2YC2C

Intraflagellar transport complex 25-27 from chlamydomonas
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
197
structure length
149
Chain Sequence
KPIDITATLRCKVAVVVAPVTIPDTTVSVELFLLDTAGSDLYKEQISQYWNGVYYAILVFDVSSMESFESCKAWFELLKSARPDRERPLRAVLVANKTQVRLDMAQDWATTNTLDFFDVSADAPFLSIATTFYRNYEDKVAAFQDACRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTRAFLAGELLAR TRANSPORT PROTEIN 25
publication title Crystal Structure of the Intraflagellar Transport Complex 25/27.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Transport protein
total genus 46
structure length 149
sequence length 197
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2yc2C00
3RS4A 5B2ZA 5JSZB 2QNRA 2HT6A 4C0JA 5GJWC 4ZDKA 3EWSA 4M21A 4BWYA 1IN5A 5SZKB 2QSYA 3QY0A 4IW3B 1FP6A 1OFUX 1BMFA 1KIMA 3ZZUA 1FX0A 5KHOC 1X3SA 2G77B 2R6CA 2ZYWX 3QF4A 3TSOA 1HURA 2ZRKA 1VG9B 4DLVA 2GK6A 3MWKA 1AQUA 2EFDB 2REBA 2J1LA 4AKIA 1FUUA 3ZVMA 1S9HA 2ZRDA 4YDHB 4QBIA 5EE0A 5DIFA 4WAUA 2P65A 1KI9A 1W2HA 4TLDA 4JLAA 4PSAA 4DDTA 3VR3A 4ACBA 2EFGA 3CNOA 3UKDA 2G9NA 4LWZA 1GNPA 4LHXA 3V9PA 3THXA 2R9VA 1H8EA 2G0TA 5FOVA 1Z0KA 2FE4A 3VKWA 2WJVA 3ADDA 2ZJBA 2FOLA 1U98A 1E2IA 1JEEA 2BBSA 2BWJA 2QG6A 2V55B 3IQWA 4PXAA 5K8UA 1TF7A 2QA5A 5CYPA 4MKFA 4RZ2A 2QSZA 1KI7A 1GL9B 4Q7KA 1G3QA 4ITRC 4IEEA 3B5JA 4WOPA 2ZETA 5K8LA 1PUJA 4TL7A 5G3YA 5J40A 3EZ9A 1KK3A 1L4YA 1BKDR 3RS3A 4XSGA 3PFIA 5FUYA 1UF9A 5AJVB 1ZM4A 3FMOB 1AZSC 1QHGA 3DPUA 1C9KA 2AFHE 3EAQA 3EARA 2J0UA 3KL4A 4ESVA 3RRYA 3AM1A 1NSTA 3DKPA 1OIXA 5H70A 2B7CA 4C7OA 1OIWA 3A1UA 4LYAA 1F6BA 2JLVA 2GK7A 1Q1QA 1KO7A 1IM2A 2WMNB 5BN3A 4HAUA 2BKUA 3P4XA 3AVVA 1NKTA 2RHDA 3CF0A 4M1KA 4BFVA 2ZR9A 1H8HD 1M7GA 3SBDA 4DLYA 2WKRA 3GJ5A 4KXFB 1UJ2A 3GJ6A 4MKHA 4URWR 2P6UA 5LD2B 2X2EA 4ON9A 1G3UA 3GLHE 2VHUA 4F91B 3EA0A 2RHMA 1VYTA 1L8QA 5CB6A 2P3SA 4Q7MB 4DCSA 4QGGA 4MQBA 4DCVA 3P20A 3Q5DA 2BM0A 1KDRA 3EXAA 4DKXA 3FB4A 3TKLA 4TSFA 3IO5A 2CLSA 4QL3A 3VQTA 1N6IA 1GZSA 3RAPR 2J0UB 2R6DA 2O8EA 4C0SA 1KY3A 4C7OB 2FA9A 4OHWA 2YKGA 3KKMA 1OKKA 1TQ6A 4JKIA 4Q1CA 2QT1A 2H17A 4RZXA 4KHZA 4PHFA 5CIWA 5AJZA 2G6BA 5FOSA 3TRFA 1E4VA 1OFIA 4EQ6A 4GP7A 3JZAA 1NG1A 2CLCX 2E9SA 3GJ4A 2VP2A 3M0EA 1NBMD 3AVOA 3OEHD 3VTKA 1ZU4A 4A6XA 2RGGA 2HDNB 2FJUA 1XJ0A 1X1RA 1XD2A 1HE8B 4P33A 4MYTA 1TQDA 2G1KA 2QM8A 4JSYA 2EQBA 5KDLA 2GVZC 3WHKA 4EFNA 1IN4A 4LHYA 3TIFA 1WB9A 1Q1EA 4LJ5A 1GTVA 3IUYA 5EE1A 2VBCA 2HCJB 3RC8A 1Q21A 2IYUA 4KV9A 4P0TA 4Q1EA 5FTNA 2JLUA 2ZROA 5D3MA 3Q3JB 5FOUA 1AN0A 4M0LA 1SXJD 3T5DA 2WWGA 2JJ8A 2C5LA 3AF1A 1YKSA 1VG0B 4BUJA 3LDAA 2JATA 3QNUA 1G1MA 3MG9A 4CEHB 4TMVA 3QPWA 1UKEA 1XTRA 3KXKA 4MH0R 4M1MA 3RSLA 4B6EA 1JJ7A 1TEXA 1XD2B 2OFWA 3B1ZA 4C0LA 4EPXA 2ZS7A 4GL2A 5HE8A 4A2WA 2ZI6A 1SKYE 3EA5A 2QL6A 4OQXA 4Z8XA 2WSSD 2F3RA 3TVTA 4PFSA 1EFCA 3CRQA 1COWD 4H1VA 3WP0A 4E07A 4Q01A 4P4TA 1U8ZA 2CNWD 4MDEA 2DB3A 5JWOA 2OM2A 1FMJA 3OHMA 2WWIA 3R9XA 5TXGA 3U3MA 2KB0A 3BD9A 1G7CA 4BFSA 3MGCA 1P2TA 3MJRA 1SVMA 3CRMA 3PUXA 2UVQA 4PC2A 2OCYC 1W5TA 1E9CA 3BXZA 2IXGA 4HLCA 4C2UA 1YR8A 2NQ2C 3I5YA 3N2IA 4DCNA 1EWRA 2YVUA 1OV4A 5JJLA 2ZRMA 1IY2A 2GTPA 1XTIA 2ZXUA 3ICEA 4UKDA 3T1OA 1Z06A 3TJZA 4D25A 1K6MA 1M8PA 4MRSA 1JEDA 3V4FA 5DI9A 5G53C 4L5BA 1ZJ6A 3QG5A 2C78A 3NKVA 3TVDA 4PC6A 4Q5IA 3QXSA 2BC9A 1FP7A 4D4MA 2ZR7A 3QKSB 4LI0A 1D2MA 4AG5A 4LSGA 4FMCB 1YZNA 5BN5A 1T8UA 4I1VA 1UPTA 3EASA 3SYKA 3VFDA 3O8CA 3GFOA 2BMDA 5EZ5A 4PO1A 1Z5ZA 3P27A 4PPFA 4HAWA 4YQFA 4LBVA 4EJSA 3G82C 3VNVA 2BIFA 3KFXA 4IDPA 5KSPA 4URXR 3V4RA 2QP4A 1NMYA 3BB4A 2GJ9A 1NMZA 3ZD7A 1OIVA 2CE2X 4NHOA 2VLIA 3MCAA 1Z2CA 4D81A 1NL3A 3NHBA 3N5CA 1MKYA 2C2HA 4Y0AA 1XTQA 2GCOB 3KKOA 4DJTA 5JHGB 2V6IA 1ANKA 2BEKA 3SHWA 1M6NA 1E79D 4JBXA 4A0GA 4O0MA 2VTKA 3FKQA 3HYRA 2C77A 2OZEA 1QHYA 1OXSC 3GJ3A 1H8HA 1N6PA 3QVVA 2QTVB 1QRAA 1OH5A 3B7GA 3PIRA 4EJSB 5M04A 1P9RA 5J47A 5HKKA 2GZHA 2YWEA 1E99A 5E4FA 2MMGA 2YC4C 2O8CA 1E9RA 3C14C 2IA5A 3K0CA 2YWFA 4KFSA 3GLGE 1M74A 1R0WA 1VCMA 5JEDA 1YE8A 4M1YA 2QM7A 4EPVA 5IK2A 4AYWA 2GILA 2ZUBA 2W00A 2OUKA 3ZQ6A 1DOAA 2DCUA 5FBQB 4L16A 3U6KA 4IOLA 5D3QA 1NG9A 4S35A 1RJ9A 2XTMA 2K5UA 2YWGA 4QNMA 4MYCA 1E2NA 4A2QA 1NBMA 3OEHA 3LLUA 4HDOB 4QM6A 4US0R 3LBHA 5TV2A 5SZHB 1N5LA 1P9WA 4QGAA 4DCUA 2O8CB 1KJYA 2ZYUX 1YRBA 3AQ4A 4LC0A 5LD2C 2Q6TA 3ZZ0A 1QHSA 5TVKA 1A7JA 1MOZA 1TADA 3C7KA 2AX4A 2G88A 1Q20A 3AVPA 5EUQB 4CW7A 4R2HA 1J70A 2HJGA 2W0MA 1J8MF 3THWA 1SVWA 1T0JB 5CYOA 2QMEA 4O2RA 5FPHA 5JMTA 3FMIA 3KQLA 1SULA 1SXJA 2VHJA 3VAAA 2ODWA 2VHCA 3KFVA 4TZ6A 1RJ9B 2CE7A 3VMFA 4Z51A 1Z0IA 3KXLA 5SZJA 2ZANA 2FF7A 4CRWB 1GRRA 1U9IC 1W36C 3VHLB 5BWMA 4JSTA 4F4JA 3LBIA 2DR3A 4XTCS 1NKSA 3O8DA 3NG1A 2WSSA 3HU3A 4II7A 5KNBA 3AEZA 1O3YA 4LJ6A 1COWA 3BFXA 3BRWD 4TQ9A 1HH4A 1T91A 2QAGA 4GDFA 3THWB 1DTSA 4P4SA 1W0KD 3A37A 1G8GA 3T5GA 4DBLC 4N3NA 2BBWA 1JPJA 3QIAA 1JXOA 2OLJA 4TL6A 1SXJB 1TEVA 1FUKA 3MWJA 4OJKA 1NMXA 4NTZA 1QVRA 4EPWA 1U99A 4OI1A 4C0BA 3ZVNA 2FG5A 1HYQA 5EQTA 4IDHA 1TQ2A 2XZPA 4U02A 4ZCMA 5DE3A 2F43B 4TL8A 4N1AA 2DHRA 5E7IA 3ZQJA 4EUNA 2GETA 1P7CA 4BLOA 2WAXA 5JBQA 2OHFA 3C16C 2ZI7A 4GMDA 1OXUA 4JLBA 3A4LA 1G8FA 4X8HA 3ZYCA 1XEXA 3K0FA 1TF2A 2CVHA 3VR4A 1QHIA 5JEEA 3UMFA 1FOEB 2J59A 1G20E 2XJ4A 4F93B 2QAGB 3K53A 5LBIA 4PC3A 1BH2A 2ZRFA 2ODEA 4MITA 1S96A 4C30A 3WRYC 2RGBA 1UEIA 2REXB 3KQNA 3RWOA 4CEJA 1BYIA 4IOJA 2ASEA 1SGWA 4LJYA 4BQSA 4M1SA 4DLTA 2IYRA 3IHWA 1G21E 3F3YA 3UK6A 3PVSA 4XD7D 3HPQA 2WKQA 1E2QA 3GJ8A 2WWWA 3M1IA 4B3XA 1AS0A 1MABA 2J41A 4M1OA 4E03A 3K0FB 2AK2A 4TWZA 2W2XA 3L0IB 3IDQA 2FNAA 3MSXA 2C99A 2VSOA 3SQWA 4KLNA 2ERXA 4MGZR 5JJIA 5F9HA 2P2LA 3SHFA 2PX0A 2QGZA 1HE1C 1YRAA 5KYKA 2IHYA 3THYA 3OIYA 4ZDJA 1J7KA 1G7SA 2VH5R 1GKYA 1DPFA 2ONJA 1KY2A 1VYVA 2Z5FA 3IPYA 4DXAA 2WWYA 1GUAA 1ZM2A 4RD4A 1ZM3A 2BHRA 1Z6GA 4Q9HA 3NDPA 3AGPA 3THOA 4FINA 3WYFA 1CR2A 4HYYA 4MDFA 1FFHA 1MABB 1XZQA 1S3SA 3KTAB 1ZM9A 2JJ1D 2R2AA 2WWHA 4P32A 4TZ0A 1NP6A 2CL6X 3LW7A 1IXZA 3I4LA 3FOZA 3GLHB 4EPTA 3Q9LA 1SHKA 1KI1A 1WCV1 4NP6A 1NVVR 1UM8A 2A9KA 2C9OA 1D9ZA 4BGDA 2PCJA 4QJ3A 2CHGA 1VECA 4JLNA 1FW6A 4XSHA 2PZGA 3THYB 5GJBA 1XP8A 1Q3TA 5IF9A 4TQAA 2IYVA 5KPJA 3EPLA 1N5IA 2BBOA 3W5IA 3R8CA 3FHTA 5DLQC 3VKGA 1A82A 2CCKA 2NPFA 2R6GA 2ZAMA 2EWWA 4EJSC 1XB2A 1R6BX 3A1TA 5J4KA 4WXPA 2JLRA 2LWIA 4C9BA 3AVTA 4GPTA 4Q1DA 2HUPA 3CRVA 5E7JA 3WNDA 2DWOA 3K0EA 3EIHA 4RCYA 3ZJYA 4JS0A 1P62B 1CS4C 3U3RA 3QXCA 1IOZA 4B2PA 3E5HA 1DE0A 2NPIA 2XNDA 2JJ2D 3MFYA 3QEJA 3TQFA 3WMFA 1T5IA 2F1HA 1R10A 4M1TA 5EXTA 1GNRA 2WIBA 2ZSDA 2JAQA 4HZIA 2PZFA 2YOGA 2OEPA 4M9XA 4Q19A 5FBRB 4Q4AB 4RFVA 4RZ3A 1Z0JA 5CK4A 3AP2A 5EP2A 3GPLA 3AVYA 3MRSA 4Q1BA 3K0CC 2FEOA 2GF9A 4BEJA 3TUZC 4WZAE 2V8OA 3ZGXA 3ZH9B 2ZI3A 4WBSA 4F7WA 5EUMA 3X1XA 1I4TD 4NZYA 1A4RA 1SKYB 1NRJB 3E70C 3GEHA 3CW2A 1IXRC 3OIVA 2J7PD 2UKDA 1P72A 1SVSA 2V1XA 1TL7C 4M53A 4N0DA 2PT7A 4AURA 5P21A 1I4LD 1R0XA 4R71A 2N46A 2BVNA 1XTKA 2PL3A 2GEUA 4ZPXA 2FPKA 3EC2A 1RFLA 1Z83A 2J0VA 4HLUA 1XU4A 5ANRB 2J46A 3B6EA 3PV0A 3SC3A 4US1R 2ZU0C 3KQKA 1TMKA 4B3CA 1Z47A 3C5CA 1VMAA 1KK0A 3REGA 2RGNC 1LY1A 3QE0A 1FPMA 1Z0AA 5AJWA 2RGEA 4Q18A 5JECA 1R5BA 4BASA 3CUEF 2H8KA 3W6OA 4JLPA 1CTQA 4BZPA 1SXJC 1ZBDA 2CJWA 2A30A 4W5WA 4XD7A 4JBYA 3AUXA 2C04A 2ZR0A 1N6HA 2WAYA 5TY0A 1W49A 2ZVQX 4F38A 2BCGY 1HQCA 1JAHA 2QENA 4OQLA 1M34E 4PC7A 4PQFA 2PH1A 4WW0A 1E2DA 4CT5A 1ZRHA 2A5FA 4NYIQ 4QBGB 3TMKA 4A8JA 1K5DA 2QPAA 2O5VA 2GJKA 2MMCA 5JFGA 1J2JA 521PA 1KDTA 3SJCA 4DLUA 5EJEA 5B57C 1VHLA 3KUDA 5F3WB 2GCPA 3SE0A 4GT1A 4KSCA 2W0SA 4Q9LA 3DMDA 5AUNB 3GLGA 2ZE8A 2ZUCA 4DEYA 3NH9A 2JLZA 2FFHA 2RH5A 5DNYB 5AUQA 3GD7A 1KZGB 1UBCA 4UXIA 5LB4A 3ZVLA 8OHMA 4KFTA 1WE2A 4OI0A 2WJHA 2XSZD 1CF4A 2OBMA 1IQPA 2JJ1A 4KBFA 2FSFA 3AKYA 4FI3C 2IS1A 2IWRA 4R7ZA 3AVQA 3RANA 4IDNA 1N0VC 3FDIA 4A8JB 1VIYA 5B58C 2KJQA 2ODBA 2P6RA 1EESA 4AKGA 1N25A 1T9HA 1ZCBA 3OE7D 5DISB 5L3QA 2XITA 1XZPA 5EE5B 1E2FA 1NIPA 4GOJA 4I4LA 2WKPA 2ANCA 3A1WA 4OK5A 4BZXA 1B23P 3LLMA 3KUCA 2ZRCA 3VR1A 2J0SA 1S9DA 4WXRA 1LV7A 3EZ6A 4Q4JA 1ZD1A 5LB2A 2ZU6A 4X8MA 4QG7A 1L7VC 3W8RA 2FV8A 3RS5A 4TMXA 1DO0A 1G18A 1W44A 3W8NA 1T6NA 2J7KA 2HLDD 2PLRA 2ZJ5A 4FD2A 4GP6A 4HSEA 4QBFA 3SJAA 4QHTA 2EU8A 4BLPA 1NSFA 1EXMA 2I3BA 5JLJA 2IEYA 1XEWX 3KB1A 4A0RA 5DYGA 2C95A 1GL6A 1GOTA 1ZNZA 3B78A 1ZCAA 3GJXC 4TMWA 2O8FB 4Q4HB 3T1QA 4EKDA 2ZAOA 2OE2A 5L3QB 2LKCA 5C4MA 5H8WA 1AA9A 3NHAA 1JXMA 3WYGA 5B30A 2ZRJA 2QEQA 4B48A 5BW8A 4P4UA 4DDVA 2FGKA 3CZQA 3U4QA 4Q4JB 2JJ2A 2X2FA 2GNOA 3DMNA 4HUTA 4AKHA 2WPDD 1ONBA 5KSOA 2XJ9A 4Q9IA 1RYFA 1DAHA 4KLZA 1XDBA 3RS2A 4DIDA 3U61B 1NF3A 3QKRB 5CLLA 1N2CE 3K70D 2YOHA 1US8A 2BCJQ 2EFEB 1N6NA 3A4MA 1AS2A 3TH5A 2HV8A 2XNSA 2QI9C 4URZR 1ZC4A 3GJ7A 1S4QA 1NN5A 5FBLB 5L8VA 1CR0A 3QPVA 1XXHE 4HEJA 3RABA 4D0GA 5EXPA 4WVFA 2J7PA 5G3ZA 2OESA 3BB3A 3MUFA 4I1SA 2HXYA 1TX4B 4BFXA 1S2MA 2ZM5A 4RD2A 4RSGA 4DDUA 3F8TA 3MWLA 4FMBB 1EK0A 1KK2A 3IHLA 1GWNA 4A9AA 1Z2AA 1FX0B 3ECCA 3U60B 3AVWA 4JYBA 1JR6A 1G9XA 3QF4B 4PO8A 4XTRA 2F1IA 4DUGA 3IEVA 2Q3MA 3B60A 4TYQA 4WA7A 5GVRA 2ZJOA 1KOFA 4OI4A 2VYFA 1PJRA 4LY6A 4RKFA 2GXQA 2JLSA 5GADl 3PG5A 3I62A 1US8B 2NZJA 3NC1C 4GMXA 2V1UA 4QHSA 3I5XA 4CT4B 3LO5A 3FE2A 2HJVA 1P3JA 4MKIA 1W7AA 5CB8A 2FSIA 1UAAA 3H84A 3UPUA 1ZAKA 2ANBA 3ADCA 4QJ4A 4IOMA 3SU8A 3THXB 4LHVA 3NEJA 4KCGA 2OSBA 1IY0A 2FU5C 4H9GA 2GXUA 2D4HA 3LXRA 1HY3A 3IILA 1C1YA 2P6NA 1QG4A 1E98A 2BV3A 3U5ZB 2WOJA 4Q1AA 3FFBA 2O0HA 3I8SA 3KB2A 1O87A 3NBZC 2D7DA 1P2UA 4S2EA 5HKKD 1MO3A 4XVQA 3DOEA 1JPNA 5BQ5A 2D2EA 2ZRPA 3AKCA 1E0AA 2OAQ1 5AWFC 1M2OB 3T06B 4LX0A 2PJRA 3ZDQA 3K9GA 5IK2D 4ZIRA 4PZYA 1E0JA 2XSZA 2A78A 1I4DD 2ODNA 1R5OA 2J5XA 1U94A 1BIFA 1W2GA 1UDWA 2XOKA 2DFTA 2WWXA 1JB1A 3K09A 2VP0A 2WICA 1G3MA 1ZMXA 2W6JA 2W2TA 2GA8A 3CIOA 2ORVA 4TTQA 4YMWA 2ZRIA 5FOXA 3X1ZA 3OE7A 5HE9A 2AKAB 1JQJC 2QMOA 4LHWA 5AUPB 4DDWA 2PEZA 1ESMA 1XX6A 4LHZA 3AB3A 5JHHB 4NYJR 1DAMA 2RKOA 3D7MA 5JWHA 3REFA 2R44A 4BLSA 5A0FA 4Z1MD 2O8EB 1JR3E 4POAA 4Q03A 1KZ7B 4OQMA 1D2EA 1M7HA 1NVUQ 1G5PA 2XTZA 3GJ0A 4M9SA 2HLDA 4W5JA 2KBFA 1UEJA 4ZI2A 4OL0A 4AYXA 4Q7LA 4BLTA 4EQ6B 5FBWB 3BIFA 3CF6R 1KMHA 4LBYA 4B2LA 4DEXA 4PQYA 1CU1A 1GRQA 2ZYVX 5JCZA 4Q00A 4QBHA 2WJIA 4AIIA 1G64A 1X8JA 4G5RA 2Q3FA 2GWHA 4V0OA 2GBLC 3VNUA 3CM0A 1E69A 1A2BA 5BXQC 2IS6A 3LD9A 4A8JC 1NVXQ 1GKIA 4TMZA 3T1VA 2ATVA 2WWFA 4FW9A 2V3CC 1DADA 2DFLA 3RVBA 4FXPA 3WNCA 3TQCA 2ZVPX 2WPDA 2Z4RA 1JI0A 1LW7A 4FIDA 3D31A 4JIMA 3R9IA 4IVPA 3LBNA 3TW4A 2HYIC 3J81k 5AJXA 2P5TB 3LXXA 5D3MB 2XGJA 1EFRD 2CL7X 2QPTA 3PITA 4JJZA 4YONB 5JI2E 2IYXA 1IONA 2NO6A 4MRNA 3SN6A 2W6IA 5CITA 2O8BA 5KNDA 3DVLA 1FNMA 2V4ZA 1GDDA 3QUSA 2MSEB 4NYMQ 1VHTA 2QGNA 2NOAA 3Q5EA 1GM5A 1ZUHA 1OXXK 4G5SA 4X8LA 4XJXA 4JKYA 1KJZA 2R6AA 2IK8A 5AR1A 3KZ1E 2Q9BA 2Z43A 3B2EA 3MLEA 4EPYA 1IY1A 4LGMA 2IYSA 1E0KA 2OV2A 3AGQA 2B92A 3QOFA 2FH5B 1Z22A 4JMPA 2WZQA 3CO5A 3RC3A 1DS6A 1MO6A 1OF1A 4D4JA 3ZD6A 3K70B 3SYLA 5ELXA 1VCNA 3KKQA 4ACAA 5JWRA 2Z83A 3BC1A 2D62A 3MWYW 4L4UA 3R20A 2E87A 3NEYA 5IRCD 2QN6A 3GLIE 3NBFA 1GNQA 1XPOA 1E1RD 4C0HA 1W1WA 4TYYA 2XB2A 1S0UA 2QRNA 3B8HA 1M1YE 1NNEA 2OLKA 5DSZA 1Z3IX 5JS8A 3KJHA 1HV8A 1F2UA 2IT1A 3BJIC 1KAOA 4K8OA 1PVOA 4PTLA 1DEKA 4BE7B 3QBVA 2KI5A 3E1SA 4B3GA 2D2FA 1YZLA 1ZINA 3B9QA 3BS4A 3GEEA 3LY5A 2JLXA 4F4IA 3LWNA 4I99A 2DFKB 1EFTA 3DZDA 4TT3D 1XCGB 3S1AA 2YC2C 4BLRA 3WBJA 2Z4SA 3ICQB 2IEZA 4PSVA 3RNLA 2VP6A 1RPZA 1V43A 1OT3A 2RAPA 2ZPTX 1MH1A 4OK3A 1AZTA 1QBKC 3KKNA 2YYZA 1SXJE 3W3AA 2DPXA 1QVAA 4JLDA 4EAQA 3X1YA 1T3SA 3BWDD 2ERYA 3FKSA 4FN5A 1NJFA 4W7SA 2ZYTX 5FOTA 3UWOA 1F2UB 2OXCA 5F2EA 4HZUA 1G8PA 4LJAA 3B1VA 2FZLA 1Y3AA 2B6HA 3I1FA 1RRGA 2FFBA 3Q85A 4DLZA 2C98A 4KYIB 4RZUA 2NIPA 1IXSB 1E96A 1XCPA 2IHBA 2MSCB 4OI2A 3WNBA 2YHSA 4QJ5A 2XZOA 4QM7A 1G3RA 1XFAA 4ZV4A 2EYQA 1Y63A 1JR3D 4ZDWA 1DAFA 3L43A 3QQ5A 4QHYA 5C4GB 3SNHA 1IHUA 3MMPA 3QEOA 5IT5A 1CEEA 1RRPA 1KHTA 5HCNA 1K5GA 1U8AA 1WQ1R 2WJYA 1II0A 1OE0A 3CRRA 4BECA 5JJKA 2H16A 4XH9B 3BK7A 2KWIA 4Z1MA 4BFYA 1OPXA 5C18A 1W36B 2VSFA 4HZUB 1F5NA 4PR0A 1GVNB 4JJKA 4B3DA 2GVDC 5JCPA 3G5UA 2NO0A 1QZXA 3LH5A 4HLDA 3AF0A 5CLQA 3I61A 3WMEA 3W6PA 1F2TA 2AHOA 3P1JA 4KO8A 3WP1B 3TW8B 1E2GA 1LS6A 1XD8A 3TGPA 3VR6A 2OBLA 2XNDD 5GJVC 1CKEA 3GEIA 5FFMA 3HR8A 2PCLA 2ZQ5A 4LV5B 3FHOA 1Q3HA 3FTQA 4LPSA 3SFVA 1NLFA 5TARA 4HB0A 4CEIA 2VRWA 1MV5A 2JDID 2IS2A 5J4VA 4JL8A 5EZ6B 4AYTA 2ZSBA 5JRZA 1WF3A 4URUR 2X77A 4PHGA 4NCHA 4HB3A 1JJVA 1EFRA 2W83A 4V0NA 1W48A 1XXHA 2ZSEA 1ZVQA 4LUCA 2IUUA 2NO1A 4YMVA 4AY2A 1F2TB 4QNRA 1XPUA 1TUIA 4Q7JB 3AV0B 2X8AA 2QZ4A 4G5OA 3SYNA 4IEIA 4JT2A 4C3ZA 3K09C 4A4DA 3HP1A 2GRJA 2IC5A 3GFTA 2OCBA 3IIJA 4CEIB 3QVUA 4IXNA 1W4BA 1GL7A 1HEIA 3H4MA 1CJTC 3GLFE 2DWQA 4ARZA 2YINC 1CJVC 2GJAA 2ZIAA 4HUQA 4P4SB 3T61A 1HA3A 4AD8A 3EPKA 2ECKA 4NH0A 1BOFA 4MUBA 1A5TA 2G0NA 2GJSA 5KSZA 2EFCB 4JVLA 3A6PC 3CONA 2WSMA 3R7WA 3KJGA 2IF0A 1TPZA 4HB4A 5E95A 3PUVA 4XWAA 4KODA 3RRNA 3RYTC 1E1RA 1UDXA 3B85A 4GI7A 4V0LA 5C1BA 4QFMA 1XEXB 2FFAA 1CIPA 2QROA 1AKEA 4KBGA 5FI0B 3UIEA 3L0PA 1L4UA 4BZQA 3K0SA 4LPKA 4Q02A 5J5CA 3W9YA 3UWKA 3IBYA 4HUQB 5L3SA 1E3MA 1E1QD 2IUTA 2HEIA 4KFUA 1P6XA 5DYIA 1ZNWA 3SI7A 1GIAA 1DO2A 4GZMA 3IEUA 1SVOA 4DLRA 2ZRHA 3ONWA 4TT3A 3DEFA 3CX8A 5FL7D 3R7WB 3CR7A 4CEJB 1T3LA 1AGRA 1IN6A 4M1WA 4JL5A 2A5JA 1WP9A 2QP9X 2W58A 1Q0UA 2IYYA 3K70C 5E3HA 2BBTA 1MT0A 4PAOA 1AKYA 4UNRA 4TQUS 3FGNA 1KYIA 4RY2A 2GCNA 2YWHA 1N0UA 5L3SB 2XAUA 3FWYA 1BYUA 3FHCB 1KDPA 2BOVA 4C0KA 1Q22A 5DH9A 3DM9B 2WV9A 3B82A 3F0TA 1S3GA 3DO6A 3L82B 3UMSA 3H2YA 2R62A 5J4YA 4ESHA 2VF7A 3UMRA 3ADKA 1QHNA 1DBSA 1JR3A 2C96A 2FGJA 3LFUA 4AK9A 2ORWA 5H68A 2GDJA 1D2NA 4ZCLA 4IHQA 4FWTA 2NO7A 4KU4A 1EFHA 4DLWA 2IWHA 3BBPA 3TAHA 4EPRA 3K1JA 5SZIA 1R0YA 3KX2A 3JVUA 3CWQA 4HI0E 4K46A 4GNKA 1P61B 3B13B 1CJUC 4BPBA 4C2TA 1FNNA 2GXSA 1L2TA 4GRAA 3AP1A 1I2DA 4U5XA 5GVSA 3QBTA 3T35A 1QHHA 2QMUA 3IKJA 4V0ME 4KITB 3CNNA 4UJ3A 1X8KA 3IBGA 3T34A 4RD1A 1U2RA 2RGCA 4IRUB 4TLAA 3N2EA 1GSIA 2QQEA 4ILEA 1W47A 2CHVA 2H1LA 2PJZA 3EX7C 1G5TA 2FMXA 3KDSE 2IYTA 4R9UC 2F3TA 3U6BA 2D74A 2PZEA 2REOA 1E9DA 3TUIC 3GP8A 2JDIA 3SS8A 1UBGA 2KE5A 2CXXA 2P67A 2IXEA 3Q7PA 121PA 4QGHA 2N42A 1AK2A 4RJLA 2H7VA 3LW8A 2LCFA 1DVRA 1KI6A 3LVQE 5DGXA 3C15C 3FMPB 3U44A 4OJQA 1Z0DA 4MGYR 1VIAA 5KOYA 3U7FB 2ZUDA 4FMDF 3A36A 1UKZA 3FYHA 1N6LA 5KNCA 4B43A 4QGFA 1P73A 2BMJA 1CJKC 1G291 4DUGD 1TNDA 3BORA 1UFQA 1KO1A 2AKYA 1G4AE 1GAJA 3OEED 4LJ4A 2WTUA 4KI0A 1TQ4A 3T15A 4Z54A 5FR2A 3GLIA 2J9RA 4TMTA 1E4YA 2RGAA 4TL9A 3RSOA 2IUSA 3O8BA 3DM5A 5LPNA 1PLKA 4UXHA 3SOPA 1VG1A 4UXJA 3U44B 2IF2A 2VPPA 1N6OA 5KDDA 1SVIA 1Z0FA 1CBUA 2LKDA 3K9LA 1G4UR 2A5GA 2R6FA 3CPEA 4B74A 3HPRA 3NC0C 3QKTA 2YOFA 2PBRA 1NY5A 1SVKA 2NZ8A 2X19A 3MJHA 4BLQA 1DELA 1OXTA 1SQ5A 3VHXA 4LYJA 1FMLA 2ZTSA 3M4YA 3TR0A 1QG2A 2UZIR 3IGFA 1N6KA 3HR7A 1D6JA 1E1QA 1T3HA 2AD1A 3GLIB 3UG6A 2BMFA 4URVR 1KI2A 1UADA 1JQLB 5EE9A 2QAGC 2WJJA 3X1WA 4A0FA 5FL7A 1LF0A 2GAAA 4BEBA 1JNYA 1Z6TA 4B47A 1ZUNB 3BH0A 4EDHA 1TF5A 4JLJA 2HYDA 4IVRA 2CJWB 5KPDA 3MD0A 3I8XA 2Y8EA 5CDFE 3VX4A 4GBMA 1AS3A 3QF7A 1T0HB 1EWQA 1V5WA 4KFRA 4MRRA 1XMSA 4LV6A 3WYAA 1RRCA 3TBKA 1N6RA 4NCKA 1KI3A 2E1RA 2XOKD 3TSZA 3RS7A 1II8A 4I81A 3LAWA 4O2LA 2W6JD 2GZDA 3PUWA 3VU9A 4B3BA 4B2IA 2VA8A 4GZLA 1XPRA 1G7RA 1T4GA 1XEFA 1KJWA 4G3XA 4OK6A 4ZDIA 1KAGA 2PLFA 1W5SA 2ZEJA 4TYNA 1W0JA 4NU0A 4D6PA 3GLGB 2FPLA 1E2JA 3D6TB 1XNJA 1AM4D 4MYUA 1Q12A 2N1BA 3B1WA 5JZVA 1R5NA 3P4YA 1Q44A 2RMKA 3IQXA 3K0AA 1ZYUA 4H1UA 3HJNA 4GOKA 4L15A 4DB2A 4LJ7A 1XTJA 5FUVA 5CK5A 2ZE6A 1TTTA 2GKSA 2VEDA 3FFAA 5AJYA 3VKHA 2QBYA 3BAFA 2ZJ8A 3KJEA 1LFDB 3VU9B 1YZUA 4KVGA 5JSZA 2O0KA 2JIZD 3A1SA 4DVGA 1NY6A 2F1JA 1BS1A 4D0NA 4PO9A 1E2EA 1W4CA 3RLFA 5EP3A 2WHXA 2FX3A 4J0QA 2AN9A 4D80A 3EZ7A 4NBSA 3QXHA 4LK2A 1QF9A 4A1FA 4OHZA 2ZRBA 1ZD8A 2GJ8A 2ZRGA 3W34A 3WY9A 3RWMB 5DN6A 4E5UA 4LBWA 1S1MA 3QXXA 4JZKA 4MUAA 4E22A 4NCIA 4D0LB 2YV5A 1NVVQ 4DSOA 1RC8A 1YR9A 5CJ2A 2HXSA 4P3YA 3ZS9A 4RCZA 4EFMA 1YZQA 2W6ID 5FPTA 1ZIPA 2Q3HA 4XIGS 5FUXA 3LV8A 1WA5A 2QE7A 2P5SA 4B6FA 4PC1A 4PAQA 4A6PA 3GLFA 3EZFA 2L0XA 2VF8A 3L8ZA 4N0EA 3U4QB 1GG2A 2ONKA 2C9YA 4XOIA 5K8TA 1HT1E 1XRJA 1W4AA 1XJQA 3C41J 4TLBA 3PCRB 3B1XA 3CRW1 3SJBA 2GESA 3KJIA 1AIPA 1OFTA 1B0UA 4HLQB 4X8OA 3OEEA 3JVVA 2PMKA 5KUTA 2Q9AA 4PHHA 1Z08A 1ZNXA 4IJMA 5UKDA 1OB5A 4U00A 3L2OB 2BJVA 2J87A 2F55A 2JASA 2FZ4A 2VO1A 4G5QA 4MRVA 1G8HA 3ND9A 4PPNA 3NBYC 2ZRNA 3C5HA 1PLJA 2WBLC 2BEJA 1YHNA 3GLFB 3RRMA 2VHQA 3DKVA 3G0HA 4ZKDA 1DAKA 4GOXA 4O3MA 5L3RA 2VQSA 2CBZA 2AL7A 3OFND 3B1YA 1NN3A 3UATA 1UBEA 1MRSA 4XVRA 4LYHA 1Z6AA 4M2LA 4A82A 3BOSA 1WBDA 4JYCA 3LQRA 3IIMA 2GZAA 1KSJA 1CRQA 3M6AA 4B34A 2BMEA 3ADBA 2ZE5A 4RVCA 1CLUA 1NN0A 2V54A 4DLXA 3TLXA 1JBKA 4L9WA 4B73A 4GSYA 1XJCA 2PMDA 3FKSD 1G19A 4JVSB 5KTYA 1U0HC 3EZ2A 3SEAA 1FQJA 1U9IA 1Q57A 1GP2A 2GHIA 1ZIOA 4TTPA 1JECA 2A7QA 2VL7A 4NPHA 4R2IA 2AK3A 3GMTA 2XX3A 4M22A 2J45A 5FOWA 4DSUA 3SQXA 2CCJA 5KO2A 1E2PA 5L3VA 1OJLA 2I4IA 4HLUC 1OH8A 4QKQA 3OIUA 1WXQA 1YJ5A 4ZI3A 3BFVA 5AK0A 4I1UA 4JLKA 1WDTA 2GEVA 2JLQA 1GRNA 3PEYA 3UANA 2A5YB 2EFHB 1Z07A 5G40A 5FPSA 3TR5A 5TB5A 1U0LA 1RYHA 3K8YA 1OSNA 3X2SA 3RDPA 4DT1A 4NE2A 3CNLA 3RRZA 3WHLA 2NMVA 4DC9A 4ZIRB 2EVWX 1ESNA 1FQKA 4D2IA 5DHFA 1P75A 1X86B 4V0MA 4CEHA 1OB2A 1P60A 4WZBE 6Q21A 2R8RA 1HT2E 1NIJA 2VIIA 2IYLD 1R8SA 4G1UC 3EPHA 4JT4A 2ZI4A 3AUYA 4UJ5A 2ZRAA 4R98A 2AFIE 2NGRA 1E94E 2F7SA 3I73A 1GKUB 2JIZA 3PEWA 4MRPA 3L0OA 4QRHA 5EXSA 4TYPA 3AH8A 2FPMA 3BERA 1LTQA 3EIQA 2NO9A 3AP3A 2BM1A 4FWIB 2H5EA 1XMJA 4DT1B 5DI3A 1E9SA 4PPQA 4Q47A 3SBEA 3CH4B 1CRPA 3CF2A 2VP5A 1N5KA 1F3OA 4MGIR 1KMHB 3LA6A 4EIWA 3AF3A 3EC1A 1H65A 4KAXA 4P31A 1AJEA 2FSHA 3GCGA 1DAGA 2QUZA 5FI1B 1W4RA 1G6OA 3OIWA 4UNPA 3HDTA 5FL3A 5FTLA 1SVLA 1UKYA 3KXIA 2HF9A 4QOSA 3QKSA 2IYZA 2CDNA 4M8NE 4M9QA 3GFPA 2OO7A 2B8TA 2Z6VA 2H18A 5DI3B 2R65A 4A0HA 1OH6A 2NG1A 5HR5A 1OFHA 2ZJZA 1CJMA 2HT1A 3A1VA 2FSGA 3N70A 3HWSA 2IBMA 3PQCA 2P0EA 4M9ZA 3BH7A 4TTRA 2BDTA 4YDSA 1U81A 1YR7A 4KSBA 2O8BB 1TU4A 3C4JA 3O47A 3RS0A 3L0SA 5KSYA 1KO8A 4TMKA 4LYFA 1ZW6A 4JLOA 2GCOA 2KBEA 2OT3B 3NIBA 2D3WA 1NVWQ 3LX5A 1Z29A 1D5CA 4DIEA 2IYWA 3LX8A 221PA 1GITA 3OFNA 4FCWA 3VR2A 4BFUA 3BB1A 5CIQA 1S1CA 1N0WA 4CVNA 1KO5A 3QI2A 4FCVA 1OHHD 1YZKA 1NLZA 3A4NA 3LRPA 1VDZA 4A15A 2I1QA 1LB1B 5GJCA 4C0QC 2D06A 1FTNA 1KNQA 2AXPA 1G8YA 1VG8A 2O0JA 2PT5A 4FCTA 4HB2A 4UNSA 5CDFA 4DWJA 2AD5A 1P2VA 2XEXA 1CR4A 3U2QA 3VX3A 3AKEA 1F48A 1XCMA 5TMPA 1PZNA 1G6HA 4FMDB 3H86A 4BFTA 2CHQA 3E2IA 4URYR 4US2R 4PANA 2XB4A 1II9A 1HQYE 3L8YA 4O25A 5A4JA 4OKSA 3TSWA 2J0QA 4GFDA 3UXMA 4TYWA 1GFIA 4AC9A 1DAIA 4Q48A 1Z63A 3CBQA 1VKJA 2YZ2A 3BGWA 4C0AC 2JLYA 3QSYA 4LV8B 5HTKA 2WOOA 4YXWD 2J3EA 4B35A 3PUZA 4IFBA 1CP2A 1ELOA 3S1AB 3TNFA 2EW1A 4PSKA 1E2MA 1AQYA 4JL6A 1KSGA 3SJZA 1U8YA 1PV4A 1YZGA 3TK1A 3D8BA 1P5ZB 5EE3A 4CF7A 1RZ3A 2JA1A 2ZJYA 2OBNA 4QC2A 4ERNA 3KQHA 3ZIAD 2IXFA 2JCSA 3EIEA 1YU9A 3CX6A 5EP1A 3CR8A 2B7BA 3AVXA 2UZ3A 3P26A 1G3IA 2QT0A 3I72A 2B8WA 3QENA 4ZKEA 1LVGA 5J4LA 5JI3E 1OW3B 5KDOA 5KU1A 2A3RA 2FWRA 5HZKA 1DG1G 4NL4H 4NDZA 5CM9C 3KQUA 1E2HA 3CLVA 1KSFX 4ABYA 4KYUA 1XF9A 1P2SA 2DBYA 2FN4A 4L9SA 1Q1BA 5FBVB 1N5JA 1VCIA 1Z8FA 3C8UA 2IW3A 4DZZA 4PZLA 1XEWY 2BKEA 5BN4A 5C46F 4PZZA 4OHXA 1KNXA 2RGNA 5A5GA 4C4PA 1E9FA 3I3SR 3K9HA 5HPYB 2O52A 1G7TA 1J90A 1UBFA 1NN1A 2ATXA 2ZSAA 2IS4A 5BYKA 3CH5A 2AWOA 4HDCA 2Q21A 4LDJA 2DYKA 3CZPA 2C9CA 3LVRE 3V00A 1OXVA 3PUYA 1XMIA 1K8RA 4B3FX 2A2ZA 3BE4A 2ZI5A 1P4SA 3Q8XB 4HDQB 1PLLA 1X8LA 4D82A 1MRNA 3NXSA 2X1VA 1YR6A 2WIAA 2FFQA 2KSQA 3GQBA 2F43A 4G01B 4G5GA 4HATA 4JVMA 1OYWA 3A8TA 3CX7A 4YLGA 2V7QD 1NJGA 2VP4A 1QHXA 4Z8YA 3QXJA 5LDDC 4DB4A 3PJRA 3T12A 4NYJQ 4HAVA 2YJTD 1A2KC 4QXAA 3O8RA 3FPAA 1GILA 1NI3A 3U3KA 2CNWA 1W46A 2Q9CA 3EWAA 1CULC 2F1RA 4NYIR 2A5DA 3VR5A 1YQTA 4RD0A 3ZLJA 2OG2A 4AWXA 4YC7A 1FL9A 3ZVRA 1YZTA 1G17A 3CPJB 2VP9A 4CIDA 2XXAA 4LZZA 4XWKA 1KI8A 1RRFA 1XXHB 2W2VA 4DSTA 4ASUD 4OQFA 5IHPA 1CR1A 2ORIA 2QTFA 3TE6A 1E0SA 5FUWA 1VTKA 4M4SA 1ZNYA 1VPLA 2G3YA 1R7RA 2RGDA 3MAAC 1BO6A 2ZITA 3OF5A 2RGXA 3EW9A 3W90A 1S8FA 4JBWA 3DHWC 3OAAD 1Z6XA 3PEVA 821PA 2QORA 5FPKA 4E09A 4ARZB 2D7CA 5BYJA 3UG7A 3D3QA 4JLMA 1VYUA 1X1SA 3TAUA 1OHHA 1DG3A 3NWJA 2XXAB 3ZS8A 5FH9A 1KMQA 2O8DA 3K9NA 5H1YA 721PA 2CCGA 3TUJC 1KGDA 4TN1A 4Q9JA 3AF2A 1E2KA 4NONA 4V03A 5C2JB 1ZC3A 4IVQA 5DHAA 3KTAA 1WBBA 1OH7A 4CGZA 3CWZA 1Z6YA 4Q9KA 2PX3A 4IKEA 2CEAA 1CXZA 1TU3A 3GLHA 3QKUA 4TLEA 1E79A 1X6VA 2H57A 4KJZA 1ZP6A 1XD9A 3DZ8A 5AUOB 1P9NA 1KO4A 4B71A 1EX7A 1IAQA 4NCJA 1G5RA 2XZLA 4JVNA 4B32A 4I1OA 2GAOA 1M7BA 4DRZA 3DL0A 5F9FA 2O8DB 4YXWA 3QG1A 4B44A 1JALA 3W5JA 2HCBA 1W0JD 2ZJ2A 3AF4A 1IBRA 4LBZA 4RD3A 1U0JA 4PAMA 3ND8A 5F98A 2V6JA 2I1VB 3SR0A 3ZIAA 1J8YF 2QY9A 1DARA 4Q66C 1RKBA 3ZZTA 2JLWA 5DO9A 4U7DA 3ETLA 1RVDA 1KSHA 1YVDA 1IN7A 1SHZA 1QDEA 3X1DA 4LJ8A 2NTYC 2B21A 4IDQA 1PUIA 1G41A 1R2QA 1WMSA 5FTKA 3U7EB 1J99A 3IO3A 4EFLA 1UKVY 3LQQA 3U3OA 2QPOA 3NH6A 4NMMA 1U90A 2FEMA 3KKPA 3PEUA 4OYHA 1IN8A 2CK3D 3FMFA 1I2MA 1XTSA 4MA4A 1ZUIA 3P32A 3HYTA 4D4LA 3WMGA 4A36A 4D26A 3EG5A 5K8IA 4A92A 4FMCF 4HAZA 4Q21A 2CL0X 4B33A 4Q4AA 3BH6A 2ZRLA 4UNNA 5DN6D 1G16A 1RW4A 1WRBA 2F9MA 3HU2A 4NCNA 4ZCIA 3SFZA 1JAIA 1E2LA 1MO4A 4F92B 3ASZA 3H1TA 1IJEA 1KKMA 2C03A 3W6NA 1E32A 2OXRA 2VHTA 1SKQA 4IFEA 2Q0HA 1E6CA 4UNQA 2QMHA 1QHHB 4WIAA 3Q7QA 1T5LA 4LRWA 1AGPA 2JEOA 2QE7D 3BFKA 4CYMA 4AI6A 2V7QA 1R0ZA 1BMFD 1KTVA 1XMVA 2QU8A 2RCNA 4B75A 2ZI9A 4K81B 2PEYA 2ZS8A 4LC1A 4V0KA 5TDHA 2DWPA 4HAYA 1LS1A 3WRXC 1A1VA 4Q1FA 1EX6A 2ZJAA 4F4CA 4AG6A 2EYUA 4CDGA 3ASYA 1RE0A 2YNMA 4WZ6A 1W0KA 5HZHA 2ZE7A 4Y0VA 4OQNA 2G83A 421PA 1TAGA 3SZRA 3RHFA 1C4OA 2IX3A 4KVAA 3WBKA 4ZO4A 4G0NA 4Q4LA 2GF0A 4W5HA 3A58B 2F6RA 1D8TA 1KI6B 2TMKA 4RKEA 4PHTA 3PXGA 4LOAA 4XVUA 5J4HA 3U7GA 1EGAA 4ASUA 5G41A 2GEDA 1H8ED 2OCPA 2EWVA 3R8FA 1MR3F 4UQOA 4V02A 3NDBB 1MO5A 2IYQA 1OYYA 2DY1A 3CPHA 3U7HB 4JLVA 4YMTA 4YMUA 3W3ZB 3OAAA 1RIFA 2SHKA 2ZS9A 4YMSA 2JGNA 5EP4A 1E9BA 4DLSA 4PX9A 2OFXA 5FTJA 1XBTA 3CB4A 1R4AA 2QTHA 3AKDA 1E9AA 4IDOA 1FTSA 3EPJA 1LNZA 4BFWA 3PENA 2CLDX 4D4KA 1ODFA 4MGKR 3NBXX 3WXMA 3H0KA 2CVFA 2QP3A 2C8VA 3I32A 3JZMA 4A2PA 1ETUA 4RFSA 3U3JA 1LF5A 1W36D 4BFZA 2G1JA 2GBLA 1KKLA 3NVAA 1FZQA 5B64A 2OCAA 4XWOA 4CZ2A 5CJPA 2CMKA 2BJWA 5FTMA 2Z0MA 5EXXA 2F9LA 1TUEA 4OBEA 4MKGA 621PA 1ZD9A 2OFOA 3SDZA 2HF8A 1E9EA 2OILA 2QQ0A 5FPYA 2V9PA 3T1TA 5E7MA 5FR1A 2AWNA 1D9XA 3FVQA 3F5FA 4TSFD 3QJYA 1N3BA 2WJGA 4TLCA 5CM8B 4IXMA 4LJ9A 2WM9B 1KK1A 2FDCA 5JS7A 5HCIA 4LCBA 4RFSB 1OKKD 2RB4A 1F60A 5JRJA 1VCOA 3CKLA 2WMOB 2WVJA 4IOKA 1HTWA 2O8FA 2H92A 4W9MC 1XWIA 4PQRA 1IJFA 1NLYA 1SZPA 1T8TA 4Q4HA 1Q1ZA 3AVUA 1II8B 3R9WA 4RD6A 2XTNA 4DCTA 2QRZA 4B76A 1R8QA 3NTUA 2QAJA 1HUQA 4BRWA 1EG7A 4NYMR 2MSDB 1EFUA 1NBME 2CK3A 1DAEA 2ZSFA 2VSXA 1ZM7A 3DDCA 3I92A 3OESA 4MYHA 2AR7A 2AXNA 1OLOA 4HAXA 4PPGA 3DOFA 3IIKA 4BRUA 4OHVA 3QPUA 1KDOA 3PR1A 3Q72A 5IDVA 4DHEA 3OZXA 3QKRA 3K0AB 4OHYA 3LNCA 1Z28A 2OAP1 4DSNA 3IPXA 4AKEA 3B9PA 2IL1A 4L8GA 4NKRA 2ZREA 1KI4A 2QBYB 2GXAA 1ZU5A 2DFNA 3HU1A
chains in the Genus database with same CATH superfamily
1ZKDA 2NU7A 1S5PA 3NNNA 1G6Q1 4BQFA 4F1KA 4JOCA 5HJEA 3K05A 4H7DA 4PXSA 4DARA 2YZ7A 3DBHB 2PKRA 3HZZA 4I8DA 4XDGA 4KXLA 1ULTA 3JS5A 5FKJA 4M21A 3UXEA 5JNRA 2NPOA 1QGOA 5SYNA 1K0FA 1WXIA 2H85A 1K92A 3BWCA 3DFZA 1M2NA 1Z4QA 3O2SB 3QY0A 3ZE6A 4B5KA 4FSDA 5AM3A 3EIXA 4KVZA 1X3SA 3PZRA 5HQJA 2BI4A 1HMPA 1Q1NA 4DLNA 2DXIA 3TZQA 1Z56C 3UO8B 3L1HA 1VG9B 2P2DA 4OXYA 4DLVA 4M8SA 4ZHQB 3FPEA 3N58A 1DKRA 4FYJA 4Y1RB 2REBA 4R6XA 4YLEA 2CJFA 1UC4B 5BWNA 1QDLB 1W59A 1OFVA 1Z9BA 3F6EX 1K2WA 1S9HA 3SGLA 5K0TA 5FLXA 5EN4A 1WW8A 4M55A 4QBIA 3HR4A 3OQNA 3RC7A 1Y4ZA 1QSGA 3UB3A 4TLDA 2F1KA 4PSAA 1WXHA 2QUIA 4MSUA 5E4YA 4DDTA 1MAHA 4ACBA 1K08A 4FNMA 3V9PA 3PGLA 4LHXA 4D8UA 1K27A 3JWIA 1UM9A 2R9VA 2XH8A 2G0TA 3DV9A 3IQEA 3A3OA 4OXIA 3DULA 2FE4A 5JQWA 2ZJBA 2FOLA 1ZISA 1U98A 2BBSA 2BWJA 2QG6A 2V55B 3K5PA 3IQWA 2FSPA 4J2OA 4JDPA 3ITKA 3ZJVA 4LHSA 4RZ2A 5IC6A 4X66B 5BV7A 4LVNA 4Q7KA 4FT2A 1ENOA 4JJ4A 4KVFA 5B4VA 3C6XA 4FKZA 4QXRA 4TRRA 2VDJA 1I0ZA 3CX3A 2RHJA 1G21A 4R8RA 1NZFA 3AM3A 4RWEA 3EIFA 5EIAA 3EZ9A 1KK3A 1U1FA 5AM5A 3PFIA 1NI4B 2IJGX 5FUYA 5IJWA 1UF9A 1WZEA 1WD7A 4F60A 3DR5A 1SA0B 4KX3A 5C3MA 1XFDA 1AZSC 4P7JA 3LKDA 4F5YA 1M2OA 4PZPA 4DV5B 1JIKA 4DA7A 1Y9EA 4X1IB 2MYPA 2J0UA 4ESVA 2Q5CA 3N2NA 4C05A 3QVGA 1S7GA 5H70A 2B7CA 3ELBA 5DIZA 2AZTA 4QUKA 3A1UA 3EGOA 4LYAA 1JHYA 2HBYA 3TLJA 5BN3A 4OXRA 4MS4B 3D4IA 1VBKA 5JAUA 1PJ4A 3AVVA 2RHDA 1HL3A 3PWZA 1H8HD 1EJ6A 2MJLA 2P3OA 2WKRA 2QYTA 1RWBA 4B8YA 3BRCA 4URWR 4Q3NA 4ON9A 3BA6A 3OY2A 2VHUA 4ISCA 4YGYA 1UBUS 2WE8A 1T35A 3EA0A 3HUFA 5DNVA 3UYKA 1VYTA 4BDTA 4PS0A 4C4AA 2PX2A 3GFQA 4M8LA 4EB0A 2CC2A 2I8CA 3U7RA 1Q5PA 1DC7A 4DCSA 5IN4A 3M81A 5C1PA 2G36A 1L4EA 2NYUA 3NAGA 3H1BA 2BM0A 1KEUA 3Q5DA 4QG3A 3UCEA 2XYRA 4MW4A 1WQ3A 4QL3A 1L5NA 2XBMA 3HCFA 1N6IA 1GZSA 1NHWA 3RAPR 4DR4B 4UTPA 2Q3LA 1KY3A 5IM5A 4DSZA 3RRBA 2GARA 2CXNA 5INTA 1EFLA 3N05A 3PHJA 5DP2A 4M88A 4OHWA 1YBVA 5D85A 2YKGA 5U4XA 5AP9A 2GBFA 1TQ6A 2HA7A 3BWMA 4Q1CA 3LPMA 5CIWA 3Q8LA 4EQ6A 1EK1A 2GN2A 4MAAA 4JASB 1CZOA 1BEEA 1GA1A 3D3JA 3TRFA 4GP7A 4LI3X 2XUFA 5J2TF 1EJBA 1U3TA 2VP2A 4QSHA 5IPFA 1VLQA 4QPCA 1Z8HA 1ZU4A 4OB7A 4FVTA 1T9AA 4IH1A 2HDNB 1CRZA 2IEAA 3OECA 4ZVLA 5IMBA 1BKYA 2OHHA 3RW9A 5LQRA 4AY4A 3UAVA 2H2DA 5L7YA 5ALXA 1NBIA 4JSYA 4Q7EA 4V1CA 2GVZC 4UQLA 1C1XA 2QN2A 4QOGA 3PE3A 4MV1A 4CLRB 1PR9A 1IN4A 1IC6A 2EC5A 2XRYA 3KYIB 4LHYA 3VI3B 4B80A 3AERA 2FDRA 3HJGA 5HMLA 3IUYA 3AY7A 4CF6A 4UM9B 1Y8AA 2WG0A 2HCJB 3RC8A 4BNDA 5BSVA 4KQ6A 4N5MA 2GPSA 4CHTA 2KPOA 3S44A 1ICEA 4C7XA 3TE7A 4OQPA 3Q3JB 1PBTA 3QFSA 2P6MA 2WWGA 3O8OA 4OHFA 1DQPA 1JF8A 1YKSA 3A28A 3K2IA 5CEJA 5JSFA 4I50B 5A6SA 1A4UA 4MJLA 1G1MA 1H2HA 2X8BA 4G8CA 4RXUA 1AKQA 1R9GA 3QLJA 4RIEA 5CVUA 4YRRA 4ZP1A 1MORA 3UUFA 3OJOA 2H51A 1KAEA 2BKVA 2BY4A 1TEXA 2L69A 3B1ZA 4RF3A 4YB8A 3SBOA 4HPJB 3IDAA 5HE8A 4D3ZA 2YFHA 3VYWA 4LX8A 1LWNA 4NMLA 2ICAA 1U0FA 2C0QA 3F71A 5KNBD 4CR6A 2HAEA 3CRQA 3ICPA 1GZ6A 4HRVA 4W63A 2EJCA 2CZGA 1VYHA 4Q01A 2CNWD 3PCXA 5IEBA 2OM2A 1FMJA 5JWOA 4E12A 1W1UA 2IPXA 4ED9A 1IIBA 4K6KA 1P39A 5F7ZA 3LS2A 3MGCA 4D02A 3M3HA 1CUCA 4NAHA 3T3MB 1W96A 3C8HA 3R5HA 5KHOC 2HL6A 2FQXA 3HV0A 2XCSB 2Q6IA 3RK0A 5C80A 1BRTA 4LDNA 4FZJA 2G17A 5JH7A 2OHJA 2YVUA 5KOJB 1Z2DA 2ZRMA 3OTQA 1CVRA 2GTPA 1XTIA 1QE3A 2C7QA 2EL9A 3T1OA 1RCTE 2PTGA 4BNNA 1OI4A 5AM2A 5CXXA 2ZM6B 4G97A 2LDBA 1QTNA 2V45A 4PZUA 1JEDA 2DULA 4KQWA 4RIIA 5ARDA 3VR4D 4L5BA 3E7PA 2VRCD 3UMCA 3NKVA 1U1DA 4BQEA 2FG7C 4PC6A 1WOYA 2BC9A 1L6RA 4BAZA 1L5MA 5TEVA 4L6CA 2GK3A 5CB0A 3QKSB 2VWPA 4CM4B 3PB3A 2ZJ7A 3IYLW 4RS4A 2R6ZA 5BN5A 1NHGA 1YAJA 1I3OA 3LPAA 3BIOA 3OJWA 2BE9A 3BE6A 3LQYA 2WHPB 1JA1A 2WWVD 3KTDA 4HAWA 4U2KA 4UREA 1DXHA 2PUHA 3W2TA 1PNVA 2H06A 2JZNA 2ST1A 3DAHA 1Q7BA 4XZ3A 3VNVA 5E8RA 4I8IA 2AUNA 4Y18A 3TWOA 1PGJA 1W19A 1F14A 4WJLA 3GDFA 2VJMA 2ECQA 1N8KA 1T9GR 2CE2X 3FSRA 5B1YA 3VUEA 1NUQA 2O7RA 3MCAA 1Z2CA 5ALMA 3FPFA 5GZ6A 5AQ1A 4OX9B 3THSA 1ADGA 4X62B 1PUXA 4IV5A 3U19A 1XTQA 2NV2B 2D00A 3I8OA 4A91A 3KOXA 2Q1WA 1L4NA 2BEKA 1SHJA 2JGDB 3SHWA 2YXLA 3OZCA 3LPNA 4JBXA 4A0GA 4O2AF 5HIIA 2VTKA 3FKQA 3HYRA 4CFZA 1XZHA 1QHYA 2OZEA 3GJ3A 4H0CA 1ODCA 3PC6A 4DRXB 5AIBA 4DQDA 4HEQA 3HXOA 6YASA 4E5UA 1IOWA 2PXXA 1PJCA 3MINB 2GZHA 1SQSA 3MTIA 5ALDA 1A9YA 1E99A 2O8CA 5LQCA 4XUEA 1VKOA 4BBJA 3OKAA 4LMBA 2PKYX 1CY0A 2RGWA 1Z7WA 2P2GA 2GN9A 1UWLA 5JEDA 1CERA 4M1YA 4YDQA 2IZ7A 2QM7A 4EOGA 1UBSB 5IK2A 3IJRA 1E20A 2VI5A 4ONEA 3JVEA 1Z7EA 2W00A 1NQTA 1DFGA 1RVV1 3SKVA 3RYHB 1SUWA 1OLSB 2G4CA 1BAPA 4L16A 4Y8VA 4IH4A 3Q41A 3U6KA 2COEA 4KIGA 2CXPA 4WADA 4MYCA 3OCJA 3ZU3A 2BFFA 2CYBA 1V5GA 4A2QA 1D0SA 1O5OA 4DW8A 4QM6A 1EM8B 4GPAA 1JFVA 5SZHB 5BNIA 4MV7A 1UDCA 3GZ4A 4R2LA 1WUIS 4DCUA 3AQ4A 1YRBA 4O4HA 4LC0A 4ALMA 1NZDA 2Q6TA 4CXMA 1XC7A 4IDDA 1PD1A 2WINI 1MOZA 3X44A 3AR3A 4G26A 2VF2A 2MT9A 1UZNA 1EA5A 3DBVO 2G88A 1AKMA 3IALA 4GLOA 1XYVA 5IKOA 1J70A 4CMBA 3K5IA 2XVXA 5JUWA 4B3IA 3CS3A 5CYOA 5FPHA 5CFNA 3TB6A 5JMTA 4DXHA 3TG2A 3FMIA 3A4VA 3PSHA 2BFCB 4ZI7B 2COKA 4NS1A 4KFCA 1LV8A 3KFVA 3SF8A 3AI1A 4CQMD 3VMFA 4BKPA 4JSRA 1JG3A 2OGWA 4UHDA 2VRNA 4YV0A 3O74A 2IHUA 4ZPJA 3EC7A 1G0NA 1B8UA 5IAOA 4HDRA 4JSTA 4M60A 2DR3A 3MRTA 1CEXA 4R83A 4XTCS 5C7IO 3DGFC 2ES4A 3GEMA 3PYMA 2IIQA 4PM4A 4J0CA 2EF1A 4ZT7A 1N2CA 3ROKA 4PNHA 1COWA 4RA6A 4Q9NA 4YGXB 4PV7A 3ABOB 3AK4A 4BNWA 2IV7A 4L5JA 4CCAA 4F85A 5J2UF 3THWB 1RD4A 3A37A 4Z4CA 2BBWA 5HF6A 4ZTBA 5JD6A 2RD2A 3FOAA 5AVYA 1JEQB 2Z6AA 1JXOA 1SXJB 5HVNA 1FUKA 1AVTA 1USWA 4PRYA 4OJKA 4A7PA 2OMEA 1PJZA 4YMLA 1NMXA 4M9RA 4NTZA 4TZTA 3IVXA 5ALTA 1HYQA 1USUA 1XA3A 2E1PA 2ZQYA 3SP1A 1THGA 4GF5A 2AGVA 2Y9MB 3B20A 3S29A 2GBIA 2XUZA 2DHRA 1R4ZA 2GETA 1P7CA 1DCFA 1SZJG 2G4LA 2OHFA 2WAXA 3C16C 3KJQA 2ZI7A 5DU2A 1MB4A 4A3SA 5B12A 3O94A 2HWKA 3PICA 2G25A 4QIHA 3UWDA 3ZYCA 3ET5A 4L2IA 4RJIA 5KOJA 4LSZA 2J59A 5ALJA 1K7YA 4FDMA 3JZIA 1A8IA 2XA1A 3K53A 4OQ4A 2C7OA 1OYOA 4GX1A 1QZZA 2BHTA 2PZ8A 3RC1A 4JYAB 3M5DA 4RL6A 3MA0A 3G8YA 4DS3A 4HNHA 2ZRFA 4BMVA 3VVLA 1H5NA 4MW0A 3HV2A 1AN9A 3MYYA 1S96A 3WRYC 4OP1A 3D8RA 2BTOA 2REXB 3W1EA 2Q3EA 3RWOA 4CF5A 1JQBA 2AFHA 4A8HA 4YV2A 5BSEA 4CCSA 4RQBA 1KY5A 5CB4F 2PUGA 3IHWA 1G21E 5I9MA 2EV9A 1K4MA 4P83A 1E2QA 2RHWA 2WWWA 4FR2A 3DOCA 4KIWA 2BYTA 4AJ2A 2C1XA 4FFSA 3Q3HA 4E03A 3BYZA 2O1EA 3K0FB 3KYJB 2HGZA 3IPAA 4K2HA 1ZD5A 4BNFA 2FNAA 4GLFA 1DJNA 5I9BA 3MSXA 3LVBA 2VHXA 4TTTS 4O2BB 3HL0A 4X0EA 3VYSB 4P0PB 1AV6A 5F9HA 2XQKA 5EXEA 3I2FA 3SHFA 2ZKIA 3OLZA 5TGTA 4G2TA 5K3DA 3IAFA 2QUHA 3V1TC 1FUIA 5DM4A 1GDTA 3PC8C 3OX3A 2L42A 5A9TA 5KYKA 2VYNA 2VH5R 1GKYA 3WLTA 3PVCA 2ONJA 1WX1A 2QVZX 3PXBA 1J1ZA 1VYVA 4FFOA 4WKCA 1GG8A 2PH5A 4QQ8A 5FNVA 2JD1A 1GUAA 1J49A 4RD4A 2JIBA 1ZM3A 4Q9HA 1Z6GA 1JHAA 2CWWA 3GDWA 2C2OA 2NUAA 2FG6C 4LMAA 1FFHA 1PZFA 1XN4A 3KKKA 3LWDA 5KBYA 5LLDA 4P32A 5JO9A 5HZGA 1IXZA 2JI4A 3I4LA 4K88A 3HN7A 4P9NA 3FOZA 3WJAA 2NX2A 2GTIA 2ZBDA 3GD5A 2VHZA 3CO0S 4IX1A 5T6MA 1E66A 1VE3A 4A73A 4EF4A 2PCJA 1Q6YA 1VECA 2PWAA 1ZMTA 3GYBA 2PLAA 2VJYA 3R6WA 4JLNA 1H23A 5F51A 3T9CA 1GTSA 2BAGA 5IM4A 4JGIA 3KJXA 4ZRNA 4YP0A 3H5NA 3OIGA 4HN2A 1NZJA 2FAXA 5BSRA 4G8JA 5E7QA 1I51A 3FF4A 3R8CA 4AZ3B 2VWQA 5F1YA 4HDNA 5DLQC 4UE6A 1U0EA 3VKGA 1A82A 2E3JA 1WDKA 3R1IA 5D1HA 3BWVA 1C7IA 1DHRA 3DE6X 3PQ6A 2I4RA 3FZNA 3CLSD 3KLOA 3S8EA 4LXGA 2VRBA 5JZ9A 3A1TA 4ZV9A 2N1MA 4WXPA 1GTZA 2JLRA 4BV2A 3AVTA 2IYNA 1HWYA 1JB9A 1V95A 2V5UA 1JHPA 2D5CA 3KLBA 1DRKA 4KOEC 5B4TA 4OU5A 3A06A 4B17A 1Y3DE 4J0FA 4RCYA 5JO0A 1Y8RB 3F1LA 3P2IA 3K8QA 4IDCA 3T0GA 3I01A 4JS0A 3R76A 3U0BA 3VVCA 1CS4C 4MX8A 1S8AA 1V6AA 3IUNA 3ZK7A 2WFZA 1NASA 4LAFA 1ZSNA 3T4EA 4B2PA 4G84A 1V96A 3HKDB 1C7ZA 1LSOA 1PL7A 2JJ2D 3MFYA 3IKLA 3RLIA 1Q0QA 2QV7A 1YOBA 1L7RA 1XK6A 1U5BA 3LBAA 4JU9A 3DQQA 3EULA 1U6IA 2H4FA 5DBIA 4DMLA 3ZWMA 1TRKA 1CZUA 2J30A 1XVTA 2JJMA 3KSDO 1K3TA 1GZDA 3NKFA 4TUYB 1XE3A 4M9XA 4Q19A 1IUPA 4P3XA 2R96A 5K3BA 5FBRB 4Q4AB 3TFOA 5CK4A 4WOJA 2I6GA 4JQSA 1UPUA 4XEHA 1VJ0A 3H11B 3NHFA 4FYKA 4P4LA 4WBSA 5B7NA 3NWEA 2EIXA 5COQA 5F23A 1I4TD 4KRXA 3PFHA 1UMKA 1DT5A 2BRUA 1SKYB 3CYFA 2HU5A 2IXDA 3GEHA 1IXRC 3INNA 3OIVA 4PYOA 4WCFB 3L4JA 4LCEA 5B37A 2UKDA 2D7JA 4J0JA 3D3WB 1P72A 1QPGA 4JP8A 1ZNQO 2PT7A 3I4FA 5BSMA 1LUAA 1MXHA 1WY5A 4RM2A 2PXAA 2RHTA 1E3LA 3OCUA 3OJFA 4G81A 4N65A 5JPDA 2CVZA 2BVNA 4DLBA 1N34B 4B3RB 4D6XA 3NIWA 1AG9A 2QTGA 2QZSA 4BNVA 3EC2A 1RFLA 4HO1X 1DC4A 1ESCA 1VBFA 3E6AA 5ICSA 4N0MA 3E61A 3MHPA 4YMGA 4FKMA 1X7YA 4IO0A 2YJ4A 4AFNA 5G2OA 1XZFA 2JVJA 1D0IA 3B6EA 3PV0A 2ZTMA 5E6RA 1MB9A 4GL4A 4LZJA 5FO1A 1Z47A 2L2QA 3C5CA 1VMAA 2PRIA 3IKMB 3TIXB 3TW6A 1LY1A 2X58A 1FTWA 2FK7A 3O1HB 2RGEA 1F0YA 4Q18A 1AB5A 4Q24A 5F4ZA 3Q1KA 2H8KA 1L5LA 5E6SA 4GP9A 4P22A 4BNTA 1F38A 3JR7A 5C81A 1ZOOA 4LY0A 1N2SA 4JBYA 2HA4A 4MVJE 4ARSA 4TV9F 2A57A 2R47A 2VYVD 2AOTB 4XGRA 4AJNA 1JAHA 1YB1A 2QENA 1M34E 2VUIB 4PQFA 4X1KA 1OWNA 4K3VA 4H3KB 5IHXA 4CT5A 3EIUA 2H4HA 1KYYA 2O5VA 2RBGA 2IV3A 2GJKA 1ZICA 2BMAA 3SC2A 3WWCA 521PA 1XQ6A 4AO7A 3KR2A 4IZOA 2IBTA 4A5OA 1O0BA 3EGIA 5B57C 5F3WB 5TLSA 1XLWA 2QR5A 4GT1A 4R3WA 1AMUA 2ON6A 2ZE8A 1IUKA 1PEAA 2ZUCA 3NH9A 3QFCA 4KXQA 3M70A 3RVQA 3QWHA 3RUIA 2JLZA 1HT3A 4ZO6A 3AUFA 4HLNA 2RH5A 2NZ2A 3STXA 3OZ7A 2BEVA 3FVTA 1BMQA 5CBPA 5JVDA 3GD7A 4UXIA 5LB4A 4YUAA 3QV1A 8OHMA 3WJ2A 4M83A 4J16C 1DTWB 3G5MA 4Z4FA 4UUQA 3RYFB 5EIOA 2HXGA 2OP1A 1IQPA 2CYCA 5K45A 1YFLA 4PU0A 2LVBA 3AKYA 4FI3C 3AVQA 2WJWA 1SB8A 1HFWA 2YZMA 2DM6A 2WD9A 4IDNA 3O8QB 4E0BA 3DWGA 16PKA 3R5SA 1EGQA 4DN6A 4RLSA 3OWOA 1FDTA 4MUKA 1EESA 4AKGA 3WBBA 3EDOA 4YRQA 5CVVA 2AZXA 2GPTA 2YHUA 1T6YA 1MQAA 5EE5B 1E2FA 1FVFA 1NIPA 2I03A 4JA0A 2ANCA 3ZXYA 5LMZA 3DC2A 5EYPA 2J0SA 3KUCA 3PDHA 2D0OB 3NPAA 2NWQA 4WXRA 4FGUA 3UT5B 1LV7A 2BGIA 5CLGA 2BR4A 1VLVA 3UMGA 4QG7A 5CMLA 1L7VC 3LUCA 3RS5A 2ONCA 4TMXA 3TINA 3C3KA 1W73A 3GVIA 2BJHA 5DF1A 2UUPA 4IDEA 4UD6A 3WK4A 2BKLA 1HF3A 3VSDA 2JZCA 2PLRA 1ZN8A 1CE8B 4FD2A 4KXYA 1DBPA 3S2FA 3SSOA 1RYEA 4BLPA 2I3BA 1X3LA 4HRYA 5AW5A 1TUBB 3VXKA 3H6HA 1SXHA 3KB1A 4A0RA 2O8FB 1GL6A 1ZNZA 4MV4A 2ZPUA 2R4TA 3LCVB 3FG9A 1KP9A 2VXCA 3V8VA 4KMRA 3FWKA 5H8WA 4LYDA 1F8YA 2PGDA 1ISFA 5A04A 4E1AA 3U7JA 3C8MA 4ZAWA 1EVQA 3E9CA 4DYDA 1T36B 3G59A 3UV7A 3GRUA 5BW8A 3G0BA 4HS9A 4J29A 4Q4JB 4NS4A 2IKQA 2X2FA 2R8XA 5AVZA 3DMNA 3O1LA 5CA0A 3HM9A 3ITEA 1K9VF 3W7VA 2KW5A 2XJ9A 5DM2A 1Y5RA 1NJ2A 5TQ2A 3RUEA 4BB0A 1R9NA 2CSUA 1DAHA 1UH5A 1XDBA 4Q3LA 1YI1A 3PD1A 3ZG6A 4DIDA 1FFEA 3DCNA 3RF7A 2XF2A 1ZJ5A 1DIRA 1XZBA 4GQBA 5CLLA 1N2CE 5JE8A 5FWXA 2VR1A 2NVWA 3GYGA 2EFEB 2BGMA 3CKKA 5A0TA 5EZQA 2O57A 5JZSA 4RZQA 4NAVA 3R3UA 4URZR 5LA6B 2WZCA 3RFFA 4YRJA 2VLBA 1CR0A 2OTCA 3V1YA 1RC0A 3WGTA 1DKQA 2OESA 1BWRA 1GKLA 1G20A 3MUFA 3ZKAA 3CUTA 2GK4A 1U7ZA 2ZM5A 4DWOA 1POXA 2H1FA 3HH8A 3F8TA 4FMBB 4QFBA 1VB5A 3LLSA 7ADHA 2JA2A 3FPGA 4Q0MA 1R3UA 4A9AA 1GWNA 1YJBA 1Z2AA 1FX0B 3ILYA 3U60B 2HMTA 3HXPA 4XTRA 5DHRA 4RPKA 5GVRA 4OGFA 1C81A 5CPBA 4DQVA 3VZRA 2WJ3A 3DYVA 4QU5A 2AF4C 2Z3VA 2UYOA 2ATIA 4N8SA 4EMUA 5HIAA 4I3GA 2BZ1A 5GADl 3I62A 2EL7A 3G68A 2WYWA 4OHBA 1WMAA 2MR6A 4QQRA 3WK8A 3QKWA 4MVJD 4G1MB 4O3FA 1ZGCA 2R00C 4CT4B 5JMWA 2QM0A 3I5XA 5TIIA 1C1HA 2EBWA 2WP8J 1W9HA 1P3JA 3C3BA 2NUTA 1EQ2A 1W5FA 5C8YB 5CB8A 3QE9Y 3H84A 1QXSA 3DSRA 3E3OA 3TFWA 1N9KA 1T2EA 4IOMA 2D1SA 1IY0A 4BYMA 3O21A 5BWOA 1AH2A 2XUKA 5DX8A 2D4HA 1AHIA 3AL3A 1S8NA 4PVCA 2B82A 5HIMA 2Q1SA 4IHAA 3ED5A 1YVRA 3OWXA 4LFCB 3IILA 4D79A 1U2PA 1NFQA 3SSMA 1LDEA 3UB2A 1E98A 5E38A 1G59A 2PSDA 4CODB 1P5HA 1P91A 4RPIA 5B6IA 2D7DA 3IVMA 2F8MA 1LC0A 1XKLA 4S2EA 4IFTA 3BIJA 2Z1DA 3AFGA 3OMWA 4XGKA 3C85A 2FX5A 3R6GA 4YJ2B 4EM6A 1F8UA 2ZRPA 1ZHFA 4YJHA 3LIPA 2HRCA 3I52A 5AWFC 4REQB 2GPAA 2FOIA 4NCAA 3PP8A 4HGZA 2XUQA 1EZ4A 4BO8A 2PSHA 4CV3A 5IK2D 3U49A 4PZYA 1E0JA 1OXBB 1PK7A 4R1PA 2V03A 5LXTF 1SOWA 5T41A 3FVVA 3T41A 4J8PA 1U94A 1BIFA 3RRXA 5EIEA 5K0SA 4W6QA 4L8FA 2WWXA 1JB1A 2IY7A 2VP0A 3CIOA 2GA8A 4MXDA 3D43A 2O3QA 4YMWA 1J2UA 2VAMA 3PE4A 4IIGA 3OE7A 4YP6A 3R7NA 4FB5A 2F8TA 1PZHA 2VQDA 2BFBB 1KOLA 4DMMA 3O82A 3LLVA 3OEYA 2GZSA 4IG9A 1DAMA 2DBZA 1H1LA 3D7MA 1BG6A 5DTRA 3REFA 2Y76A 1LX6A 2BI7A 4Z1MD 4J6EA 3GUZA 2P40A 3T7DA 3WQBA 2FR0A 1H0RA 1KZ7B 4RDHA 1HNWB 4HNRA 3SS7X 1DJPA 1VI5A 2HRQA 1BMTA 1Q74A 2XTZA 2HLDA 2QMYA 4LDQA 2OCXA 4EUSA 4YX9A 5JTTA 4H15A 5CW1A 2CFSA 1P3Y1 4ZU1X 1EFAA 4B2LA 3OIFA 5JS6A 4IR7A 3AESA 4LFBB 1CU1A 5A9RA 3T5BA 3IEMA 3CVWA 1FTGA 3OQIA 4PXYA 4PYMA 5ERGB 3KU4A 4KQJA 2GBLC 3C87A 3GH3A 4COKA 5CNIA 1G2QA 3LD9A 1GKIA 3T1VA 4CHGA 1GAWA 3H2HA 2OXTA 5L6MB 2V3CC 1DADA 1WDMA 3MIZA 1XZGA 4MLCA 5CGQB 4X6UA 4FXPA 4WNIA 4W1PA 3EEOA 5TT1A 5TRTA 1XNQB 3G2NA 1FP1D 3B7WA 4WZAA 3A9CA 3D31A 3TNFA 3O3OB 1OVMA 1ZOPA 3EH2A 5JNVA 1EFRD 2CL7X 5B1IA 3ROPA 2ZPAA 1PAUA 3M34A 4JJZA 3IQIX 3PL1A 4MTLA 1RHQA 2IYXA 2VPIA 4W5TA 3T9BA 4GGPA 4MRNA 4IIUA 1A5AB 4C4RA 2VNJA 2ZWOA 2UAGA 3FPKA 1SUFA 1TYDE 2MSEB 4XLZA 1VHTA 2QGNA 4FHEA 3RRFA 4RIGA 1OXXK 2Y1LA 4G5SA 4JEMA 1SY7A 3O0TA 3UQZA 4XJXA 3ZV7A 1NWHA 1QOPB 1EH5A 3PI7A 1X9HA 3CUVA 3JASA 4UHEA 4P53A 5BVHB 3QSGA 1PR6A 2I6FA 3F9IA 4TWBA 3TVDA 4D3YA 1O6BA 3HCCA 2JBAB 4RQTA 4TV8B 4JBGA 1GPUA 4HXYA 1VZ3A 3CNEA 3AGQA 4DILA 5AHOA 1ZCFA 4JMPA 4QYMA 5J3JA 5KWIA 3R3WA 2C29D 1KVTA 3IMGA 1MO6A 1UK8A 3JD4A 4R5HA 1JR4A 4WFIA 5DYNA 3ZHTA 4DIFA 4CR7A 3EVCA 4Z7JA 1P0MA 1VE5A 4IV8A 3ZD6A 4Y2UA 2W93A 1I0IA 1YQGA 4NC9A 4QYWA 4C21A 1VLMA 1F4VA 3GLIE 4IYRA 5BSTA 1E1RD 5I7FA 4TYYA 3WDSA 5T3UA 3BQNB 3TKAA 1DRJA 1QLWA 2K6GA 3B8HA 1M1YE 3DKIA 2AJLI 3E9NA 3PNLA 1NNEA 1Z3IX 4KQ1A 3KLNA 3S7ZA 1A76A 3BJIC 4GI5A 4YY3B 3HSSA 4QUDA 4MQ6A 1DEKA 1I94B 3QBVA 2KI5A 3DLTA 5AW6A 2ZIXB 5IN5A 3O9MA 2G5GX 3VR5H 3WB0A 4FTWA 3BS4A 3GEEA 1SC3A 3BVPA 3A9WA 3HSKA 3OE5A 3PPWA 5LP6C 1U28A 2TECE 4F4IA 1RM0A 3LWNA 4I99A 2B9VA 2DFKB 4ABTA 3G0CA 1TVEA 3DBLB 1GNTA 4NBVA 1KZ6A 1TGVA 4TT3D 5FPQA 1J9ZA 2YC2C 2B4KA 4BLRA 2A58A 4MQLA 3WBJA 1U63A 2F3SA 2IEZA 2OZPA 1W52X 3P2MA 4O63O 5EXDA 3RNLA 3U1BA 2VP6A 4OBXA 1RPZA 3UMVA 3WQSB 4BHTA 3VGJA 1MH1A 4OK3A 1Z4MA 1OX5A 4ZQIA 1CUJA 1HDOA 2Z2ZA 3GLKA 2LGJA 3N07A 3ODPA 4R0MA 4FN5A 2GVNA 4UEOA 1FDIA 5FOTA 2VH2A 1YVEI 1C30A 5F2EA 3T7RA 2Y67A 1TJNA 1Y3AA 1XTBA 4PIVA 1G9SA 1XLUA 3GJZA 4F71A 4HL6A 4K3UA 2QVLA 4KN6A 1LSJA 1GNSA 4RACA 3RI3A 3SX0A 1RXSA 2IZ5A 4KYIB 4AO8A 1XMXA 2MSCB 3DE4X 3TW8B 3ABRB 5AVOA 4WK4B 3FYTA 4RVGA 4QJ5A 5BUZA 5CP8A 4W5NA 5AI0A 4ZV4A 1N4AA 2EYQA 2EBUA 1DAFA 3R2JA 1GQFA 1U9YA 4KPUB 2WIFA 4QHYA 3V32A 3WLFA 1IHUA 3QEOA 1Z0ZA 2AMJA 3DP7A 4ROTA 1K5GA 5E0KB 1H42A 1BH6A 3TNYA 4EG3A 4IKPA 4UVDA 4XH9B 5JY6A 1ZA1A 2KWIA 1FRZA 4UZFA 3AFOA 3ISTA 1K7EB 2NADA 3A26A 4FHZA 2WIJA 3QBJA 4KQXA 4LJLA 5AI4A 1D7AA 1YU6A 2VF5X 4JJKA 3UJHA 3TL2A 3UTDA 3ZWOA 5JCPA 4P0QB 2DUMA 2NO0A 2JFHA 3DS8A 2QLBA 3I9LA 4HLDA 3UFBA 4PLZA 3HSYA 4R1TA 1B1AA 2B5VA 3N8DA 4FOSA 2QMZA 3RIXA 1HOTA 2PRKA 2FDXA 3LGSA 1F2TA 4MR7A 8ADHA 1GPDG 1K88A 1E2GA 2CLFB 1XD8A 2OV6A 2Q6VA 1J8QA 3KWMA 3RHSA 4FXOA 4A1OA 1CKEA 4E70A 5FFMA 3HR8A 1S01A 4NR0A 4PZ9A 4H7HA 3SDSA 3WNQA 2ZYIA 4UCFA 3FTQA 1W29A 4LPSA 3V8PA 1NLFA 3I6BA 2PMEA 4INOA 2W2NA 2XT6A 4NF2A 2VRWA 1EWVA 1WAMA 2JDID 1U3GA 4LXTA 3NS7A 4K6OA 5ES4B 4URUR 5JRZA 3H1AA 2X77A 1W35A 5EJ9A 2AYXA 1I4EB 1SBQA 4QUIA 2VOJA 1P0PA 3DVAB 1Z38A 4K40A 5WRFA 2A7XA 2X14A 1MF7A 4UM8B 4W1QA 2WTBA 2ZSEA 3MFQA 3LOUA 1QCYA 2O2XA 4HTFA 4M0EA 2ZYRA 4HAOA 3PDIB 2XBLA 4Q7JB 1S7CA 2X8AA 4NFLA 4R69A 4AVYA 1NW5A 3JW8A 2ERCA 2J5RA 4ECEA 6CHYA 2HKIA 4JT2A 3G1TA 2FHSA 3HP1A 1UT8A 2FKNA 3GFTA 4J1TC 3E9ZA 3EXG1 3SSNA 2VCEA 2DSTA 3ANNA 3QVUA 1W4BA 1HEIA 4H0NA 5L4SA 3QPDA 2DWQA 1AUVA 3R6LA 2FW7A 1M0TA 2JRLA 2QZ9A 5AOAA 3ELYA 5KYYB 4QQNA 1WVIA 4RGQA 1HA3A 3EPKA 1JHQA 4IJUA 1BOFA 2O2DA 3NX4A 3VZDA 1NLUA 4UTVA 3ZGVA 2AUTA 4CIWA 4X1YB 1RRMA 2WSMA 3R7WA 4H3SA 4MVJI 4XW2A 3TPFA 3GRFA 1EP9A 1I3CA 1K5PA 3AY0A 4HQOA 1ZBQA 2JAOA 1SM4A 2ZQZA 4XWAA 1N5RA 4ETMA 3RYTC 2A0FA 3OO0A 3IEKA 3TSAA 2J3DA 3B85A 4YCNA 3R7DA 2BUBA 3QVLA 4GI7A 5JADA 1RT9A 1QIJA 1XEXB 4GX0A 3BHJA 3K4PA 4HVTA 2QROA 4PAWA 4QAQA 3SIXA 4D1YA 3EEBA 3L7MA 1B3RA 5FI0B 2CFIA 5MN5A 3M9LA 1D4FA 5HIKA 1ZZGA 2JEYA 1KVQA 2FQ1A 3S2UA 3M3PA 4BNZA 5BVHA 3W9YA 2HRBA 5L3SA 3L6UA 2HWXA 1F1JA 3GFBA 3L7IA 1BXKA 1WHSA 4KFUA 1ZNWA 2DT8A 3MCWA 5EZSA 1L9KA 1ISIA 5ALSA 5ILOA 4DLRA 2PN1A 3AOEC 2FN7A 3IP9A 3TQSA 3CX8A 1DINA 3BRQA 4CKEB 4CEJB 1R5JA 1R0RE 2ZIGA 3KQVA 4JL5A 1SHLA 2G06A 2L17A 4KE9A 1WV1A 1Q0UA 3CT6A 4H7JA 2ACWA 4BN0A 1XVAA 3AR7A 2P77A 5IAAA 1GGEA 4F84A 5JQGA 3GRAA 1ILEA 3RPEA 4LDAA 5BW6B 1JAZA 1L5VA 4TQUS 2XNCA 1KYIA 3WLAA 2DETA 3E3MA 3OQOA 2DRIA 5ILQA 3BKXA 1JG6A 2VDOB 1J07A 1N0UA 4ID3A 2IEGA 1VGQA 2G9ZA 1MAAA 3SZ3A 3JQBC 4OY3A 2SICE 2VZLA 5B36A 2NXNA 3IV9A 3L07A 1KDPA 1Q22A 2ENWA 2F3PA 3ROZA 3URMA 3WK7A 1S3GA 4F6RB 1HYHA 3AM5A 1NDUA 2WJ4A 1EVLA 2R62A 3H2YA 3HU5A 3D1VA 3IMFA 4MW5A 4OGLA 2A86A 4V0MA 4DA9A 1OXMA 4R9SA 4IIJA 3H05A 3JR3A 2FGJA 2C96A 3LFUA 1QO7A 5DBOA 2ORWA 5ES3A 3GJSA 2IHVA 4L9AA 2CT8A 1A9XA 5AH0A 2PNFA 1MX9A 4IHQA 4FWTA 3ENNA 3QV2A 4PPYA 4JQZA 4DLWA 4IUBS 2IWHA 3FLMA 3K1JA 3LCUA 4WBNF 5TPWA 3DD1A 1G0OA 2OK7A 2YY7A 3CWQA 3F7MA 3Q40A 1QPBA 4K46A 4PICA 5GAJA 2GXSA 5IARA 1NDQA 5AHKA 1D8AA 3HCBA 4N5HX 3HE3A 3TTUA 4DHWA 4DUPA 3IKTA 2J9XB 2O5CA 5GVSA 2XE7A 3B52X 3T35A 1L8OA 1QHHA 2ARKA 2FUG1 3LFHA 1PZMA 1HYBA 1SD2A 3M4JA 4LISA 4PSCA 3ZTTA 5E3IA 4BO2A 5AKZA 3WIUA 2H2FA 4C06A 4CUKA 1V16B 1Q2UA 2E6UX 2QVXX 4KXXA 4NV1A 3TOCA 2HEGA 5M2QA 3CY6A 1NVBA 1GPJA 2BF4A 2VDMB 1V25A 1GSIA 4LW8A 3WLOA 4UQPA 3KVNA 1D2CA 3B6MA 3QMMA 4WKOA 3VAZA 2F00A 3WJ1A 3LQKA 2QF7A 1BXRB 2FMXA 2FPPB 3KDSE 2C7PA 4Q37A 3GRZA 4UMFA 2DGDA 1UBGA 4R9RA 1X7ZA 3NORA 2QUJA 4KWEA 1H94A 2P67A 3Q7PA 4QGHA 121PA 3FRIA 3D2CA 3FDJA 3G0DA 5JAOA 2ONYA 1O94C 4D74A 3R0JA 1I5OA 4MOWA 4WASA 2LCFA 2ZVJA 2AJCA 1UZUA 2R6JA 2WU1A 1XQWA 1YCDA 2H4JA 4L8LA 3BT7A 4OJQA 1ZRMA 1R4NA 2P9ZA 1VHDA 5KOYA 1ZSYA 1K8ZB 3U7FB<