2YC2C

Intraflagellar transport complex 25-27 from chlamydomonas
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
197
structure length
149
Chain Sequence
b'KPIDITATLRCKVAVVVAPVTIPDTTVSVELFLLDTAGSDLYKEQISQYWNGVYYAILVFDVSSMESFESCKAWFELLKSARPDRERPLRAVLVANKTQVRLDMAQDWATTNTLDFFDVSADAPFLSIATTFYRNYEDKVAAFQDACRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTRAFLAGELLAR TRANSPORT PROTEIN 25
publication title Crystal Structure of the Intraflagellar Transport Complex 25/27.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Transport protein
total genus 46
structure length 149
sequence length 197
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2yc2C00
1GKIA 2MMGA 5FBQB 2FFAA 4MQBA 2CNWA 4XSHA 1ZM9A 3ZJYA 3T1VA 1RFLA 3D3QA 1YR6A 1XEXA 5FL7D 2J9RA 4EPVA 2DFKB 4MA4A 3WMFA 3I5YA 5LD2C 3VR1A 1XPUA 2ODEA 3S1AB 2AXPA 5SZKB 1UBEA 1ZJ6A 3PENA 1F5NA 5BWMA 1HY3A 1JAHA 2A5FA 1IQPA 1C1YA 4FI3C 4RZUA 2V1UA 1JB1A 4MKFA 1WB9A 5HE9A 4BPBA 4TMTA 4G01B 4IOMA 4ZIRA 4C0KA 2ORIA 3HR8A 4M1SA 3IO5A 3H84A 2PL3A 1P7CA 3CWQA 1AIPA 1XEXB 4MYHA 5UKDA 2WJVA 1R2QA 3E70C 2VSOA 4A15A 4B34A 2QE7A 5D3MA 2VL7A 2ZI3A 3GLIA 1ESMA 2V7QA 2ZQ5A 4Z1MA 4OJQA 1P72A 3IQWA 2RGXA 1CF4A 1DAEA 1QG4A 2GCPA 2WPDD 4DHEA 2O52A 1G16A 2IYYA 2ZI9A 3MFYA 4BFVA 1S1CA 1QHGA 1RKBA 2Q3HA 4MDEA 2NO7A 1OFIA 1P3JA 3RRZA 2C9CA 2QPOA 4ZIRB 1NNEA 2BV3A 2JLUA 2HLDD 2V8OA 2ZI7A 4EJSA 5SZHB 2ZU0C 4URXR 1VIYA 4US1R 1NJGA 3CBQA 5D3MB 4UJ5A 3UIEA 5J4KA 1Z08A 3GLIB 1OSNA 1E2QA 5GVSA 1E0KA 1DAIA 1I4DD 1Z83A 4I1UA 2BM1A 1RRFA 4GOKA 4AY2A 4XH9B 3GLHA 1W4BA 2KI5A 2GKSA 2AX4A 4I1VA 1OFUX 1P2SA 4LV8B 2HEIA 2ZJ2A 4JJZA 4I81A 2BKUA 3T34A 3TSWA 5EP1A 4W5JA 2ANCA 4LC1A 4EJSB 5DI3A 4JLPA 1P4SA 3KXLA 1SXJC 3FFBA 4MKIA 1GKUB 1MO6A 4N0EA 1RYHA 3AKEA 3H4MA 4B74A 2RGBA 2REBA 4BZXA 2O0KA 4B3BA 3SC3A 2I3BA 4BFTA 2Q3MA 5AR1A 1XMIA 2ZS7A 1PUJA 3GLHB 4OQFA 3WMGA 1KDPA 5KSOA 1XXHA 2IUTA 4OYHA 2JDIA 2N46A 3QKTA 1Q1BA 4Q18A 2IF0A 3H0KA 1T8TA 3Q9LA 1Q20A 1JEDA 3M0EA 2OLJA 4UXIA 2BEKA 4EAQA 5DI3B 4QGGA 4XWKA 5F9HA 4BRWA 3J81k 2ERXA 1HT2E 3EC2A 5B57C 1ZNZA 4CZ2A 1E9FA 4RZ2A 2PMKA 2VP9A 4KU4A 1HQYE 4HDCA 2ZRMA 1TF5A 1VTKA 2R6GA 3BWDD 1VYVA 1NG1A 5GJBA 2A5DA 2JATA 1HUQA 4DIEA 1WBBA 4DLWA 4PQYA 1XXHB 1J99A 4FMCF 3O8RA 1G8HA 2IS2A 1W44A 4F93B 2ERYA 1O87A 3RVBA 3LX8A 4AIIA 4LHVA 4HAWA 3CH5A 3SN6A 3KDSE 4C0SA 2FU5C 1D8TA 3CNLA 1FQKA 3B60A 3QQ5A 1LS6A 5DLQC 4TYYA 2D62A 4IOJA 2ZM5A 2GJSA 1WXQA 3CM0A 3H86A 3NTUA 4LPKA 1KYIA 1RRGA 5FR2A 1VPLA 4Q21A 4KYIB 4LJ8A 4XWOA 4M9QA 1H65A 5HKKA 5KNBA 1CTQA 5EQTA 2E9SA 2K5UA 3JZMA 1R5NA 4UNSA 1RIFA 5KO2A 1II9A 4OK6A 5K8IA 1MV5A 3LLUA 4TQUS 1Z8FA 1EX7A 1DAHA 2EVWX 2QMEA 5L3RA 1Q22A 2NMVA 4C2UA 4PQFA 4M1OA 3MAAC 3CRQA 4G5QA 1Z5ZA 3X1ZA 1G9XA 4C3ZA 3OAAD 3QJYA 3ND9A 4PHHA 3V9PA 2CMKA 4UXHA 2BIFA 5HCNA 3DL0A 3SQWA 1EFRA 3AVOA 2YOFA 3GMTA 1OB5A 5TV2A 1KI9A 2Z43A 3AF1A 2OCYC 1E2FA 1U8YA 1XD2A 4MRSA 1Z6AA 3SEAA 1KSFX 4IXMA 1OKKA 1NKSA 1XJCA 2C9OA 3EC1A 3T1TA 4HAZA 1KJZA 2XOKD 3WNCA 1TEXA 1LS1A 2CEAA 2IXGA 2JLQA 3IIJA 2ZU6A 3SJAA 1YU9A 3THYA 2YC2C 4RY2A 4D2IA 1P9NA 2J0UA 2F9LA 3AP3A 3QBVA 1EGAA 1LW7A 3ADDA 1GFIA 1XMJA 1NLZA 1OHHD 1OXVA 3KL4A 5BN3A 621PA 1XD2B 2RCNA 4Q4HA 2ZUBA 4M9XA 2C9YA 2CCGA 3LX5A 1GVNB 1G19A 1S96A 5E3HA 2IYUA 5FUVA 1GL6A 1UPTA 3TBKA 1OXXK 3AH8A 3H1TA 4M4SA 4ESVA 1ZNXA 2O8BA 2ZE7A 4D0GA 3TRFA 3DHWC 1IJFA 3THYB 2DYKA 5DYIA 4IEEA 2J0UB 1Q3TA 2E87A 4DCTA 1LVGA 1ONBA 4URYR 3PEWA 2EFGA 2X2FA 2VHUA 4Q4HB 2P6NA 521PA 1NY6A 4J0QA 4JLVA 2RHDA 4IFBA 2FPMA 1CR1A 1FNMA 1ZUIA 1W49A 2J46A 4O25A 2GEUA 2IYQA 1U99A 2O8BB 3TKLA 2WAYA 1SZPA 3SDZA 1U9IA 3TH5A 4DDUA 4BFSA 4R2HA 2QP9X 2WWFA 2ZTSA 5AUPB 3U7HB 1CEEA 3K09C 1F6BA 4JZKA 1ZU5A 1Q1QA 3LBHA 1XU4A 3TR5A 2B21A 1A7JA 2RGDA 5JBQA 2GA8A 4EIWA 1QHHA 3GQBA 2CDNA 1QHSA 4HYYA 4IVQA 4B47A 2NO6A 2WV9A 2ZRHA 1NSTA 1U98A 3GJ4A 3AVXA 2ZVPX 2QEQA 2QPTA 3OF5A 4DKXA 1OV4A 3KQKA 4G5OA 3AP1A 2F7SA 4IDOA 2VF7A 1KJWA 1E2EA 1XBTA 1N6KA 2DWQA 3A8TA 4IVPA 4B3GA 2FSHA 3OIUA 2RGAA 4PXAA 4Q19A 1ZC4A 3IHLA 2ZJYA 4JBYA 2LCFA 1KDOA 4MGKR 3BH7A 2B8WA 3Q8XB 4OQMA 4PZYA 4DCUA 2CBZA 3K0AA 1QHHB 2ORVA 5FTMA 1WA5A 3K70D 2OZEA 3DPUA 5EUQB 2NIPA 1TF2A 1IJEA 1F3OA 2H18A 4KFTA 1OJLA 3NG1A 5LB4A 5K8LA 1CJKC 3ZZTA 3WBJA 3MJHA 1U2RA 3MLEA 4MRVA 3ZH9B 2B8TA 1H8HD 2ZSBA 5AUNB 4AWXA 2REOA 1G8PA 1P60A 2XZLA 4RD3A 4DLRA 5J4VA 1GIAA 2Q3FA 4JS0A 2YWEA 3MUFA 4JIMA 4P3YA 5TDHA 4ZI2A 1KHTA 1L4YA 1K8RA 3K0AB 3EA0A 2FSFA 2HF8A 4FCWA 3Q3JB 4KAXA 2EYQA 1RRPA 1PVOA 2ZE8A 5IHPA 1E79A 4F4IA 3VR3A 2X2EA 4M1WA 1CJVC 1DE0A 1XDBA 4AI6A 2DB3A 4HLDA 2AD5A 5JEDA 5BN4A 1RRCA 4TZ6A 1A82A 1G41A 1IN8A 4LSGA 1W7AA 3DZ8A 3LVRE 2QPAA 1P2UA 2AFHE 3RABA 4RFSA 3NEJA 4DLYA 1IN7A 4YMWA 1E3MA 2C96A 3TVDA 4M1TA 1TUIA 4LZZA 2KWIA 1RVDA 4L9WA 5FPHA 3DZDA 1BKDR 2QA5A 4US2R 4M1KA 1KK1A 2C78A 3THWA 3RS7A 5FBVB 4QXAA 5K8TA 3A58B 1IONA 4TMZA 1UFQA 4HAUA 2I1QA 4OI1A 3SZRA 4KCGA 3SR0A 1NVVR 3JVUA 2IS4A 5IF9A 1A2KC 2RHMA 4R2IA 1GKYA 1FW6A 1KAGA 5EE3A 2JLVA 4MITA 1H8ED 2R8RA 4RFSB 1R5BA 2PZGA 3KB2A 1KNQA 4OQXA 2QL6A 3EARA 1ETUA 1YKSA 1SVKA 1UEJA 4MUBA 2V6IA 4NMMA 2ZAMA 1YZKA 2ZR9A 3Q85A 4BFUA 1WDTA 2P6UA 3THWB 3CW2A 3EZ9A 3B9PA 2J59A 1Z0FA 1II8A 1WRBA 2CK3D 4DDTA 4BEJA 3KQNA 1Q0UA 1G8YA 3CPJB 4LV6A 5KDLA 4D4MA 3AVWA 3TE6A 3FOZA 2J3EA 2QP3A 4GI7A 5C18A 1RC8A 3HR7A 4MUAA 4NYJQ 3SYLA 3WP1B 3GLHE 3SI7A 1DADA 2NO0A 1RZ3A 4BGDA 3CO5A 1G4AE 1JXMA 3TJZA 5JWHA 3ICEA 2GNOA 2OCAA 2OESA 4KODA 1A4RA 1FUKA 1K6MA 1II8B 3X1YA 3LXXA 5FOTA 5KPJA 1XPOA 3BE4A 3C14C 1FOEB 2YWGA 2QM7A 1Q57A 2F3TA 1KMQA 2OSBA 4JL6A 1TQDA 3VNUA 4URWR 1SVWA 5JZVA 4HB0A 2A5JA 3CR7A 3I3SR 5EE5B 2W6ID 3GJ8A 1XXHE 1G1MA 1CXZA 2ODBA 2YINC 4Q1FA 4MGIR 2IC5A 3TMKA 1EX6A 4DSUA 1JALA 3TSOA 1J7KA 1GWNA 4JMPA 2W2TA 5HPYB 4Q03A 1GITA 4XVUA 4CGZA 4L8GA 1IBRA 4NONA 1XEWY 3B8HA 3A4NA 2HV8A 3K0FA 4GZLA 2JLWA 3C4JA 3K0CC 1S8FA 1FPMA 2ZETA 1X6VA 5DN6D 1FMJA 5BYKA 2IWHA 3ZD6A 2J41A 4D80A 3BK7A 5F3WB 4QM7A 1VCMA 4YXWD 3QF4A 3RRMA 2G88A 3T15A 121PA 3BD9A 2YNMA 3R20A 4TMKA 5FL7A 3FE2A 3RC3A 3TQCA 1AA9A 2OHFA 3KKNA 4LX0A 2QENA 1E9RA 4A92A 4PHTA 4HATA 2ZE6A 1W4AA 4XD7A 2PZEA 3SFVA 1FTNA 1Z0DA 3K0FB 1AN0A 2ZRNA 2XNDA 4Z51A 1S9HA 3RS3A 3W9YA 2A7QA 1ZUNB 3I72A 1XD8A 2WWXA 1P62B 2A5YB 2HJVA 4TL9A 3QF4B 1K5GA 4TYQA 3K9HA 2XX3A 3KJGA 4RD0A 4CF7A 3PITA 3FDIA 5FTKA 5LD2B 4BE7B 3REGA 1E2LA 1G3MA 2BDTA 3IO3A 1Z07A 5JSZA 5TMPA 4QBHA 1W0KA 3VFDA 4D6PA 1AM4D 3AVYA 4W7SA 4RJLA 4ON9A 1P2TA 1KDRA 1WBDA 1P9RA 2XZPA 4B6EA 4Q4LA 3EPLA 1XX6A 3SS8A 2YC4C 4PQRA 2ZAOA 1YVDA 2J5XA 2JJ2D 5P21A 4AD8A 4ZO4A 2GRJA 1KI2A 2HLDA 2IYVA 4F4CA 2HF9A 1KO4A 2EFEB 4JKIA 821PA 4ZKEA 2ORWA 5JSZB 3UANA 4PO8A 3B5JA 3ZIAA 5B64A 3IPYA 4NYIQ 3L43A 1LFDB 2PX0A 5JMTA 2QTHA 3PEYA 5CB8A 4PO9A 2YYZA 3U3MA 2L0XA 2OFOA 1L7VC 3BXZA 3N2EA 3AV0B 3D6TB 3WRXC 5IK2D 2WHXA 5EXSA 1YR9A 2NZJA 3FKSD 2WSSD 1SXJA 1UDWA 4YMUA 5JS8A 3GLFE 2WWHA 4KV9A 3EWSA 2FDCA 3I62A 1DG3A 2GJAA 2IYWA 1E69A 4B33A 3A1VA 4TLCA 4G5SA 3IKJA 4Q02A 4D4JA 4KO8A 2D7CA 4EUNA 4AYTA 5DNYB 3VX3A 2C04A 2OXCA 1RW4A 2GCOA 1CKEA 1ZD9A 1IXRC 3PIRA 1NMXA 3GJ0A 1HT1E 4LJ5A 2VHTA 3VAAA 4LBVA 5L3SA 1W5TA 1PLKA 1LV7A 4ACAA 2WKRA 2QQEA 4YONB 1Z6TA 1SXJB 1G7RA 2Z83A 4DBLC 4C7OA 2R6CA 1IY2A 1W4CA 5JS7A 1D2MA 1MO5A 4V0MA 2D06A 2GBLC 2HJGA 3BRWD 3K53A 2GVZC 1JR6A 1OFHA 5FBWB 1KO7A 2WBLC 1E1RD 2ZSDA 5KSYA 2CCJA 1NRJB 2GCOB 4BLOA 2VP2A 4A0HA 2ODNA 4KHZA 4NCNA 3I5XA 5KNDA 3AGQA 3AUXA 4Q47A 3ADBA 1NIJA 3KTAA 5L3SB 3KXKA 5J47A 5FPKA 1TMKA 3LNCA 5A0FA 4NKRA 3OIWA 1EK0A 3NXSA 4C7OB 4Q48A 1GG2A 4RZ3A 4JVMA 3RYTC 4BECA 1ZM7A 1W4RA 4OQLA 2RB4A 2CCKA 1NMZA 2XEXA 4EPTA 3U6BA 2BM0A 1YQTA 1ZM2A 4DSTA 3L0OA 2LKCA 4RKEA 2VF8A 3U4QA 2G1JA 1P75A 4NE2A 3DVLA 3GEHA 5IDVA 2ZJ8A 4B44A 3Q7PA 3KTAB 3KKMA 4LDJA 4GMDA 2O0HA 2BCGY 2P5SA 1VKJA 4TLAA 1MR3F 1P73A 2Q9CA 3PVSA 1W2GA 1JR3E 2AD1A 3HDTA 4HUQA 3VKHA 4NTZA 1DAKA 3TUZC 2C2HA 2WZQA 5H70A 2G6BA 4E07A 4U7DA 2J0QA 4FCTA 1N0WA 4M9SA 4XJXA 5BQ5A 4CT5A 3AF3A 2ZI4A 1W36D 1Q21A 4A0FA 2YOGA 4TYPA 5M04A 4BFWA 2VP4A 3EWAA 3U4QB 2IYXA 2B6HA 2XXAA 3DDCA 4YC7A 2AFIE 2JLRA 1P6XA 1MO3A 2UZ3A 3TAUA 5CIWA 4KFSA 2EQBA 4PZLA 2P5TB 4YDSA 1I2DA 2DFLA 2OG2A 1IY0A 4HUQB 1OH6A 1VDZA 4JLJA 4WXPA 4LC0A 3T5GA 2VA8A 4OI4A 1YR8A 4H1VA 4V03A 1ZW6A 4D0LB 2GXQA 2YZ2A 5DH9A 1R4AA 1NIPA 4C0LA 1E2HA 3WMEA 5TB5A 3QKRA 3I92A 2QGNA 2AWOA 4L9SA 1M7GA 5F98A 2H57A 2XXAB 1FP6A 4LV5B 4GL2A 3ADKA 2ZRLA 1TQ4A 1VCOA 1OXSC 3QOFA 5DE3A 2XOKA 2G77B 4P4UA 2W2VA 3OEHD 1EFUA 2ZSAA 3A1WA 3ZZUA 2BBOA 2QGZA 2RGGA 3QI2A 3N70A 5FUYA 5CYOA 1XPRA 2NO1A 3AF2A 4M22A 2XJ4A 4TQ9A 1OXTA 5A5GA 1NI3A 4W9MC 2P6RA 3RS2A 4IVRA 3QKRB 4XTRA 1YZUA 1II0A 3I73A 2CHGA 4CW7A 3IIMA 3AP2A 1GSIA 3OEED 4BASA 2N42A 2VEDA 1GRNA 4RCYA 2ZR0A 3HYTA 1N25A 2JA1A 4IJMA 2O5VA 2D2FA 2VLIA 2CE2X 2W83A 1R0YA 1ZMXA 2NPFA 3FHOA 2BCJQ 1G3QA 2QM8A 3FHCB 3HU3A 4B3XA 1CULC 1EXMA 2CLDX 3SU8A 2ZRKA 3CRVA 4DEYA 4V0KA 2ODWA 4FMBB 1T4GA 1OYWA 2DFNA 4M1MA 3EZ7A 1W48A 2IA5A 1EWRA 3V4RA 3QSYA 4DLUA 3E1SA 4N0DA 4ABYA 3FPAA 4P4SA 3SHWA 4GOJA 3PXGA 3BBPA 4NHOA 4O2RA 4TL7A 4A2WA 1U94A 1G291 1QF9A 1FX0A 3NBFA 3K09A 2H7VA 4PPFA 2C95A 2A2ZA 1M7BA 1VG0B 2VBCA 2ZEJA 3GPLA 2FZ4A 4B35A 3WRYC 1M34E 2QT0A 2D2EA 4D26A 4B71A 2EFDB 4QGAA 3UG7A 5E7JA 2XTZA 4QC2A 3TNFA 1FNNA 1JPNA 4P4SB 3GJ7A 5FUXA 3SJZA 2FZLA 3G82C 4EFNA 3AUYA 5FOWA 3B6EA 1T8UA 1R8QA 2OAP1 3QVVA 5AJXA 5G3ZA 3W8NA 1FX0B 3QXSA 4M0LA 4IDPA 221PA 4NH0A 2G9NA 1S1MA 3CZPA 2QN6A 1COWD 1KI4A 4FWIB 4BUJA 3EW9A 4PFSA 4KLNA 4YMTA 1KO8A 4WAUA 3KQLA 2PH1A 3MCAA 4WVFA 2N1BA 4QBGB 3EPHA 1Z6GA 3QKSA 3THXA 3QE0A 4EQ6A 2YWFA 2J7PA 4P0TA 4LJYA 5CM8B 5EXXA 4ESHA 2QTVB 2BMDA 4PR0A 3D7MA 4A8JC 1GNPA 3WHKA 4UNNA 1U8ZA 1KI1A 2GXSA 2ZREA 4DRZA 2KE5A 1MO4A 1ZVQA 5FFMA 4EPWA 1H8HA 2BBWA 4X8HA 1LF0A 1DAGA 4ILEA 4WBSA 5LBIA 2QAGC 1ELOA 4NCHA 3W3AA 3MJRA 1MABA 4Q1DA 1KO1A 1E2NA 2R9VA 1N0UA 3QKSB 3A4LA 2O8DA 2H8KA 3THXB 3WHLA 4EQ6B 2VTKA 3BC1A 4H9GA 1E2GA 4JL8A 1I2MA 1G6OA 4KITB 3B1YA 1NY5A 4Y0VA 1Z0KA 4HLCA 5FH9A 1J2JA 3GFTA 3L0PA 2P0EA 4NCJA 3OFND 4O0MA 5CLQA 1AKYA 2FG5A 4TLDA 4DCNA 1NBME 1U0JA 3W6OA 1TF7A 2O8FA 1G64A 1Z0AA 1MABB 2J0SA 2IS6A 2BBSA 1Z3IX 2QG6A 3KJEA 2REXB 4K81B 1R7RA 3CX7A 2O8DB 4QG7A 3PEVA 3NDPA 4RD1A 1Y63A 3TUIC 3LD9A 2RGCA 2NG1A 1XJ0A 1K5DA 3QPVA 5CDFA 4MRPA 3CX6A 1T9HA 1W5SA 1Z0IA 3CH4B 3W3ZB 1G7CA 3HU1A 1VHTA 1W2HA 4IDNA 3ZLJA 2P67A 1M1YE 3HWSA 1Z2AA 2O0JA 2O8FB 3WNDA 4BLQA 4TQAA 3T1QA 1N6OA 5HZHA 1M6NA 1DELA 1YJ5A 4DUGD 2OFWA 3MSXA 3W6PA 4DVGA 1KI6A 1Z22A 2CHVA 3M1IA 1P61B 4TYNA 2NPIA 3QG5A 1Z6XA 5DO9A 4PC6A 4OHYA 3VNVA 1NN5A 3NDBB 4D82A 4A6XA 2CK3A 1QVRA 1KZGB 1WP9A 4MDFA 1JEEA 4CIDA 3KUCA 4PSKA 3BJIC 5AJWA 2H16A 3IEUA 4D4LA 4X8MA 4O3MA 2FE4A 3X1XA 3Q7QA 1YZQA 1CU1A 2FSIA 1KI6B 1U90A 2AKAB 5B2ZA 2GESA 4V0LA 1SXJE 5DHAA 3C7KA 3O47A 3L0SA 1F48A 2LKDA 3AVPA 2JGNA 2QMHA 4PC3A 4C0BA 1PUIA 2AK2A 2RKOA 3C5CA 2NQ2C 4HDOB 1LB1B 2GF0A 1YRAA 2HT1A 3HU2A 4KSCA 2KB0A 2W6IA 4RD4A 2W00A 3QVUA 3FKQA 3P27A 5FI0B 1E2DA 4GFDA 1IM2A 5JJLA 2FA9A 2ECKA 1QHNA 4BZQA 4MH0R 4TTRA 4LHWA 4PO1A 3SE0A 1N0VC 3B1ZA 1TAGA 4DCSA 2VHQA 4DIDA 4I4LA 3K0CA 4U5XA 3L2OB 2KJQA 1ODFA 3FB4A 2OBNA 4ITRC 3U7FB 3FVQA 4D0NA 5CB6A 3U60B 3B9QA 1OB2A 4Z1MD 1NL3A 2VP5A 1O3YA 4YXWA 1KKMA 1GAJA 2FEMA 1OPXA 1IHUA 2Z5FA 3T35A 2FFQA 1JQLB 3ADCA 4B48A 4BLRA 2FFBA 1XCMA 1XMVA 3AKDA 4TSFA 4EKDA 3LVQE 1M7HA 3AKYA 3EIHA 3IIKA 1LTQA 4ZDJA 4PSVA 5DHFA 5TARA 3R9IA 1JJVA 2J87A 1RPZA 1FTSA 1VCNA 1NVVQ 4PTLA 4TMXA 2F55A 2DPXA 3CPHA 2GHIA 1KKLA 3VR6A 2Z4SA 1VG1A 4F91B 1ZD1A 3B1VA 2W0MA 2D3WA 2Z0MA 4ZPXA 2J1LA 4CYMA 4N3NA 1A5TA 2IK8A 3DMNA 2G0TA 5L3VA 4CDGA 5J5CA 2GK6A 3ZQJA 1R5OA 4XTCS 3CF2A 4BQSA 4DLTA 3K70C 3OESA 2VH5R 3RAPR 4X8LA 2CHQA 5FPYA 3AF0A 2XJ9A 2O8CA 3F3YA 3A1TA 4UKDA 1XTRA 1G7SA 2G1KA 2C99A 2GJ9A 1AGRA 2UVQA 4TMVA 1FFHA 1AZSC 4JYCA 4P33A 3L0IB 3PUVA 1Z6YA 2JLSA 1N6RA 2A3RA 1XCGB 5GJCA 4AKEA 5KHOC 4GOXA 2WMNB 2PEZA 2WJHA 3B2EA 1OLOA 4LHYA 4PX9A 2BVNA 3BH6A 3AGPA 3O8DA 3CZQA 4C0QC 1NP6A 4QOSA 3TK1A 2O8CB 1UBFA 2ZRGA 4B73A 4QHTA 3U44B 4F92B 5IK2A 3PFIA 3C8UA 1R10A 3A1SA 2IUUA 2WSSA 5AJYA 5FR1A 2GF9A 1TU3A 3NBYC 4M21A 2CVHA 1CR2A 1E2KA 4JJKA 4KVGA 4DCVA 2SHKA 1UAAA 2IYRA 1EG7A 1L4UA 2AHOA 2VO1A 5JWOA 2WOJA 5KSZA 3NHAA 3ZS8A 2QP4A 4LPSA 2CLCX 2FJUA 1MT0A 1ZM4A 5C1BA 2X77A 1CR4A 3GEIA 4K8OA 1GUAA 5DI9A 3VKGA 4HB4A 2MSEB 3WNBA 1WMSA 1GNRA 2HDNB 1UF9A 4UNRA 4Z8XA 3B82A 2VQSA 4G1UC 1VECA 2JJ1D 2ZRPA 1XEFA 3O8CA 3U7GA 1HEIA 2ZYTX 3KKQA 1Q44A 2GBLA 3GLIE 1UBCA 2VPPA 2XSZD 4E09A 3BB4A 1X8LA 5LB2A 3A6PC 2W6JD 1N5IA 3U5ZB 3AB3A 4Q7MB 1G4UR 3LFUA 3BB3A 3VHLB 1E1RA 1XF9A 2ANBA 3EZFA 2MSDB 5L8VA 2PLRA 4FW9A 5FTLA 2BEJA 4KBFA 4P32A 4AG6A 1GZSA 2X1VA 3DEFA 3EPJA 4LYFA 1JXOA 3TW4A 4DSNA 3PUZA 4RKFA 1KOFA 3ZVRA 4DLXA 1GILA 1N3BA 5FBRB 4IEIA 4Q01A 3K9GA 1E4YA 3IEVA 3BB1A 4AKIA 1DG1G 3RRNA 3LRPA 1M8PA 5KYKA 1ZRHA 1UKZA 4Q4JA 3KJIA 5KUTA 4LJ4A 2R44A 1F60A 3JZAA 4V02A 2WVJA 1D5CA 5C4MA 1Y3AA 3ZVNA 1CRQA 2IW3A 4YMSA 4TMWA 4AKHA 2JEOA 4GP7A 4HDQB 1G7TA 1G20E 4Q1BA 1CJMA 2FWRA 2IYTA 4QJ5A 1MKYA 4GNKA 4QL3A 4FMDB 3C5HA 3PJRA 3LDAA 1IY1A 4GZMA 2DFTA 2GDJA 3REFA 2JIZA 2BMEA 2ZRJA 4HI0E 2PCJA 4BZPA 5CITA 5H8WA 2ONKA 2IX3A 4MRNA 1KI3A 1ZAKA 4Q4JB 4ASUA 4Q1AA 1L8QA 4UNQA 1S2MA 2ZYWX 1HQCA 1W1WA 5E7IA 3QPWA 1YZLA 1T91A 1X3SA 1EFHA 5EP2A 1SVMA 2WIBA 4XWAA 1N5JA 5HCIA 4BRUA 1XTQA 2WTUA 4PZZA 4Q1EA 1J8YF 1J70A 3I4LA 2FNAA 2ZRCA 4BLTA 6Q21A 3ECCA 5GJVC 1G8FA 2R6AA 1X86B 1QHXA 4HEJA 4P31A 1CR0A 5KU1A 1VYTA 3LLMA 1R0WA 2CVFA 3EIQA 3HPRA 1IOZA 4B43A 3LO5A 1W36B 4DT1A 2BMFA 5SZIA 2GTPA 2ZPTX 1SQ5A 4GSYA 4DLZA 5AUOB 4KXFB 1YHNA 1XJQA 2RH5A 5C2JB 2PCLA 2JLXA 1BYIA 4XIGS 4OKSA 3TQFA 4KBGA 3OEHA 5CM9C 3CF6R 3KZ1E 1N5KA 5JECA 1TL7C 1KNXA 3CUEF 2V3CC 2FGKA 1AZTA 2V54A 1SVIA 3CNOA 2WWWA 4L4UA 1GRRA 4LJ9A 4WXRA 3CR8A 3UPUA 4AKGA 4FXPA 2R65A 1A2BA 4DT1B 1FL9A 3PV0A 1E9DA 2ONJA 4OHWA 3UXMA 2ATXA 3CWZA 4ZDIA 4G5GA 1KI7A 2BKEA 5FOVA 4M1YA 1PV4A 2ZS8A 1VIAA 2WWYA 3AQ4A 5JFGA 4MYUA 3GFPA 2GJKA 2OLKA 4UNPA 1G8GA 1TQ2A 1IN5A 2ZRFA 5CDFE 1NKTA 3RC8A 3ZGXA 2WPDA 1JR3D 3JVVA 4YQFA 4JVSB 5J40A 2V4ZA 3FMOB 3CB4A 1MOZA 3IPXA 4KFUA 3RS4A 1E1QD 4LHXA 3GD7A 4JT4A 4FCVA 4QHSA 3ND8A 2OBMA 2ZSFA 1OF1A 2ZRIA 1E9SA 3C16C 2F6RA 2OXRA 4EFLA 2R6FA 1OXUA 4EDHA 4C4PA 5AWFC 1VG8A 1Q3HA 1YZGA 2GVDC 1VCIA 3CRW1 1KSJA 3NBZC 2RAPA 1KDTA 1LF5A 1RE0A 4QRHA 4LCBA 2QMOA 1XD9A 3NC0C 1NLYA 3FTQA 2VP0A 1DEKA 4G0NA 5EE9A 2DWPA 1KTVA 5AJZA 1M74A 4LBWA 4LHZA 1X8JA 4IW3B 1XCPA 3CRRA 2OCPA 2PT7A 1E32A 3QEOA 4IOLA 1UDXA 1TUEA 2ZR7A 2QUZA 1SGWA 4MRRA 1COWA 1ZD8A 1T0JB 4A0GA 3BOSA 2W0SA 5DISB 4Q9HA 5D3QA 4JLOA 2BHRA 2IXFA 3ZDQA 1XP8A 3TW8B 2ZJZA 5CLLA 2NGRA 3QKUA 3PQCA 2EW1A 4HB3A 4A8JA 5C46F 3SYKA 4CT4B 3UMRA 5E4FA 1YZNA 3A4MA 3OZXA 4QNRA 1XB2A 3P4XA 1XZPA 5EJEA 2ZRBA 4E22A 1ZIOA 4MGYR 3LA6A 2QAGA 2AXNA 4OHVA 3SFZA 1KK2A 2GJ8A 3CRMA 3AVTA 4L15A 2FPLA 2F9MA 3HPQA 3NC1C 4DSOA 4HZUA 4JLBA 1N5LA 2IBMA 3I32A 2DR3A 5KDOA 3CNNA 1DVRA 1E99A 5L3QA 2HYIC 4MGZR 1TX4B 4IRUB 1AQYA 1RJ9A 3QIAA 4A8JB 1CP2A 1Z63A 4BFXA 2GETA 1X8KA 2ZUCA 3FYHA 1KO5A 3BIFA 3LAWA 5FTNA 5B30A 3B85A 4E03A 3DKPA 3X1DA 2Q0HA 3FMIA 1DS6A 1N6NA 2EFHB 4ZCIA 1W47A 1SKYB 2QAGB 1IXSB 1XZQA 4WIAA 1BS1A 4Q4AA 3QBTA 3F8TA 4HZUB 3U3RA 2CJWA 5EP4A 2C03A 2IEYA 5CJ2A 5L3QB 1E0JA 5KDDA 3KXIA 5E7MA 3TAHA 1RJ9B 3ICQB 5HR5A 1AS2A 4POAA 4LBZA 2BJVA 1G5RA 2J0VA 1SKQA 4FN5A 3A1UA 3KQUA 2IEZA 3EZ2A 4PHGA 1W36C 4P4TA 3OE7D 1E0AA 3KKOA 1KSGA 1N6LA 4FIDA 3MWKA 3IBYA 4Q4AB 5KTYA 4B32A 3HP1A 4AK9A 3UMFA 2RGEA 3QPUA 2CJWB 3IHWA 3OAAA 2BBTA 2E1RA 4NPHA 5G3YA 5GJWC 4K46A 4EFMA 1B0UA 1WCV1 1I4LD 4DUGA 3QXCA 3Q5EA 2GZDA 4B2IA 2I1VB 3NHBA 2ZE5A 5FI1B 4RZXA 1TU4A 4KYUA 2W58A 4BEBA 1D9ZA 2VHCA 1G21E 3VR2A 5FUWA 3LW8A 3R8FA 2WKQA 3P4YA 3QXHA 5FOUA 1S0UA 4FD2A 4LRWA 4DXAA 3EZ6A 1T6NA 1V43A 5FOSA 4ZV4A 5KNCA 1AGPA 1HA3A 1UADA 2C5LA 3A36A 4M8NE 1JJ7A 4ZCMA 3I8SA 2JASA 3P20A 2FOLA 3W34A 421PA 4KI0A 1XWIA 1OHHA 2VYFA 2FSGA 4PPQA 4C0JA 2HXYA 4RSGA 5JI2E 4G5RA 5B58C 1MH1A 3N2IA 4EPRA 1WE2A 1US8A 3T12A 1OIWA 1KIMA 2IT1A 3LXRA 4HLQB 2ZIAA 2V1XA 3L82B 3T1OA 1SVSA 2VSFA 4PSAA 1NBMD 3ZVMA 4XD7D 1OH5A 1N6IA 2ZS9A 5GADl 2OFXA 2XNDD 3BFXA 3CF0A 2GWHA 2QNRA 2ASEA 1P9WA 4Y0AA 2JLYA 2JLZA 2QSZA 4JVNA 3ZD7A 3IBGA 2ZYUX 721PA 2G83A 2XB4A 3BAFA 1US8B 4KVAA 4UQOA 1Z29A 3EAQA 3M4YA 3IQXA 2OE2A 4FMDF 3QY0A 1W0KD 3GLGA 2FPKA 2QROA 2ZXUA 3THOA 1SHZA 4LJ6A 2V6JA 4Q00A 2ZJOA 5E95A 5FOXA 1NJFA 3R9WA 1E96A 1KY3A 5JHGB 1QRAA 2CL0X 4A6PA 2WOOA 1T5IA 3QUSA 4W5WA 1BYUA 4CEJA 2GZHA 1E94E 4D25A 4C0AC 2KBFA 5EXTA 1E0SA 1OH7A 1AKEA 4TT3D 1FMLA 3F0TA 3ZIAD 4Q7LA 3GLGB 2GEVA 2RGNC 3FHTA 1XNJA 5AJVB 3CKLA 4MKHA 2C77A 1BO6A 1KY2A 3HJNA 4OI2A 4Q9LA 1B23P 4DJTA 4B76A 4JVLA 1SXJD 4CEJB 5JRJA 5EUMA 4DB4A 3X2SA 4WZBE 4HAYA 4NCIA 1FP7A 3FGNA 2QORA 2B7CA 3ONWA 4JSTA 5TXGA 5AK0A 5DSZA 4N1AA 3TIFA 5TY0A 2W2XA 3RDPA 2FV8A 2XTNA 5CK4A 2JCSA 2EFCB 4WA7A 3RANA 4URVR 1ZYUA 3R8CA 3RHFA 4FWTA 2UZIR 2ZJAA 4HLUC 4AURA 1VHLA 3GCGA 3EA5A 1DBSA 3K70B 2ZSEA 3FMPB 1N6PA 3EASA 3HYRA 3EXAA 1N6HA 5HTKA 1T3HA 2A5GA 4TZ0A 4NU0A 2Y8EA 2IYZA 2R6DA 4I1OA 1ZIPA 4PAOA 2DBYA 3ASZA 4ZCLA 1XTSA 3LV8A 3W5JA 3UWOA 1SVLA 3RRYA 2GAOA 4IKEA 3SJBA 1BIFA 2AKYA 1UKVY 1D2NA 3NWJA 4US0R 1T5LA 4L5BA 5BYJA 4DC9A 1CJTC 4AG5A 1Z2CA 3H2YA 3SQXA 2ZROA 1T3LA 3DM9B 4G3XA 1TEVA 2FF7A 2H92A 1KSHA 5FL3A 2ATVA 2QI9C 1W0JD 4A36A 1DAFA 2KSQA 4LYJA 2CL7X 3I1FA 4QNMA 4TWZA 1G6HA 2JJ1A 4XSGA 2QU8A 4IHQA 3VMFA 3RS0A 1Z28A 3IILA 4IDHA 1VG9B 2XSZA 1Z06A 4NZYA 3VX4A 4NYMQ 3U6KA 2IWRA 1H8EA 2W6JA 1JI0A 1JQJC 3AF4A 2NTYC 4B2LA 4A2QA 2PT5A 2AN9A 2WSMA 3LW7A 3U3KA 1WQ1R 3WP0A 1BMFD 3PUWA 4Q9KA 3P26A 2IHYA 2R2AA 2XB2A 2MMCA 1G18A 2X19A 2OILA 5LDDC 2WM9B 4TN1A 5ELXA 4HAXA 1R0XA 3SHFA 4HUTA 3AVUA 1OIVA 3PUYA 2X8AA 2IS1A 2YKGA 2PZFA 3QF7A 4Q1CA 1PJRA 2UKDA 3B78A 4WOPA 4GMXA 3I8XA 1GL9B 1CLUA 1ESNA 2WWIA 2ZRAA 4KJZA 3V4FA 5C4GB 3OIVA 1GM5A 1TTTA 3UKDA 1SVOA 2OT3B 2CNWD 2FFHA 3DO6A 2ZRDA 3PR1A 4S2EA 4XVRA 3SYNA 3I61A 3GLFA 1AJEA 1G3RA 1Q1EA 3MRSA 4B75A 5JCZA 1NN0A 1D9XA 2DHRA 3OIYA 2QTFA 4JT2A 3DOFA 2NZ8A 4NDZA 4NBSA 1E6CA 1FUUA 1CS4C 4Q9IA 1Z47A 1GOTA 3BORA 4YDHB 2YVUA 3EX7C 2D74A 3Q5DA 1NN3A 4V0ME 4GDFA 5GVRA 3QEJA 3KFVA 4L16A 3GLFB 4C9BA 3U61B 5DN6A 4TL8A 5DYGA 2QE7D 2ZJ5A 2EWVA 3W6NA 2V7QD 1C4OA 3E2IA 1WF3A 4IXNA 4HB2A 1SKYE 4LOAA 4Q5IA 1AK2A 1UKEA 3B7GA 4QBFA 3PCRB 1E9EA 2HUPA 4NYMR 3T06B 2D7DA 3WY9A 1Q12A 2BOVA 4R7ZA 1CJUC 4XVQA 2XITA 3EIEA 1L2TA 4MYTA 2IYLD 3VKWA 3KQHA 4B3CA 5KOYA 4TTQA 3CLVA 3K9LA 4Q66C 4OJKA 5EE1A 2GK7A 1X1RA 3W90A 4LWZA 4A2PA 1U0LA 4M9ZA 2GILA 4QGHA 4EJSC 1FZQA 1EFCA 1FQJA 2IYSA 4UXJA 4AYWA 4YMVA 5JJIA 3IGFA 4DDWA 3L8YA 1VMAA 1HTWA 1E2PA 1YR7A 5IRCD 4B2PA 2IXEA 3K1JA 3BERA 3IDQA 1ZCAA 4M2LA 4DB2A 3NIBA 1YE8A 1TPZA 4PHFA 2ZUDA 4WW0A 1JECA 3LY5A 1E2MA 5A4JA 5FPSA 2WJGA 1GNQA 4QM6A 5F9FA 1UKYA 1P2VA 1QHYA 1MRSA 3B13B 1JPJA 4QGFA 2G3YA 1Z0JA 4B3FX 3ZYCA 2WKPA 1S4QA 2YOHA 4URUR 1JR3A 2QZ4A 1U81A 3RSOA 4GP6A 5DIFA 1QBKC 1BOFA 1KGDA 4FINA 1DOAA 2JJ2A 1E1QA 2OAQ1 1PLLA 4R9UC 5F2EA 2IUSA 2Q9AA 4AC9A 3SJCA 2VSXA 4NP6A 4CVNA 2P3SA 3G0HA 1I4TD 2JDID 4JYBA 4OQNA 2V9PA 4TL6A 1KI8A 4XOIA 5CYPA 2YV5A 3GEEA 1JNYA 4I99A 4X8OA 1XFAA 4TLBA 5TVKA 2EYUA 2WIAA 3SNHA 3VR5A 2CE7A 2F1JA 2J7PD 1NF3A 2PJZA 3MWLA 3W8RA 5J4YA 5JHHB 1DARA 1UBGA 4A82A 5DGXA 1OYYA 4RFVA 3TUJC 3TVTA 4OI0A 3FKSA 1GTVA 2FX3A 4EPXA 2GXUA 1GP2A 4RD6A 3ZZ0A 4F7WA 2YWHA 2KBEA 2J45A 4RD2A 4B6FA 1EFTA 4M53A 2BMJA 1G5PA 2QAJA 1NVWQ 1QDEA 4JLMA 5G40A 4GPTA 2WAXA 2A78A 4JLNA 1AS3A 5HE8A 3R9XA 4IFEA 1HE8B 3MMPA 3AVQA 3R7WA 5SZJA 2PEYA 2QRNA 4IOKA 2ZITA 3CONA 1ZUHA 3KKPA 1GRQA 5JJKA 4TLEA 3TSZA 3CIOA 3B1XA 2VRWA 4JBXA 3QENA 5HKKD 1NMYA 4QFMA 3VHXA 2TMKA 3QNUA 2VHJA 3AEZA 2WJJA 3DMDA 1UM8A 1XRJA 5EZ6B 2DY1A 2LWIA 2YJTD 1AS0A 3U7EB 4GT1A 4URZR 2F43A 1E2IA 3TLXA 2PX3A 1Q1ZA 3RWMB 3LBNA 3Q72A 3R7WB 1QG2A 1LY1A 4V0NA 3N5CA 3RNLA 3WBKA 4JLKA 3B1WA 4JSYA 4U02A 3WYGA 3LH5A 1DTSA 1IAQA 3GLGE 3VTKA 2YHSA 1NLFA 4S35A 4QKQA 4C2TA 2F1RA 2IF2A 3DM5A 1U8AA 3ZVLA 3QXJA 4A9AA 4KLZA 3LBIA 3IUYA 4Z8YA 2VP6A 2H5EA 1ZU4A 2HXSA 1EFRD 1HV8A 3GP8A 3GFOA 3BS4A 2MSCB 1ZC3A 5K8UA 5CK5A 2F43B 3PUXA 1GDDA 4CEHA 3GJ6A 2GAAA 2IHBA 3P32A 4HSEA 1OKKD 2WMOB 1OE0A 1OH8A 2AK3A 4KFRA 5J4LA 3CX8A 3PG5A 1ZNWA 3LQRA 4LK2A 1E98A 4R98A 1ZNYA 5EZ5A 4BFYA 4HAVA 1OIXA 3OE7A 4DEXA 1NVXQ 4LUCA 1IN6A 4O2LA 5BW8A 4LYHA 4ACBA 2FMXA 2NO9A 3BGWA 4U00A 2ZI5A 2I4IA 4CEHB 4A1FA 1TADA 4H1UA 2BJWA 5KPDA 3GJ3A 4LY6A 1F2UA 3D31A 1J8MF 2PLFA 4Q7JB 4Z54A 2OBLA 2R62A 2C8VA 1ZINA 1C9KA 4LI0A 1M2OB 3O8BA 1HYQA 4QJ4A 4OHZA 4A0RA 2Q21A 1E4VA 5BXQC 3KB1A 1DO2A 3KJHA 4RCZA 2G0NA 3AKCA 4Q7KA 3TGPA 2WWGA 4ERNA 2QQ0A 3NH6A 2HT6A 3VU9A 2ZVQX 1S3GA 1SULA 3GJ5A 4KSBA 3WYFA 2QRZA 3SOPA 4BFZA 2BWJA 1F2UB 3WXMA 5KSPA 4MYCA 2FH5B 2WICA 1D6JA 1KK3A 4D81A 5HZKA 1TNDA 5H1YA 4RVCA 4ZDKA 1JAIA 2Q9BA 1YRBA 2EWWA 1QVAA 4E5UA 1U9IC 2CL6X 4DWJA 5CJPA 1DO0A 3OEEA 1TQ6A 3NEYA 1R0ZA 1VYUA 1JBKA 2QT1A 4BWYA 2RMKA 4DLVA 1UJ2A 3T61A 3VU9B 4TSFD 1DPFA 4R71A 3AVVA 3M6AA 1NBMA 1XTJA 1EESA 3MWYW 1A1VA 1ZP6A 1J90A 3K0SA 2C98A 5EE0A 4CEIA 2ZYVX 4FMCB 2B7BA 2ZI6A 2OCBA 2PBRA 2FN4A 4OHXA 2OV2A 3DKVA 3E5HA 2HCBA 2O8EA 3BH0A 4LJAA 8OHMA 3G5UA 1OT3A 3BFKA 4BLSA 1CIPA 4NYJR 4W5HA 1HH4A 1E9CA 2FEOA 1AQUA 2H17A 3UATA 4V0OA 1OFTA 1BH2A 4QJ3A 1P5ZB 3LQQA 3LWNA 3NH9A 4TTPA 4ZDWA 4B3DA 3KUDA 4CEIB 4HZIA 2A9KA 2WJIA 1YZTA 3MGCA 4QBIA 3FMFA 4JL5A 4PAQA 3UMSA 4DLSA 3VQTA 3AM1A 3BFVA 2O8EB 2AL7A 4JLAA 4I1SA 5LPNA 4OBEA 3KFXA 2F3RA 4TT3A 5H68A 2RGNA 3OHMA 4DZZA 2F1HA 3RWOA 4QHYA 4PAMA 2XGJA 3W5IA 2PMDA 3QG1A 1F2TA 4F4JA 3A37A 2GXAA 5FPTA 1E79D 1N2CE 2V55B 3PEUA 3ETLA 2CLSA 1ZCBA 3MWJA 1D2EA 1E9BA 1U0HC 3KX2A 1NN1A 2OM2A 3UG6A 4PPNA 1CBUA 4Q9JA 2J7KA 1KMHA 1G17A 3SBEA 3GJXC 3RLFA 4GBMA 3U2QA 4LYAA 3DOEA 1PZNA 2Z4RA 2GCNA 2NOAA 1NG9A 2H1LA 2JAQA 5FBLB 3QXXA 1CRPA 3EPKA 4LGMA 1R8SA 4OK3A 2PJRA 1F2TB 1RYFA 4GRAA 5EXPA 4F38A 1E9AA 2XZOA 2OO7A 3RSLA 4HLUA 2XAUA 4LJ7A 2ZJBA 1XTKA 3UWKA 5JWRA 2AWNA 1KMHB 2GEDA 3EG5A 4II7A 3C41J 1KZ7B 1S3SA 4WZAE 4ZKDA 1MRNA 1R6BX 2EU8A 5J4HA 2GZAA 4PC2A 3NBXX 2XNSA 4TYWA 4UJ3A 1V5WA 4DDVA 3OFNA 3NVAA 3X1WA 5ANRB 1ZM3A 2CXXA 2A30A 1XMSA 3U3OA 3NKVA 1GL7A 3K0EA 3FFAA 4NL4H 2F1IA 1EWQA 5G41A 2QMUA 3SBDA 1ANKA 3ASYA 3K8YA 4ARZA 4WZ6A 1KAOA 2VIIA 5JEEA 2DWOA 1PLJA 1G3UA 1W0JA 2P65A 4JLDA 2QBYA 4PANA 4IDQA 2IL1A 1HE1C 1HURA 1XEWX 2B92A 3F5FA 3MG9A 1UEIA 2QSYA 5IT5A 1E2JA 5JRZA 4CRWB 1G5TA 1QHIA 4NYIR 1T0HB 5BN5A 4C0HA 1IXZA 3TR0A 3WYAA 2JJ8A 2FGJA 2ZANA 3ZQ6A 2JIZD 4LBYA 3C15C 2P2LA 3RS5A 4ZI3A 1S9DA 3V00A 4ARZB 4YLGA 1G3IA 4OL0A 5G53C 1BMFA 1DAMA 1QZXA 4OK5A 5EP3A 4ASUD 2QBYB 2Z6VA 3T5DA 3K9NA 4PC1A 5JI3E 4NCKA 4A4DA 2DCUA 1OW3B 3U3JA 3U44A 1KJYA 3L8ZA 2BC9A 1KK0A 2HCJB 4PPGA 1XTIA 4MKGA 3VR4A 5JLJA 2D4HA 4AYXA 2AR7A 3MD0A 5FTJA 3ZS9A 2QY9A 2OEPA 5CIQA 1ZBDA 2OUKA 3UK6A 4JBWA 1W46A 2WJYA 4BLPA 4EPYA 5JCPA 5AUQA 1LNZA 1NSFA 3S1AA 1SHKA 2XTMA 2HYDA 4C30A 4PC7A 1IN4A 2Q6TA 4JKYA 1T3SA 3D8BA 3P1JA 1X1SA 4D4KA 3CPEA 3FWYA 1NVUQ
chains in the Genus database with same CATH superfamily
4XM0A 5DGIA 4LQ4A 2CNWA 1RHRA 1ZM9A 4YQYA 4YWJA 3ZJYA 1RFLA 2D1TA 4IS3A 1GPYA 1UH5A 1XEXA 2VAMA 1A98A 3ZE9A 1UM9B 1TGYA 3FLMA 3GDHA 4I55F 5EWJA 1Y5LA 1OWOA 4HNQA 4YJKA 2AFHA 5SZKB 3S1AB 1UBEA 3RTDA 4UVGA 1NVMB 1T13A 3JQ8B 1JAHA 2M98A 4GS5A 3W6ZA 1IQPA 2YJ4A 2JAXA 3G0OA 2D54A 2DZDA 3N76A 3OO1A 1PHPA 2NXJA 2P78A 4IJQA 5LP6A 3IXLA 4RMHA 1MAUA 5DTQA 3UB2A 4G01B 1P45A 3P2MA 4XWTA 4NZZA 2ORIA 4C0KA 4M1SA 4ZIRA 3WAJA 5C5CA 2B0CA 2PUFA 3TLBA 2ZCJA 3G2HA 4XR9A 1XKQA 1ZFNA 2VSOA 3E70C 3GLUA 2VL7A 3BCUA 5K5EA 5LQKA 4JOBA 1L6IA 4OLJA 1N5DA 2RGXA 3ENZA 3QBEA 4S0ZA 1L5RA 2GCPA 4UCWA 1QIJA 4R05A 4NBWA 3TVYA 2ZI9A 4BFVA 4EITA 2C9BA 4J2TA 2Y1OA 3MINB 3OIDA 4GE3A 4MDEA 4AFNA 4UDOA 1KBOA 1NFFA 1P3JA 2R5NA 1FVFA 3RRZA 3WGJA 4NZOA 2QPOA 4CTOA 2KX7A 3P4UA 3P9SA 2QN2A 3G9QA 4ZHQF 1BGVA 3IFSA 3M9LA 1E6WA 1AQJA 1SU7A 1N1GA 2IHKA 2G80A 2O8NA 5FAXA 1R6TA 5A62A 5D3MB 2ID4A 1RWPA 1Z08A 2Q49A 1E2QA 3FVTA 1I4DD 2VT7A 4I1UA 2B4YA 5IDYA 2YXDA 1RRFA 2P6MA 3IAHA 1LLFA 4XH9B 2XWSA 1W4BA 1NUQA 2KI5A 4E5NA 2PUHA 3WX0A 3N6RA 3VC1A 3IP3A 2HEIA 4KNVA 3QVOA 1QP4A 3E9NA 1THZA 1XNHA 3EXIA 5AKXA 5EN4A 5LXTA 2CXPA 2Q5QA 4S12A 5IH3A 5JOQA 1PIWA 2O2GA 3PYLA 2FY8A 1SXJC 4MKIA 1GKUB 1LRKA 4M1ZA 3TJMA 4B6RA 4JK3A 5EINA 3GAFA 1RYHA 3AFNA 4B74A 4Z4EA 3W0LB 2PZAA 2RGBA 2X6QA 1QC5A 3IUSA 4BZXA 3FCYA 5IASA 4AULA 2O0KA 4H3KB 2A35A 4H7EA 1L5NA 3SVTA 1CP3A 4IIVA 4BFTA 5AR1A 2NUAA 4HP8A 3LDFA 1L4EA 2ZS7A 3GLHB 3P0EA 1SK9A 3FAKA 2W6OA 1XQ6A 4OQFA 1KDPA 2YW9A 3I2KA 3A6DA 2IUTA 5GTDA 4WKPA 5FBKA 3W8EA 2IF0A 1JV2B 5JBNA 1G20B 4Q4DA 1T8TA 1CUYA 3Q9LA 1Q20A 2FLWA 3A9CA 1JEDA 2M6SA 3M0EA 4L4SA 2OA0A 4EAQA 2BEKA 2ZB7A 3H2HA 4XIJA 5DI3B 2Z2IA 1E66A 4BRWA 1FSSA 3LXMA 3J81k 5B57C 3F67A 5I9IA 1FDWA 1JH9A 5JQGB 1PEKE 3QE3A 3QOXA 1NMSA 1NUAA 3NORA 4YJHA 1R4ZA 2VCYA 5H59A 4ZMSA 1JSRA 1NA5A 2A88A 2IXDA 2R6GA 3BWDD 1VYVA 1NG1A 3QE4A 3LHSA 4V3CA 4D3FA 4DE5A 5BQOA 1ZXLA 3CW8X 4H4EA 4EYEA 2VA9A 3PR3A 3QELA 4TGLA 3E7WA 2IS2A 4KBYA 1SZCA 1Z2NX 4TT8A 5T6MA 4F93B 5FV4A 4X66B 2A0YA 3SIRA 3WL3A 3KUUA 2Q9UA 4LHVA 5ABPA 4XYMA 2FXIA 5CH5A 5ALOA 3KDSE 2QLTA 4I9GA 3W8DA 2FG7C 1C1HA 3KR9A 4JC4A 4UTVA 3CNLA 4JJ6A 4PS1A 1KMMA 3B60A 1LS6A 3TZKA 5ICSA 4TYYA 3LY8A 3NTUA 3H86A 3BMXA 5IYZB 1DQRA 1FP4A 1KYIA 1MMFB 3EVAA 1VPLA 4OMDA 3LP5A 2HD4A 1J4AA 3UT5B 3C4QA 2WUVA 4FVTA 4JU8A 3W2EA 3WGYA 1CTQA 4KE9A 4G8BA 5H5JA 5IKXA 3D5QA 2VSYA 4UNSA 4I19A 1II9A 3STTA 3ZHTA 4RY0A 3GH3A 1EX7A 1B8UA 4UBJA 1XXLA 1GPBA 1P5FA 2EVWX 2HRCA 2VAXA 5CP8A 5FLKA 3IP5A 5L3RA 4JI6B 4OSPA 4RJKA 3HI4A 4C2UA 2GI4A 1G0OA 3QYAA 5BSHA 3CRQA 5JVDA 1U1GA 3STUA 1ODKA 3AEUB 3T4EA 1VLJA 5AM5A 4HBGA 4C3ZA 3OTQA 1YBVA 3KSZO 4ZALA 3IOEA 1HZZC 2BFWA 4L5CA 2ATCA 4WA8A 3O8QA 4YJFA 3SXUA 3W2IA 3WMXA 2YY7A 3AVOA 2WUDA 4LRTB 4LWQA 3RS9A 1F2DA 2Z1MA 1J8DA 2LTAA 2F48A 2DUUA 4J9VA 3AF1A 5FPPA 1I2BA 3OUZA 1E2FA 1U8YA 3NVMB 4UU0A 1SXGA 5ENDA 4EJ6A 1SNYA 1BW9A 2EEPA 1X1EA 4M55A 1T1IA 4RMNA 2R4UA 4UMFA 2BUBA 5L9AA 2C9OA 3IE0A 4H6VA 4RJ2A 2I2XB 5I9NA 5KQMA 4DUZB 4QYMA 2IXGA 4WXEA 4RETA 3IIJA 1T8YA 1GZ4A 2UZ0A 3MJSA 3VDMA 1YU9A 1VHWA 3JASB 1YB1A 1QQTA 2YC2C 3OY7A 4RY2A 1U9CA 4XM1A 4D2IA 2PSEA 1P9NA 1L7EA 5IANA 3JQGB 3IYLW 1EGAA 4MS4A 5HRCA 3RG8A 5I48A 1GZDA 1GFIA 1XMJA 3KL4A 1OHHD 2EEZA 3W1EA 2RCNA 4Q4HA 1RVV1 4X6UA 3PICA 2C9YA 3D5EA 3JTMA 3EQ9A 1HG1A 4DKJA 4G36A 1S96A 1KYQA 5DCYA 5E3HA 1IQ0A 1N8KA 4MRMB 2I4MA 4JHXA 5FF9A 4QAJA 1QIKA 4H17A 3RVQA 3ER8A 3BHMA 1UPAA 3L0YA 2FWBA 5CA1A 3THYB 3GHYA 2DYKA 5DYIA 4IEEA 1H0SA 2AUTA 4MWGA 4AMBA 4ZOEA 2P6PA 5JZBA 3AJ8A 2VDWB 3AFGA 1KEVA 5BP7A 3L05A 1UWVA 3PEWA 1YI0A 4ZOLF 3QFCA 1WDWB 3O73A 2KYRA 3TZLA 4J0QA 3BHJA 1WD7A 2CZQA 2HFKA 4K88A 2AYZA 1ATZA 3KR0A 5KBYA 3R0JA 2V3VA 2WA1A 2J46A 4W5OA 2X4LA 2ZJ1A 4YS6A 1GLGA 2I54A 1E8MA 3G7UA 4EZEA 2BRUC 4UATA 3TH5A 4WQMA 1ZVJA 3OTIA 4TM7A 4BJ6A 2IH4A 4R2HA 3U7HB 1B74A 2ZTSA 1MGOA 2OCDA 1BXZA 3BT7A 3DE7X 1BX1A 3K09C 1CEEA 1GYPA 3ESZA 3Q1LA 4G56A 3V7WA 3OLYA 3ISVA 1Z7BA 3TTWA 3UUWA 1XU4A 2JFFA 3U48A 2FETA 3WE7A 2QLFA 1A7JA 2GFQA 4ZC1A 1A9SA 1YK0A 1QHHA 1TMOA 1QHSA 1GPLA 4PBSA 4NATA 4WOBA 2D59A 1J5PA 5TS3A 2NO6A 3DC2A 2X8LA 3H9QA 2H2WA 3UHPA 4PLZA 1GG5A 1E1KA 2QPTA 1T6YA 1VRCA 3DV2A 2XRZA 2F7SA 4YUAA 2VF7A 3D0RA 5C8DA 5LOVB 3ODPA 2B4KA 1AGNA 3DL2A 1H4SA 1UMBB 4BC1A 1DL5A 1N33B 1ZC4A 2ZJYA 2AQ8A 2H0RA 3RNOA 3TPCA 4NFSA 4MGKR 3OLVA 4M0KA 4RQUA 1G55A 5LL6P 1T2CA 2B8WA 2VBGA 1OA0A 3DBRB 3SSMA 1JLLB 2HRBA 5FTMA 3ENNA 1KDZA 3K70D 4N41A 2OZEA 5DOZA 4EY4A 1KBZA 4A16A 1ZY2A 4M0FA 3BHNA 1DV1A 1RQ2A 1Q77A 3BHIA 4DQDA 1RQPA 3AEQA 3QOYA 5TX7A 1BHSA 2ZVJA 4N4AA 2BT4A 3TEJA 1E7MA 1CJKC 5I47A 3WZ2A 5K8LA 1U02A 3MLEA 5BR4A 1R0RE 1H8HD 1Q7TA 2H2HA 2QM3A 2RB5A 2B34A 3MSCA 4RK5A 5AUNB 3DLPX 3O9MA 2I76A 1FQOA 3VSEA 1FJXA 2HJWA 4RD3A 3T7AA 1E89A 1LZKA 2JIPA 5J4VA 2Q3FA 3N0XA 3W3AD 5LQRA 3MJ4A 3OZVA 4JIMA 4ZI2A 1C8KA 4QJIA 1L4YA 1Y7TA 3PRKE 1EDZA 1E1LA 4FCWA 1JAZA 4FGKA 4JEMA 4KQJA 2MSLA 2PANA 4KVFA 5AHOA 2J9YB 2YBDA 1PVOA 4B4KA 1IVYA 4XQ9A 2ACEA 4F4IA 1X7ZA 3A26A 1LW6E 3QLUC 4M1WA 1CJVC 4GBGA 4AI6A 2AD5A 1NOKA 2FN9A 2PTHA 5B3LA 5JEDA 1DTWA 1FNDA 1B0ZA 3WFJA 1I3LA 4E0BA 5FLXA 1OILA 3LVRE 4L57A 1VIVA 5CLGA 3GZTB 4UPEA 1M54A 1ZW1A 5LP6F 2VDRB 1P2UA 3RABA 1OVGA 1KZ9A 1X92A 4BNLA 4LSZA 2C96A 1TUIA 3INRA 1C3XA 1NNSA 4X6XA 2Z5GA 4QGSA 3KCNA 2HWYA 3H2IA 4AY4A 2EHDA 4P83A 2HJRA 1BKDR 3HC7A 5THXA 4YAEA 2QA5A 4A1OA 4M1KA 1KK1A 3NX4A 1QKIA 1ESDA 3O38A 4DYVA 1RQ7A 1YVEI 4QQRA 4QXAA 4KIJA 1U7HA 1XHEA 3SZRA 4GHWA 2XUGA 4KCGA 3SR0A 3ZX4A 5ADWA 4L2IA 3VPHA 2IS4A 1A2KC 1SA0B 1KAGA 3OICA 2JLVA 2VRCA 4GR9A 3IUPA 1YKGA 3WZLA 2WJ4A 2QL6A 5CDSA 5HJ5A 4Y9UA 4UULA 2QM0A 3NATA 3PXBA 1Q1AA 1THGA 1SVKA 4FCCA 4MTLA 3ZBTA 3VDNB 4DS3A 2VXBA 2V6IA 1Y1LA 1D2GA 2XRYA 4WCVA 4YT8A 3ZLBA 1Y1KE 2NU6A 1RLUA 1RKXA 1YZHA 1W88A 3PP8A 3PC2A 2IKQA 4L0QA 2JGKA 3B9PA 3OECA 2FE1A 3PPVA 5LMZA 1KZ1A 5HF8A 3Q7RA 4JGIA 1C2YA 2O23A 3CPJB 1G8YA 3EEBA 1RJWA 3BGOS 1WXIA 4B5LA 3AVWA 3QZUA 3S2UA 3TE6A 2P2SA 3FOZA 3RTAA 2PD3A 4ZOCA 4GI7A 3K94A 1U7TA 2ODAA 1PSZA 1SFRA 3N8NA 1XV5A 3A4VA 2IV2X 3NGLA 1N5MA 2JGEA 2JVJA 2FWIA 1JJAA 2RIRA 4ZYZA 3CO5A 1FTGA 1G4AE 1JXMA 5B7NA 2MHCA 1ZJJA 1ML4A 1U3VA 4MB2A 2GNOA 1YFZA 4A8HA 4BMDA 3UA4A 2N9UA 4C6HA 3EGXA 1OU4A 2OESA 5IVPA 5KPJA 1II8B 3LXXA 1XPOA 2BF7A 3HLYA 2BW0A 3BSSA 5IUJC 4XB6B 1NRXA 4RH1A 2B6NA 1KAHA 1DAOA 2HU2A 1FOEB 3N9IA 1EU1A 3H1PA 3RARA 2QM7A 4JL6A 4OQ4A 5F5XA 3JQQA 1GVHA 2QL5A 1XPJA 2CD9A 3QJGA 2B4RO 5ALRA 3GQVA 1NVGA 2A5JA 3IS3A 4FX2A 5BT8A 5D87A 1XXHE 4DADA 5CVCA 4QQKA 3TQTA 3CNBA 3B7PA 4DRXB 1D6SA 1PTKA 2WU8A 1R3DA 2HDHA 2YINC 4MGIR 2IC5A 3P96A 4MS3B 4DSUA 5JAPA 3CN9A 1JALA 3GVHA 2Q1XA 1J7KA 5DLPA 2DEUA 1OGIA 5HPYB 4YRPA 1F0NA 1XWFA 3SPXA 2XRMA 2YHUA 2XEDA 3PA8A 4GZLA 3F49S 1S8FA 4MR8A 1FPMA 4O4JA 4WZBB 2B0JA 1ZUNA 1SCNE 3ROFA 5A06A 2PNJA 4D80A 3RAGA 2Q8PA 1VCMA 4TWAA 1HNZB 1E8DA 3O7WA 3PLNA 3QNWA 2GAJA 3UTCA 1M1NA 2IU6A 4PN3A 4UBIA 2B1QA 1VIDA 3BD9A 4KUEA 4R2KA 1YFKA 2CFIA 2BFAA 1KQNA 3KKNA 2QENA 1E9RA 2JKYA 1VLMA 2Y3IA 3MYRA 1ISSA 2IP1A 4HATA 1PV2A 3KJZA 1X7WA 3BREA 1A9QA 1F17A 2IZ0A 1AN0A 3IP7A 2H2FA 2ZRNA 1URPA 3N59A 2AZDA 4NMWA 1BVUA 4PCLA 3UJ7A 1PV1A 3W9YA 5CA0A 4HQLA 4Y3UA 1WJGA 1X7GA 4WJKB 2Z6QA 3F2VA 3CEJA 2WWXA 1PJ8A 4OHFA 2HJVA 4DUPA 3V1LA 1ETHA 4FYPA 4XQGA 4ENWA 3FZNA 4GC9A 2CV1A 1EFKA 3C3EA 3C0KA 2XX3A 3KJGA 2ZAYA 4LTNA 3KQYA 4TYQA 5FTKA 4C4TA 3ZV7A 1E2LA 1G3MA 1M1YA 2HIGA 4MLPA 5JSZA 3KJNA 4FFDA 4QBHA 4D6PA 1AM4D 2GTIA 5LLTA 2XE7A 2I87A 4UM7A 4QU9A 1P2TA 2FPUA 4B6EA 3NJ4A 4RWZA 5IZCC 2DHDA 4RQBA 3SS8A 2BI7A 4RZIA 2X6RA 2ZAOA 4EHNA 1A96A 1R0LA 1ZSVA 2J5XA 2ZJ6A 2EX0A 2GRJA 4KQHA 4Y9DA 2IYVA 1JFFA 1TK3A 3HUFA 2KMLA 1J22A 2IXBA 4H7PA 4G0XA 1ODCA 5I9MA 2KS6A 821PA 1T5DX 1SXIA 2QMQA 2M1ZA 1H94A 2YVLA 4KW7A 4PO8A 3ZOZA 1HSZA 1WF6A 2GK4A 3MIIA 3QUCA 3C1OA 3SE7A 2QN9A 3QHQA 4CMEC 1EYZA 3H6GA 3SKYA 1WKVA 3T95A 5LIPA 4MB0A 4M37A 5EQFA 3D59A 3N2EA 4RCVA 3TXYA 4DCGA 3AEKA 4OM7A 1NDUA 5HYVA 2WHXA 1JIIA 1XZCA 1QFJA 1YR9A 1EVYA 3RUFA 5AHWA 1SXJA 1UDWA 4S0XA 4RAOA 5JS8A 1JSCA 3T3MB 2OC9A 2PFSA 2QZZA 2W71A 2FW1A 3EWSA 4MYDA 2AB0A 1R00A 1SN7A 4JH0A 3GJZA 5G02A 4EO9A 3I62A 1YQUA 1E69A 4B7UA 5KYXB 4ZZ2A 3DAGA 4TLCA 5TSDA 4G5SA 4C3VA 4KO8A 4G9GA 2PZMA 4J0GA 4FYMA 1Y3CE 1Z4KA 2FMHA 3VX3A 5DNYB 2GCOA 1IWOA 2O50A 1E6MA 1ZD9A 4MKZA 4QU5A 1NMXA 3GJ0A 2P5UA 5HQ3B 3OM9A 5BSWA 3EEIA 2YYSA 1Z13A 2LUOA 1EP1B 5JV5A 2QVCA 4WE3A 3CZ5A 4AY5A 5CA1F 3ORYA 1J1ZA 4WY2A 2YJZA 1MO5A 1NJ5A 2DHQA 4RQTA 5HUQA 2ZB3A 1M6VB 2D06A 2GBLC 1PFGA 1W94A 2A94A 2VJNA 2YIVX 4XQ0A 3K53A 4MQ5A 4C4OA 2O7NA 1TO2E 1QRRA 3B6IA 5FBWB 1ZZEA 4OYLA 2WIJA 5AHRA 2XYPA 4WKGA 1S2OA 4KHZA 4A0HA 4W1RA 3TOCA 3VU8A 3AGQA 2H2GA 4RDHA 2QX8A 4E5DA 3AOGA 3ADBA 5J47A 5T3UA 1TMKA 5F52A 1BDJA 1ZH8A 4UOEA 2AFRA 3OQ6A 3W5VA 3TJRA 9ABPA 3TN7A 1GG2A 4NDAA 4JVMA 4ICIA 2WM3A 3ZEIA 4MAAA 1GHTA 4BXOB 1W4RA 2OUIA 1NYQA 3L6DA 4N8DA 1R6AA 1WV0A 4F4UA 3U6BA 2BM0A 3K0KA 4EKNB 1ZM2A 3H5TA 3KQQA 4XX0A 3AFMA 2F9FA 3ORSA 4BNFA 2VF8A 4M88A 5KMGB 1U9JA 1XTBA 2BZGA 3DVLA 3L7AA 3JWIA 1V7CA 5CFQA 3KTAB 1AURA 3KKMA 1TAHA 2CC2A 2XOXA 3JQAD 5D85A 2AUNA 3HKCA 3UOGA 5CAEA 2YWXA 3DHVA 5DW0A 1AZLA 4TLAA 1MR3F 1Z74A 3PVSA 2PYZA 4IHAA 4NK5A 4ZQFA 2IW1A 4J9UE 1JR3E 1L8LA 3O31A 4U7DA 2WZQA 1JU3A 4FCTA 4M9SA 2WSLA 5EPEA 3FYUB 2C2WA 4LOKA 4CT5A 4A0FA 1ORWA 4HFNA 4GBJA 5DM0A 1J06A 3WOVA 2A58A 4WINA 2ZUTA 5E3IA 5KOIA 2ASVA 2GCIA 1MC1A 2FWAA 2VP4A 5HKLA 5A2GA 5JALA 3U4QB 1MA3A 3T54A 2NSJA 1UXGA 1Q7CA 2QLLA 5AVUA 2P0AA 4HX2A 5L4SA 4FHZA 1LPSA 4JT9A 5A9SB 3SICE 3NWBA 4HDAA 4QX6A 4G26A 1HZZA 4H7JA 5DTRA 2DY0A 1A27A 2H1HA 3BWXA 3NIWA 4OQPA 4YDSA 2L19A 2PXXA 4LAFA 1Z4OA 2J6IA 3C1AA 1M76A 2JGDB 4HX9A 3OP1A 3FW1A 1N2BA 4E5SA 3T5GA 5EKTA 4EUEA 4V03A 4OY3A 4ZAZA 1VXRA 2BZ1A 3HHEA 4D0LB 5AKEA 4C0LA 1DMRA 1YE3A 1MN6A 3GLSA 3BILA 4QBKA 1Y8QA 1JN0A 3EUFA 1DEXA 1E5VA 1RMYA 5TB5A 4BUZA 1RYYA 2JFGA 3E53A 4OIFA 2ZYSA 1UT6A 2COKA 2ZRLA 3FWHA 2YN4A 3PCXA 2HC9A 3PD7A 1OXSC 2CMFA 4AMGA 4Z7JA 5HM6A 3HGTA 2XUHA 4QYIA 3CUKA 5IKOA 5EHXA 5JAUA 2ZSAA 3MUEA 2QGZA 3PQ4A 1X7YA 5CTJA 3MEQA 5FUYA 5CYOA 1XPRA 4MQLA 2NO1A 1HG0A 3TSAA 2JEYA 4N3BA 3TTTA 4B2YA 3FOAA 3I1JA 1ZAYA 3RS2A 3PC7A 1DOHA 2Y92A 5HXAA 1VFNA 4IVRA 2VQEB 3QKRB 2C3UA 1FYVA 3P2JA 4G65A 2BYTA 3IIMA 4NJMA 3INTA 1IEQA 1NPTO 2ZWOA 3HP4A 3RIYA 3DDNA 2HMTA 2K6GA 4RCYA 1EFDN 3HYTA 1JTVA 4B7XA 5FEUA 4GUAA 2O5VA 3WL8A 2X1HA 1PL8A 3BMQA 4OB6A 1R4MB 1ULSA 2X5NA 5HDBB 3FHOA 3HU3A 1ZWKA 2Q2QA 4J7AA 3JD4A 1EXMA 1R6DA 4XYEA 1BGWA 2ZRKA 3DV0B 2QX6A 4Y1EA 5ELLA 5GZ6A 4DEYA 1DC5A 3SBOA 3FZQA 4MP3A 3SMQA 2AJBA 4FMBB 3D4OA 3LCVB 1T4GA 4HYEA 4DBZA 3IT1A 2OQVA 5JYEA 3EZ7A 4UM9D 4O2AB 4N0QA 3FYSA 2CLKB 4E30A 3O1JC 4DLUA 1VE7A 4OX9B 2Q2WA 3FPAA 1Y3BE 4V2UA 4AS3A 2BRUA 4NNPA 5FQNA 4A8TA 4GZ6A 4X90A 4A2WA 1U94A 2I33A 2IHTA 3OPXA 3L8MA 1FX0A 4MROA 5JAMA 1MTOA 3RIXA 3K09A 1K7CA 2DULA 4NXNB 4FNGA 4GO1A 4GPBA 4ND8B 4BMSA 1PNRA 1RKUA 1QHFA 4WV3A 4L6CA 2E3JA 4C6TB 2XDQA 2FDXA 2VSNA 2B8JA 1T34A 2XGGA 5CT4A 1M34E 1X94A 1CUWA 3LUBA 4QTXA 1QJCA 3RBAA 3QV2A 1FMFA 3MTJA 3EAGA 4QC2A 3H5IA 1FNNA 1JPNA 2I3AA 1SUBA 2A9PA 2XMQA 4PLVA 2FZLA 3G82C 4EFNA 3LUGA 1H3NA 4R31A 1MCZA 3VPXA 3HN6A 5DTMA 3B6EA 3U49A 3QVVA 3MJFA 2IYFA 5G3ZA 5KQRA 3DWFA 5AI8A 2GPTA 3P9CA 1JKJA 4JI0B 4IDPA 1CZRA 1A76A 2EWMA 3UGKA 4BUJA 2QN6A 4FWIB 3ORQA 4FJ0A 4TSRA 4GKBA 3M9XA 4QUBA 2P4EA 4YMTA 4L5YA 3GCZA 3UFBA 4JA0A 1JRLA 4WAUA 4BMNA 2PH1A 3NTVA 3TTYA 1L4BA 3KUXA 1SHJA 3RVKA 4MR7B 2V7GA 3FUXA 4R84A 4GX5A 3EPHA 4MCIA 2FRVA 3EVNA 2BTQB 1X1DA 2J7PA 4NBRA 4LJYA 5CM8B 4NWIA 5TQ0B 2RHOA 3WTBA 2QTVB 4ZHSA 4TKLA 4CDNA 2BGWA 1GZUA 2HPZA 4A8JC 5J23A 4BO1A 1Z37A 3H4TA 3VV2A 1C81A 3D6FA 3ZWVA 3NBQA 1H8HA 2EKQA 3ROPA 1BC5A 2SCUB 1PZGA 1QV9A 4Q7QA 3LY9A 3EYAA 3IP9A 1TYZA 4KX5A 5SV2A 4BMYA 2QAGC 2OOKA 1UMCA 4K6MA 5COAA 2H1CA 4MW6A 2Q0SA 3W3AA 4EEXA 5FBZA 1LD3A 2OBBA 2XYRA 2J3QA 3FNHA 4N7RA 4N6NA 3G9XA 2R9VA 4KC0A 4WY5A 4LFCB 2H8KA 1PW7A 3GGDA 3TQSA 3WHLA 2WV7A 4U2FA 4WOKA 2CNDA 1I2MA 3QLUA 2MOKA 3IUEA 3UVEA 4CCAA 1E2UA 3GP3A 1KEPA 3GFBA 2ISQA 1J2JA 3GFTA 2NW6A 2P0EA 4BLOA 4EVIA 4NCJA 4XVHA 5EWMB 2YFYA 2PMBA 5LQNA 3GOQA 5CLQA 4E13A 5U4XA 4RS4A 2FG5A 2O2YA 3JPYA 4RMJA 4ZAWA 4NBVA 2BKLA 1TF7A 2IELA 3GUYA 4GM0A 2BBSA 3IAS1 2IS6A 1ZR4A 1QOPB 2W8BA 2W6CX 4GE0A 1RTKA 2JFOA 4NLLA 1F8GA 1Y63A 3TUIC 4YJ3F 1XMQB 4FFMA 2D5AA 5CDFA 3WGQA 2P9BA 1V45E 3CX6A 3IH5A 3QX3A 4PBRA 3WIBA 5AI0A 1AB5A 3W3ZB 1G7CA 4HKTA 1XDUA 2PZJA 2YMQA 3HYSA 3PWKA 4HN2A 1J97A 2CBGA 4IGIA 3GRYA 4IDNA 3KYJB 3GVPA 4MZXA 3ZPXA 2HGZA 5JNUA 2ZTHA 2X7HA 1V95A 4X64B 2VDOB 3HJAA 5E4TA 3B6MA 2O0JA 1SRRA 3BL8A 3QA9A 4ARSA 4ARAA 2YIDA 5CYFA 2IU0A 5A4FS 1QYRA 4TQAA 2CXRA 2ZBUA 1N6OA 1I7DA 3T1YB 1KC3A 5HZHA 1M6NA 2HV9A 2Y9MB 3O7MA 3PYMA 1EDEA 4FDTA 2EQAA 3MSXA 4J76A 4R1NA 3G2KA 5AXDA 3W6PA 4AZVA 2CHVA 2WSBA 1VE9A 5CT5A 3SC4A 5F7XA 5GINE 2Z08A 4TYNA 3ELWA 4LSWA 2AI1A 1Z6XA 2UUBB 3C8MA 3CUVA 4QEDA 3NRCA 1NN5A 4G4SP 3BICA 5ALKA 3NM6B 3RROA 1ZGAA 1K0FA 3NNNA 1JILA 4Z53A 4MDFA 2O7SA 3LFTA 2R0QC 3UT0A 1JLKA 3NASA 5BW6B 5C8ZA 2H8GA 2OZVA 3ZDYB 3B5EA 3EBLA 3Q2IA 4C5BA 1WB4A 3LOUA 3FDXA 1QAOA 1A2QA 1TMYA 4H77A 4MJ7A 5I4CA 3EGVA 3L8EA 5HBGA 1GXSB 1WXXA 3T4XA 2PR2A 2ZJ4A 2H4XA 4LDQA 4QAQA 1YZQA 5ERGB 1NYTA 3T52A 5A3JA 5KS2A 2FF5A 1ZZGA 2W42A 5SYNA 2R8OA 2FP4B 4CI0B 2DPYA 2GESA 4MPTA 2HSJA 4YI5A 5DHAA 3C7KA 4OGLA 3UY4A 5KYYA 3L01A 1N9KA 2JGNA 2GUWA 2QMHA 2FKNA 2R8BA 3CNEA 4NV0A 1EH5A 3WQRA 2Q4RA 4WKNA 3PD0A 2JZNA 3ZDCA 3LVFO 2FZCA 4Z9FA 1YMQA 3DLAA 4HDOB 2W2NA 1YRAA 2BHNA 3GAZA 1IRXA 2GBCA 1T25A 4IGEA 4HD8A 3SIWA 1EPUA 5BUSA 2KB0A 2WTBA 3UXHA 1SOMA 2FK7A 2OSVA 2W00A 3D2AA 5BV7A 4NBKA 1JDPA 1VOTA 3P27A 4R1QA 1E2DA 2IIPA 4QUAA 1IG0A 4R0NA 4ROSA 5EZYB 3U9TA 4CUKA 4PY2A 4IX9A 8ATCA 2GM4A 4MH0R 4W63A 1Y1SA 4DCSA 1TAGA 1WNTA 2Y1XA 1QVVA 1SAYA 3S2ZA 5JFTA 3L2OB 1R9NA 1PNQA 1ULBA 2KJQA 3FB4A 1QQAA 1YQEA 2YJNA 5EGNA 1XA3A 3FVQA 1XZ8A 2DWCA 3DTVB 5LMUB 3KHTA 5ILGA 4ZCTA 3B9QA 4DL9A 1NL3A 5ITSA 2DQKA 4QDKA 1KKMA 1UC8A 4JGBA 1PG0A 3T7SA 4CLOB 2ZQYA 4HGOA 2IEDA 3AY0A 2UDPA 1EBBA 1QS0A 1WX1A 1XCMA 1XMVA 1VB5A 1SBQA 3PPWA 4I9NA 5AM1A 1M7HA 3EIHA 2RHCA 5BSGA 2XYGA 4KTVE 4C20A 3K3PA 3ZK9A 4YV2A 4D46A 4ZDJA 1GSAA 5DW3A 1SXQA 1TJNA 3OT1B 2J87A 1RPZA 3AZQA 2XUAA 3EH2A 1RABA 1F7VA 1V9CA 3IDFA 4PPYA 4J49A 1YL7A 3CV3A 4TMXA 4NQZA 2F55A 3TLMA 2WFZA 2A84A 2RAVA 4RIIA 4R4JA 1VG1A 1BA3A 1CUFA 2EJCA 1N5RA 2W0MA 2D3WA 2W22A 2VWGA 4PV7A 2NUBA 3ID6C 4UDYX 3VDRA 4BO0A 2J1LA 2PA3A 2H9YA 3NYQA 3VAZA 4O4HF 4LF9B 1A5TA 1LJ8A 2EG9A 4FGWA 4P7GA 1N8SA 5L3VA 5DJ5A 5K2MA 2F1OA 5CVDA 4DW8A 1SKBA 4EHKA 3V42A 2GK6A 1W4ZA 2EJTA 2F3QA 4MUEA 1EQAA 5IZCA 1UWKA 2VPYA 4QPPA 3I9FA 3GPCA 5FYQA 4DLTA 1D5WA 1CQPA 3I6QA 2B37A 2CHQA 1M9NA 3AF0A 1SVUA 2XJ9A 4UKDA 5JFOA 1L5GB 1WCIA 2ZUWA 4BVBA 3UBTA 2I71A 1AGRA 1AT1A 4JYCA 3IL2A 3KHUA 3OC6A 1IB0A 1T4CB 1ID1A 2M9MA 1N6RA 1A95A 1Y6RA 3AR5A 3CTPA 1HFKA 4LCEA 5GJCA 2HMUA 3G9ZA 1YRWA 2PFKA 2WMNB 2MYUA 2JFUA 3PGJA 4CMEA 2WJHA 2FEAA 3B2EA 4PX9A 1V4NA 4XIYA 3EMVA 3TAXA 4KAJA 5ADUS 1ADFA 2C0QA 5AMXA 2ZDHA 3CZQA 5E38A 1NLMA 4C0QC 5JADA 1A9XB 4MS1B 3DA8A 3T5BA 1NP6A 3VKVA 2O8CB 1G4HA 2QYOA 4OUDB 3WJAA 5LZ9A 4QHTA 2QW0X 3U44B 1R10A 4M9RA 3CXUA 1UOPA 2VHXA 4II3A 3BJEA 3PIDA 2AG5A 2I3GA 3I53A 3TDKA 4KO4S 1IXKA 1G21B 1PS0A 3LX6A 4JJKA 1UBJS 1CY7A 1EHCA 2CNKA 2DSNA 1E0DA 1OR8A 2OD9A 3FN4A 4I2VA 4RA9A 5KSZA 3CIFA 3MTAA 3G2MA 3NHAA 3VM6A 4AJOA 2R6R1 4PNHA 1YU6A 5EI5A 4X1OA 1W85A 3BJMA 3ENQA 3AJ9A 3T3IA 2C4VA 4ESEA 2V5UA 5C1BA 3PL5A 5L4NA 2VUHB 4YRKA 4LRXA 2R3SA 4UNRA 4Z8XA 4F6RB 3BWBA 5K0BA 1O6GA 1PDOA 1VECA 2JJ1D 2ZRPA 4I4CA 1T4DA 3DOHA 2FSVC 3U7GA 1CUHA 2GBLA 1DC6A 3H5RA 1UBCA 1IK4A 3BMOB 3AJAA 4NOKA 4OEHA 4WJZA 4BNDB 1KVSA 3A6PC 1ENYA 3TB6A 3HADA 3HO8A 4F8YA 1VBFA 3BB3A 4MPPA 3VHLB 3VYUB 4BTLA 1CF9A 3GZ4A 2GPSA 4BP8A 4E1AA 5L8VA 3QLJA 4KBFA 3FHLA 4AG6A 4M3NA 1GZSA 3DEFA 4RQAA 1HXHA 1MOPA 3FUCA 4CMJA 4F3CA 3EPJA 2PD6A 5BNTA 4AJ2A 1LWNA 4NABA 5DM2A 3AKZA 2P62A 2V96A 1GFZA 1OX5A 5DCUA 1B1CA 4GEKA 4IEIA 3QU4A 2PS9A 4PTZA 5FBRB 4YCLA 1GNVA 3SZGA 1MIOA 4MLDA 2NTEA 3WWCA 1XZKA 4KVZA 4HC4A 1I8TA 1M0EA 1BQ4A 5HKAA 1KQPA 2QVYX 2R44A 1N4AA 5KOHB 3A04A 1K8QA 5DRTA 1GCAA 3DYIA 3P9IA 1VL1A 1M0WA 4MVJD 4YFYA 1FS4A 1ABBA 2JVKA 3W7BA 1E3DA 1EUQA 1G7TA 1WCYA 4Q1BA 4XB1A 5DYYA 2IYTA 2RFLA 4JENA 1UDCA 2GM9A 4RF4A 5JQGF 3KKLA 1H6AA 2YJ6A 4X7MA 4XM2A 4ETNA 3CY6A 3T6KA 1IY1A 1Z35A 2RHBA 4GZMA 3ZWWA 1F9EA 4BP1A 1NVBA 4WACA 2ZRJA 1N2SA 1L5FA 4BQNA 5CITA 4NBTA 5H8WA 3CYFA 3O95A 5IAKA 1GYQA 1NW8A 1O95D 4Q4JB 5DLYA 3WRWA 4ZYTA 4UNQA 2YMLA 1M2FA 3ST7A 1XOIA 1O95C 1W1WA 4J3FA 4KE8A 1MT3A 1WLSA 1YA8A 1T91A 5CR9A 5GGYA 4AZ0A 2C29D 1Y9ZA 4I14A 5LFAA 2JPDA 3TGLA 1NASA 3C24A 3OT4A 5BVGA 1XTQA 3U37A 4Q1EA 2J6HA 3NYWA 1OXKB 2FNAA 4BLTA 3GFRA 3DNMA 3HRHA 1N3YA 4L75A 2PUDA 4OXXA 1QHXA 2AN1A 5IYZF 3DE6X 1HTTA 2BL4A 3ELBA 3A7DA 2CFCA 3MMZA 3U40A 5KOJA 1IY8A 1PFUA 2D1RA 3B6JA 1R8YA 5JCXA 2PO5A 4CMAA 2D2VA 1I1OA 1V6CA 3D1VA 2GDZA 4OA8A 5SZIA 2GTPA 3SJ7A 1TE2A 3QHPA 3UAGA 1IUPA 1GGFA 3PB3A 4PYNA 4WLVA 3OZCA 1ZLYA 2RHJA 4KOAA 4DCOA 1RWVA 1O4VA 4CDMA 1Y4SA 4CFSA 1NI4B 1IC6A 1ZD2P 5T4HA 3NTOA 1XCJA 2QRHA 3OM0A 3UW1A 1N5KA 3GMSA 2WTAA 4IUYA 4KMMA 3DFUA 3A4YA 2X1LA 4XE5A 2WWWA 1GRRA 3L4SO 4JEIA 4WXRA 2QLJA 2BP7B 1E77A 3FA2A 3CR8A 4J91A 1L5WA 3T3NA 1SB8A 2CJFA 2R65A 3I37X 1E9DA 2CMHA 4D5GA 1WVGA 4P2BA 4XD2A 1VE1A 1Q6YA 4OHWA 2GD0A 3FH0A 1WSWA 3R7FA 2XUDA 1H1TA 1ZMRA 4E70A 1ODIA 3IVCA 4M1YA 1VIAA 4YBRA 2GCEA 1CY2A 3AQ4A 3GFPA 1R16A 1H5NA 3D3WA 4UNPA 3FLBA 1G8GA 1TQ2A 1IN5A 5ALSA 4LZOA 5JANA 3VPSA 3V1MA 5L7WA 4OHBA 3CLTD 4EOGA 1U11A 3GJQA 3THSA 2BEUA 5GQSA 1WMBA 1V7QA 4UD6A 3CB4A 3IPXA 4XGIA 4LHXA 1MEJA 2QV0A 3KLBA 4I9FA 4JT4A 3UM9A 3A6KA 3PHCA 1CB0A 3OO0A 2QZPA 4D7AA 2OBMA 3THRA 1C14A 2ZBQA 3ZHCA 1X7HA 4RIEA 4EFLA 2X