6A 1T21A 3RX8A 4BM7A 4PG2C 4UTBH 3I6GA 4F7MB 3T4YB 2AI0H 1SJVA 5ADOL 1FIEA 5KSBE 4ZUVB 1FGVL 4R4ND 1M7DA 4J3OC 4XVUD 5HXMA 5E8NA 3HI5L 2WBJD 2UYLA 4R4FH 5JXEC 4X99B 5I2IB 5ERWA 3OKNA 3KAAA 2V2TB 2ID5A 1ND0B 4DAGL 3RKDD 3O9WB 3Q6GL 1JYNA 3WEXA 5F44A 1U36A 1RD6A 4PRAB 1KCUL 2IQ9H 2RGSA 3QQ3B 5ALBH 1DBKH 3U9UB 4HK3N 4NCC2 3IU4L 1T20A 1G9EA 4NFCA 5IW3A 3I50H 1U8IA 5J56B 4K71C 3WV0A 1R3LA 2GYSA 4X9IA 5EU6E 5INCA 3OB0K 1GC1C 3GSOA 1P53A 4HH8A 4X5LA 3W82A 2HLFC 1BBJA 1EO8H 3V0AC 2VNCA 3VD5A 4ZYKA 1JGVH 3UCRA 4LVEA 3UJJL 4JQXA 1UADC 1M7XA 5FO8B 3L5XL 1JHKL 1I8IB 1IRAY 1CD8A 2OLDA 1TPXB 2A38A 3SY0A 5HYEA 3UTQB 3ILQD 1JWUA 2XZAL 3UZQA 1XF2A 2FBJL 3B8YA 5C0BA 4Y8DC 1RZ8B 4B50A 4MZ2A 3G6JA 2YPKA 4FFZL 2G60L 1AIFA 1RURL 1KCUH 4O2EA 2X7LB 1MIEH 4C58B 5BVJB 5GGSY 4PJIB 5I73B 4OD3H 3HHRB 1Z2KA 2C3WA 2VDNH 4HMDA 2VZTA 2Y5EA 5DJDB 1IM3B 3BKJH 1F8TH 5F1NB 3PP3H 3DV4A 3MV7B 2N4IA 2VLLB 1G7PB 1SMAA 1BQHG 2HFGL 2IALA 4UUJA 3L1OH 4OCWH 4G8IB 4QNPE 1CDHA 2VL5B 5F9JB 1OT1A 3MRFB 3L7EA 1ADQA 3U0PB 2GFBB 2LAAA 3UPCA 4D9LH 3OKEA 2VLJA 4F57L 2VITB 4DGIH 5C08E 2XT1B 1D7FA 1CLYL 4HC1A 2ADFL 3KHOA 4TOYH 4KKLC 3CSGA 3QPQC 4F8TA 4DFIA 2WWKO 4MB4A 1U3ZA 3C8KA 1PEWA 3QEHA 2APTA 4E41B 1QO3B 1NCTA 5I1EL 4PRPE 2HFEB 3NACL 3L3GA 2Q7YB 4JQIL 1RY7B 2P46B 3TBYB 2VXSH 1YNTA 1T04B 3G6DH 1X4YA 4M3JA 1U8LB 1MI5A 3AB0B 3BIKB 5F1SA 1F4XH 2I9TA 2FECI 1QSEB 2X1XR 1B88A 1CFSA 3MRNB 1NCNA 3DX7B 5JZ7C 5ICZA 3MYZA 4LDEB 1B4JL 4WU7A 5FHBL 1HEZB 2BC4A 3QNZB 4Y19D 4YHML 1HHIB 2DLFL 4QCIB 4ODHH 1LILA 3TIEB 4I48B 3BQUC 3LS5H 1MRCH 4P4RB 1AGBB 3WKML 4K55A 4BQ6A 4HAFA 3X13B 3MV01 5D70L 5I8CA 4HMEA 3NIFF 1OM3L 1YUHA 1T83A 4JFFE 5I74C 2YD4A 3CLEH 4C59B 2GJZB 4EI6B 4N5EC 2V7NA 3PWVA 2CIKA 3AAZA 3KDMA 3OKKB 1CFQB 1FAIH 4X6CF 12E8L 2J8UE 2UV3A 1EVTC 1MSPA 1QYGL 1N26A 1KC5L 4RAUA 2J6EH 5E56A 1EO7A 4NSKB 3CFKB 1OCWL 4U1LB 3T0AA 3O81A 3LD8C 4HUUA 1IGCH 3IDGB 4NQXB 4D0CA 2BSTA 1LO3L 4FXKA 1XT5A 3OX8B 4NQDB 5J6HA 4YDLB 5DDHB 3QNYA 5JUEL 2EXYD 3Q1SH 1E4XL 4MDIA 2YD1A 1P4BL 1C16A 3G5VB 3MV8B 2X89A 3VXQB 1DBJH 3W0WB 4XVUC 3OSKA 1X7QA 1NMBH 4Y4HB 3T0EA 5I71C 1DUYA 3QIWA 1QSZA 4AYFA 1F6AA 2AK1L 5DC4B 1E4XI 3L5IA 1FG9C 1FFQA 4U33A 2UZYB 1DLFH 3EYSL 5DJXA 4PJEA 2OJEA 1OQXA 4ZOCA 3HUJE 5E5RB 1RQ5A 1H15B 2AK1H 2YSSB 1MREL 3O11B 5GS0H 1RVFL 3LQZA 3L5WB 4PJCA 4YDIL 1QSFB 2R29H 1L0YA 5GGQH 4E5XB 3Q5YA 1AKJD 1XGTA 2VXVL 5E7BA 1HYSC 3QUMB 1X6LA 2Z4QA 1YNKH 3A67L 5D2NB 5E8PB 4TULL 1NPUA 4PFEA 3O41A 3TBVA 3Q1SL 5BJTA 5FECB 2CJUH 4ONFH 1RZGA 2C7UA 4IM8A 1RI8A 1TIUA 1CL7L 1DL7H 5HGGS 5DJ2B 2J88L 5KOVC 3IDXL 2IG2L 3K74B 4HDIA 5ID0B 4LDOB 1OGAE 3HB3D 1YDPA 1NDMA 5T1LD 3EOTL 5JW4M 3E2HB 3FB7A 1WCBA 4XP5H 1A1NB 3P73B 2F5BL 2M26A 2ATKA 1E0OB 5MENB 1QFWI 3SPVA 1I9IL 2KH2B 1E4WL 3TJHC 1V3JA 2F5AL 3IFOB 3VXSA 2XQYK 4WCYL 4BKLA 4RBPK 4FXKB 4EI5B 4NNYA 3NIFE 1M4KA 3Q6FB 2EDDA 1EFXB 1RMFL 2PO6A 5TE7H 1U3HB 1P7QB 1AR1C 2PXYC 2X4RB 3O3EA 4R97B 1ZGLB 3P3YA 3OKMA 2OL3B 3DLQR 1Y18A 1U42A 1XZ0A 1UZ6E 4QRSB 1MRDL 4JKMA 2N7AA 4TTDC 4Z0BL 1P2CA 4KV5E 3L3JA 1U8MA 4XVSL 3E2HC 1ULVA 5DJXB 2BNRE 2FECL 5F7YC 4BQCA 1FLTX 3BO8B 3DECA 5HHPB 4JKWA 2H9GB 5E6IA 3C5ZB 4MQSB 5JXED 3CC5B 4NQSA 1MUJB 2QSVA 3GSUB 3EJZD 5D2LF 5ITFB 2VDKL 4W6YB 1HWHB 3C08L 4C56A 4GQ9L 4LEOB 1NBZA 1PLGL 1S9WA 2MWCA 4F9PC 3MBEB 1ZLWK 1CTOA 2XKNB 3FQRB 2UUDH 2XG5A 1CFBA 2QSCH 3CZFA 5L0QB 4GAYB 4WJ5A 4HEME 1JRHL 4YHZL 2DLHA 3JXAA 3C8KB 2XPGA 3UO1L 4MX7A 3WCYA 3JZ7A 1YNTB 3ZLQC 4X99A 1JNLH 2YZ1A 3M17A 1KTRL 1FFRA 4M8VA 1FL6A 3SCMB 1FAIL 1RUKL 2R0KH 4FQ1H 4KKLD 2EEAA 3NCEB 3VH8B 3PGDB 3C87A 4FRWA 4KU1A 2YA1A 2B1HH 3SE8H 2A6KA 2BP3A 3GSNH 1AXSB 5E2TL 3U4BH 1A14L 5I66A 4PJAB 2X4OB 1OP3H 3O3DB 4HWBA 4JPKL 5DLML 4GG8A 4WFHE 5F7HA 4LIQE 4R7NB 5D2LE 2E7MA 3ALWA 5TGBB 2X05A 5A3IC 4P5MB 1JYWA 2B1AH 2R2HB 2HG5B 4JG1L 2IEPA 2NXYC 1A6TB 5E8DL 3UPAA 3DYMA 3MNZB 4PJDE 5CD5D 4NQEB 4MXWL 4A6YB 4F58H 2C4FU 4WU7B 4MHHI 2QBWA 1KPRB 5GGRY 4M43H 1KIQB 3SDAC 1MFBH 1T83C 1N7ML 4FABL 5B8CB 2NY2D 3MRGB 1A6PA 1EGJA 5FYJH 1DSFH 1CF8L 1IEAB 4YH6A 3S5LB 3RGVC 3O6FC 4R2GB 5GRUH 2WBJB 5I8OH 4HUUB 1F00I 2ARJQ 3O2DL 1WFOA 5ETUA 1NFDF 3ARZA 5F7NC 1OB1B 5J6GA 4HLZG 4AT6A 5LQBH 2W07A 2OK0H 4KKBC 4Z7UA 3UTTB 3HCVA 3TBVB 3PP4L 4ZTPL 1JK8A 1CWVA 2VDPL 5GS0D 1CVRA 2XPGB 1CFTA 3LH2H 6FABH 1IC4H 5B8CC 3QSKB 3H0TA 1RUML 2NTSP 1HZHL 5C0NC 3MUGA 1AGEB 2JELH 1F58H 1CL7I 1PQZB 3L3HA 3BDYL 5IB1B 1NMCB 1D5XB 1GIGH 1RURH 3ZYIA 4BK4A 1HILA 5HDQL 1BVLB 3AU1A 2D9CA 1Q9WA 5KBNC 1S5HA 1A3QA 3NZHL 3LHPL 1K2DB 2D2OA 5KG9B 3NABH 2ITCB 2B2XL 4N5UA 4QF1B 4GG6F 3QDJD 3SDXE 4ZOAA 4W4OA 3RVUC 4LPVA 2FJFB 1CFSB 1BAFL 2A1WH 4P49A 5C09D 3UJJH 4RFEA 1XGQB 5TE4H 4N68A 3G5XB 2ILLA 3K46A 3VWJC 3FT2A 4OD2B 1AR1D 5H35A 4R4BA 4N0RA 1JPTH 1RIHL 4KVNH 1HH6A 1UM4L 2DICA 4MWFB 2XTJE 4PJGE 2VLKB 1NJ9A 5E94B 5FYJD 2JE8A 4J4PC 1DFBL 1XZ0B 4MA7H 4X4XB 1MI5B 2A6IB 1S9YB 2B4CC 4GAFB 1IC7H 1TETL 3RU8H 4XBGB 2HT4D 2FHFA 2VAAA 2W9DH 4RDQG 3L3GB 5F3BB 3NAAH 3S3PA 3VDAA 1DE4A 3U7WH 3EOTH 4OZ4A 3DROA 3IU4H 1I4FA 5I1HL 4LK4A 1U3HA 15C8H 2J2ZA 2MPAL 3HS0A 4Q97A 1QTYT 5IOPA 1T66D 3ZKND 5E4EC 3ULUF 1ES0B 4X5XA 2DQHH 1N0LA 4UILH 2XN9B 5E6YA 4MJ5B 3FOMB 3TN0B 4P4KD 1A1OB 3H9SE 5JW4N 4ZUUA 5JPMA 3QRGL 3D25A 4YHLH 4L8SA 4G8FA 4JM2C 3DNKA 3QG7H 1E6JH 2DI7A 4MAUH 1A1NA 1U8OA 2X4TB 4K7PL 5IVNA 1KEML 2VQUA 1S5IL 4DK6A 1H3TA 4DZBA 4Y4KB 1W72L 3C6LB 3MNVB 3GUTA 1A3RL 2XFXB 4PP2B 3BPOC 1FYTA 3RTQB 5CJ8A 1R3IH 4ZFZB 3MODH 1DQLL 2DMKA 3WFZA 5EOCH 1M6OB 2AJYL 1TTUA 1ZSDB 5D71H 4FQ2L 1BECA 5CEXB 4OIIH 4MHHG 1HXMB 4FQXC 1FORH 1RFDL 5GISH 4NJ9L 4F9LC 4HXAL 4JDTH 1QSFE 1B3JA 1NC4B 3PXHA 4HULB 4FQ2H 1A6VL 3MXVH 3AXLB 4WV1B 3VXRE 1CBVL 5SWSE 4F3FB 3NA9L 1NFDB 1J10A 1FHGA 3KYOA 1JNNH 4MAYD 4TYUA 1DANU 5HGBA 2H2PC 1EDQA 1XGUA 5AZ2L 3JUZA 1Q38A 1XGPB 4J2XA 2XN9D 1YQ2A 4M9OA 2JCCB 4XNYH 43CAB 5FKPA 2NXYD 4IMKC 4Y7MA 1BF2A 3QDJE 2OJEB 4DUVA 3WXWH 1AD0A 1W0YT 4UI2A 3WFDL 1HN1A 5DSCB 4O9HL 1MIMH 4PGEA 1IKNC 4G80B 1R0AL 2M1KA 4FXGA 3IF1A 3QUXA 2QQQA 3BMVA 2V5SA 4OUUB 1NANH 1N7MH 1L7IL 5DT1L 2FH6A 5KSUB 4JGUA 5GZND 4QWWC 1H9VA 1MCPH 3LIZH 1FZOB 1I3RB 3CUPA 2QSQA 4XT1C 4X6EB 4PJGF 3CLEL 3V7MA 3V5KA 2NY5L 1WWAX 2A9NL 2ZUTA 3EOYG 4L5FL 2OI9B 2IBGA 1CDBA 4M9PA 3NTCH 3OF6D 3F5WB 4O51B 2DJSA 2NY5H 4PB9H 4MS8C 1EJOH 3TPUB 4HX1B 5HDLA 4LHUB 3BDBA 4FQCH 3L5JA 1P7QD 3EHBD 2YWYA 1W0WA 3FO0H 2J5LC 4BZ1H 4PRIA 1IM3A 1MCOH 25C8L 2D7MA 3MRKA 5EBWA 4PJ9C 1T89C 1WZ1H 4J8RB 2ITDB 4WFGD 3RWGB 3EAKA 1GGTA 4ZUWA 5EBGA 5H2BB 5C0ND 5C08B 2X4UB 1P4IL 4Y19E 4UDTB 1KG0B 4HIHB 5L0QC 1LD9A 4UIMA 3ROOA 2ESVA 5IEHB 5BRZA 4MJIE 4HHAB 4YBQC 1FNAA 1JHLL 3S34L 4NQUA 2R2HA 2ZUVA 4OZHE 3VXOB 3IAPA 4QHMA 3QIWD 1L7TH 4PLKD 2NY0C 5BO1L 3T0ED 3UJIH 4G9DA 3RNKA 4X5WA 1BQSA 2P5ED 2VE6B 2ICWI 2HKFL 4D3CL 1D5BB 1I1CA 1RJLA 2NX5B 3QCUL 1YYML 3STLA 3HFML 1FZJA 5EC1B 1U8QB 4L9LC 1R5IB 2HLFD 4F15B 3HUJB 1KFAH 2AI0L 1GCFA 1MLBA 2MJWA 1K4DA 3LDBB 4NZTH 4PPTA 5CEYB 1MH5B 1OP3K 3SKJL 3MV7E 4S1QH 1RIUH 1JF6A 3GI8L 4ZOBA 4JY6B 3TH2T 4OZFG 2YUXA 2FX9L 5I1KL 1A7NL 5E0QA 2HT4C 1CLOL 4NWTL 3LRSB 3FB5A 5DVOA 5JR1H 4KMLB 3GMPB 4G42A 2P5WB 1ZANH 5I9QB 4CN1A 2XQYG 4LEXL 3BKMH 4Z7QF 3GJFB 2YHGA 5E00B 3SE4C 2PW2B 4JFFD 1EAPB 1H5BA 3BKCH 5INDA 1ND0A 1K8IB 5SWZA 4PJ8B 5CFHA 3RWIB 3CZJA 4I4WB 3WDJA 1U3YA 1BFOA 4Z78B 1JGLH 4UQ3A 4HS8H 3ZE2E 2HKHH 4JHWL 2NR6D 4LSRL 4MA8L 5GRYA 4LLYA 1I8IA 2D3VA 2AXFB 4NKMA 5DJCB 2BNQE 5HPMB 3V6BR 3VFGL 3H9YA 2IAND 5CJQH 5EBLB 4XPHL 3VWKC 1G7QB 4NQXA 2BVQA 1TETH 1BBJB 3QULB 4J4PD 5ID1A 2N7BA 1PJ9A 1U0QA 2H26B 4S2SA 1JHTA 2YUVA 4KJWC 3RIAF 4JFED 5DEGA 1C1EL 1A6UH 4R8WH 3GSNL 4CADA 4LSDA 2HMID 4U1JA 3CPLA 1HK6A 2ED8A 2M8XA 4U7SA 1PW3A 4AT6B 1OTSD 4LP4A 1BREA 2EYTA 4UU9B 5SX4I 1PSKH 2IFFH 4P2RD 4P23B 3SGJC 1F4AA 3ILPA 1KV3A 4W68A 1TMCB 2EYSB 4WUUB 2O5XH 1FYTB 3RTQA 3I02B 3AMKA 4Y4KA 5KVFL 4Y4HD 5DUPH 2FEDC 3MXWH 1KJ2L 4N0CD 4GRMB 4D9LL 3IAQA 5AG9A 5E1AB 2ZSVB 3T0WA 3QWRA 2FDBP 1AHWB 4CGTA 1A7PH 1YJDL 5LGKA 4PJ5A 1YEEL 5DUPL 4OUUA 4OCSH 3QG6B 1LK2A 3P4MA 3QDGB 1N59B 3GMOB 1IBGH 3ZHDA 1ZT4B 5GZNC 1FRGL 3C09C 1PKQB 5C0BD 4B7IA 2Q7YA 3T0VA 5D7JB 3R8QA 5KANG 2IF7A 4KQ4H 3CFBA 4U6YB 1I8MB 3DI3B 2BJML 4K3JH 1TITA 1VADB 2APFA 1BHGA 1I8LA 2HFEA 1JBJA 4ZAKB 4EN3A 4K9EL 1Q72L 4P57B 1UCBL 4WW2B 3RDTB 2WWKT 1FFNA 3BJLA 4HFWB 4BFIA 5FGRA 1X44A 2NX5E 3WNLA 3IJYA 1MNUH 3BP6A 3Q48A 4Q6IA 1UKQA 1FH5L 4X6EA 5D7LB 3UTZA 1CGWA 2A73A 5IW6B 5D1ZD 1A4JA 1J05A 3VE0B 2Y36L 5GGUB 2JJVA 3RL2B 1QFHA 4PLOB 3IDYC 4Y4FB 4HWZB 3HPLB 2XI9A 2D0FA 3LSOB 4JN1L 4PR5A 5IJVA 1OAKL 4PGEB 1EZVY 2OTUA 4R7DA 4L8DB 2FL5B 1JGUH 3RQ3A 4M93C 1DVFB 2P49B 4LLUA 1EGJL 2DQIH 5C2BH 1FNHA 4I9WD 4MYWB 3V6ZA 2FLRT 3GSQB 1AIFB 1FIGH 2OM5A 2NTFB 3BESR 3C5ZA 2X4TA 3OWEA 5CZVL 3HMXH 2W9LA 5CJOL 3O4LD 1XF1A 4ETQA 5H37G 2JJTC 5E1AA 3EIFA 1TJHH 5DMGD 4MJ5A 3T3MF 3D1MC 4XP4L 1U8PA 3UYRL 2B2XH 4HX1A 4LPTA 1J12A 4P3DA 2H3NB 3IJHA 1N8ZA 3I6KB 1DLFL 1RJYB 4JRXB 5T1KB 3VFPA 1RVFH 3MLUH 5BMFL 2O5ZL 1CR9H 2F8VA 2HTKC 2VUOA 3EDJA 3NZHH 3D39E 1FGNH 3MNVA 5IIEA 1BX2A 4XXCA 3ARBC 2X1QA 2Y5TB 1BQLH 1FVDA 3STLB 4RX4A 5SV4A 4QLRA 1VFAA 3WNKA 5K9JL 1BQHA 1IAMA 1J88A 3J8F7 3PWPB 3L3OB 1QLRA 2DJUA 2E6QA 1BJ1J 2NXYB 3V7AE 1WEJH 3RI5F 4NQTA 3TYFB 4HWNA 3SEPA 3TO4B 5IEKA 4OD1H 5FUCC 1LWRA 1IKFL 1P9MC 5ENWA 3FRPG 4QRUA 5I1HH 5HYJE 5IB3A 4M61A 2BRRH 3CDFA 3PL6D 5SWQA 4NQEE 4YBHA 5FGBA 1PZ5A 2DOCA 1CIDA 4Z0XA 3LSOA 2F58H 4DGYL 5E00A 3DETD 4RNRA 3K4AA 3UTSA 1OM3H 1H3XA 4LHQB 3IDYB 4YHKL 3RVTD 2LV4A 3ARUA 1T7YA 4GMSL 3BEWB 4OJFL 4WFHD 4Y1AE 3ULSA 3RTQD 1PYWB 1CGUA 3GNML 4WCYH 3MYJB 4PJ9B 2HVKA 5JHLH 5IMKA 3SDAB 1NGQL 4H1LB 2HRPL 4MD4B 4WWKA 2AERT 5FDWB 2HJKB 1RUPL 2PO6D 3MRJB 3U7AA 1NC2B 2HJLB 5FM4A 1NCCL 3UBXB 3CFJA 5D7IA 4WHCA 4Y2DC 2NZ9D 4GBXB 3KS0J 3UP1A 1AQKH 2NY7H 4ERSL 1YY8B 5DO2C 4P2QB 4NKOA 4HWUA 1RZJH 3W5MA 4QYOB 5HDBF 3MNWA 2EDTA 4YXLL 4JFEA 1G7LB 1F4XL 5DA0B 4IBLT 3W5NA 1QNZH 3VMPA 3WIHA 3QBTB 4OZGE 1ED3A 3VD7A 1NUFA 4EZMA 1ITBB 3P4NB 1WBXA 2IANA 1OD7A 5IF0A 5I1EH 5C0DA 3H7LA 5IMMB 2EDWA 5CKGA 1YZZA 5EOTB 3O2VH 5HVHC 4LVHC 4NQSB 1KCVL 3VGEA 4ZODA 4M7JH 4GAJL 1R24A 5BW7C 3TJEL 2BNRA 4IOSD 1FE8H 2OZ4L 2DDQH 2KKQA 4F57H 3VJ6B 1MOEA 2KZ1B 1S7RB 1NBQA 1IMHC 5A3ID 4J6RL 4X6CA 1IGFL 2DMCA 4P23D 4P2RB 2Q1EA 4GRLC 5C09B 4FQLL 3HFMH 2EIDA 3L7FB 4IS6B 2X70A 4DVBB 1ZHKA 1MELA 4OIBA 1JV5A 3ELAT 2XXCB 5KVGH 3WFCH 1P4IH 4OQTH 2NPLX 3RGVD 1SJHA 3VCLB 3TT1H 2VLKD 4OGZA 1S9KC 3JWNC 5FOJA 1LP9A 1XIWD 4U1MB 3S34H 4I2XE 3L95A 1IGYB 3BPCB 1F2QA 3FOLB 4MJ6A 3WN5A 2HN7B 3S35X 1UC6A 5CSZA 3B5HA 1SJEB 5CMAB 3JTSB 2Q76B 3VXMD 2D7PA 1K5NB 1WC7A 4PD4K 3EJZC 2R1XA 2ICCA 3OKOA 2QR0B 3OAUH 2HWZH 2BSRB 3PDOA 1AY1H 2QQKL 3TYGH 5HHME 5HPMA 2X4OA 2P5EA 5IB4A 5B38A 1FL3B 1LK3L 3I3BA 1RZGB 1A14H 2CPCA 3FOMA 2ICEB 2VH5H 4PRPB 3GSNB 5DI8B 1U8JA 1CD1A 1LO2L 1KTLA 2FYYA 3E8UH 5GGUA 5J3HC 4PRDA 3HNVH 4XHJD 4FQIH 2J7LA 4KGLA 1NCWH 2EE3A 4AEFA 4RMSA 4HGKC 2FX8H 5I9QC 1KLUB 3B9KC 5HI4C 4IDJL 2DM3A 5DHVH 4M5YL 4NM4H 4XB7A 5IVXB 4P4KB 4LKCB 1R3JA 3P4OB 4JREB 5CZXD 2WLZA 3O6FD 1I8LC 1P7QA 4B7LA 1OP5H 5F7EH 5B8CA 4DKAA 3G6JF 1I9JH 1JPTL 1RIHH 4JFYA 1TVHA 1A3LH 3GJFK 4UTBL 2DYPA 3D3VA 5D7SH 1QUNA 5C0CB 5EBMA 4K7FB 4TNWF 3ARYA 3O4OB 5ESQB 1DN2A 4HV8B 2PKDA 1I1AD 2FLBT 3TESA 3Q5OA 4M7LL 3HNSL 4OQTA 3GMRA 1WVZA 5HGHB 5IEKB 3DTXA 4XCYA 3ULUL 1RUMH 2H9GA 5E6IB 3RY6A 1A2YA 5B3JF 1KXTB 1HINL 1UT9A 2FATH 4TSCL 4UOJA 3H3PL 3IT8D 1X5AA 4LAQL 5CP3H 3QUXD 4OAWB 4TUOB 1ZT1B 3FAXA 3BVNB 1QHPA 4K8RH 5D1ZC 1I85C 4JR9L 1VGKA 3CZFB 1JVKA 4XPGL 1M71A 4Z7NE 2GAZA 5KVEH 5DD6A 1H8SA 1A1MB 4LCYB 1PY4A 4DUWA 4XCEB 3TV3H 1A3LL 3KXFE 4S1DD 3EGSA 1ZLVK 3SKNB 5JLZB 4WW1A 1LEGB 1CTNA 5GS1B 4G8GE 1EERB 5FM8A 1QFWH 2HJFB 1XMWA 3VXMA 3EYVB 1A4KB 4EN3C 1L0XA 4LPUA 5DWUL 3K8MA 3BGFB 4ZFOL 1S7WA 4OFVA 4X6BB 3C2AH 5H35B 1BVZA 4HUXA 4A2LA 3QEQA 1Q9LA 5DJ8A 2DTSA 5CHNA 1WAAA 4RRPA 3PL6B 4H25B 5DHYA 5C8JB 3OGOE 1XIWA 2B4CH 3S88L 4JDZA 5CIPB 3VW3L 2AQ2A 2Z35A 2UUDK 3GMLB 1WFUA 4ZSOA 5GRXG 3MV9D 5CGYC 1W0VB 4L8DA 2W60A 1BD2E 1NBYA 4OLXH 4FHBD 3KXFB 2B4CL 5EU6A 5GRJH 1G7HB 1IC7L 1UEYA 4R7NA 3HE6C 2IC2A 4X4ME 5JHDE 2FX7L 3DXAA 2PXYA 5DRNB 3KYKH 3D69A 3T65A 4RCAA 1MCFA 3RL2A 5E2WH 1UWEH 2R0ZH 3DMMC 3SDXF 1JE6A 1AXSA 1ED3B 4U1HA 5EO9A 3SE4A 4Q7DA 4WI8A 3MBEC 5JW4Q 2EEBA 2Q20A 3RL1B 1U58A 4KWUA 3VFWB 3EFDL 2VITA 3QJFA 1AO7B 5I76B 5MI0C 3EYQD 3T77A 2ZPKL 1J1OL 2FBOJ 4NRZA 2YD2A 2AXHA 3AM8A 1LGVA 3F7YB 4ZS7L 1N64L 1J0KA 3B2VL 3MA7B 2K7PA 4P5TD 1I7RB 4CMHB 4OLEA 4QXGH 1FYTE 4IMLB 1T2QL 3QO1A 3GO1L 2GSGA 2EZ0C 1ZSDA 4RQQA 2ICWJ 4R96A 5IB5B 3UMTA 1C8PA 4YHYC 3U30B 5DJYA 5DMYA 3QQ9D 5GS2H 4HKXA 4X6CB 4DN4H 3BKYL 3ZKXB 4NZUL 3PWPA 5MEPA 2OZ4H 3LVEA 3MLUL 1S7RA 4FTVA 4P4KC 4NNPL 1LO5B 1CXKA 1NGYB 2VSCA 3KPSD 1IGFH 3EBAA 3BAEH 2E7LC 3BUYA 1DQJB 4ZO7A 3DMMA 3MFFB 1NC4D 2AEWA 4NO0D 5GRVL 2PYEA 5GRUL 3HZYA 4LLWA 2WW8A 1FLRH 2IADB 1DN0B 4LSPH 4HMCA 4PRDB 2DIAA 4ESKA 4KMTH 1ORSA 3TBYA 4LHUA 3VWKB 3MROA 4CU8A 3H42L 3U9PL 5CD3B 1CK0L 5E8EA 4V1DE 4WNQB 5LBSL 1FIGL 2YA2A 3CFCL 2HJFA 1SEQL 1R5WA 4JHAL 1IGIH 2KPNA 4MQXD 4N8CL 2KL6A 5IT2H 5KZCD 2XRAH 1JGUL 3DX6A 2CLRB 3AU1B 1U8JB 3IU3B 1F3DJ 1DQML 35C8H 2AJSH 1MCNA 2XRAL 1EJOL 5DDHA 4MJ2A 3UAJD 4I13B 1FDLL 3GNMH 2FO1A 3P11L 4AL8H 5DFTA 4RMWA 3TEUA 3F7RA 1MHPH 2YEZB 4DCQA 3MZGB 1OGTA 3ZTJG 3D5OF 3O9WA 4JDVB 1OWWA 4QT5B 3MCG1 2NMSA 1RJZA 2VLRA 5LWYL 4PB0L 4KHXH 3T2NH 2DS4A 4JN1H 4DKEH 5L8LB 3B2UD 5L7XH 4KGJA 1BWMA 1KT2B 2I60H 1HQRB 1G0YR 4K94C 5LBSH 3IDIB 4TUOA 4FMKA 5I19H 1MWAL 4HJGA 4RAUB 5DC0A 3U1SL 5BCAA 3A6CH 4YR6A 2QADD 1ZHBA 1FV1B 2BVYA 3PG2A 2F74A 3MJ9L 3VG9B 4NZJA 2WQRA 5DHVA 4UIKL 3IXAB 4LGPB 1OPGL 2V17H 5C07A 1UWXH 4CMHC 4DW2L 1I3VA 1KFAL 1JNNL 3BYYA 4K7PY 4M8QB 1C5CL 3JVGA 3LRSA 5BW7A 4JQVA 4QRTA 1CG9A 1T04A 3FQWB 5D2LA 1WEJL 3SKJH 4Q9BA 1NLBH 5EOTA 4QHKJ 3OG4B 4QXUL 3NZ8A 3UJTL 5ICYB 2X7LA 1RAMA 3QEHB 3RGVB 4KRMB 4N8VG 3BVNA 3HUJA 3R1GL 2H45A 3KLAB 2Z31D 2FO4B 3SOBH 4LARH 3QAZB 3EOBB 4ONGH 1CR9L 1QFWM 4PTUA 4QXWA 5EZJB 4PJGB 4I5BB 2IFGA 4S1RH 4UNTA 1F2XK 1QO3A 2H32H 3U0WL 1MCWM 1MFAH 2VDQH 1QRNE 4X7TA 2RR3A 1JNHB 1FVCB 1YEHH 1TCRA 2GTZB 4X6DB 5HYQB 1ZWIB 3MLZL 5B39B 1ZEAH 1ZS8B 1DQLH 4NT6A 4ZFOB 4Y5XC 3M1BB 5F89A 1U2CA 2F19L 1LP9B 2H6PA 1YN6A 4QY8B 3NTCL 1LO3H 2WINB 4JLRA 4QHNB 4YHLL 5C6PB 1G84A 2HT2D 4C56D 5HYIA 3P0VL 2EDKA 3G04A 4ENEC 2VLMD 3TVMB 5IHLB 4OF0A 5L9DH 1P5UA 2Q8BH 1YA5A 4PJHA 1I7UB 3GJFH 4FQCL 4LLQB 4LBEB 1ZHNB 3BZEB 2AJUH 1HCVA 3CDGB 5HI3C 1FZKA 3IETA 3ARWA 5D1QC 4BZ2L 1F4WH 4AENA 1NUGA 4XNZB 4O51A 1F11B 1NAMH 1AGBA 4O00A 2ZKHH 1RHHA 2IG2H 3DURA 4OD2A 2HKHL 4LSRH 4MA8H 4ZD3L 4NO2A 3LS4L 1CICB 4ODTH 4X8JB 3QWOA 1F90H 4XMLH 4ODWB 1CDUA 4FXLA 1WWCA 1QFWL 4PJ7E 4AH2B 3S4SB 5IG7B 1WWBX 5KSBA 5I1GH 4Y4HA 3T0EB 3BSZL 3HLAB 3OAUL 5CIPA 1MNUL 3VGAB 5I0DA 4HKZB 1HQRA 4Y1AD 4CVZB 4GRLA 4EOWH 1IAOB 4XPBH 5BVPH 3RZWA 4QRRE 1NFIA 2E27L 1NH6A 2H32A 5C0FA 3TA3D 5KSAC 1F6LL 5TFSL 1HSAA 3HTLX 2XKNA 2A2QT 3HR6A 5T1LA 1D9KB 1ZAGA 2UZXB 3EYQC 3WLBA 1LDPL 4POZD 9CGTA 5CSGA 2F53B 2VLJB 4JM4H 1F42A 3QIBA 1Z3GH 3RWDA 4P5TC 2R4SH 3KPMB 5FA3B 4G7YH 1DEEB 4WO4B 5K9OA 1KCSL 1OW0C 1MF2H 1NCAL 3V6FB 2CDEB 5D7SL 3CSYA 4N0UE 4NKDB 2DIBA 2NY3D 3ZT7A 1W2KT 2VZ3A 4QHUB 1AXTH 1CGXA 1O7SA 1SYSA 3G04B 4HPOH 5E2JA 4JQXC 1S7SB 4I2XB 3CVHL 4KVCH 1L9MA 5JIPA 4GAJH 4LSUL 3VWJA 2RAMA 4LLQA 2L0DA 1JZ5A 1FNEA 4QTIL 1DN0A 3N9GL 5D93B 1WFNA 1IQWH 4H1LA 3DX9A 3IRPX 5C92A 3REWB 4U6HA 3C8HA 2LU3A 4TSBH 2I60L 1KN2H 4JY5H 4FABH 5MENE 4NO2B 3BP7B 1JWMA 4IIQA 2ATKB 3RVWD 1DSFL 3HG1B 3O9WC 5FYKU 4U1SB 5E8DH 5LCVL 1OD9A 4PLJD 3VMOA 4Q6IB 4F58L 1INDL 4QYOA 3V9FA 3VFNB 4LNRB 1OAUL 2AK4D 1YDPB 4EVNA 5EA0L 3MUZ1 4APQA 5I1IL 5I1LA 2OP4H 1Q9KB 4GRWH 4BSJA 4I9WE 4OGYL 3MJ6A 4XRCB 4YHIB 1JZ7A 2JK5B 2C7UB 2X9WA 4QRPB 3OJ2C 5GJSL 4APQD 1J11A 4RDQF 3T3PF 4PJDA 4P9HL 4KK8D 1BLNA 3QJFB 5I76A 1K3IA 2FEEI 2DBLH 5J7CC 4ODBD 3K2UL 2BNRB 4DGYH 2VLRB 3EJYC 2WM0A 2ATPA 2QJDA 2Y5TA 3OB8A 3IJHB 4XWGL 3U0TB 2QTEA 1FV1A 4LL9A 4PJAE 1G6RH 5IP4A 4DWHA 3LKRB 2LU4A 3FB6A 1D9KC 3WIHH 2ESVD 3AREA 4NZDA 4KQ3H 4KROC 1N8ZB 3HZKB 1S7VB 1ZANL 2HTLD 3P2TA 2E7LA 2EECA 2Z91B 1T7WA 3CSPA 4O4YL 1YPZF 1C5DB 2OX5A 3KPRD 1WT5A 5AAMA 1A6ZB 4CDHA 3TLRA 4HIXL 1X5JA 2PW1B 1YN7B 2MHAB 3I2CL 4AMKL 3MACL 3OL2A 3L95B 3QNYB 4PG9A 3UC0H 5DURB 3FHAA 2R23A 3RWCA 3QUZA 4H88L 2NNAA 2VDML 1DTUA 5D96B 2UWEB 4FQHB 4GUPA 4U1JB 1RIVL 4NHUB 2YBRA 4PJBE 1T2XA 4X5WB 3RUGF 4JPIA 4HGWB 5EG6C 1KCKA 4HBCL 4U1KB 4JRXD 1KPUB 3OXSB 4NN5C 4ZS7H 3ZKNC 5KS9A 3PIQB 2GY5A 3U30C 1EO5A 3A6BL 4R0LC 3O2VL 5TF0A 3U9UA 4TRPH 1IJ9A 4Y5VB 3KPSE 3IJYB 4ZO8A 4M6NL 3IFLL 2WAHA 3O8XA 2XWBB 4HK3J 5I1LB 1J05B 3VE0A 1MVUB 3PWNB 1IC1A 1T5WB 2GTZA 4X6DA 5GRJL 3FRUA 2PYEB 5HYQA