2YC2C

Intraflagellar transport complex 25-27 from chlamydomonas
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
197
structure length
149
Chain Sequence
KPIDITATLRCKVAVVVAPVTIPDTTVSVELFLLDTAGSDLYKEQISQYWNGVYYAILVFDVSSMESFESCKAWFELLKSARPDRERPLRAVLVANKTQVRLDMAQDWATTNTLDFFDVSADAPFLSIATTFYRNYEDKVAAFQDACRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Intraflagellar Transport Complex 25/27.
pubmed doi rcsb
molecule keywords INTRAFLAGELLAR TRANSPORT PROTEIN 25
molecule tags Transport protein
source organism Chlamydomonas reinhardtii
total genus 46
structure length 149
sequence length 197
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2yc2C00
1GRNA 2GAAA 4IW3B 2QZ4A 4A9AA 3QF4B 3SC3A 4WOPA 1NP6A 1VG9B 1ZM7A 2RKOA 3FB4A 1R5BA 3OFNA 1C1YA 4RZXA 3U44B 3BFKA 4XIGS 1RW4A 2HF8A 2X1VA 2YKGA 3GMTA 1ZP6A 2V8OA 1A2KC 4V0MA 1W2GA 3OF5A 1TX4B 4Z54A 3GLIB 1W44A 2GJSA 4DLVA 1OIVA 4L9WA 2BMJA 5LPNA 1H8EA 5AUNB 3K9NA 5K8IA 2LCFA 3WMEA 4TMXA 4N1AA 4DCVA 3HR7A 1AM4D 4BEJA 2OUKA 2RGNC 3SDZA 2JJ1A 3QEJA 3QQ5A 1U9IA 1N5IA 4DLZA 3AGPA 2KJQA 3X2SA 2ZE6A 4HDOB 1ZJ6A 1HQYE 4GBMA 4R98A 4ZO4A 3IBGA 5FTNA 3AEZA 5DN6D 4AURA 1SKQA 4U5XA 3C7KA 5J4LA 2GJKA 2V6JA 4MKFA 4NH0A 1OXUA 1GM5A 1GL7A 2V7QA 5CLLA 3TNFA 1W4CA 1F2TA 3GEIA 4C2TA 4RKEA 5GJBA 1ZCAA 2HEIA 1T0HB 3QXHA 1XU4A 2GZHA 3CM0A 2FZLA 1GUAA 3R9XA 4LUCA 5FOVA 3U3OA 1B0UA 3FFAA 2J7KA 2H18A 3CBQA 4IXNA 1GNPA 2QP4A 3VTKA 1JB1A 3R9IA 1UKYA 2GXQA 3U3JA 4DLXA 2BHRA 3THYA 4ARZA 4NCIA 2MSEB 2P5SA 3F8TA 3PQCA 1RRCA 3BD9A 2QPOA 1NSFA 3HJNA 2QQ0A 1TMKA 1WP9A 2H57A 2XEXA 5SZIA 3H0KA 3ND9A 3REFA 1Q1ZA 1BOFA 2HJVA 1BKDR 2DHRA 4D2IA 3HYTA 4JVNA 4B3XA 4KLZA 2R6CA 3UMRA 1X1RA 4FN5A 2F1JA 4H9GA 1ZM9A 2YOGA 2QGZA 1Z63A 4PQFA 1ONBA 4Q5IA 2NPIA 3QKRB 1E79D 3OIUA 2O8EA 1MR3F 2R9VA 4JYBA 1VYUA 2IBMA 1KSFX 2QMOA 2VH5R 4BRUA 1FOEB 5AK0A 4IVRA 5FI1B 3TRFA 3NVAA 1P75A 2NOAA 2IXFA 4K46A 1G41A 4KYUA 5EE5B 4OHYA 5KPDA 3UWKA 4IDNA 1LTQA 3IUYA 4EJSA 2OCPA 3IQXA 4PAMA 4IDOA 3UPUA 2IUTA 3CRRA 4DLWA 1XTRA 2C77A 2IWHA 2A5FA 1EXMA 3EA5A 1XCPA 221PA 2ASEA 2GETA 2OFOA 3U7HB 2GVZC 4LPSA 1IXZA 3KJIA 1MV5A 5DNYB 1OFIA 4B6FA 3PUYA 2YNMA 2BBWA 2ZYWX 1L7VC 3ZVRA 2ZI9A 4OHVA 1XCMA 1TPZA 2ZVQX 1LV7A 2CNWD 2FEMA 1NL3A 2VP2A 5JS7A 5F3WB 1VCMA 2FPMA 1KO7A 4A15A 1OB5A 3QXCA 2CBZA 5E4FA 1OSNA 4FD2A 2QT1A 3F5FA 3DOFA 2ZI5A 2KSQA 1T3HA 1N3BA 4TZ0A 1AZSC 3VKGA 1OJLA 4JT2A 3LY5A 1N0VC 1DS6A 1Q22A 4KU4A 4RFVA 3QUSA 3GLHB 4BZQA 2VF8A 1JAIA 4NYJR 2J46A 1IONA 2G6BA 1R0XA 3N70A 4PHGA 2D2FA 1JEEA 2I4IA 4YQFA 1UF9A 4GPTA 2REOA 3CX8A 2REBA 2O8FB 4P4TA 4JL5A 4KSCA 3CKLA 5C2JB 1G8GA 1YE8A 2QEQA 4NYIQ 2WWGA 4OI1A 1E99A 1E9BA 2V9PA 3ZDQA 5DHFA 2Z4SA 4NP6A 1OH7A 5EXPA 1CRPA 2OILA 4EIWA 1TADA 1F48A 1XEXA 1EFCA 2P0EA 1G6OA 1OF1A 3A37A 3R7WB 2GJ8A 3SFVA 5EP4A 3O8RA 1D5CA 5KO2A 1T3SA 5G3ZA 5LBIA 1G4UR 2WWYA 3ZIAD 3P4XA 5J47A 4V0LA 4NCHA 1OXTA 1VIYA 2BC9A 2QL6A 3PEWA 4F93B 5JI3E 4F7WA 4LYAA 4OK6A 1XMSA 3EPHA 3I92A 2WSSD 4WZBE 3CF6R 2VP6A 4Z51A 3SBEA 2AXNA 4MA4A 1Z3IX 1Q1BA 4CYMA 5L3VA 1OHHD 1P7CA 2LKCA 1FQJA 1KO8A 2J1LA 3NBZC 3KQKA 3TLXA 1P9NA 4AG6A 3LAWA 4B73A 2CE2X 3DZ8A 2FX3A 3AF2A 2P6UA 4MKIA 4EDHA 1RRPA 4ZDJA 1SXJC 3KTAB 2NTYC 4YDHB 5SZKB 4PPFA 1W7AA 4G5OA 3QG1A 2FFQA 3G5UA 2J41A 3ZVMA 2WM9B 2R6DA 3AV0B 4TL6A 2XJ4A 3P27A 5F2EA 3NEYA 4ACAA 2ANCA 1ZNXA 2VEDA 2JLWA 1P73A 3OESA 5JJLA 1P2UA 4C3ZA 2VHUA 1YZGA 2CHQA 1QBKC 2QGNA 1DARA 3TK1A 4G5GA 3TUIC 3W8RA 2DPXA 2QTVB 1KSGA 1P60A 1V5WA 4LWZA 1KHTA 3K0FA 2V4ZA 1IN6A 3WY9A 2HUPA 4XH9B 4WIAA 4NCKA 4D0LB 1J8MF 4TMVA 1S1MA 2JLXA 2QRZA 4O2RA 2EYQA 4MRNA 1VTKA 4RD4A 3NXSA 4P33A 721PA 4BLSA 1P4SA 2OCYC 3OAAD 2F1RA 4RZUA 1K5GA 2ATVA 2ZI6A 1R8SA 2A2ZA 1ZM3A 2GF0A 3DZDA 2HCBA 1N25A 4JSTA 4ESVA 3LBNA 5BW8A 5EXSA 4AK9A 2N1BA 3QF7A 5M04A 1IN8A 1Z8FA 5FOSA 5A5GA 3IPXA 4LHXA 4QBHA 2FH5B 3EX7C 2O8DA 3VNUA 3L0IB 2ERYA 5CK4A 3WYFA 5B57C 3U7GA 3UMFA 1CIPA 2R44A 3PJRA 1E1QD 1N6OA 3GJ6A 4Q9LA 1KGDA 3GFOA 1OYYA 1XTJA 2FNAA 3NC1C 2AL7A 4MGYR 2QRNA 4KXFB 1LF0A 5KHOC 2ONKA 4TQAA 4AG5A 2J0UA 2ZM5A 1ZNZA 4CRWB 1BIFA 3T34A 1P5ZB 2AX4A 3LDAA 1G8YA 5FOWA 5K8UA 1KO5A 2EWWA 5AR1A 2FSIA 2RHMA 1KO1A 3UATA 5KOYA 3GD7A 1W0JD 1YZLA 4R9UC 1XB2A 1Z2CA 2QA5A 3BB4A 1FP7A 2KI5A 2QROA 1MO5A 1R0WA 2JIZA 2QAJA 4JJKA 1NLZA 3T5DA 5FBWB 5JSZA 5J4VA 4IDQA 3K0EA 1J99A 3P32A 3ZH9B 4B75A 1N0WA 3K0AA 1GRQA 2GBLA 1LFDB 3A1VA 2RH5A 3SZRA 1ZVQA 1SVIA 3VR4A 1OYWA 3FKSA 1P2TA 2PCLA 3MUFA 2BJVA 3TAUA 3V4FA 1E4VA 4GZLA 5E3HA 4MRRA 1NKTA 2ODBA 4OL0A 3NKVA 1RZ3A 3U6BA 3WNDA 4KFTA 1ZD8A 3AP3A 2KBEA 3T1QA 4C0AC 2N42A 2VLIA 3QF4A 1I4DD 4JLNA 1KZGB 3A58B 4X8LA 1ZM4A 2JCSA 1SVLA 4MKHA 1E9FA 4A2WA 2GXSA 1K8RA 4GT1A 5CJPA 2WAYA 2OFXA 3ECCA 1GIAA 3LV8A 4LJ4A 5HPYB 1WDTA 1NNEA 4V03A 3K9GA 3OEEA 1S96A 4MGKR 4EFNA 1UEJA 2JLYA 2B7BA 3IHLA 4A8JC 2CEAA 2RGXA 1E0AA 3QKTA 4PZZA 4QL3A 2DB3A 2BKUA 3D6TB 4HAZA 1F2TB 2W00A 4C30A 1KI7A 2R8RA 3FYHA 4B76A 2XNDA 3CUEF 4QKQA 3REGA 4GMXA 4ERNA 5AWFC 3AGQA 5FPKA 1WBBA 3W5IA 4CT4B 2CJWB 1J70A 3RLFA 4L16A 2ZSAA 5BQ5A 3FMFA 3Q7PA 3W3ZB 4MUBA 1GNRA 2QSYA 3MFYA 5FOTA 1Z47A 2JEOA 2Z6VA 4Q1EA 2BCGY 2RHDA 1RYHA 2OE2A 5CYPA 1ZUHA 2KE5A 4ARZB 1P62B 1Q0UA 1T5LA 3H84A 2PEZA 2G9NA 1FQKA 2QM8A 4ASUD 1AJEA 1F2UB 3SJZA 3K9LA 2Z83A 5DYGA 2RB4A 1I2MA 2ZJOA 5FBVB 3IIMA 4NONA 1YR8A 4ZDIA 1JNYA 1G64A 1SQ5A 1CEEA 2WBLC 1N0UA 1KMHA 1WCV1 3PG5A 4XSGA 2MSDB 3F3YA 2H17A 3G0HA 1R2QA 4IOKA 3BB3A 2Q9CA 4LBVA 3CNNA 4OQMA 1G16A 2ZR7A 3T1TA 2O8EB 3EPLA 1ESMA 4UNPA 3U5ZB 1E2PA 4IFBA 4CW7A 3KKQA 4W5HA 3DHWC 3LBIA 4OBEA 3I1FA 1DOAA 1CTQA 2ZR9A 4EJSB 3Q9LA 2FFAA 4Q66C 3MMPA 1XTIA 1TU4A 3QKRA 3M6AA 4M1MA 5HCIA 4LHWA 3FHOA 1VDZA 2JJ2D 2DFLA 3IBYA 3AUYA 4TL8A 3RANA 4DDUA 4OK5A 3RSOA 3EC1A 2WWWA 3SYNA 1L4UA 2IUSA 3PEVA 3EIQA 4L9SA 1U0HC 4QGFA 1RC8A 3GJ7A 4Z1MD 2J9RA 5TMPA 5FTJA 521PA 2CHVA 2OBLA 2X2FA 2QORA 4LJ5A 4R71A 2ZAOA 4US0R 5HKKD 2ZRBA 3Q5DA 3HU1A 4YLGA 1AZTA 1RE0A 1QRAA 3ZZTA 5BWMA 2GTPA 2VQSA 1CF4A 1BMFA 2C9CA 4DIDA 4M21A 3KXKA 4JLAA 4D25A 4DUGA 1DELA 1N2CE 1QG2A 4PC6A 3GJXC 3I5XA 3CLVA 4LGMA 1TUEA 2YINC 5AJYA 1KI6A 5EE9A 5A0FA 1KY2A 3GLGE 2KBFA 4BPBA 2QUZA 5FL7A 2IYTA 3GCGA 2G0NA 1D9ZA 3AB3A 1XZQA 2CK3D 2RMKA 1BS1A 1VG0B 4MH0R 3SJBA 4C9BA 4W7SA 4XWKA 3PIRA 4FINA 5L3RA 2F9LA 4TSFA 1A2BA 3W3AA 1G5RA 1UJ2A 2V3CC 1YZNA 1G4AE 4RJLA 1KJYA 2PX0A 1TL7C 4DCSA 1XEXB 5CK5A 2WPDD 4PQYA 3KB2A 4K8OA 1Y63A 4KFRA 1H8ED 2ODWA 4L5BA 4O0MA 4AKEA 4BFTA 1UFQA 3IIJA 1GOTA 1JXOA 5BYKA 4FWTA 3TGPA 1IY0A 4QC2A 1DG1G 1ESNA 2BBOA 3THXB 2DFTA 3JVVA 4HB4A 4XJXA 2ZJ8A 1VHTA 4HLUC 3CRMA 5JCPA 4RZ2A 3PXGA 4LJ9A 1YRAA 3CRQA 2NG1A 2BEKA 1HEIA 1FNNA 5KYKA 3R7WA 5EE0A 1TEVA 4A36A 4Q9HA 1EFRD 3WP1B 4QG7A 1PLJA 5CLQA 3GLGA 2ZETA 3CW2A 4B43A 1A82A 3SQXA 1KAGA 2IK8A 3UKDA 4DZZA 4JKIA 1CULC 1W46A 4QNMA 2EU8A 5DIFA 3U3RA 2UZIR 4ON9A 3THOA 3KJHA 4GI7A 5E7JA 1H8HA 2A5JA 4KFUA 3B60A 2BKEA 2G1JA 1G3RA 4US2R 1YZKA 2C96A 2YC4C 4XVRA 4BLPA 4R2IA 1T6NA 4DLTA 2C03A 4QHYA 2PMKA 4IXMA 3RSLA 5FTKA 4LYHA 2P3SA 2ZUBA 4OHWA 2WWHA 3BWDD 2NQ2C 4HLDA 4D6PA 1YJ5A 3I4LA 3MWLA 5DI3A 2DFKB 1NVUQ 4QFMA 2OXRA 1DAFA 2QP3A 4YDSA 3LO5A 4ZCLA 121PA 1PUIA 4OQXA 3HPQA 1ZUNB 2ZUCA 2PJZA 2IA5A 1SXJD 3U60B 1PZNA 1LY1A 5H70A 3C5HA 2IYXA 1FP6A 2J7PA 4B33A 4C7OA 2J59A 4HLQB 2O8DB 2BCJQ 2FGJA 2FWRA 4WZ6A 1KKMA 2OXCA 4DLSA 3TAHA 5EUQB 3WRYC 4DT1A 3R20A 4RD2A 5D3MA 5UKDA 3KKOA 3WYGA 2WJJA 4EQ6A 4MRPA 2ZSFA 4Q4AA 1TQDA 2QI9C 2J0UB 2ZJAA 1UDXA 1KI1A 4BUJA 4O2LA 2ZYUX 3RRZA 3C8UA 2QPAA 4B3CA 1HT2E 2WAXA 4XOIA 3HDTA 4BFYA 1R4AA 2GA8A 5BYJA 3CIOA 3KX2A 4QJ3A 2OO7A 1E2QA 1VPLA 2GILA 4C0KA 4IJMA 3LX8A 4RD3A 2IYSA 2IT1A 1ZIOA 1S0UA 2WKPA 4AKIA 4JLBA 3DL0A 5IK2D 1LS1A 1JR6A 4DXAA 3ADBA 1COWD 2WWFA 4A0FA 2X19A 2QY9A 2AK3A 3K0AB 3WXMA 2Z0MA 5AJWA 1JALA 1GDDA 3LLUA 2FPKA 2XOKA 4BE7B 5CB8A 4HAWA 1ZU4A 2IYUA 4I99A 3GLFE 3CWQA 2GXAA 4TYYA 4I4LA 3IDQA 1BO6A 1S8FA 4WAUA 2JJ8A 4JLDA 4HSEA 8OHMA 4KSBA 1Z06A 2BMEA 4GNKA 2HV8A 3CX7A 3EPKA 3CH4B 2W6JA 1J90A 1NSTA 3QPWA 1ELOA 4PFSA 4M9QA 1FUUA 4B32A 2ZS7A 1OLOA 2QMUA 1J8YF 4TZ6A 2OCAA 4NDZA 1E2IA 1E1RD 3IHWA 4QGAA 2DBYA 4D80A 5B58C 1QHSA 3SE0A 4Z8XA 3TSWA 4Q1DA 1AN0A 3RAPR 1BYIA 1NIPA 3QY0A 2QSZA 1KIMA 2ZRFA 4C0BA 4JLJA 3TH5A 5J40A 1IN4A 3ZJYA 4MITA 2JLSA 1NVVQ 1WF3A 3QI2A 4Q7LA 3VHXA 3NEJA 3VHLB 2QN6A 3FHCB 3IPYA 4UNNA 3L0PA 1IHUA 3RABA 4JLPA 5FL3A 4DSUA 1JR3E 4D4JA 5HTKA 4QBIA 2RGDA 4GZMA 3LH5A 1XX6A 3SYLA 2X2EA 3T12A 1UAAA 4KHZA 4PAQA 1OFUX 2OAP1 1E9RA 5JWRA 3AVXA 2JLUA 2J0SA 2VSXA 4X8HA 1ZCBA 2F9MA 5H8WA 2OM2A 4M9SA 2VP5A 3BE4A 1M6NA 3ZVNA 1B23P 2PBRA 4F4IA 2F3TA 621PA 2F6RA 4MUAA 3K9HA 4RD6A 3LVQE 4DCTA 1UBGA 1Z22A 3EZ9A 4Q02A 3W8NA 5KDLA 1MKYA 3BJIC 5GADl 2ZRKA 2CJWA 2OBMA 4LBWA 5EP3A 4WXRA 2IHYA 2FPLA 3V4RA 3OIWA 3TVTA 4LHVA 3EIEA 3KDSE 3LQQA 3SEAA 1KMHB 4U02A 4BLQA 1IN5A 3BGWA 3CZQA 3SJAA 1CR0A 4BRWA 2F55A 4FMCB 2W6IA 4PX9A 5DSZA 1NIJA 2NMVA 1D6JA 1M34E 1F2UA 2G83A 2PJRA 4LJ8A 1GFIA 4CZ2A 3QIAA 1WBDA 3N5CA 1JR3A 3LBHA 2BBTA 4TTQA 3K09C 3FFBA 2RGEA 3M1IA 4Q9JA 4JLVA 1WQ1R 3UG7A 4UNQA 1NJGA 1CLUA 4IHQA 1TQ2A 1CXZA 5F9HA 1SGWA 3MD0A 3T35A 2ZE7A 1ZAKA 1W0KA 1EESA 3RS7A 3VKWA 1E98A 5IF9A 5ANRB 1A7JA 2XITA 1YU9A 2WHXA 1GZSA 4IDPA 5J4KA 4CGZA 1ZD1A 4URYR 4XD7A 3TIFA 3ICQB 5E7IA 3K70D 4F4CA 1AS3A 2XSZA 2IYYA 4TL7A 4PC1A 1MT0A 4LJ6A 1SULA 4Q1CA 5JMTA 1IXRC 3QXJA 1JECA 1SVSA 3C14C 3S1AA 2AK2A 1KZ7B 2BOVA 3KFVA 1Z0KA 1VYVA 1N5KA 1EFTA 1NBMD 1GG2A 2QE7D 4GL2A 4MYCA 4B48A 3PITA 4CVNA 3I61A 2ZPTX 2ZEJA 1G5PA 1KI6B 4BLOA 2A5YB 2G0TA 4HLCA 2AXPA 4L8GA 2FA9A 4M1TA 4PC7A 1MRNA 1XXHB 2VHCA 5FH9A 5JFGA 4OQFA 4URXR 2I3BA 4ZIRA 1DTSA 1NG1A 1P9RA 4GFDA 1G3MA 2V1XA 1II0A 1PUJA 3KKNA 1XZPA 2C5LA 1QVAA 1SHZA 3QPUA 1P3JA 1X86B 4P0TA 3W6PA 4HUQA 3RWMB 1L2TA 2D3WA 2K5UA 2FOLA 3N2EA 1XPRA 1U98A 2XXAA 4HDQB 1S3SA 2XTMA 1G7TA 1G6HA 3B1VA 5FI0B 2QM7A 3CNLA 5TDHA 5J4YA 4LCBA 3B2EA 3P1JA 2ORVA 4RZ3A 2NIPA 3LXRA 4PO9A 4XWAA 3TUJC 2JDID 2O0KA 1Z28A 3I8XA 1JQJC 4FMCF 4KBFA 3BC1A 3CR8A 1Q21A 3UXMA 5EZ5A 4OI4A 3EIHA 4R7ZA 3WBJA 3GLGB 3TJZA 5C4MA 3DVLA 2WV9A 3OE7D 4EPXA 2PX3A 3C16C 3UMSA 3VX4A 3AH8A 3B9QA 4US1R 3THXA 2FN4A 1G8HA 2RAPA 5JBQA 4PHTA 3L8YA 1WMSA 3PENA 2O8BB 1ZC4A 4QM6A 1OXVA 1Q1EA 4M9ZA 4OYHA 1XD9A 3W9YA 2JLZA 5BN4A 2HXSA 1IM2A 4M1YA 3TMKA 4XVUA 1FMLA 3X1YA 5TB5A 2DWPA 1FZQA 3CB4A 1IQPA 1LF5A 4M1SA 3SNHA 5TARA 4PZLA 2FJUA 5EQTA 5AUPB 4L4UA 1JEDA 4UJ3A 1W4BA 5DI3B 2BV3A 1IY1A 1OXXK 3HR8A 3TW8B 2ZI4A 3AP1A 3SU8A 4PANA 1UKZA 4NYMR 1NMZA 4XTCS 4BASA 5DN6A 5KDOA 3BS4A 4QOSA 2V54A 1US8A 4EJSC 1SHKA 1VHLA 2FG5A 2VSOA 4C7OB 1KDOA 1U2RA 5EXTA 3BBPA 2HLDD 3U2QA 4BQSA 2O0HA 5KSZA 4EFMA 3O47A 3GEHA 2EYUA 4DT1B 2IYZA 3QXXA 4Q03A 4MRSA 5FUVA 3MAAC 1Z0FA 4C0SA 4Q1AA 5D3MB 4A2PA 4IKEA 1NMYA 1JBKA 1P9WA 4EQ6B 1TQ6A 4Q4AB 4HB3A 4OKSA 1T4GA 1YRBA 1EK0A 2CLCX 1JXMA 2D06A 5KUTA 2FZ4A 2PT5A 3O8CA 4V0OA 5C1BA 2O5VA 5C18A 2F43B 4D82A 1XMJA 3WHKA 3AM1A 1HE8B 3BAFA 5CM8B 1EFUA 4DJTA 2XB2A 1KKLA 5L3SA 1KK2A 2ECKA 2WJVA 2ZRLA 3AKCA 3KUDA 1Z07A 3C15C 4PC3A 4EFLA 3B1ZA 4NL4H 4DDTA 4TQUS 5TXGA 4M8NE 3DM9B 3KFXA 3BH7A 1NVVR 2ZS8A 5LD2B 5JEEA 1Z0JA 3ZD7A 5EP1A 2C95A 2P67A 4AI6A 4LYJA 2ZUDA 3J81k 1YR6A 4M1OA 1Z83A 3CPJB 3UWOA 3FMPB 4RKFA 4CEIB 3RRNA 2VRWA 1BMFD 4BFVA 1E9EA 5JRZA 1NVXQ 1CJVC 2A30A 2ZYVX 2JAQA 3BERA 3OEHD 4DUGD 1D2NA 3RYTC 4FI3C 3AVOA 3N2IA 4HB0A 4HYYA 2ZXUA 4LC1A 1TNDA 5TY0A 2WKRA 3DKVA 1NJFA 2B8WA 1JPNA 5KTYA 1FMJA 4IOLA 2QAGC 3MSXA 1P2SA 1H65A 1RPZA 2VHTA 3F0TA 2W2VA 5ELXA 2NZ8A 2GKSA 5AJVB 2VF7A 3WMFA 3UK6A 1XBTA 3QNUA 1F5NA 3IO5A 1IOZA 2R6AA 4OK3A 1R6BX 4UQOA 1DO2A 4IDHA 4HAUA 4PSKA 2CNWA 2OAQ1 4QRHA 3FPAA 3X1XA 1ZRHA 5KDDA 2HJGA 2P2LA 3NH6A 3ZZ0A 1CU1A 1GNQA 2XGJA 1OW3B 2ORWA 1T3LA 1TU3A 1CR2A 3BH0A 1P72A 2IS2A 4V0NA 3GLFB 2ZRMA 5CJ2A 2GK7A 1E32A 1OFHA 4PSAA 1FL9A 4TMKA 4JMPA 1OKKD 3QVVA 4QBFA 4JYCA 3VX3A 5EP2A 3WP0A 1YVDA 2DCUA 1SZPA 1EG7A 1C9KA 4JLMA 4E03A 4ZKEA 3QENA 4GP6A 1UPTA 3LD9A 2QQEA 4BFUA 2WJGA 2R6GA 1FW6A 2YVUA 4LSGA 2YWHA 4JL6A 1AS2A 1FTSA 2ZIAA 3DEFA 4JLKA 5FOXA 2HF9A 4EUNA 4QJ4A 1H8HD 4TLEA 3BFVA 5FPTA 3TKLA 1U94A 3LFUA 3L0SA 4FCWA 1MO4A 3E1SA 4HZUA 1F6BA 4X8OA 1W36B 5KSYA 1OIWA 4TYWA 821PA 4E5UA 2WJIA 3ZIAA 3SOPA 4ZV4A 1OXSC 1G7CA 2YWEA 2ZE8A 3PR1A 3I62A 3K0CA 2WSSA 3EZFA 1NF3A 5LB2A 2ORIA 2ZJYA 2PLRA 2J3EA 2CHGA 2VP0A 1W2HA 2A5GA 3IKJA 4IVPA 4RSGA 3Q8XB 1OHHA 1G19A 2W2TA 2IXEA 3T15A 4JKYA 1EX6A 4CT5A 2O0JA 2VHJA 2Q6TA 3OZXA 3IIKA 3TQFA 3K70C 2FF7A 1ZD9A 4YXWA 4OHZA 2EFGA 2QMHA 3GJ0A 2ZRNA 2I1VB 2QPTA 2VTKA 3EWSA 4JBXA 4KAXA 4Q9KA 2IHBA 3ASYA 3BIFA 3PUXA 4DHEA 1C4OA 3H4MA 1E9AA 2IYLD 4AY2A 1GL9B 1F60A 1N6IA 1X1SA 2A9KA 5J4HA 1X6VA 3L8ZA 3SHFA 3AVVA 1J2JA 2YZ2A 2PLFA 4FIDA 4Y0AA 1TUIA 1XXHE 4A0HA 2GVDC 1XJQA 1SXJB 4N0DA 4E22A 6Q21A 1OB2A 2CCJA 2ZRCA 4QHTA 2GDJA 3QEOA 4NYIR 3S1AB 4AKHA 2ZJ5A 1EGAA 3CNOA 3ADKA 4D26A 2WIAA 2IS6A 3OIVA 4HAYA 4M4SA 3CH5A 4BECA 4TT3A 4HAVA 3C4JA 4ZPXA 3SN6A 3OAAA 4LC0A 4MRVA 4U00A 4OQLA 3EXAA 5FR1A 3VU9B 4LDJA 1VCOA 5SZHB 3PUWA 3A8TA 4BZPA 2CMKA 4Q00A 2QTFA 2IUUA 1HY3A 1P2VA 2B7CA 4Q18A 4ZIRB 2XOKD 2FGKA 1T9HA 3ZQ6A 3K8YA 3PEYA 5L8VA 4XSHA 1E1QA 4D81A 2ZRPA 1DVRA 3TW4A 3ND8A 3LXXA 2J87A 2ZI7A 5CIWA 2NO0A 5FPSA 4HUQB 2C8VA 4A6PA 1QG4A 4WXPA 3PCRB 4PPQA 1DG3A 1MRSA 1KO4A 1SKYE 2XXAB 2W6JD 1XXHA 3LW8A 2DWQA 5B30A 4AKGA 2YC2C 1S1CA 1R5OA 2PZEA 3X1WA 1KMQA 1S2MA 1VCNA 2AKYA 3OFND 1IXSB 4IFEA 4A82A 3X1ZA 1YHNA 1N6KA 3VFDA 4PAOA 2W0MA 2CXXA 2UZ3A 2EFHB 3A4NA 3L82B 4PTLA 2A78A 2ZSDA 5B2ZA 5KNBA 1CJMA 1M2OB 1UDWA 3I73A 3LRPA 4TTPA 3ASZA 1WXQA 3M0EA 3V9PA 1UBEA 3A1SA 4EAQA 2BWJA 2WJYA 4LHYA 4ZI2A 3SQWA 2CL7X 1A5TA 2E9SA 3KUCA 3TR5A 1DAIA 1E69A 1ODFA 2OFWA 2X8AA 4A1FA 3VR6A 3RC8A 2FFBA 1ZUIA 4ZDWA 1KK3A 1ZYUA 4N0EA 5P21A 2EVWX 2IWRA 1Z08A 2JJ1D 4DLUA 2CCKA 1X3SA 3QBVA 4TLAA 4DKXA 3CPHA 1E2HA 1VKJA 1EX7A 4B71A 4D0NA 4DDWA 3IEVA 2O8CA 4TN1A 1ZNYA 3LX5A 4KVAA 3LA6A 5DYIA 4PR0A 4B2IA 1Z0DA 4CEJA 4BEBA 3FGNA 4H1VA 1DAEA 2BIFA 4LJ7A 4NPHA 2AD5A 1CP2A 1KK0A 1YR9A 2BMDA 2V7QD 3DMDA 4DLYA 1KDPA 2Q3HA 3FE2A 1J7KA 3HU2A 2PEYA 3AKEA 4Q7JB 4TMTA 1SVKA 5CIQA 5L3QA 4B3GA 3AF4A 1Z0IA 2PCJA 4NMMA 1K5DA 1X8LA 2GEUA 2O8BA 1IBRA 4IOJA 4O25A 3A4LA 4L15A 1TTTA 2TMKA 1HT1E 2G3YA 3B1WA 3DMNA 1KJZA 1U99A 2IF0A 1E94E 1NKSA 3HPRA 2YWGA 4YC7A 4ESHA 3W34A 1KSHA 4MKGA 1US8B 1VCIA 5JS8A 1N6HA 2AWOA 4KVGA 4DDVA 3KQNA 1E0SA 2D74A 3LWNA 2EW1A 1E0KA 2ODEA 4JBWA 5JHGB 3KL4A 1KNQA 2VBCA 5AJZA 4A8JB 2Q21A 2W2XA 3TQCA 5JWHA 1X8JA 1CBUA 4LJYA 3UIEA 2NO6A 1W0KD 2QP9X 2RGNA 2L0XA 2W58A 1P6XA 1FTNA 2EFDB 2OESA 1D2MA 5LB4A 3NWJA 2IF2A 4ASUA 2GCOB 2ZSEA 3SFZA 3EW9A 1T91A 1ZBDA 2WWXA 4LV6A 3I5YA 3GP8A 4A0RA 4DSTA 3AKYA 4FMDB 2WJHA 4DB4A 2FSFA 2IS1A 5L3SB 4TYPA 3P4YA 5EE1A 4TL9A 3JZAA 4ACBA 5CB6A 2WZQA 3B13B 2NGRA 5DHAA 3AVYA 3QBTA 2NO9A 4EPVA 3B1XA 4TLBA 4URVR 5FUWA 2GF9A 2F43A 2B21A 3KXIA 3HU3A 1GRRA 2EWVA 4BLTA 3AVWA 5GVSA 4P3YA 1G5TA 3RWOA 3K1JA 1CR1A 2QG6A 2WMOB 1LW7A 4G3XA 1N6PA 2ODNA 3T06B 1XD2A 4CEHA 3CWZA 3NBFA 2PZFA 3VNVA 1KYIA 1E2MA 4NTZA 3Q5EA 2H5EA 4PO1A 5DISB 3DOEA 4LPKA 3RVBA 4B44A 3EC2A 5EJEA 2NZJA 1XEWY 4Q4LA 4CEIA 3AVUA 2ZJZA 1UBCA 2JJ2A 3IO3A 1OV4A 1W47A 3B1YA 1M1YE 1PJRA 1AA9A 2A3RA 4EKDA 2F3RA 1G1MA 2D7CA 1TQ4A 3QSYA 2JLVA 3EASA 3Q3JB 4DWJA 3V00A 5CYOA 1G18A 4Z1MA 5IT5A 3MGCA 1G3IA 3Q72A 1WRBA 3VR3A 3ETLA 1FX0B 4KJZA 4F92B 1RYFA 3EPJA 1MOZA 5JECA 1S4QA 1UKEA 4P4UA 2VSFA 4M22A 2OLKA 1UADA 2AFHE 2MSCB 2GHIA 5JJKA 4JS0A 1XNJA 4G01B 3MLEA 1M7HA 3L2OB 2ZREA 4V0KA 1I2DA 5C4GB 1YZUA 1QHYA 1U0JA 2ANBA 1U8ZA 2FU5C 2AD1A 5G41A 4EPWA 4ITRC 2H1LA 4AYTA 1II8A 3AUXA 4DEXA 2J0VA 2Q0HA 1OH5A 3ZLJA 3RRMA 1IAQA 4Q7MB 2CK3A 4TQ9A 2RCNA 4BGDA 3BRWD 4BFSA 3ICEA 3I32A 3D8BA 5E95A 3WNCA 5FBLB 1E9DA 2WIBA 1II9A 2BMFA 2DY1A 2B92A 3GLFA 2ZU0C 5IRCD 4QM7A 3WYAA 4JVMA 3C5CA 2OHFA 1JQLB 2WPDA 3HYRA 1ZMXA 4HZUB 3EG5A 1DAGA 1N5LA 2ZRHA 3L0OA 4QXAA 4UJ5A 3U61B 2OBNA 4F91B 2YJTD 4B2PA 5BN3A 3ZS8A 1E2GA 1RRGA 3VR5A 3DKPA 1QZXA 4FMDF 4GOKA 1N6LA 1N6RA 4F38A 2ZRDA 1G291 5G3YA 2BBSA 4EPTA 5FBQB 1MABB 2QNRA 3KQUA 3TSZA 1KK1A 4D4LA 1HURA 5DLQC 1G21E 1CR4A 1EFRA 2NO1A 1FUKA 2C9OA 4BFXA 1SXJE 1PLLA 3W6OA 1Z6XA 1NG9A 3I8SA 2J0QA 4KFSA 1RRFA 2OT3B 4PO8A 3SJCA 3L43A 1CRQA 2ZJ2A 1XD8A 1HV8A 1NI3A 4UNRA 2DWOA 1ZW6A 4O3MA 2B6HA 4URWR 1IJFA 3B8HA 2OEPA 3ADCA 1DPFA 1QF9A 1E9SA 3RC3A 2GJ9A 3FMOB 1TF2A 1VMAA 3SYKA 1G7RA 3FWYA 1QHHB 4AYXA 2VP4A 1G3UA 3GQBA 4KV9A 2IYVA 3AF0A 3CRW1 3P26A 4TWZA 4MQBA 1XMVA 5G40A 1XP8A 4HZIA 4MYHA 3JZMA 1E96A 2BJWA 5LD2C 1OT3A 1K6MA 4HEJA 3EWAA 5IDVA 2OG2A 2P5TB 2H7VA 1FNMA 3KZ1E 1OIXA 2IL1A 4W5JA 1OPXA 2R62A 2IYRA 2W0SA 1UKVY 3H1TA 5DH9A 5K8TA 1XTQA 1G8FA 2REXB 2GAOA 4E07A 2ZJBA 4JIMA 2XTNA 4Q9IA 4LZZA 3W6NA 4OJKA 2JATA 2O52A 4NBSA 3AVPA 1GTVA 1SXJA 3IQWA 3NIBA 3PUZA 2C9YA 3TSOA 5C46F 1CJKC 1D2EA 4II7A 1HUQA 3NBYC 2WOOA 1T8TA 2C04A 4Q1BA 2YYZA 5GJCA 4YMUA 4LRWA 1IN7A 2ZITA 4J0QA 1KI3A 3KQLA 3CRVA 3E5HA 2Q3MA 4C0LA 5FR2A 1MO6A 4DIEA 1KI4A 3BH6A 2JIZD 4Z8YA 2CVHA 3GJ4A 3VU9A 1S3GA 3TBKA 2VYFA 1AKYA 1RJ9B 4DSOA 5BN5A 1R8QA 4Q4HA 4S35A 2B8TA 2ZANA 2IX3A 3SR0A 4TYNA 3UANA 4CF7A 3LLMA 3FKSD 4KYIB 3ZS9A 4JBYA 1X8KA 1LS6A 1U9IC 2GJAA 4MDFA 3GEEA 3KJEA 4DC9A 5IK2A 1NY6A 1XF9A 1SVMA 4WZAE 5F9FA 4A6XA 2A5DA 4G5RA 1KJWA 1COWA 1Z2AA 4QJ5A 4H1UA 3PEUA 5HZHA 2ZRGA 4V02A 5CM9C 2CVFA 5DGXA 3A4MA 2ZAMA 1QHGA 2D4HA 1T0JB 2OCBA 3FTQA 2VP9A 4UXHA 4QNRA 1HH4A 2O8CB 1IY2A 2GWHA 2WTUA 2VA8A 2EFEB 4UNSA 3MWJA 3OEED 2AWNA 1E2DA 1W48A 3JVUA 3A6PC 2IYQA 2VPPA 3W5JA 4CEJB 3Q85A 4LI0A 1W36C 2IEYA 1YKSA 2DYKA 1SKYB 1R0ZA 2IEZA 3MJRA 4YMTA 2FEOA 1NN3A 3FVQA 2XNDD 4HUTA 5L3QB 4I1UA 1E1RA 1E2NA 1KOFA 1XTSA 3IILA 4I81A 2VO1A 2Z43A 4AWXA 3U7FB 3MJHA 1DE0A 1R0YA 3RNLA 5JZVA 4QGHA 2D7DA 1XDBA 3B85A 3IEUA 2QAGA 4BFZA 3OIYA 4OI2A 5GJVC 1Q57A 3QVUA 4JVLA 4PPGA 1E2EA 4CDGA 3AF3A 3I72A 1LB1B 3U4QA 4P4SA 3AQ4A 2BM0A 2J5XA 2I1QA 2PT7A 2R2AA 1VG8A 2QBYA 2X77A 4C4PA 1EWRA 3FKQA 2OZEA 4Q7KA 1NRJB 1TAGA 3R9WA 4M9XA 3VMFA 1GWNA 4KITB 1I4TD 1M7GA 1GSIA 3WHLA 3T1OA 2OLJA 1JPJA 1HQCA 1UBFA 3D3QA 2BDTA 1HTWA 2LWIA 3EZ2A 5HE8A 5AUOB 4YXWD 4TLCA 2QTHA 3FDIA 1ZIPA 2F1IA 1WB9A 2JLQA 2WMNB 1E9CA 4Q4JA 3E70C 4GOJA 2V6IA 4P31A 1DAKA 1Z6YA 3AVTA 4LJAA 3B5JA 3ZZUA 4A8JA 4ABYA 5HCNA 2MMCA 3DPUA 2GRJA 4BZXA 1Q20A 2Z4RA 4M1KA 4F4JA 1TEXA 1ZM2A 5HE9A 4IRUB 5DE3A 1U0LA 4FW9A 4IVQA 1QHIA 3QPVA 1FFHA 2UVQA 1L8QA 1VYTA 2ZQ5A 4B74A 2ZR0A 1DAMA 2GCOA 2ZE5A 3IGFA 4EPRA 3THWA 1D9XA 1NBME 3H2YA 4A4DA 2ZRJA 4NHOA 4OHXA 5LDDC 2BM1A 5B64A 1R7RA 4ZKDA 4TT3D 4DVGA 2VL7A 3WRXC 5EUMA 4XTRA 1XD2B 3BFXA 1S9DA 3OHMA 3W90A 1GILA 4MDEA 4CEHB 1M8PA 1NLYA 4YMSA 1SVWA 3U3KA 1KI9A 1HYQA 3U3MA 2CLSA 5CITA 5HZKA 3KJGA 4AIIA 1V43A 4D4KA 4KCGA 3EARA 1NN1A 1E79A 2SHKA 2GEVA 2C98A 1TF5A 1YZQA 5FPHA 4Q01A 3RS2A 1OH6A 2MMGA 4KBGA 3RS4A 1XRJA 4M2LA 4MYTA 4PSVA 4X8MA 3NTUA 4WBSA 4NU0A 5FL7D 4R2HA 2FV8A 5H68A 3ONWA 3KB1A 2EQBA 1WE2A 1EWQA 2AKAB 3LQRA 5JHHB 4MGIR 1Y3AA 2Q9AA 3D7MA 4LV5B 2QMEA 1ZC3A 4D0GA 2GNOA 1U81A 1XJCA 2GESA 3QKSA 4TSFD 3T1VA 1ZNWA 1RVDA 5FUXA 4BFWA 3TUZC 1Z6TA 4D4MA 2F1HA 3MCAA 3AF1A 1NBMA 1E2FA 2QE7A 1XEFA 4M53A 3GLIE 3GFTA 4JT4A 2AHOA 2VIIA 4G0NA 4HI0E 1PVOA 4TMWA 4I1VA 5JI2E 4RFSB 3RDPA 1II8B 3MRSA 2E1RA 3VR2A 1DADA 1FX0A 4EPYA 2WWIA 3M4YA 2N46A 2BVNA 5D3QA 1AIPA 2WICA 4U7DA 2HXYA 3GJ5A 1KI8A 3A1UA 4ZCIA 1JJ7A 1G8PA 3BORA 2P6RA 1XFAA 1U8AA 2P6NA 2G77B 1CKEA 4TTRA 1PLKA 2V55B 4YONB 3FOZA 2WOJA 5FUYA 1QHXA 3CO5A 4LOAA 1LVGA 2CCGA 3ZD6A 2PMDA 2YHSA 3GJ8A 1CJTC 2Z5FA 4OI0A 4B3DA 4LYFA 3U44A 2R65A 5JWOA 1LNZA 3NG1A 4PHFA 2V1UA 3Q7QA 3A1WA 2JDIA 3EZ6A 3GLIA 1Q3TA 3NDPA 1GITA 2QT0A 4Y0VA 2C78A 2AN9A 5KSPA 3TR0A 4M1WA 4MGZR 1AQUA 2IS4A 1DO0A 4MYUA 3R8CA 5CDFE 4RD1A 5KNCA 3OE7A 1I4LD 1G9XA 3C41J 4DCUA 2HCJB 3BOSA 4FXPA 3SI7A 2E87A 2HT1A 2XX3A 1O87A 4WW0A 4DCNA 5FPYA 4RD0A 3LNCA 1MABA 4C0JA 2XAUA 1MH1A 1N5JA 4RCYA 2ATXA 4BWYA 1A4RA 1Z0AA 3KKPA 4DSNA 3G82C 4ZDKA 4S2EA 2GEDA 2YOHA 1Q3HA 4W5WA 2J7PD 3THYB 1OFTA 2HT6A 4HLUA 2XB4A 1GP2A 1Q44A 5TVKA 5KU1A 1ZINA 4QGGA 5FBRB 1IJEA 1U8YA 2A7QA 4FCTA 3ZVLA 2H92A 4ILEA 1M74A 1KY3A 1XTKA 2QENA 5EZ6B 3T61A 4PC2A 4IEEA 2UKDA 1RKBA 4LV8B 3WBKA 1XEWX 1G17A 3VKHA 1KDRA 1MO3A 4Q21A 1CS4C 1QHHA 2XZPA 4LK2A 3EZ7A 5H1YA 1W4AA 4GOXA 4Q47A 4WVFA 5JEDA 5GVRA 1ANKA 5CDFA 3CF2A 2G88A 1W5TA 3CPEA 2C2HA 1E3MA 5BXQC 2GBLC 2HLDA 2CDNA 2WKQA 5K8LA 4GMDA 3U6KA 3K53A 3PVSA 1G20E 3AP2A 3BXZA 1XPOA 2YWFA 3ADDA 1HE1C 2ZTSA 2ZVPX 1W5SA 2RGBA 1NN5A 3B9PA 3RS3A 3U7EB 4Q19A 5J5CA 4DRZA 3SHWA 5A4JA 3NBXX 4Q4HB 2R6FA 3QE0A 3MG9A 1DEKA 3P20A 1Z5ZA 1JI0A 2XJ9A 3ZQJA 1NLFA 1GKIA 3TE6A 1EFHA 2NPFA 4JVSB 2NO7A 1JAHA 2GXUA 3QXSA 3QKUA 1AGPA 4YMWA 4DB2A 3GLHE 2YV5A 3KQHA 3T5GA 3GPLA 3BB1A 4FCVA 5IHPA 2FFHA 1T5IA 1W1WA 1XJ0A 3O8DA 1E6CA 1RJ9A 4KI0A 1QHNA 4N3NA 5GJWC 3KXLA 2ZS9A 1AS0A 2YOFA 2IYWA 1UEIA 2HYDA 3DO6A 2FDCA 4GDFA 2W83A 2JGNA 1O3YA 4HATA 5FOUA 4C0QC 1W4RA 1E2JA 1G7SA 4UXIA 3NH9A 1W0JA 1DBSA 4W9MC 2G1KA 4FWIB 1NY5A 4IEIA 4P32A 5FTLA 1E0JA 3OEHA 4DLRA 2D62A 4NKRA 3MWKA 3RS0A 2ZYTX 4I1OA 2RGCA 4DBLC 2J45A 1R10A 1E2KA 4QBGB 4XWOA 4ZCMA 4IOMA 1KDTA 2Q3FA 4C0HA 4NZYA 2CLDX 4B6EA 3KKMA 4AYWA 5JJIA 3WNBA 2Y8EA 2DR3A 3B6EA 3BK7A 3K0CC 1VIAA 2RGAA 2OSBA 4NCNA 3GFPA 3GLHA 2ZRAA 2HYIC 3B78A 1UM8A 5EE3A 3K0SA 1Q1QA 1XPUA 3FMIA 1GKYA 1VG1A 2QAGB 1ZU5A 2DFNA 3AVQA 5HR5A 1Z29A 2VHQA 2ZSBA 4Q1FA 4HDCA 4B3BA 421PA 3B7GA 2CL0X 1NN0A 3I3SR 4URUR 2O8FA 4HAXA 2FSHA 3U4QB 4P4SB 2H8KA 2RGGA 3TVDA 4E09A 2QBYB 1KTVA 4I1SA 1YR7A 5G53C 4G1UC 3QG5A 4B2LA 1BH2A 3CX6A 4K81B 4M0LA 1Z6AA 4AC9A 4B47A 1OKKA 1R5NA 1NVWQ 1XMIA 3E2IA 1W36D 4A0GA 4PHHA 2W6ID 1HA3A 1PV4A 2ERXA 1AGRA 1CJUC 2ZI3A 5KPJA 1RIFA 1OE0A 2XZLA 1VECA 3X1DA 5AJXA 4POAA 4Q4JB 2IXGA 1JR3D 4WA7A 1WA5A 2PL3A 3PUVA 4G5QA 3CZPA 5EXXA 3VQTA 4LHZA 1T8UA 4LBZA 1KI2A 4DEYA 5FTMA 2ZROA 4QHSA 4LX0A 2HDNB 2IW3A 2JLRA 3B82A 1E2LA 3GJ3A 4JJZA 4NYJQ 2JA1A 1G3QA 3EAQA 5JRJA 3A36A 4ZI3A 4B3FX 1AK2A 5JLJA 3RRYA 1DAHA 3DDCA 1U90A 4RCZA 3SBDA 4B35A 5JCZA 5KSOA 2ZRIA 3KTAA 2AR7A 1M7BA 4PZYA 3K0FB 4NE2A 3VR1A 3THWB 3ZGXA 2GCPA 3CR7A 4YMVA 4OJQA 4XD7D 2OV2A 1F3OA 2CE7A 2XNSA 3LVRE 4JZKA 3QOFA 4OQNA 4CIDA 1RFLA 4UXJA 3PFIA 2IC5A 1AQYA 1D8TA 3CONA 4KO8A 1YZTA 1GL6A 2GZAA 2XSZD 5AUQA 4B34A 2BEJA 3HP1A 1KAOA 1S9HA 4RVCA 3SS8A 4A92A 1N6NA 4TYQA 2ZU6A 2FE4A 1KNXA 4URZR 1ETUA 1W49A 2FMXA 3D31A 4TLDA 3EA0A 3CF0A 1SVOA 3ZYCA 2CL6X 1Z6GA 1BYUA 3QJYA 3VAAA 1OH8A 1AKEA 1GAJA 4XVQA 4PXAA 2PZGA 3DM5A 3WMGA 3NHBA 5SZJA 3NDBB 3HWSA 2XZOA 1Q12A 4GSYA 2C99A 4FMBB 2EFCB 2JASA 2KWIA 2PH1A 2GCNA 3K70B 4LBYA 3NHAA 4GP7A 4TMZA 2LKDA 2AFIE 2GZDA 4A2QA 1XCGB 3RS5A 4JLOA 3QKSB 2WVJA 3K09A 4V0ME 5F98A 3AKDA 5FFMA 4JL8A 4AD8A 3UG6A 1YQTA 4Q48A 3FHTA 4GRAA 1NMXA 1L4YA 4NYMQ 5DO9A 3H86A 4JSYA 1KSJA 2H16A 2GK6A 5JSZB 3PV0A 5KNDA 2D2EA 2QU8A 5DI9A 4BLRA 3R8FA 4C2UA 2FSGA 2ONJA 1TF7A 3NC0C 1XWIA 3O8BA 1A1VA 2P65A 1P61B 2XTZA 3LW7A 5HKKA 2WSMA 4KLNA 2Q9BA 4KODA 1E4YA 5TV2A 1GVNB 2KB0A 4UKDA 3A1TA 4PPNA 4LY6A 1QVRA 3RHFA 1GKUB 4HB2A 2F7SA 1QDEA 4RY2A 3MWYW 4NCJA 4PQRA 4RFSA 5E7MA 1JJVA 4G5SA 1FPMA
chains in the Genus database with same CATH superfamily
2VDWA 2QZ4A 1L5LA 1M6VB 2XE6A 4PBTA 1JFSA 3SC3A 3FYDA 4D96A 2C7VA 2QTLA 1DT5A 2I3GA 5KQMA 4DG5A 4RHXA 1PG0A 2PUJA 4XIGS 1H4TA 3QTBA 1DIAA 3QNWA 3DD5A 3GMDA 4KTTE 4V0MA 3OF5A 3GG9A 2ZIVB 3EDRA 1PYGA 1W44A 4DLVA 1M83A 2C4WA 4ME6A 1C29B 1OWMA 2I62A 2EDCA 4ZARA 3RT9A 2BDEA 3K9NA 1TTQB 1A8PA 1GAXA 3JS5A 1ISMA 5C7IO 2Q3CA 1SVUA 5E0KB 4KXXA 4N1AA 3HR7A 1IMOA 3BL6A 3MBKA 2IPLA 5KSZA 2E2WA 1O2DA 1AM4D 3ENNA 4G8CA 2OC4A 3ZWMA 1P2FA 2OUKA 2RGNC 3INRA 4TVOA 1PSDA 2X2PA 4IFIA 4KZKA 3ZGNA 5ADUS 2WZCA 2JVKA 2QQGA 3QEJA 3ZIUA 1ULBA 4OV6B 3KR0A 3AGPA 2KJQA 3ND7A 4JJFA 4U2EA 4HDOB 1L5NA 5DM60 4BFCA 4AJOA 5CBPB 1HQYE 2R1VA 1JSLA 1YDMA 3AR4A 3EQ6A 4P9NA 3AEZA 4QXMA 5FTNA 3C87A 1XEAA 4DLNA 1JVBA 1SKQA 1TYEB 4RPCA 3AYXB 3CSSA 4BNVA 5J4LA 1IWBB 4MKFA 3NHWA 4AJPA 4DWOA 1BXZA 1GM5A 3FUWA 2GYVA 2V7QA 4MIOA 3H3XA 3KVOA 5F77A 3TNFA 2Z5GA 3OOSA 1ZXBA 5L95A 3VSAA 3WLFA 2Q49A 2VYND 3D7NA 4S24A 2O2JA 3M7IA 4ZCRA 1JEOA 3QXHA 4D44A 3LTNC 3CM0A 4X85A 2FZLA 2OZVA 3TG2A 3FCEA 1GUAA 4D42A 4C4ZA 2H5IA 3HZHA 3MWGA 2Y67A 4LUCA 3E9MA 4FYMA 2GFHA 4IX1A 3FFAA 5JIBA 3JQRA 1KC1A 3EZXA 3TZKA 1GNPA 2BGKA 4MVCA 5DTQA 1O0BA 1YJ8A 3IODA 2WZBA 3DE0X 1KH3A 4WNAB 4ZDJA 2OGWA 2XZDA 3WQRA 4BN4A 1ZI8A 3R9IA 1UKYA 1KE1A 1F2DA 1W94A 2E6KA 2QX4A 3F8TA 3PQCA 5P8WA 4LRTB 3NJ4A 1LDGA 3QYPA 1K3UB 2QQ0A 3GR6A 1EE2A 1TMKA 2H57A 2Q4EA 2XEXA 3H0KA 5F51A 5DMHA 3UT6A 1FPQA 1BOFA 2P3QA 1BKDR 4HPJB 2B61A 4FNGA 1K8ZB 4RF3A 2GSDA 2P90A 1L4BA 3IUPA 1JG6A 4JVNA 3SSOA 3U3XA 1I4OA 2PBZA 3B1KA 1ZGBA 2F1JA 4ODIA 2O2ZA 3USZA 1GPLA 3WGYA 4MARA 2HGZA 5GGYA 3VO9A 2L82A 3N2NA 3B1FA 3N8NA 2R6HA 2NPIA 4GXRA 4RVHA 4YJHA 4BMXA 3PIDA 1MR3F 1PO7A 2D2VA 3K6SA 4JI1B 1KEEB 1U7ZA 3IUQA 3N7TA 3OJ0A 1CUFA 4D6XA 4X64B 1FOEB 2PT6A 3D7SA 4PVCA 1MX1A 2G76A 1K5PA 2NOAA 4JQZA 3NZEA 4KYUA 5KPDA 1KF0A 1OBOA 1ZH6A 2XUAA 3L07A 3C3BA 4EJSA 2AX3A 2HO4A 2YJ6A 4LQCA 3MZ0A 1VHQA 2PK3A 3CRRA 3KAKA 1WZNA 4E2FA 5F7XA 4G5XA 3ZQKA 2OO3A 4BX9A 2V7PA 2A58A 2A5FA 3CKMA 3F7NA 4JJ4A 1XVIA 4QUIA 2ASEA 1F9EA 4QTYA 1PQYA 1M0WA 4GBGA 3VC1A 3F5QA 5A6VA 1RBMA 4CMKA 1CS0A 4MAFA 4O6VA 3A28A 4RMJA 3TINA 4B6FA 3PUYA 1GVHA 4PIMA 2YY7A 4LWPA 1L7VC 1XA0A 1ZHFA 4X95A 2ZI9A 1G20B 3AFMA 3V8MA 3DE5X 3ZVRA 1PX2A 3FHJA 1CVRA 1NJ5A 2D2XA 2OWDA 2H1SA 4PG4A 3IRVA 1SUDA 5JZOA 2X14A 5GTDA 5TC4A 3WGTA 3ES9A 1M5RA 2CBZA 3G17A 2R68A 5H0IA 1GG5A 4O4LA 5AIAA 2M6LA 1WABA 2UUBB 3Q3HA 2ZJFA 4NVRA 1T6YA 3RVJA 3RYCA 2QT1A 1U3UA 4W82A 1YDHA 2XNCA 2W42A 4JEIA 4J7AA 4JJEA 1T3HA 2XDAA 1TXGA 1Z39A 1O77A 3VKGA 3HJUA 3B3QA 1XDDA 1XLVA 1FBNA 1U4OA 1VXOA 3N70A 3QTTA 1V2GA 3K5WA 4G1FA 1J39A 2VJBA 4FGUA 2OG1A 4QPJC 1QYXA 5I51A 2WIJA 1UF9A 5FQNA 1QZ3A 3QW4B 4GE0A 4IIXA 3CX8A 2REBA 4R2JA 4PE5B 4PIVA 2O8FB 3D81A 4QGBA 5JNRA 1DGQA 3K15A 1YE8A 1Z2NX 2WAOA 1C7EA 5AMXA 1E9BA 3D4OA 4BYMA 1G8MA 2IKSA 4Z0HO 2Z4SA 1TC2A 3EWIA 3I9NA 3VO8A 3R6DA 2CL5A 4U9IS 2OILA 4FGKA 3WQBA 4AJEA 1CRPA 1TADA 1F48A 4AW9A 1XEXA 4QVIA 5TMDA 1Q92A 1G6OA 1OF1A 1KC3A 3A37A 3VC7A 5KCMA 3M6VA 4GR9A 1D5CA 2CZCA 1N1EA 1HFKA 5KO2A 3W1EA 1PRYA 1G4UR 1U2SA 1X94A 2VQ6A 3H5AA 2GZ3A 3INYA 4G0OA 5J47A 1DINA 1X80B 4IHJF 3ZWXA 1I51A 2BC9A 4RHFA 4F93B 1DXQA 1NC3A 4F7WA 4LA4A 4Q3BA 5ICMA 1VPDA 3BRWA 1DOZA 3OCJA 4L5YA 1XCOA 1D0VA 1JTFA 2E4UA 2WSSD 4Z9AA 3EVAA 3RKUA 1SKAA 1QHFA 3SBEA 5DM4A 3UAOA 2AXNA 4Z51A 3RC9A 5L3VA 3EOZA 2H51A 5FA6A 1SM4A 5K09A 1EVKA 2EARA 4EGAA 3FJ1A 3Q6IA 4HH4A 3TLXA 4RQBA 1LC3A 2R8BA 1GYRA 2BTQB 1HZZA 2G07A 3LAWA 2GZRA 2CE2X 4GGMX 1QZZA 3DZ8A 2FX3A 2PGOA 3AF2A 3N0RA 3WV5A 4C4TA 5K0ZA 1CUWA 1PR6A 4DG9A 1SXJC 3AZQA 3EUFA 1HOXA 1Z4QA 5SZKB 2J09A 4JQSA 2B7LA 4G6ZA 2PTHA 3QG1A 4G5OA 5JH7F 2FFQA 3SVZA 3TIVA 2WNSA 2XCLA 4HNQA 1AQLA 2ID4A 3AV0B 4TL6A 3NEYA 4K6FA 1GV0A 5CFMA 2EL7A 3LYUA 1N34B 1FNSA 1MEEA 3LDHA 3KYCA 3D3EA 2E4AA 2JLWA 4YV7A 2C00A 2RK3A 1XE3A 1IE3A 3VYWA 3VYVA 2VHUA 4ZHSA 1MAVA 3TUIC 1JJBA 2HMSA 3R5TA 3VYTB 1DRKA 4UARA 2Z98A 5EAIA 2UVPB 2OFFA 1UFVA 1EWTA 3O4FA 4M9UA 2PUVA 4LWZA 3FTNA 2WP0A 1NBAA 2V4ZA 1IN6A 3CEPB 1RADA 5BR7A 3MTBA 1PJAA 1KAMA 4IDAA 1HFEL 3D3WA 3H4IA 5KCZA 1QRTA 1YA8A 2QRZA 1VI6A 2CMHA 2EYQA 4QOIA 2HREA 2Q99A 1VTKA 4MRNA 2QR3A 1AY0A 2FLKA 3MB5A 3QUTA 4P33A 4KE6A 4BLSA 3DMHA 3BCHA 1ISGA 2A2ZA 3DAFA 1GYPA 1Z0SA 4KMSA 2A33A 3B3AA 3W78A 3LBNA 3JWHA 4A5OA 1DFIA 5EXSA 5THKA 4WV3A 3QF7A 1M2VA 4BVLA 3Q40A 4H16A 5FOQA 5M04A 1EFDN 3HFRA 3UJCA 2XE4A 4B7CA 2AQIA 3GFGA 5CK4A 5CLFA 2CXSA 3VH1A 1CIPA 3GZTB 2R44A 1OREA 2XRMA 4X93A 3PJRA 1UZMA 1X2BA 1PJLA 3FJOA 2BF4A 3TBFA 4RTKA 1YJCA 2GFIA 2PO5A 4OJYA 4KQHA 1SHUX 4C0WA 2WHPA 2PXAA 4C87A 4HVCA 4MGYR 5KHOC 4KXFB 3GVPA 4W5QA 4AG5A 4V24A 4ZI5A 5K0GA 1BIFA 2B8JA 4IGEA 2YRFA 1L5HB 4D9KA 4OUKX 1P5ZB 2AX4A 2SKCA 3HYLA 1B73A 4JB8A 3RM3A 5FOWA 2HCRA 5I7HA 4MW1A 3RVKA 2EWWA 1NVKA 3BJMA 2WF6A 3D7LA 5JT1A 2NYRA 3WSVA 3BT7A 3RIXA 1XN4A 3WMXA 5A5VA 3GD7A 5KWSA 1YZLA 4EGQA 5HFAA 5J1SB 3DOJA 1XNGA 1RWQA 2DJ5A 5IBPA 5A3RA 3MN1A 1Z15A 2KI5A 3HY3A 1R37A 1MO5A 1R0WA 1JEQA 4YWHA 2JIZA 2OQ2A 3T5DA 1MVOA 2OKGA 3RFTA 4C6SA 4IDQA 2XIQA 2J3KA 4I9FA 1J99A 2NV0A 3R40A 4N0PA 3H2SA 3VR6D 1FVHA 3ZH9B 4CI9A 1FXWF 2IHZA 4K26A 1LFDB 4KWEA 4EMSA 1SHLA 4ZU3A 1XRQA 2RH5A 3DOCA 3ZTYA 4OOEA 3V97A 4JR2A 1UXJA 2WZDA 3UAYA 1V11B 1P2TA 2FSSA 4DIFA 4EFDA 4DBLE 2YRWA 5E3HA 2BFDA 2HMYB 4MRRA 2IXAA 4QBKA 4OL0A 4U2BA 3NKVA 3ZU5A 4F3KA 2DR2A 1AXGA 2X1MA 4MV6A 3U6BA 1I6WA 3WNDA 4IH9A 1UKBA 4KFTA 1ZD8A 3AERB 4QWWA 3HB0A 4UCFA 1EDOA 2Z4TA 4MEAA 3RGGA 1TYBE 1KZGB 3A58B 4MKHA 4DQDA 2EW2A 2O3RA 4RMHA 3L05A 1PDVA 4YHHB 1ENOA 1I13A 1K8RA 4GT1A 4PWYA 3TD6A 1L7AA 1WUKS 4LF4B 4L4RA 4XPIB 4F4HA 1E9VA 3SMQA 1CJCA 2A1TS 1Y5LA 3G0GA 3GPDG 2HRRA 4R69A 5I47A 1YUMA 5CVUA 2EWMA 2ZG6A 1PP4A 4DJ5X 4EF4A 1UJNA 1ZOOA 4XJTA 2JLYA 1ZMOA 1ZN8A 4A8JC 4EF6A 2CEAA 3CJQA 2LNDA 2VHEA 3LFTA 4E30A 2YBDA 1WNTA 4YLYA 4XKJA 1JT9A 2B20A 4KQWA 4WK4B 4OU5A 3OPNA 5H02A 4GOMD 5EXEA 3RBXA 2FUNB 4GMXA 4ERNA 3M82A 4F60A 4ZQHA 1WBBA 1WTCA 2CJWB 2TMYA 1J70A 3RLFA 1AKWA 3ZU4A 1BWRA 1H93A 2PY6A 1J0CA 4MI1A 3C3KA 4MKXA 3MYRA 4LDZA 3TPZA 1TLFA 3UC9A 1JS1X 3LPAA 4EP1A 3DWIA 1NZJA 3I9OA 1RQPA 3KQVA 5FOTA 4Q1EA 1ECJA 2BCGY 2RHDA 1RYHA 2Y1GA 2OE2A 4MLCA 2FJPA 1LDMA 3WMRA 3UGJA 4CM8A 4D8TA 1JLLB 2G9NA 1XL0A 4RXTA 3SHQA 1IULA 2QM8A 3FTCA 3C97A 2NUBA 4GI2A 3EMBA 3SJZA 3WK4A 1W87A 3W5HA 1C0PA 1I2MA 4OFZA 5LP6B 1PG5A 4BFLA 4LK3A 4NONA 1YR8A 3HGQA 5FO1A 1YA4A 8ABPA 3IUMA 4ZDIA 2Y0CA 5H80A 1RLUA 1SQ5A 2P75A 1N0UA 1N2HA 1KMHA 1RYZA 3HM2A 1JQAA 3E8MA 4IDGA 4MO2A 4UHKA 3DO8A 4IOKA 5FBZA 4LBVA 3H3FA 4MV0A 3U7RA 3O92A 4QOFA 1RM4A 3HYSA 3T1TA 4J7XA 3V34A 1ESMA 2ISQA 3C3DA 4UNPA 4QA9A 1NTRA 3BXHA 8GPBA 2AI1A 2WD8A 1L9XA 1ZDMA 2CD9A 2W98A 3GGGA 3H17A 3DHWC 2WT9A 3LBIA 4EGJA 1Z7EA 4OO3A 4Y6GB 1KEUA 3I1FA 1JNXX 2WUVA 4OA8A 5JCOA 1SN7A 3CMMA 2ZR9A 3N8GA 5BV0A 1X7WB 3H18A 1V96A 1EK5A 3LUKA 1NDQA 1UBLS 1UWCA 1LQ2A 3HCCA 4E6PA 3IBCA 3AHEA 3MF4A 2HLPA 1XTIA 1TU4A 3EGCA 3KSMA 3OIGA 2CD7A 3CURA 1BFKA 2C84A 4QU0A 5CA0B 1DUIA 5AYVA 3VDQA 3ROZA 1U7DA 1VDZA 4KXUA 1IQ0A 1QANA 3F1LA 4TL8A 4BJ5A 1BVHA 4C6TB 2WNIA 3A25A 4IQ0A 3RCBA 1L4UA 2YXNA 1U1IA 4HTFB 1N7GA 3T7JA 1RC8A 3OJEA 1SG0A 3SYRA 2VSQA 2YHBA 4LJ5A 4R2XA 3OQHA 4RLHA 3GJTA 4I4CA 4R71A 5CD9A 4W1QA 2BGMA 2AZXA 1O94A 2ONYA 4US0R 5K20A 3PYLA 3GLTA 2Q28A 4HAIA 3UBMA 2I67A 4WY2A 2PWZA 3DEAA 2GTPA 3QTLA 1I7LA 4UTRA 2C9CA 2ZTVA 1U2DC 2C9MA 3D3KA 4X3OA 1UBSB 4Y2PA 4PC6A 2I1WA 2I4MA 5D7NA 1W29A 4LGMA 5AM5A 4N7RA 3QVKA 1I3OA 4HY3A 2A3NA 2KBFA 1EU1A 2VEOA 5FL7A 3O94A 2PUHA 2VJAA 4M37A 1XZQA 4R9NA 4MH0R 5B3AA 2C1ZA 4NCXA 2XMRA 4C9BA 3PIRA 4TS1A 5CTJA 2N9UA 3EULA 1ZHHA 1K0UA 1B76A 4TSFA 5EKSA 1E92A 5BSGA 1XZDA 2NNWB 2O3QA 5KAPA 4CKYA 5B2FA 5E6UA 1JFFB 1G8SA 1TL7C 2AZMA 4JK3A 1CQJA 4HT3B 4CQMB 1R8XA 1UT6A 1K7SN 5REQB 3ZWQA 3CINA 1PEYA 4AKEA 2ODWA 3UWPA 4KKVA 2A94A 3IIJA 1GOTA 4GGPA 4IL5A 5JE8A 3G2NA 5HS6A 1A9SA 1IY0A 4KN5A 1SZJG 2VT6A 4HC4A 1YRWA 4PRKA 4RA6A 3FH0A 2J3QA 3AQIA 3N05A 3O3CA 1ZH2A 4UM5A 1YCFA 2CJPA 4X6YA 3ZDRA 3EJWA 5KVQA 3TCKA 3CRMA 5T57A 2B1QA 1QO7A 4ZJPA 3CRQA 4WLVA 3DMTA 1NUUA 4H77A 4TWRA 1C7QA 1JLMA 4Q9HA 1N2CA 3JASB 4QG7A 4LGCA 4AUNA 4B3JA 3JQ7B 3BSWA 1PLJA 4DCCA 3UFBA 3GLGA 2P9ZA 4UZEA 4B43A 3ZK9A 2P9FA 5CPFA 3SQXA 3FZNA 1H9CA 2DKFA 3A2NA 4JKIA 3D8NA 3L4KA 1Y1SA 4WXYB 4QNMA 5HFJA 1QE5A 1SPBS 1YI0A 3C8DA 4RPLA 5AXCA 1H8HA 2A5JA 3DV0A 3OCCA 5E0OA 3OTIA 4XUEA 1QNFA 1Y9ZA 4MQUA 2A0XA 4GKBA 3OEYA 4NFSA 4H0NA 5IKPA 2FK7A 2J8ZA 2C96A 2YC4C 4BAZA 4BLPA 2IPMA 2WI8A 1KERA 1T6NA 4UAVA 3KR2A 1T1EA 2O3TA 3AI2A 4I66A 4IXMA 3TQHA 1PT8A 1U9ZA 5FTKA 4ZVPA 5E9QA 1L5SA 2P3SA 2XLCA 4CN8A 2ZUBA 2WWHA 4RS4A 1N9GB 3HNPA 1QYDA 4ZQBA 1YJ5A 1K4YA 1M1ZA 3P9YA 2OXRA 4FDVA 4WY5A 3LUAA 2WLTA 1VL0A 2R1UA 5ENVA 4YA6A 4OQXA 4BZWA 1IBMB 1D7OA 2ZUCA 4OTZA 4NK4A 4O4LF 2G82A 2IA5A 3WGIA 1PZNA 3ZX4A 5LXTA 2HNBA 1FP6A 4ZXFA 5FKJA 2J59A 3DULA 2IEGA 2Y1FA 2ZBRA 3AEYA 4G86A 4MPRA 1YQEA 3E0XA 1Q16A 2Z3ZA 4OMUA 5F3DA 2WQ6A 4YY3B 2Y99A 2VRNA 4Q7EA 1KKMA 4X6UA 5L4LA 3WKCA 3FRJA 3TAHA 4DLSA 3DWFA 2FF5A 4ZVNA 2J31A 4Y9DA 3ZWCA 1XA3A 1QO0D 2N3ZA 2JIDA 4QFCA 2Q62A 5ALMA 5UKDA 2QMQA 1NR7A 3N7AA 5BWLA 1TQDA 5BMVA 2J0UB 1KI1A 4G0PA 1XMPA 2Z2IA 1W2WB 4HL6A 3RRZA 1I1NA 1HT2E 1CDZA 2WAXA 1KJ8A 1R4AA 1GNSA 2QVLA 3CIOA 1PFYA 5IW8A 1E2QA 2GILA 4JHLA 5K3BA 1ZN9A 2LV8A 3HLYA 4B2YA 2FW7A 4H60A 4N4AA 3ZN2A 3P2IA 3IBSA 5JS6A 1LPAB 2IY7A 1T6XA 2DBRA 2YWDA 3O93A 5AI8A 1S0UA 3JARA 3OQBA 4NBVA 2HWWA 2VYQA 4CUJA 1EI9A 4E12A 3HRIA 4JLBA 2OCIA 3DL0A 5HKBA 3A1NA 5HGJA 5ALUA 5K03A 2XCRB 1QNLA 3SE7A 2WWFA 3ZY3A 2Q7OE 2O1WA 2PS0A 2ZYIA 4KTVE 1CUXA 2FUG6 4WOBA 4XWWA 2BZGA 3WXMA 3R7AA 3WOVA 2Y9MB 1PSWA 4NX2A 3QX7A 5DU2A 4YRKA 3GFFA 2PSFA 1WW8A 2XOKA 4N12A 4LE0A 4ND8A 4BE7B 3V7WA 3IR6A 1TQHA 4HAWA 2IYUA 4N65A 1P45A 2DAPA 4H0CA 1VPWA 4NG5A 3RGWS 3L4BA 3CWQA 4QPCA 5CB4F 4C29A 1V5IA 1L3BA 1E5LA 2Q1SA 5M2QA 3RV3A 5H9WA 4PS0A 3CU5A 3DBRB 4PSCA 4HSEA 3HWWA 3OCYA 1TIPA 4HFRA 2FR1A 3GZNA 3OPQA 1PDWA 2HV8A 4EY5A 1J90A 3QVGA 4RV4A 4FR0A 1ELOA 1O8BA 2XDYA 4LECA 1LNSA 4IV8A 2AHRA 2QMUA 4PFSA 5AI0A 1FVOA 4ER3A 1VB3A 2A57A 4OBXA 1HNWB 4P98A 4AMUA 1E2IA 5ESRA 4J16A 1XNRB 2WQ7A 3CVJA 2WM3A 2O2XA 4BXOB 1OFGA 2A35A 2R66A 1BYIA 1NIPA 1SA0A 3VUFA 3KP1A 4GLFA 5CW1A 1DEHA 4OH7A 4LXXA 1KIMA 4C06A 2EP8A 1GHTA 3TEFA 1LDNA 5CBPA 4FYXA 2P2YA 3OKCA 4A6EA 1CIVA 3FDZA 2ZT7A 4MITA 4QD3A 4KPEC 1WF3A 3QI2A 1IHYA 4Q9NA 2RG7A 2D0PB 2DFVA 1JU4A 3Q11A 5JAHA 4KNVA 1IN1A 2WUGA 2XVMA 2WE7A 2KMLA 1T2AA 3I9FA 1IHUA 3H6GA 5E2IA 3RABA 1L1FA 1RXVA 1JR3E 4CFYA 4D4JA 2YQZA 5HTKA 4O2BA 5HILA 4C3OB 3LH5A 3T12A 2NX2A 5HQ3A 2YYSA 2F90A 2BPOA 3GUHA 1PVDA 1E9RA 2PUAA 4F5ZA 4LDRA 3Q1KA 2HB6A 5K3FB 5K4AA 1BGWA 1XVLA 2OQVA 1DQNA 4IV5A 4ZVOA 3UJ8A 5KJFA 3BE4A 4BNZA 1Q7TA 5AK4A 4LMPA 1YI1A 4GW3A 3ZVNA 2H11A 3DTTA 1Y4SA 2PBRA 4F4IA 5HIJA 4MUAA 4YP7A 5EJ8A 1DLJA 1ARZA 1DV2A 1PTKA 1Z22A 3AI1A 3W8NA 2LE0A 2GAJA 4H17A 4KX3A 4OLJA 2PZKA 1PGJA 4UEOA 1U8FO 5FP0A 5TT1A 3KOXA 1T5OA 4OX9B 4MQ4A 3ETNA 4L28A 1XPJA 4BKQA 4UAUA 1UBMS 2PPLA 2AN1A 3GDOA 4XCXA 3RSFA 3KDSE 1WXEA 2VNAA 3JATA 4PAGA 2IUYA 4YACA 4BLQA 1WXFA 3DFUA 5C34B 2EZ9A 2AFRA 3AIMA 4L02A 4IHKA 3Q7SA 3CEHA 4Y8VA 2W6IA 4PG8A 1GLNA 3FTFA 1G6Q1 1DIBA 3KYDB 4LXTA 3ZJVA 2QLTA 2AF3C 1STOA 3VYSB 1TW3A 2BRUA 2G6TA 3W1WA 1F2UA 4D9GA 1I94B 1HDXA 2H08A 4FBGA 5M29A 4LJ8A 1Y1LA 2B3TA 2WUWE 3VHRA 1WBDA 4GBED 2VS1A 5CEJA 5HQTA 3K09C 4UTNA 3HO1A 4G0XA 3V4OA 5K0SA 4OMCA 3LF1A 2C9ZA 1ESZA 1RBYA 5HIIA 3T5PA 2QV7A 1CLUA 1CXZA 1NW8A 1SGWA 3K1TA 3GHHA 4FX2A 1BE1A 2C5SA 3T35A 1TJ4A 5IWCA 3SZLA 4B17A 2O5CA 2ZE7A 2ZWOA 5IJ0B 1EESA 5ECGC 5THQA 4CIYA 4AX4A 5C3MA 2KS6A 5CVJA 1Z6QA 5J2TA 1J1UA 1GZSA 3MS4A 3DR5A 2RD2A 2OV3A 3AINA 4UM9B 5J4KA 1ZD1A 4URYR 1DCFA 3TIFA 4DXHA 2IE8A 3ICQB 2XMBA 3WRVA 3QFHA 1NJ2A 2JHAA 5E7IA 5K45A 1AS3A 1RTKA 5ALPA 2IYYA 1ZK0A 3AHGA 1DCMA 4TL7A 1MT0A 2XA9A 1YFZA 2WQZA 1GPUA 1MNAA 2C4HA 4I4NA 4Q1CA 5EKTA 4BTEA 1P0QA 1JECA 1PTJA 2IHKA 3QXJA 4ZCTA 1AN9A 1Y8QA 2YFKA 3F9RA 5CLGA 2DT5A 3C14C 3X3HA 1L5FA 4HNHA 5D85A 1VKHA 1Z4PX 2AK2A 2AS0A 3S1AA 3KFVA 1Z0KA 3LHDA 4XB2A 1GG2A 2XRYA 4KAJA 4MYCA 5AHXA 2BFAA 1J0XO 4B48A 4KREA 2NXJA 4CKBB 1PFGA 4CVNA 3L7IA 3I61A 2ZEJA 5JD4A 4YP0A 3C6ZA 2XF8A 5AW8A 9LDBA 2A5YB 1OVGA 5J59A 1DC7A 3M33A 3NTRA 3R0VA 3R5KA 2OMEA 3NJ8A 1J5XA 2D5AA 1AXEA 1EAYA 3EZLA 4M1TA 5CT6A 4CMIB 4PC7A 2VHCA 1XXHB 3E4DA 5EUCA 5F7ZA 3QVMA 3T0GA 1RWPA 2XQJA 2ZVDA 1IUKA 1V16A 1YACA 5C5CA 1NG1A 5HMMA 2QM3A 1P9RA 1WDWB 4GFDA 2AZTA 2V1XA 3RF6A 1HEUA 1O96B 1EFPB 4IH4A 3KKNA 4I4TA 1KEKA 2EKZA 2V4MA 3QPUA 5KJ6A 3ZVKA 2PTGA 4GYJA 1X86B 4P0TA 4PGHA 4D45A 5JARA 2XODA 4HUQA 3HXTA 3IXMA 3HCFA 4ETWA 2K5UA 1XIVA 1NF9A 3DH0A 1GXSA 4HDQB 4JFAA 3CCFA 3HP4A 1G7TA 4A16A 4UUOA 5LFAA 5HEKA 4P3YA 3WK5A 3OIFA 2QM7A 3KPVA 4MB2A 5J4YA 4YPVA 4K9MA 2HFJA 3B2EA 4ZYUA 1J42A 1A9YA 3MPUA 3HKBA 3OE1A 3S2UA 4RZ3A 1L7OA 2FI1A 2X41A 4M0DA 3LXRA 5T4FA 3HL0A 1QONA 4DCMA 1PSZA 1ULHA 1Y81A 5I9BA 3ETCA 3AL0C 5DV9A 1CB0A 3H8JA 4KBFA 4C4YA 1DJNA 3EVEA 2V45A 3T6KA 3CR8A 1Q21A 4ZAZA 4FLMA 3UXMA 4OI4A 3EIHA 4R7ZA 4WDQA 3RYIB 3MK31 2RKBA 4QDZA 3WBJA 5I45A 1N0HA 3VKUA 3LPCA 3WL4A 4OP3A 3AH8A 3ZC3A 4US1R 1PZEA 2Y2VA 2FN4A 2RAPA 1LBIA 3G2PA 3FLBA 5JBQA 3UFXA 4HGNA 3HLKA 1KQPA 1R0BA 3ILHA 5TJHA 4HQKA 3HK2A 2UUOA 5FWXB 1ZZGA 4QPZA 2FEWB 4A6DA 1U2EA 5LP6C 4QM6A 2K6GA 1Q1EA 4ZV9A 2F8TA 4M9ZA 3RIHA 3AJDA 3V4ZA 1DX4A 1L5RA 3E22B 2CFIA 3W9YA 2C4NA 1CUIA 3J7TA 4M1YA 2FWBA 3NASA 4JUDX 5TB5A 1JDBB 3VNQA 3LOUA 1BNCA 1FZQA 2MTBA 2V3WA 3UB2A 5JATA 1P0FA 2OV6A 2QRPA 4PZ9A 3DLBA 1AKMA 3SHTA 4PZLA 4DZRA 3DVQX 1WP4A 5AUPB 2O50A 5BSVA 1X7GA 4L4UA 4ZT2A 5I9NA 5DI3B 1VOTA 1PL7A 2OAEA 1IY1A 3HR8A 4MVYA 1Y6FA 1O8CA 1QLJA 3Q5GA 4GGOA 2ZI4A 1VLMA 1B2LA 2R86A 4G41A 1RI1A 3PXAA 4EM6A 4PANA 2SCUA 3S0JA 3I3OA 4XTCS 2NUTA 1E5XA 5DN6A 3FKJA 3P9QA 4ALIA 1JQ3A 3X43A 3BIOA 2UVDA 1Z38A 5DCWA 2XB6A 3ESRA 1CY1A 1S8NA 1SHKA 2VSOA 3RTBA 1RXWA 2DPGA 3HRHA 5DXAA 1L5GB 1U1CA 2IH4A 2J4CA 1SIOA 3DYBA 4KR9A 3ROPA 5I9MA 5C37A 1AKRA 3O47A 4DT1B 4YJ2B 1KXJA 4MRSA 5FUVA 3QLJA 4ZFNA 1SIUA 1F4LA 2HJWA 4C0SA 2GLUA 5D3MB 2PGDA 4IKEA 1NMYA 1KDVA 3AUAA 3DTNA 3I53A 3GCWA 1NC1A 1P6UA 3I6YA 3IUNA 1QU3A 1F8YA 4PX2A 4BJHB 3BSYA 5AHWA 3RG8A 1RQNA 5LA6A 3ZW8A 2XCSB 1EK0A 5LQMA 4ZXPA 3JW8A 1JXMA 1WAMA 5KUTA 2PUEA 1N78A 2AOVA 2FZ4A 2Y2UA 2PT5A 3O8CA 4V0OA 4X92A 4N03A 2OYCA 4HDKA 4ISCA 4R1OA 3OCWA 3T3PB 5C18A 2HHCA 3Q9NA 3L1UA 4IUDS 1EA5A 1TD1A 1XMJA 1KL7A 2COUA 2JCBA 3H8VA 5I7OA 2C94A 1CEYA 2P9TA 3Q3IA 2EBHX 3F7TA 4RTNA 1EFUA 3LS2A 1KKLA 4BZZA 4L27A 2ECKA 2GN1A 2V0NA 2WJVA 3E18A 4YRNA 2D4AA 2E85A 2Z57A 1A8UA 4RSHA 4EFLA 1X9GA 4DDTA 3JQ9C 4XQCA 1KVSA 3G9UA 3ULKA 1NVVR 1VRVA 3S2SA 3M4NA 1FX1A 4DAEA 3IV6A 4AI6A 1VLVA 2ZUDA 3C6YA 1M6YA 1YR6A 4CLRB 4WESB 2JK1A 5CDUA 1AZLA 4CEIB 3ZCQA 7YASA 4CN9A 3M6IA 3KZMA 2OHJA 3PYXA 4Q6BA 3RUHA 1GZ4A 5C8VA 3LTEA 3R3UA 1TCCA 3HMQA 3ZXXA 1BD4A 4NZOA 4LFAB 1QOQB 2BJHA 4H15A 4R31A 2ZYVX 2JAQA 1OZFA 2HU7A 2R6JA 3BERA 3JCZA 4LZWA 4QSHA 1MCZA 3AVOA 2CHFA 3G88A 2A0WA 3I0ZA 2GLXA 2EXXA 4FI3C 4HYYA 3TTVA 2ZB3A 5CVVA 4Y67A 4DV4B 2P27A 3LF2A 3P8ZA 2Q3JA 5DIZA 1Y1TA 3KOOA 4ENRA 3WDSA 2QAGC 5EGNA 1W9MA 1SKBA 2OCGA 5CDSA 2COEA 2A0KA 2VHTA 1CK4A 3F0TA 2J85A 4PY2A 3GIDA 7MDHA 2JLCA 3K2BA 2NZ8A 4RIHA 4F3NA 1U0BB 2GKSA 3WMFA 1DIGA 2HLHA 1P7YA 4KH0A 1XBTA 3QNUA 4CM5A 1GTJ1 1QIKA 1IOZA 1ZD5A 3KVYA 4KQJA 5DTJA 1R6BX 3UZUA 4Y2UA 4BMSA 1FYVA 1XYVA 3A6ZA 2GA9A 4HAUA 4XYEA 1PN3A 4PSKA 3ZDYB 4ZGGA 5JAMA 2CNWA 2EJBA 3AEXA 2ZB7A 4HH3C 4ZAXA 1Z12A 1ZRHA 3X1XA 3ZZ0A 3ZW9A 1QC5B 3AU9A 2V74B 5FLKA 3TN7A 4P4NA 1UQRA 1RWOA 2W2KB 1Z4IA 4GR4A 3RC1A 3GDFA 3BH0A 3BWYA 5A5DA 3R6TA 4EH1A 3PC7A 2R8YA 3E9RA 1V4NA 3PGMA 1G98A 4V0NA 3UMVA 1GPMA 1JH8A 3HRKA 4WA8A 5JDCC 3X1JA 5ISMA 4DCJA 1UJ6A 1R15A 4P38A 3F7MA 4QBFA 1KPGA 1E7SA 4P5PA 4YJFB 4OLFA 4BS9A 4CIVA 4DCPA 1YB2A 3FNFA 3WP0A 4LQDA 4N6OA 1D4ZA 4CG0A 2YYAA 1AZWA 1SZPA 3HCAA 3EXHB 4JC8A 4KG7A 1EG7A 1C9KA 3WL7A 2QTGA 4WUTA 3PXEA 4ZICA 2I3DA 4R3WA 5DLYA 1HRDA 1O95A 3CXRA 3RIMA 2R6GA 4FGLA 2YVUA 4DFDA 1TO6A 5JOQA 2PFSA 3OQMA 1FRQA 9MHTA 3P9PA 2WPNA 1JEAA 2OZLA 5FOXA 3V1YA 5BMVF 3GLKA 2J6BA 1H8HD 4TLEA 1T5SA 1U94A 3IOCA 4MW9A 5JQGA 5LQJA 6PFKA 4LNHA 4R54A 2QN2A 4FCWA 5AKJA 4BU0A 3SR3A 2A84A 1F6BA 3BWCA 3BD7A 2J6HA 1MLDA 2WFLB 2BONA 1JEYA 2QVZX 2WJIA 2ZCUA 4S1TA 3FF4A 5F33A 4Q9AA 3JSXA 3E3LA 3E23A 2Y1LA 1X7YA 4K8RB 4M76B 2FHPA 3SDBA 4EBFA 3E15A 3I62A 1L6IA 2HSJA 2H65A 2TS1A 3OY2A 2XUGA 1PNTA 3MIZA 1N0IA 1FFSA 2CHGA 3IKJA 4L5CA 5DT9A 3SF0A 4AU1A 1ABEA 1Y5RA 2L18A 1NF8A 2E89A 4MSUA 4TTJA 1OHHA 3ROMA 5KHLB 3IKMB 3T15A 5KC9A 3R1IA 3NM5A 1EX6A 2O3SA 2O0JA 1YXMA 3EXEB 1SUWA 3K70C 1ITZA 1WLYA 2FF7A 1ZD9A 2WYWA 3A2MA 2QVCA 3BGSA 3LOQA 4GPAA 3IAFA 2V6BA 2QMHA 5AOVA 5EWJB 3WJ2A 2BHTA 2ZRNA 2QPTA 4RH0A 3V4SA 1SU4A 3WGZA 5KTMA 3QMMA 4MVJG 3PCXA 4UBMA 1XLTC 4M8KA 1S2GA 3BIFA 1J2YA 1LFAA 1RQXA 1C4OA 1TJ3A 3KZNA 3EGEA 5ERGB 1Y8RA 3TZLA 2QJFA 2J07A 5AJUA 2P1RA 1E3SA 3QFRA 4GZ5A 5TS3A 1WXHA 2G5PA 2ZSJA 2PLFA 2XNKA 3TW6A 5FDFA 4Y6RA 2V7UA 2X8JB 3PD0A 5A1TA 2J33A 5AW3A 4E22A 3FNIA 3JPYA 4QTZA 2CCJA 2YV3A 4OHBA 3W06A 4NR0A 3TDMA 1YHZA 1YUNA 3JQCA 3PF8A 4RZQA 2NU7B 2VH2A 4EJ0A 2W93A 1A1SA 4YAJA 4HPWA 3K3PA 3NV9A 3CNOA 3RHTA 3ADKA 2HQOA 3QX8A 3R44A 1JWBB 4D26A 4HAYA 2DM6A 4M4SA 1ZR2A 2C4MA 3IT0A 4ZPXA 3WDKA 5FR1A 3VU9B 4C2BA 2I33A 1AK1A 3OA0A 4LZPA 4C2AA 5KNDD 3CIFA 5IVDA 4YAUA 4HGPA 1VCOA 5FHRA 5SZHB 1DKMA 1HWYA 1IUNA 1SOAA 1QTRA 2E37A 2OV8A 2UYYA 3A8TA 3P9SA 2CMKA 1MC8A 2C3YA 3D1LA 4PAWA 4BZPA 1I7QB 3R6WA 2EJCA 4DZTA 3KEOA 2XOKD 2FGKA 1EAMA 1NWHA 1T26A 1T9HA 1GSAA 2I5PO 4Q6WA 3CVXA 3PEYA 3FPFA 1TVEA 4OYLA 2WSYB 4AZTA 1E1QA 2Y0EA 4BNTA 4TMFA 3AM4A 1KIFA 2GB4A 2OB2A 3FCYA 3OPYB 3U13A 3ND8A 1NW4A 2MDTA 4CM6A 2DPMA 3II6X 1IIBA 2CYAA 1P7ZA 1MFZA 3NT4A 3PCRB 3T3NA 2FAXA 3W6ZA 5EHZA 2QLBA 1Y8CA 2IYOA 2JL1A 1SKYE <