2YC4C

Intraflagellar transport complex 25-27 from chlamydomonas
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
198
structure length
177
Chain Sequence
KPIDITATLRCKVAVVGEATVGKSALISMFTSVVAPVTIPDTTVSVELFLLDTAGSDLYKEQISQYWNGVYYAILVFDVSSMESFESCKAWFELLKSARPDRERPLRAVLVANKPPQRHQVRLDMAQDWATTNTLDFFDVSNPPGKDADAPFLSIATTFYRNYEDKVAAFQDACRNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Intraflagellar Transport Complex 25/27.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Transport protein
molecule keywords INTRAFLAGELLAR TRANSPORT PROTEIN 25
total genus 52
structure length 177
sequence length 198
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2yc4C00
3TIFA 1OB2A 2BM1A 2BVNA 3D31A 2FSGA 2ZJYA 1OFTA 4I1VA 1T9HA 4LHYA 4OHVA 2QAGA 3P27A 5KSPA 2XNSA 2YYZA 4LGMA 4DCVA 2GA8A 3SJCA 3ZZUA 2J87A 4L9SA 1W0JA 2A30A 1EWQA 5L3VA 3EZ6A 1ANKA 2PCJA 4LJ7A 2GCNA 3I4LA 3SYLA 4CEHA 2ECKA 4MKIA 2PZFA 4MUAA 3TBKA 1UKEA 2C2HA 5TMPA 2OAP1 4QGAA 3CM0A 4DEYA 4B48A 4KV9A 2XZLA 2ZU0C 5CLLA 3BORA 4URWR 4ZCLA 2YVUA 1UEIA 1RKBA 1MO4A 2DFKB 2IYYA 4PC6A 3AM1A 1G21E 2JLUA 1IY1A 1E2QA 2A2ZA 1W4BA 4E22A 3W6NA 4D4KA 4NCJA 4DIDA 4GDFA 2CL0X 3GLFE 5H8WA 4H9GA 4IXNA 3SYKA 2GCPA 4DLRA 1D2EA 3BFKA 1XJ0A 4PAOA 2OFOA 2V6JA 2JIZA 2VP6A 4OQNA 3RDPA 1LW7A 3I92A 3GJ7A 2CK3A 3QXSA 4EFMA 1Q20A 2QZ4A 3SQWA 3NVAA 5C4GB 3ND8A 4QC2A 2GZHA 1ZP6A 1CULC 4XVRA 5FTJA 2AK3A 2CHQA 2J7PA 3R9XA 4M53A 1KDRA 3THXA 1GL7A 1S8FA 1SQ5A 3GPLA 1NBME 4BFYA 3U7GA 2XXAA 2YJTD 1R0XA 3UKDA 2PLRA 3I5YA 2QPOA 2KWIA 2NIPA 1UJ2A 3BJIC 2H16A 1PUIA 4EPYA 4A8JC 1U0HC 4NU0A 5L3SA 1P73A 1TTTA 3NBFA 3PEYA 3B1VA 2YC4C 1CXZA 2W0SA 1IQPA 4HAWA 4HDCA 3TVDA 4KVGA 3H86A 3SJBA 2QBYB 2MSEB 4AIIA 4KVAA 2ZS7A 4DLUA 3O8DA 1TAGA 3DO6A 3THYA 2ZSFA 2ZANA 3W34A 1G3MA 2RGXA 4C2UA 2O8EA 3LFUA 2LCFA 1KMHB 1RPZA 1WXQA 1V43A 2AD5A 2FMXA 2RCNA 4NCIA 3WMGA 1FZQA 1XD2A 2XB2A 2BCGY 4QOSA 2ORVA 1Z3IX 1I2MA 1OB5A 3L82B 4OQMA 4G0NA 3SFZA 3KJGA 3WYAA 1JECA 2J45A 4LYFA 3NTUA 4GT1A 4ZCMA 1BKDR 4WVFA 1J8MF 2PBRA 4JJKA 2QM8A 4BLOA 2ZE7A 4MYTA 1WDTA 3B85A 1JR3E 1Z2CA 2IX3A 4DSOA 3H4MA 4ACBA 3W5JA 3E70C 4BZQA 5G3YA 3QVUA 3QF7A 3EXAA 4J0QA 2ZSEA 4A9AA 4TMZA 2R6FA 3NH9A 2Q9CA 4ARZB 3AF3A 3NWJA 2HF9A 2WAYA 3TW4A 1OW3B 1IAQA 1P2VA 4XOIA 1R0YA 2ZRPA 4Q7KA 5KNCA 1IN7A 2FH5B 3ZVRA 1XD2B 3QOFA 4GOKA 2R9VA 2PZEA 2WIBA 4WZBE 4KJZA 3PUWA 1JJVA 4QNRA 4UKDA 2KBEA 5FOVA 1ZRHA 5FL3A 1FTSA 4LBYA 3SJZA 1H8EA 5L8VA 5JCZA 1NIPA 2XOKA 4NL4H 3UMFA 4BZPA 1IJEA 3B1XA 4O25A 2Q9BA 1VCIA 2J0SA 3ZS8A 2WAXA 4KCGA 5AUNB 1UAAA 2B6HA 2FFAA 1FQKA 1GM5A 1IOZA 3I8SA 4F4CA 2QL6A 2CE7A 2VHTA 2J59A 2OM2A 2W6JA 4US1R 1A2KC 4B44A 4DCUA 5AUOB 1KO4A 4IDPA 3T06B 3ZJYA 4RFVA 3THYB 1SKQA 3QXCA 3T34A 5JEDA 1TF7A 4HUTA 1XEWX 5FL7A 3K8YA 4L16A 2BKEA 521PA 4JVMA 4B34A 2VLIA 1FP7A 1W2HA 2D3WA 2J9RA 3W3ZB 3EZFA 1XEWY 4PC3A 3WP0A 1Q44A 3FGNA 2VP9A 1C1YA 3M6AA 4LYAA 5ELXA 1T6NA 1E69A 2IWRA 1P3JA 4ASUD 2GKSA 2MMGA 3ZZTA 2QY9A 4LJ6A 1E2LA 4PQRA 1KJWA 1YZNA 4G5GA 3R9WA 2H57A 1XX6A 4AK9A 3CR8A 1G8YA 2JEOA 3D6TB 1EESA 1L8QA 4R2HA 1BYIA 5FTNA 3SFVA 2O8FA 3Q9LA 2QROA 1U8ZA 2SHKA 3SS8A 3ZVLA 1XPRA 3ZS9A 4Z8XA 2VSFA 5CK5A 2A7QA 1ELOA 2V7QD 1S3SA 3LRPA 4FN5A 1E2GA 1G41A 4G5SA 4MYUA 2JJ8A 5F9HA 3B5JA 3W6OA 1OKKD 4TMXA 5SZHB 4C9BA 1T3HA 1TEVA 1KZGB 3I73A 3D7MA 3CH4B 2DFTA 2YWGA 3IKJA 1NLFA 1W4AA 4UXJA 3PQCA 4W9MC 2OFXA 2QE7A 3K9LA 4A6XA 1NF3A 2ZXUA 1XXHA 1KYIA 4D82A 4LBWA 1HURA 1SVOA 4W5WA 3BWDD 1GNQA 1JEDA 2C03A 4YQFA 2VSXA 1Z22A 4BLSA 3I8XA 5KDOA 1TPZA 3CRQA 3PVSA 5J40A 4G1UC 2FPLA 1DO0A 2CNWD 3NIBA 3VHXA 4Q9IA 2ZTSA 2QBYA 3EPKA 1NKTA 1XNJA 1FNNA 4FINA 3PEWA 3LX8A 3Q5DA 2X8AA 2QA5A 1Q57A 5GJBA 1S9DA 3CF2A 3SZRA 4FIDA 4HUQB 3EC1A 3FWYA 4JLJA 3GLGB 4G5QA 2ZYTX 1ZC4A 4RKEA 3THXB 4KITB 1XB2A 3EWAA 4TT3A 1T3LA 1HTWA 4RZ3A 2EQBA 3HR8A 3FYHA 1KTVA 1UBCA 5CYOA 3BE4A 1XZQA 2DHRA 4R7ZA 2DY1A 3DHWC 4UNNA 3SE0A 2A5FA 2IYVA 3GLGA 121PA 1LS6A 2OFWA 4DSNA 4DT1B 2G83A 2ZSBA 2GHIA 1QBKC 4RJLA 2R6CA 3DKVA 4CYMA 4PX9A 3ND9A 4DWJA 1D9ZA 3IIJA 2WICA 5FTMA 4IFEA 2GILA 1WE2A 4QJ4A 3CONA 4XTCS 3KUDA 1IXRC 1CJUC 1E79A 2OBLA 1Z6YA 5HPYB 4HUQA 2DBYA 3BRWD 3I32A 4EJSB 4IVQA 4W5HA 3IHLA 1OIVA 4Q21A 2QGNA 5LBIA 2XSZA 1CBUA 1T5LA 3QJYA 5HTKA 1J7KA 3WRXC 4O2LA 3L0OA 2GESA 3LH5A 4A0FA 2IYRA 1MOZA 4PSAA 1Q12A 1UKVY 3FMPB 4B74A 1G17A 1DO2A 3SOPA 1E79D 1JR3D 1OXUA 1NVVQ 4DVGA 1FW6A 3B1ZA 1YR7A 4DHEA 3SYNA 3FDIA 2BEKA 4RFSA 2R8RA 3VNUA 2JATA 2QTVB 1OFHA 1KGDA 3HU2A 2HLDD 1EX6A 5EP2A 1ZYUA 2GETA 5F3WB 1XCMA 1G3QA 3VR2A 4JSYA 4EJSC 4NKRA 2WBLC 2HDNB 1TF5A 2O0KA 4PPFA 2EYUA 2JLVA 1CKEA 4CEHB 4Z51A 3MLEA 2QAJA 2WJIA 1TQ6A 4IVRA 2ZRDA 3IPXA 4M0LA 2WKQA 3BAFA 4HI0E 5HR5A 1IN8A 1FMJA 3CBQA 3IEUA 4KU4A 4CZ2A 5C18A 4ZI2A 2DWQA 2V6IA 4Q4JA 5HCIA 2Q0HA 5IRCD 3PFIA 1AQYA 2KI5A 4NYJQ 1XTQA 1Z06A 4D4MA 2FFQA 4DUGA 4US2R 3VKGA 4KODA 4JLKA 1E6CA 4E07A 1KDOA 1NSTA 1RRGA 5JS8A 1Y63A 1W0JD 4PR0A 1EFUA 3IO5A 4V0NA 4OHZA 4ZDJA 2MSCB 1FUUA 3BC1A 3L8ZA 5FFMA 3D8BA 4RKFA 4NTZA 5TY0A 1X1RA 3VU9B 4RD0A 3TR0A 1CR4A 2EYQA 821PA 2O8BA 2JLSA 2RGGA 2YKGA 3SC3A 3J81k 3BK7A 1E4YA 1TMKA 3S1AA 3VNVA 1Q22A 1QHXA 2JJ2A 2QAGB 1N0UA 2ZETA 2D7DA 3L43A 1EX7A 4MKFA 3DM9B 4M1KA 5DISB 3NDBB 3RRYA 3LLMA 4FMBB 4MGZR 1GZSA 2GVZC 2AK2A 4Q1FA 1NJGA 3ZD6A 1X1SA 2ZRHA 5DIFA 2WWYA 2KB0A 3LXXA 2FSIA 2AWNA 1CP2A 4IOKA 1JPNA 2JLWA 4DLXA 4MDEA 3EASA 2YC2C 4TZ6A 3CRW1 5DLQC 2J7PD 1KO5A 1XXHE 3ZYCA 4Q9JA 2O8CB 2JDID 3O8BA 4TZ0A 2C04A 5KSYA 3GJ5A 2RGAA 2BKUA 2A5DA 5G53C 1U0JA 4KXFB 5F2EA 2F55A 4TMWA 5GVRA 3X2SA 3U61B 2DR3A 3MJHA 4PPQA 1UDWA 5EZ5A 4OBEA 4OK5A 2C96A 1VYTA 4JLAA 5D3MB 1K5GA 3PUZA 1RYHA 1I4DD 1ZM2A 1KMHA 1NG9A 2CEAA 1GG2A 2BMDA 1Q1QA 1VIAA 1WRBA 4QGHA 1RIFA 2AWOA 4D0GA 1P62B 2D74A 1ZMXA 3B9PA 4DCNA 3U7HB 1U8YA 1MKYA 1GSIA 3LX5A 5AJXA 5JCPA 3CW2A 1KKLA 3NBYC 4Q7MB 2QPTA 1YU9A 2P5SA 1G5RA 1W1WA 1Z0IA 1G4UR 3NBXX 4LV6A 4TLBA 2QP3A 4TLCA 4IW3B 1W4CA 3TQFA 2CL7X 3RRMA 4QNMA 4BZXA 1D2NA 2VSOA 1ZUHA 2HXYA 3TSWA 3P1JA 2BIFA 3U3KA 1SKYB 2BM0A 3AEZA 2J1LA 4C0AC 3ZD7A 3RRNA 1R5OA 3WNBA 5JJKA 1YR6A 4L4UA 3K0AB 2WSSA 2KJQA 3B2EA 5GJVC 5JWOA 2C9OA 4BE7B 4FCWA 4CVNA 3AKCA 5LB4A 4EPXA 4QXAA 4Q4HB 2WJVA 2DB3A 5AK0A 2OCPA 1TU3A 4LHXA 5JHGB 5FBQB 3KKQA 1N3BA 3FFBA 1AM4D 4RCZA 2QT0A 2YWHA 1SXJC 3BB1A 1XMVA 1LF5A 3CUEF 2PMKA 4RZUA 4MQBA 1G3IA 4OL0A 4PFSA 2QPAA 1OFIA 1W5TA 2VHCA 2IYQA 3BB3A 3FFAA 3X1ZA 3CPJB 3LW8A 5AUQA 3DZ8A 4V0KA 1XMJA 2ZSDA 5JHHB 5EP1A 4KSCA 2FGJA 3U4QA 3MAAC 3LVRE 3OE7A 3B8HA 4PQFA 1N2CE 4BFVA 2HYIC 4BGDA 3EARA 4OHXA 1VYUA 2VF7A 1KJYA 4GFDA 3P26A 3VR1A 1W0KA 2ANBA 1B0UA 4QHTA 2QAGC 1G8GA 3ZIAA 1OXSC 2AHOA 2ZM5A 1OHHA 2CLSA 3IHWA 3KTAB 3O8CA 1GTVA 1FX0B 2ODEA 3PUXA 2VRWA 3WNCA 2WTUA 1ZCBA 5CJ2A 1AS2A 2GK7A 4JL5A 4ZKDA 1ZNZA 1NVWQ 4RVCA 4LY6A 4HB4A 3ZH9B 4MYCA 4IFBA 5UKDA 1JAHA 2IYZA 1WF3A 4GBMA 2E1RA 3VHLB 2GJ8A 2F9MA 2X77A 2UKDA 2W2VA 1FTNA 2CVHA 2J41A 2YZ2A 1O87A 3THOA 1DOAA 2P67A 4NPHA 4IXMA 1KI9A 2QI9C 2ZYVX 3QKSB 4B2PA 2JLYA 4MKHA 1PLLA 3CRVA 3U6BA 2J0VA 2PCLA 2JASA 3IGFA 5HKKD 1ZD9A 1I2DA 2ZQ5A 1R6BX 4KLNA 2BBWA 2NMVA 5JZVA 1R8QA 1OPXA 2OBMA 2QTHA 1MV5A 1LS1A 4LSGA 2C78A 2QORA 3EZ9A 4BFTA 5JECA 1SXJA 5J47A 2REOA 5JWRA 3GP8A 1GILA 2FU5C 3NC0C 4AC9A 2IEYA 2F43B 5J4LA 2ZRLA 5E7MA 1T0HB 4BFZA 4DLYA 4V03A 1YZLA 4YMWA 1LB1B 3K9GA 5EE1A 1D6JA 3FE2A 4EUNA 3MWKA 3OIUA 3SHWA 1X8JA 4JBYA 5DYIA 1RFLA 1OH7A 2VP5A 3PUVA 3GLHB 3QPWA 4G5OA 2Q3HA 4GI7A 4IVPA 4A2PA 4TQ9A 1ZINA 5EUQB 3WMEA 1P9RA 1P2SA 3RYTC 5GADl 4HZUB 1D9XA 2G77B 1UBFA 4PQYA 4Y0VA 3GMTA 4EPTA 1H8ED 1DAIA 4MGKR 1E2DA 3KKNA 4JLBA 1KSHA 3DZDA 2PX3A 3W3AA 3WP1B 1YVDA 3IO3A 4B3BA 4KSBA 4DT1A 3OAAD 1KK3A 4NYIR 1OE0A 4Q47A 3RRZA 2VYFA 2FNAA 2GAOA 5FPSA 2A3RA 2AXNA 5JI3E 3A6PC 1X6VA 3FMIA 4TL6A 3EG5A 1NN1A 1Q1EA 1Z0AA 1BH2A 3AVUA 1MH1A 1G16A 3U3JA 5AR1A 2WMNB 3KQLA 3TUJC 1ZIOA 4M9QA 1R10A 3K0CA 1S4QA 5C4MA 3QY0A 2IF2A 2V9PA 2IUTA 2J5XA 1CR0A 5EE5B 3U3RA 5HZKA 1M2OB 1GITA 2F9LA 2O5VA 1KO8A 2O52A 1H8HD 4MYHA 1J70A 3K53A 4JLPA 2IS2A 1CJTC 4LOAA 1ZU4A 2DWOA 3KB2A 3W9YA 2CCGA 4FWIB 1RW4A 4HB3A 3Q3JB 1NVXQ 6Q21A 5HE9A 3LAWA 5EE0A 3QG1A 2BBTA 3BBPA 1KZ7B 3MCAA 1H8HA 3BIFA 4ERNA 2CLDX 4HLDA 4Q03A 1OSNA 2ZRMA 5FI1B 3PEVA 3FOZA 1SVMA 1XD9A 1XJCA 2VQSA 3WHKA 1E3MA 2B7BA 2F6RA 3CKLA 3LWNA 3NHBA 2JLZA 3DMNA 4QFMA 4TYQA 4EFNA 4PPNA 5AUPB 4GZLA 2I1VB 4DDUA 3TK1A 2IHBA 3TSZA 5JI2E 4TYNA 2O8CA 3KB1A 4TL9A 1CU1A 1R0ZA 2N42A 3LDAA 1YR8A 2FEMA 2ORWA 1NKSA 3C14C 4R2IA 5FUYA 1F5NA 3R7WB 4A0HA 1PVOA 4M1SA 1UKYA 2W00A 3AVYA 3OEHA 1R8SA 3AP3A 4XVQA 3OIYA 4A15A 5FOTA 1VHTA 1UBEA 1W2GA 2VO1A 2VIIA 1CJMA 2GJ9A 1EK0A 1JAIA 1KI7A 1E2NA 4I1SA 4D2IA 1P6XA 2GVDC 2ZI7A 1Q0UA 3TUZC 2GF9A 1VCNA 2VP2A 4NZYA 1PUJA 4W7SA 4F91B 4OKSA 2IF0A 1NBMA 4ESHA 4YDSA 2ZJOA 2WSMA 4Q5IA 1KNQA 1OH5A 3HP1A 3TMKA 2HYDA 2ZUCA 5KTYA 2GK6A 2ZI4A 4PHTA 3W6PA 4TYPA 2BMJA 2ZSAA 5TV2A 1US8B 4FMCF 3SN6A 5LDDC 1KMQA 2CCJA 3HU3A 4BASA 3GLGE 2IS1A 1QDEA 2QMEA 3AH8A 4JVNA 3IPYA 3THWB 1R4AA 2WWXA 2XX3A 2WJJA 4V0LA 4EQ6A 2ORIA 2OHFA 3QEOA 3ZLJA 2F3RA 3FMOB 5E3HA 5E7JA 4D80A 5H70A 2BV3A 2WWHA 2ZRIA 5FOSA 1S96A 3EPJA 2ZS9A 4JVLA 5FUWA 5JEEA 2ODWA 1V5WA 1T91A 5TDHA 1IBRA 1G7TA 2OXCA 4AG5A 3SI7A 4YMVA 4D4LA 5G3ZA 2HJVA 1MRSA 2QMHA 2H5EA 4QJ5A 2F1JA 1AGPA 4MKGA 5A0FA 1JBKA 2X1VA 1FFHA 3B82A 4CT4B 4FMCB 3W8RA 4IEEA 4HLUA 3ZZ0A 1QG2A 2VP0A 2IW3A 3EZ7A 2XTNA 3C8UA 1P7CA 2VF8A 3LVQE 4MRSA 3T5DA 4Q1CA 3IDQA 1UEJA 3U4QB 3EA5A 1FP6A 2XNDA 4NE2A 1AJEA 4P3YA 4BRWA 5JSZA 3W5IA 3K70C 3THWA 2O8FB 1QVRA 2ZRNA 5L3RA 1XTJA 3RAPR 3QKSA 1NL3A 2XJ9A 1G3RA 3KJEA 3CIOA 1PV4A 4QL3A 4G5RA 2ZI5A 5L3QB 3K70D 5D3MA 1CR2A 3QKRA 4F38A 1SGWA 3SR0A 1EFCA 1ZD8A 4PPGA 5LD2C 3L0SA 3EIQA 3H2YA 4TT3D 1N0VC 4HZUA 3RWMB 4DKXA 3VKHA 2Z4RA 2W6JD 4WXRA 3S1AB 3A4MA 2VHJA 1PJRA 1U99A 5BYJA 3WYFA 1NI3A 4LK2A 3LV8A 4Q1AA 3IUYA 3KKPA 3T1TA 1KOFA 1L4YA 3Q72A 2FF7A 4RD4A 3DVLA 4TSFD 2NPIA 4OK6A 5KUTA 4ZI3A 2BBSA 1BS1A 3X1XA 2FN4A 1KAGA 2RMKA 2HT6A 2AR7A 2V54A 2WOOA 3ONWA 5KDDA 2N46A 5IF9A 3R8CA 4YLGA 4X8MA 2ATVA 4FXPA 2AKYA 3UMSA 5KSOA 1HT1E 1W36D 1F2TA 4XSGA 4PZLA 1IN5A 5LD2B 1ZM3A 3T1VA 1P9WA 3PV0A 1QF9A 1G9XA 1X86B 1ZAKA 5FPYA 3GLFB 4ZO4A 2WOJA 5B30A 4JT4A 2GXAA 1LV7A 1VKJA 4TN1A 3RSOA 1WCV1 5KNDA 4A1FA 5J4KA 2VP4A 2QSZA 2PT7A 1F3OA 1JNYA 2JAQA 4AG6A 5DGXA 4HAXA 3BH7A 1TL7C 3AKYA 3WYGA 4HZIA 2G1JA 1G5PA 2E9SA 3IIMA 4C7OB 1DS6A 1W4RA 1GOTA 4M1OA 1G3UA 1NMZA 3BERA 3LBNA 2QMUA 1G8PA 2J46A 1KK2A 3JVVA 3TW8B 3T12A 3GJ4A 4MGIR 3QENA 2ERYA 2WJHA 2OT3B 1OXXK 3E5HA 5JSZB 5JRZA 2CVFA 4B6FA 4TTQA 2BCJQ 5DNYB 2R62A 3AGPA 1XTIA 5FUXA 4GL2A 3QXJA 1XCPA 2OE2A 2WWWA 3PJRA 4LJAA 1H65A 1U9IC 2IT1A 5LB2A 1JEEA 3EIHA 1OF1A 1E1QA 2FG5A 2GRJA 4JSTA 4L5BA 5LPNA 1NLZA 2DCUA 2YWEA 4ZDIA 2Z43A 2QT1A 2GNOA 2XTMA 4PC1A 1OIWA 3LO5A 1Z6TA 4JLMA 1T4GA 1S1CA 1GP2A 4JKYA 1YZUA 2WZQA 4OHWA 3A4LA 2W58A 4Z1MA 1UPTA 3A1VA 1HUQA 4OQXA 3WBJA 1SXJB 3G5UA 1G6HA 2FOLA 3QPUA 3EWSA 2D2FA 3UWOA 5JJLA 4WIAA 5AJVB 1OIXA 4HAZA 1DARA 1RZ3A 3WXMA 4LBVA 1N6KA 3DPUA 4NDZA 1HH4A 4TL8A 5EXPA 1IXZA 2JJ2D 4CEJA 1N6OA 2W83A 1Q3HA 3IQWA 1N6PA 5DO9A 4GZMA 3F3YA 4RD1A 3KJIA 3NH6A 2QRNA 1E1RA 4AYWA 4CF7A 1JB1A 4BFUA 5KHOC 1IONA 4TLDA 3TR5A 4LJ5A 3P20A 3CF0A 3UWKA 3UANA 3BFXA 4Q19A 1PLKA 3QXXA 5HCNA 2P65A 4NYIQ 1KDTA 1MO5A 4HEJA 3T35A 3FPAA 1VPLA 4HLCA 4BLTA 5EXSA 2IUSA 3KXKA 3BB4A 4RFSB 1GDDA 4QBIA 2ZRCA 2REXB 3K0CC 1II8A 4V0OA 3NKVA 1KO1A 2HV8A 1N6NA 4N1AA 5FI0B 3MWYW 4DJTA 2IYWA 3SDZA 1WBDA 4TQAA 1JQLB 1LVGA 8OHMA 2R2AA 1VG0B 4D6PA 1LNZA 2EWVA 2OAQ1 3RSLA 4AY2A 4PAQA 1DAEA 3RHFA 4FD2A 2R44A 3RWOA 4KFSA 2DPXA 2O0JA 1OHHD 3NEJA 2HCJB 2XTZA 2F7SA 2NO0A 2ZJ5A 4RCYA 3ADKA 4C0HA 4OQLA 5JS7A 2V1UA 2QM7A 3AVTA 2OCYC 3QKRB 4POAA 1WP9A 1N6RA 4JLVA 2Q21A 2CE2X 3PITA 1NY6A 4BLRA 1AGRA 2R6AA 1GIAA 1RRFA 1A1VA 3UG7A 4O3MA 5KDLA 1E2KA 2AN9A 3JZMA 4RD3A 2IUUA 2IWHA 4LYJA 1YRAA 4HSEA 4JL6A 2HCBA 2RGNC 5HKKA 1F2UB 3QKTA 1E1RD 1HQCA 2CBZA 2WVJA 2ZR9A 1TU4A 2YV5A 3T1QA 2OILA 3K0SA 2NG1A 2ZAOA 1QHIA 1G4AE 3QF4A 3F8TA 1E96A 1SULA 1Z6XA 4M8NE 3PG5A 1D8TA 1SHKA 3L0IB 4Q1EA 4IDOA 1GWNA 1WMSA 1RE0A 2A5GA 2ZJZA 3E1SA 3IIKA 4E5UA 5IHPA 2G3YA 3DDCA 3QBTA 5AJYA 1R0WA 2AL7A 1G7CA 2XNDD 5SZJA 3AVXA 4IHQA 1WQ1R 1E9DA 2YOGA 1P2TA 2ZI9A 4EDHA 2NPFA 1FQJA 3PIRA 1HT2E 1Z2AA 1OKKA 2LKCA 1E9SA 1SVLA 1F48A 2YINC 2RGEA 4M9ZA 5GJCA 2ZE8A 3Q5EA 3CR7A 3MSXA 4XD7A 1SHZA 2G88A 1DPFA 2ZYWX 3ADBA 2ANCA 1KHTA 1ESMA 1I4LD 5B2ZA 3SHFA 4MRRA 3AKDA 1WB9A 5DYGA 3BD9A 3MRSA 1AIPA 1AZSC 3HR7A 4KAXA 3M4YA 1HE1C 4A2WA 2P3SA 1VHLA 5EJEA 5G41A 2P0EA 5D3QA 1NBMD 5FPHA 3B7GA 4LJYA 2XXAB 4GNKA 4K81B 4LI0A 1MABB 2D2EA 2OCBA 3U7EB 1E98A 4M9XA 2D06A 1KSJA 1DADA 3SJAA 2YWFA 1YZTA 3VR3A 3C4JA 3KDSE 1HQYE 1ZCAA 3ZQ6A 3RNLA 4C0LA 4M1WA 2F43A 3REFA 1VTKA 1YZGA 3LLUA 1QVAA 1G64A 1L2TA 2Q9AA 3GEEA 3UK6A 4TYWA 4CIDA 2ZYUX 2ZR0A 4URZR 4EPRA 2VH5R 1DE0A 2ZREA 3LQQA 4QKQA 1ZUIA 3A1SA 4B73A 3ADCA 1S9HA 1KI1A 1Z6AA 5K8LA 4LV8B 2ZVPX 2IYLD 1E2JA 3GEHA 1YKSA 3X1DA 1XPOA 2WWGA 1CRQA 1YZKA 2ZJBA 1GRQA 3TNFA 5A4JA 4Y0AA 4MRVA 4B35A 4CW7A 1TEXA 2H8KA 4NBSA 1WBBA 3BH6A 1K5DA 4XTRA 5SZIA 2RHDA 3GJ3A 4C0BA 4LRWA 1QHHB 3RC3A 1Z0KA 2H1LA 2FDCA 4Q01A 4OQFA 3VX4A 2ZS8A 5M04A 3K0FB 4JZKA 2C8VA 5CJPA 4DLWA 2BEJA 1N5JA 2RB4A 1KKMA 1T0JB 4K8OA 1FX0A 4I81A 3SNHA 1GVNB 3DMDA 1WA5A 2Z0MA 3U44A 1RC8A 3QE0A 2ZI6A 4H1VA 3JZAA 2IS4A 3ASZA 1NN3A 2V1XA 1VG9B 2WWFA 4KI0A 4NMMA 1N0WA 3AP1A 3OEED 2CL6X 1YHNA 4AKIA 2O8DA 5L3SB 2JLRA 2QG6A 3FKSA 2BMFA 1ETUA 3MG9A 4IKEA 3VAAA 5EZ6B 3A1TA 5TXGA 3U3MA 3T5GA 1CLUA 1JJ7A 3B1YA 4XWKA 4FMDF 4Q7LA 5E95A 1GNRA 2VTKA 4CEIB 2WPDA 2JDIA 3ZIAD 2J0QA 2Q6TA 1ZUNB 2KBFA 4KHZA 3N2EA 3QNUA 1RRCA 3CPEA 3VTKA 1JQJC 3LQRA 3P32A 2P6RA 4X8LA 1VMAA 4QHYA 4LHZA 1U94A 4TSFA 1Z29A 2QQEA 2L0XA 3M0EA 4C4PA 1D2MA 5BQ5A 2C9YA 1P4SA 4A82A 2O8BB 2YOHA 1GRRA 3C15C 3EIEA 3OIVA 4BLPA 4F4IA 2IA5A 1KK1A 2ZUBA 3HYRA 4BEBA 3P4XA 1A2BA 2V7QA 3FTQA 3B1WA 3N2IA 4ZKEA 3I5XA 4LJ4A 2FA9A 4C0KA 1VG1A 1Z0JA 1A82A 3PCRB 1VCMA 4LJ8A 3C5HA 1W46A 1RYFA 3B9QA 3UPUA 2GJAA 1R5BA 3C41J 2FZ4A 2RGCA 2NO1A 4TMKA 1SKYE 2O0HA 1NVVR 2ZRGA 1I4TD 2EVWX 4ASUA 4P31A 1UADA 2IXEA 1U8AA 3RS4A 3T1OA 4PHGA 5TVKA 2OG2A 3R20A 4RZXA 5KYKA 1XPUA 3OEEA 1N6HA 4M21A 4PC2A 1CS4C 3LD9A 4KYIB 4OI4A 4PTLA 4BPBA 3UMRA 3IBYA 4U00A 3TJZA 5FUVA 4JVSB 3UATA 4FWTA 1Z28A 4WZAE 2BBOA 3AB3A 3GFPA 2IL1A 2ERXA 1S0UA 4S35A 4XWOA 2CJWA 2GEVA 4MA4A 1BMFD 4URUR 1W36C 1ODFA 1XBTA 3H84A 5DI3B 4DDWA 1ZD1A 3HJNA 4Q66C 4BWYA 1SVKA 1NMXA 2IYUA 5BN5A 3CNOA 4YXWD 1OT3A 2Z4SA 5L3QA 2FFHA 2A5YB 4WA7A 4EPWA 4P4TA 3FHTA 1W49A 2D62A 4F93B 1G19A 2O8EB 4TL7A 4A0RA 1NN5A 3QVVA 2EWWA 4UQOA 3ETLA 621PA 1E2IA 4URYR 1E1QD 4UNQA 4EKDA 3U5ZB 3BOSA 2VHUA 3B6EA 2X19A 1VECA 3BXZA 2PJZA 3GJ0A 1IY0A 1KI6B 4AYXA 1N6IA 4I4LA 4GP7A 1XCGB 1RRPA 4DLTA 4RD2A 5CIQA 4MDFA 2NQ2C 3VU9A 5F9FA 2OCAA 2BJVA 1DG1G 3GFOA 3MD0A 4NONA 4OI2A 4US0R 4C3ZA 3RABA 4DB2A 1BOFA 3AGQA 2JA1A 4I1UA 3IBGA 1UKZA 4N0DA 3LA6A 4QGFA 2JJ1D 5DN6A 5FOWA 4LCBA 3MUFA 4B3CA 3I3SR 2IXFA 3EPLA 2QN6A 3VMFA 4Z1MD 3R8FA 4MRPA 2MSDB 1E9EA 1W47A 3CWZA 1U98A 4R98A 3GLIB 3RANA 2UZIR 2B8WA 2GBLC 1BO6A 2ZAMA 4D4JA 5CDFE 5JFGA 2OV2A 2PH1A 2AFIE 2J3EA 3KTAA 5G40A 3IQXA 1TF2A 3OF5A 1OJLA 1S3GA 1E2PA 2J0UB 3B60A 3A4NA 4JL8A 3SBDA 3X1YA 3FKQA 3MWJA 2QQ0A 4B43A 2WM9B 4XH9B 3CWQA 3TVTA 3QG5A 3ICQB 3U7FB 1US8A 4KO8A 1E99A 4XD7D 2BOVA 1SXJD 1XP8A 1N5IA 2WKRA 2XAUA 1A5TA 3VKWA 2GAAA 2LWIA 3ZDQA 2B21A 3B78A 3CNLA 2CJWB 2UVQA 4DCSA 2C77A 3WHLA 1IN4A 2RHMA 3NDPA 1KI2A 1YJ5A 2ZRJA 3FHOA 2GEDA 1AZTA 4B71A 1ZM4A 4NYMQ 3KX2A 4F92B 3OFND 2ZI3A 4BLQA 2E87A 2NGRA 1JPJA 4IDNA 4B75A 5FH9A 4OHYA 3KKMA 4C30A 5BWMA 4FMDB 1Z47A 5DH9A 4LHVA 4BRUA 2P2LA 2GBLA 2XZOA 2NO9A 3CO5A 5AJWA 4A0GA 2JGNA 2GF0A 5GVSA 2PT5A 2VHQA 1MR3F 4AURA 4OI0A 2HXSA 4X8OA 1JXOA 4OK3A 4HB2A 5DN6D 3LNCA 4PO1A 4JBWA 4B32A 3LBIA 4ZCIA 1Z63A 3NXSA 4WOPA 2GCOB 1TUEA 4P33A 3UIEA 4WBSA 3K0FA 1KNXA 4AYTA 4PANA 3UG6A 4KFTA 1II0A 4FCVA 4IEIA 1DAKA 2NZ8A 4NYMR 3V9PA 4HATA 3AVPA 3QIAA 3GLFA 1J8YF 1GAJA 4UXHA 5KPDA 4W5JA 2K5UA 4U7DA 2EFDB 4G01B 3OIWA 2FFBA 1YRBA 4Q1DA 4UJ5A 4V02A 3AUYA 2ONJA 1JI0A 4G3XA 4UNSA 2JLXA 1G291 3A1UA 5FTKA 4C0JA 2RGDA 5DE3A 3AF0A 4IOMA 4NCHA 1OH8A 4IDHA 2GZDA 2EFEB 3O47A 1Z08A 2YOFA 4QBHA 3TKLA 3TH5A 4IDQA 2ODBA 2PMDA 221PA 1OLOA 2W6ID 1EG7A 1ZNWA 5JJIA 3WY9A 1XTSA 4PAMA 3W90A 5DHAA 4Q4LA 5C46F 1KI4A 1XJQA 4M1TA 2C98A 1A4RA 2EFHB 1Q3TA 4XWAA 2N1BA 1SXJE 1Q1BA 3GJXC 2YHSA 3QXHA 3WMFA 1OXTA 2WIAA 2WJYA 4BFSA 3V00A 1XU4A 3EA0A 1XMIA 1R5NA 2EW1A 4ZPXA 4Q4AB 2W6IA 1XFAA 4QBGB 4B3DA 3U2QA 3LBHA 4URVR 3KJHA 2V3CC 4C0SA 2DYKA 1LF0A 3N5CA 4MH0R 1T3SA 2CLCX 4LWZA 4CEIA 2V8OA 1E9FA 2AD1A 2VA8A 1W7AA 2I4IA 3PXGA 4HDQB 3K1JA 4XVUA 3VX3A 2XEXA 3FHCB 2G9NA 1M8PA 4D0NA 3G82C 1Z6GA 1KDPA 5F98A 2OZEA 2LKDA 4EJSA 1J2JA 3SBEA 1KIMA 2Z6VA 1GL6A 4M9SA 4X8HA 3O8RA 1NY5A 4B3FX 1KSGA 4P4SB 1O3YA 2VBCA 3A58B 3EZ2A 4UNRA 1GRNA 721PA 2RH5A 4QG7A 2FE4A 5FPTA 1GL9B 4Q4JB 2CCKA 1DAGA 2GZAA 1M6NA 2B8TA 3GFTA 4BFXA 3MMPA 2HJGA 3KKOA 3Q7QA 4JLOA 4ACAA 4ZIRA 1YQTA 5IT5A 3AF4A 4ILEA 1M7HA 2NOAA 4U02A 4DB4A 3DM5A 4HAYA 1C4OA 4LZZA 4PSVA 3TSOA 1OFUX 1IM2A 5FOXA 3U60B 2ZIAA 2C99A 2JLQA 2JIZD 3KQNA 4HYYA 4ZIRB 1K6MA 2EFGA 4JYCA 4PHHA 3SEAA 1D5CA 1KY3A 4RSGA 1MT0A 1EFRA 3HPRA 2IS6A 1CTQA 1RJ9B 1B23P 4RY2A 4PXAA 3KZ1E 2HLDA 5A5GA 1GNPA 1NSFA 2EU8A 5IK2D 1BMFA 1E0KA 1QHSA 4JS0A 3AF2A 1FMLA 3QUSA 4TYYA 4A6PA 1AKEA 2O8DB 3CX6A 3CZPA 4A4DA 5EE9A 3VR6A 1TADA 2B92A 4S2EA 5FBVB 3W8NA 2H7VA 2HF8A 3K09C 3PR1A 2NTYC 3JVUA 3KQUA 5J4HA 4B3XA 5IK2A 2OLKA 1CR1A 1E9AA 3AVQA 4LX0A 3K70B 4M1YA 4DCTA 5CLQA 4PZYA 3AUXA 2OBNA 2R6DA 3WNDA 5TB5A 1E2MA 2FJUA 5FPKA 3EW9A 3GJ8A 2OSBA 2BWJA 4JLDA 4Q4HA 5TARA 3GQBA 5HZHA 3MJRA 2ZU6A 1F60A 1E4VA 1TUIA 4GP6A 2C5LA 4HLUC 4CRWB 1OH6A 4FI3C 2G6BA 1ZNXA 1KI8A 4M2LA 5JRJA 4FCTA 1XRJA 2BDTA 2F1RA 3QI2A 2TMKA 4UJ3A 5CM9C 1ZJ6A 5DSZA 4Q9KA 1ZC3A 1W0KD 3GLHA 3F5FA 5KPJA 3DL0A 2I3BA 4QM6A 1KO7A 1VCOA 3Q8XB 4YC7A 5AWFC 2ZITA 2V4ZA 4JMPA 3EAQA 3T15A 5FR2A 4EIWA 3AKEA 3BFVA 3LXRA 4IRUB 1ZM9A 1NP6A 1CF4A 2RGBA 1HYQA 3PUYA 3SU8A 1ZNYA 3KUCA 1AK2A 3REGA 5BXQC 3KQHA 3B13B 4MITA 2Y8EA 421PA 3GD7A 4Q4AA 4RZ2A 3RS2A 1YR9A 4A8JA 3CH5A 4KBGA 3QQ5A 3RLFA 2DWPA 3TLXA 3L8YA 2QSYA 1LY1A 2WJGA 3QPVA 2GDJA 3RVBA 2Z5FA 4O0MA 2OLJA 2PL3A 4A92A 2DFNA 2CDNA 5KO2A 4B2LA 5CB6A 4DEXA 1JR3A 1DBSA 4Q02A 1COWD 2CK3D 1UFQA 2W0MA 1Y3AA 1CJVC 4B2IA 4TLAA 4Q00A 3TGPA 2FV8A 4AI6A 4PO8A 4LHWA 3OE7D 2GWHA 1TQ2A 1PLJA 5JMTA 1Q21A 5K8TA 4M22A 2PLFA 5EXXA 4CEJB 2GCOA 3OFNA 1FNMA 5KNBA 3K9NA 3AVOA 4XSHA 2CHVA 1P61B 5DI3A 2PEYA 1G7SA 1EWRA 4MGYR 2OEPA 1M7BA 4L9WA 4EFLA 3H1TA 2QUZA 4OJQA 1P2UA 2XZPA 2FGKA 4HLQB 1DAMA 3HWSA 5CK4A 1XEFA 2AFHE 4PO9A 1U2RA 4H1UA 3DOFA 4MRNA 2ONKA 4IJMA 4DXAA 1AA9A 5CB8A 1QHGA 2F3TA 2A78A 4YDHB 4WAUA 1T8TA 1Q1ZA 4DIEA 4R9UC 3ASYA 2V55B 2IYTA 3I61A 3QBVA 1SVSA 4IOJA 4I1OA 2ZRFA 2FEOA 1T5IA 4E09A 1P75A 3HU1A 3AF1A 5GJWC 3DEFA 1U81A 4HAUA 5FL7D 4WXPA 1FOEB 4Q7JB 1YE8A 2PX0A 4C2TA 2HT1A 2DFLA 1G1MA 3OAAA 1U0LA 4DSTA 1DG3A 3IEVA 2G0NA 2ASEA 4GMDA 2JJ1A 1KJZA 2ZJAA 1M34E 4DBLC 2QEQA 1HY3A 3NEYA 1W44A 2IC5A 3H0KA 3HYTA 1M1YE 4Q18A 1N5KA 1BYUA 1HE8B 1QHNA 5BN3A 1CRPA 5BYKA 5FTLA 5KU1A 4QM7A 2FPMA 4KFRA 3VFDA 5JBQA 2BC9A 5AJZA 4AWXA 5C1BA 2RAPA 1DVRA 1Z83A 3U6KA 3V4RA 3OESA 4V0ME 2ZRKA 2ZE6A 3FB4A 1P60A 2IYXA 3KL4A 4DDVA 2OESA 4JKIA 2J0UA 3Q7PA 3VR4A 4LJ9A 1KI6A 1IN6A 1CIPA 3U44B 3A1WA 2H18A 2WV9A 1XMSA 2FWRA 2ZPTX 4DLZA 4LBZA 4QJ3A 2MMCA 4HB0A 4EAQA 2C95A 2WWIA 3MFYA 2XSZD 1XDBA 1XD8A 3HDTA 3VQTA 4TTPA 3ECCA 3K0EA 1ONBA 4P0TA 2CHGA 1G18A 1W36B 2P5TB 4BFWA 4WZ6A 3KXIA 4P32A 2VPPA 1E9RA 2XJ4A 3ZVNA 1GKYA 1X3SA 1XF9A 4BQSA 1XXHB 3TE6A 1M74A 3F0TA 5HE8A 4C0QC 2CMKA 4YXWA 3C16C 4B76A 2P6NA 4GSYA 1NVUQ 3AQ4A 5CYPA 1NLYA 1AS3A 2GXQA 2Q3MA 4AKGA 4NHOA 1VYVA 3GCGA 2CXXA 1II8B 2QTFA 2ZJ2A 3A37A 3Q85A 1J90A 2RGNA 3RS0A 2A9KA 1G7RA 1GKIA 3NG1A 2I1QA 1G6OA 4PZZA 4YMSA 1G8HA 5ANRB 5DI9A 1IHUA 1AQUA 2AXPA 1P5ZB 3M1IA 5EP3A 4V0MA 1S2MA 4EPVA 1E2EA 4KYUA 4Q48A 1K8RA 3UXMA 4PC7A 1GFIA 1EFTA 1HEIA 2A5JA 2FX3A 2WHXA 3RS5A 2QENA 3NBZC 4DUGD 1XTRA 1L4UA 3C5CA 5CM8B 4JLNA 4JBXA 2IYSA 5H68A 1OYYA 1F6BA 2QU8A 2W2TA 2ZEJA 1JXMA 2REBA 3GEIA 1ZBDA 4LPKA 2XITA 2YNMA 1FUKA 1UDXA 4YONB 2WSSD 3TAHA 3CLVA 2OUKA 4A2QA 3L2OB 1R2QA 1JALA 1SZPA 2P6UA 4P4SA 3A8TA 3PEUA 4ON9A 1MABA 3K0AA 4N3NA 1MO3A 4TMTA 1Z5ZA 5J4VA 1QG4A 3WBKA 2AX4A 1ESNA 1DELA 4PHFA 1IY2A 1F2TB 2IK8A 3RC8A 1TQ4A 4AKHA 2HEIA 2EFCB 3TUIC 3AV0B 2GXUA 1G20E 4GMXA 3AVWA 2QP4A 4HAVA 3LW7A 4B3GA 4NH0A 1AS0A 2QE7D 3FMFA 1A7JA 5EQTA 3U3OA 5IDVA 3OEHD 2H92A 2QMOA 1N25A 1LTQA 3I1FA 5EE3A 1Z07A 5J5CA 4A36A 3AVVA 2B7CA 1DAFA 1LFDB 4NCKA 4D26A 1UF9A 2R65A 3SQXA 4TTRA 4I99A 2ATXA 5CIWA 4LC1A 5C2JB 1U9IA 1W5SA 3OHMA 1E2FA 1DAHA 4DSUA 4BUJA 2VEDA 2NO7A 1EXMA 2CNWA 3LY5A 2GTPA 2FZLA 3QF4B 4GOXA 1L7VC 1DEKA 2ZRBA 4B6EA 1ZIPA 2ODNA 5DHFA 3ZGXA 5K8IA 4F4JA 3L0PA 2BMEA 3BH0A 2UZ3A 1S1MA 5JLJA 2ZJ8A 5EXTA 2GJKA 2IBMA 3IILA 4QBFA 5EUMA 1QRAA 1Z0DA 4DRZA 3GLIE 1E0SA 3ICEA 1HV8A 5EP4A 4BECA 4II7A 4NYJR 2W2XA 1XWIA 1ZU5A 4NCNA 1TNDA 4QHSA 5B57C 2ZRAA 4UXIA 1KSFX 4B47A 3CX7A 5FBRB 3ZQJA 5SZKB 4AD8A 2QGZA 1KI3A 3QKUA 3CRMA 2NO6A 1TX4B 4Z8YA 4A8JB 3DOEA 4ITRC 2D7CA 4K46A 4LC0A 1OXVA 3A36A 1N5LA 1COWA 4RD6A 3VR5A 2BHRA 1JR6A 2R6GA 3TRFA 1E9CA 1EFRD 1YZQA 2X2EA 3CPHA 4ZDWA 1BIFA 1AN0A 1NNEA 3FVQA 5BW8A 1CJKC 4LV5B 2G0TA 4HDOB 2FSHA 5KSZA 3EX7C 1KK0A 4FW9A 3CRRA 3GJ6A 4BEJA 2KE5A 2VL7A 4OI1A 4CT5A 5BN4A 1QHHA 1VDZA 2IXGA 3GLHE 1FPMA 4OYHA 4QGGA 3NHAA 4LYHA 3ZVMA 3TQCA 1E2HA 5E4FA 4JJZA 2G1KA 4E03A 4ZDKA 2BJWA 4L15A 1IJFA 2ZE5A 3GLIA 2ZUDA 4ABYA 3EC2A 1NRJB 4TQUS 1P9NA 1NN0A 1EGAA 3N70A 5H1YA 5J4YA 1QHYA 1VG8A 2OO7A 2XB4A 5FOUA 2ZR7A 3TAUA 2ZROA 1J99A 4NP6A 2IEZA 2F1IA 1SVIA 2NZJA 2XOKD 4PSKA 1XTKA 4GPTA 1OV4A 4M1MA 3ADDA 2AKAB 4MUBA 3RS3A 4JYBA 1HA3A 1UBGA 1XEXA 4XJXA 4DC9A 2WMOB 4DLVA 5FBWB 4O2RA 4Q9LA 1NG1A 1P72A 1ZW6A 3EPHA 3K9HA 3PENA 2GJSA 2WPDD 3V4FA 3G0HA 2WKPA 1UM8A 4KFUA 4TLEA 4URXR 1NIJA 1GUAA 2RKOA 1RJ9A 2PJRA 1G5TA 1N6LA 4EQ6B 5E7IA 4P4UA 3MWLA 4AKEA 2ZVQX 2Z83A 1G8FA 1TQDA 4YMTA 4ARZA 4B33A 5K8UA 2FSFA 3KXLA 3CX8A 3OZXA 1X8LA 4LPSA 4GOJA 4ESVA 2PEZA 3R7WA 1CEEA 1GKUB 1QZXA 1ZM7A 2PZGA 4N0EA 5FR1A 1X8KA 2GEUA 2QP9X 3HPQA 3I72A 4D0LB 4L8GA 4JT2A 4KLZA 4CDGA 5FBLB 1NJFA 3I62A 3C7KA 5CITA 1Z8FA 1XEXB 4LDJA 3NC1C 1SVWA 4Q9HA 1NMYA 3KFXA 4ZV4A 1F2UA 2Q3FA 2QRZA 5JWHA 1W48A 1XZPA 2OXRA 1II9A 3E2IA 4Q1BA 4DLSA 5B64A 3MGCA 4TMVA 5P21A 1FL9A 1RVDA 4LUCA 4D81A 4KBFA 1T8UA 4WW0A 2H17A 1Z0FA 1EFHA 2C9CA 1MRNA 2F1HA 4JIMA 4U5XA 5CDFA 1E0AA 4C7OA 1R7RA 1VIYA 3QEJA 1M7GA 2FPKA 3RS7A 4XIGS 1E94E 4D25A 3KQKA 3T61A 2IHYA 1KAOA 1E9BA 4YMUA 2XGJA 1DTSA 3BS4A 3KFVA 4M4SA 4IOLA 2KSQA 5B58C 4GRAA 5KOYA 4UNPA 2QNRA 3P4YA 4DZZA 4CGZA 3CZQA 4F7WA 2X2FA 4QRHA 2JCSA 3DKPA 3QSYA 4Z54A 1C9KA 1OYWA 3CB4A 4DDTA 3WRYC 3BGWA 1E0JA 1U90A 3CF6R 3D3QA 1E32A 2J7KA 4OJKA 1IXSB 3K09A 4R71A 1MO6A 3FKSD 4TWZA 1ZVQA 3R9IA 3X1WA 3AP2A 1KY2A 1PZNA 1AKYA 3CNNA 2HUPA 2D4HA 2GXSA
chains in the Genus database with same CATH superfamily
3TIFA 3MUOA 2FSGA 5B4UA 5EWLA 5IJZA 1JHMA 1GG9A 1ZA1A 3P27A 5KSPA 2YYZA 1LU9A 3SLRA 4B83A 3ZHTA 4H7KA 2VXYA 4L9SA 3ME5A 2GO1A 2D0OB 2O2EA 1MJHA 4D74A 4P3OA 2XBUA 4RIIA 2Q2OA 2PCJA 3N2GA 3F8WA 1TQ8A 3I4LA 1XRLA 1L6RA 1Z38A 4MUAA 1UKEA 4JAVC 4KNYA 3ILYA 1IY9A 3MIIA 4UTRA 1KZ1A 2C92A 4LDQA 4B48A 3CLHA 1DG9A 3RU2A 3SMVA 3MQ4A 3H19A 2PKWA 3LMKA 3IC5A 5T4EA 2YVUA 4TRRA 3WLHA 3H1PA 2M6RA 3EVZA 2JLUA 1K6EA 1GQYA 2C5AA 1E6EA 2P35A 1U2SA 1KEPA 5H8WA 3QVTA 4ND7A 3BMOB 4OKNA 4QD3A 1EX1A 4N9QA 4BFLA 1XJ0A 4P8RA 1DNPA 3O8QB 2V6JA 5C8ZA 4KXQA 3E3AA 5D7NA 1DV1A 4ALNA 1NWHA 2NO5A 3AWIA 3GJ7A 2CK3A 3EFHA 3ESXA 2X2OA 1RHUA 1GTG1 2QTLA 4GEKA 4K9NA 4Y2RA 3UUFA 3AHDA 1PT7A 3FGPA 4KKVA 4R9VA 3RYFB 4QC2A 4LZJA 2GZHA 2OP0A 4MKZA 1ODLA 3ADOA 2O14A 3ZHXA 3FZGA 3ROKA 4K1LA 5CRIA 2J7PA 2M1XA 4M53A 5LBTA 1Z5VA 1JYEA 4IS3A 4F3YA 3THXA 4MINA 1S8FA 1JVBA 3GPLA 3O91A 1QVZA 3G5AA 4BFYA 1YB5A 4I6EA 3PA6A 1NI4B 1XKTA 1DDOA 1ISJA 5HTOA 3KK0A 4UAGA 2I99A 2QPOA 3M6UA 2UVPA 4IV5A 3VR6D 2KWIA 3HXLA 2R2GA 3B2NA 4YY3B 2H16A 1PUIA 4N01A 4P93A 5D7BA 3IUQA 3FDFA 3IYLW 3MXOA 4A8JC 1FXWF 3OBIA 4XCVA 4EPYA 1DOZA 5ITVA 1KQFA 3NBFA 1B8PA 1CXZA 3OCCA 5JY1A 3BMOA 1J2TA 3FYTA 1IQPA 3PDCA 4HDCA 5EFZA 2HAEA 4KVGA 2EQ5A 3H86A 3I1YA 3X44A 1IQUA 3VSBA 3W7BA 1OJ7A 2ZS7A 3E5RA 1KRWA 2LNDA 3JQBA 3VJKA 1TAGA 4CKEA 2ZANA 3W34A 3D54D 3ORQA 1O8CA 3HUTA 5GIPE 2O8EA 2LCFA 4P5EA 1WXQA 1OGJA 4NCIA 2I66A 3WBFA 4WXYB 3UFXA 2VZ9A 3UQYS 4TZKA 3L6CA 2W2MA 3PNYA 2XB2A 1L8AA 4K7JA 5BNIA 1WIWA 3PR2B 5TQVA 3QNWA 2VYCA 2PJUA 1GR1A 1BD3A 4PLGA 4P86A 3KJGA 4QPCA 3KT6A 3SFZA 4ZICA 4LYFA 2G06A 1EFVA 1ML4A 4F3KA 1BKDR 4ZCMA 4YDRA 4U0KA 5AK5A 3GAMA 4MYTA 2HA5A 4G67A 4CGYA 4DSOA 1W94A 2W2QA 2YQ4A 5D51S 3W5JA 4EVQA 1GQSA 3E70C 3MILA 5G3YA 4BZQA 3JARB 1ISIA 1B00A 1HYEA 1AGYA 3IHKA 2GBCA 3B6MA 1M34B 2QLTA 3QVUA 3UBTA 3EXAA 2X86A 1W2WB 2AMFA 2ZSEA 1PDVA 2PKRA 2YVAA 3C8DA 3I0ZA 3MJDA 4RH0A 5TF4A 3UMJA 3KLOA 4A9AA 3RUHA 5HVNA 1MZPA 4ARZB 4G1MB 3VZSA 2B3TA 4R2XA 5FT9A 3KS9A 2O6HA 3OZBA 3A9VA 4RLQA 4HVAA 4XOIA 5LOVA 3OSZA 4PLFA 4Q7KA 3SDSA 3ZCPA 1M0TA 1IN7A 1NVFA 4LFBB 1DQSA 4BRZA 3QOFA 1IEXA 2BT4A 4GOKA 4WZBE 4C01A 1JLRA 1MJ5A 2WFMA 4ZVOA 1UBMS 1CZKA 2BM9A 1ENOA 5FL3A 1N77A 1FTSA 2GERA 3DTTA 4LBYA 4G1FA 2PUVA 1H8EA 3U4IA 3DL2A 1GQRA 3FBWA 2OSVA 3AFNA 2XOKA 2RJ3A 4O25A 4CF5A 1MVOA 2WAXA 4I55B 5AUNB 1HRDA 2B6HA 4H0FA 1EVEA 1UAAA 4J90A 3FYUC 4LZNA 2Q1WA 3W3AH 4EB6B 4HNGA 3ROZA 3N8HA 1ZMOA 2QMYA 5CXSA 4DCUA 1TM3E 3K2EA 5AUOB 4WFQA 2PD4A 4LWOA 4Y6GB 2V0NA 3RYHB 3T06B 4JB8A 1NMQA 1D4ZA 5AI5A 4Z7OB 3PGLA 5BR1A 3T34A 1TF7A 3B2QA 1SA0B 1W9HA 5TT0A 3K8YA 4WKPA 1IVYA 1RC1A 2HKIA 1Q16A 3IAM1 4L16A 3BXFA 4H7PA 521PA 4EYEA 3NHMA 3L1JA 4L57A 2J9RA 1QMPA 3EZFA 2M6SA 2EF1A 4BP9A 2NVUA 4R8MA 3GCXA 2BFPA 2UZ1A 2IU4A 1C1YA 5ELXA 1NA5A 2Y0EA 2F1OA 2AFHB 1I4WA 1T6NA 2FR0A 2REQA 4MKRA 5GM2A 2IWRA 3ZU5A 1NWCA 3PXUA 2DLNA 3AHIA 4IO0A 4ASUD 4F2HA 5T67A 1KJWA 5F4BA 4CQLA 4AS2A 4BEWA 3R9WA 3HCPA 2IHZA 1W85A 4LYGA 1VFPA 2WK1A 4UU1A 4AK9A 2EC5A 1Y6FA 3CR8A 1G8YA 4JQCA 1VCHA 3G2IA 3P52A 3LX4A 4OYRA 4FLEA 2O8FA 3Q9LA 3ND6A 2ACEA 1IMOA 3QLVC 2SHKA 2QV0A 4QEZA 1FVHA 3ZLVA 2A7QA 1ELOA 2V7QD 4L51A 5D01A 5DWVA 4XYMA 1RLMA 1G41A 4FN5A 1C1DB 2JJ8A 5KNDH 1U6IA 2YCBA 4J7AA 1V8DA 4TMXA 1KEZA 2AYYA 1TEVA 1Z9BA 4LZAA 2QN9A 2W2OA 5EAIA 1SOUA 2HU5A 2UYYA 3CUSA 2YWGA 2G63A 4W9MC 3PQCA 1V4BA 2OFXA 3DE1X 4X20B 1DKLA 1NR1A 1C3LA 3GBPA 4FNAA 3K9LA 4KWEA 4A6XA 4YMLA 1XXHA 1Y33E 3ZX5A 3C3XA 4EABA 2ZUUA 1HURA 1JXQA 4ZO7A 1SVOA 1VIVA 1NBWB 4MI6A 2H4YA 1JEDA 4M46A 4YRFA 3C43A 5J40A 5GPBA 2PE5A 1GA4A 1X92A 1FRZA 2SECE 2ZQZA 3B89A 5FXMA 4FINA 4W6QA 3PEWA 3LX8A 3Q5DA 2VI5A 2C58A 2NN3C 4KO4S 4Q7EA 3SJUA 2AJTA 3SZRA 4JLJA 3FWYA 2AH5A 1U4SA 2CLLB 3T0FA 3THXB 4KITB 3E23A 5KYUA 4I9UA 1CUHA 4TT3A 1Z7BA 4RA9A 1K4MA 3HSYA 1XWWA 3RSZA 1UBCA 3P2YA 2ZWPA 4C4AA 2GDZA 5A0VA 2Z4TA 1ZK3A 4G86A 2ZXFA 1XZQA 1A27A 3G59A 4O4HB 4Q3NA 5EQJB 5BW5A 2ZUFA 1C9NA 3SZMA 3ZW9A 3SS7X 3DHWC 3AG5A 4UNNA 4KPUA 121PA 4LQ4A 1LS6A 2OFWA 4EY6A 5AW7A 2A4KA 4DSNA 5JNLA 2FP4A 3MINB 1NF9A 3WB0A 1RWKA 1A5SB 1WXXA 3ZV7A 5IX8A 3QBEA 4RJLA 2XCIA 2R6CA 1C3OA 2NSJA 3FNQA 4ENTA 4PX9A 3OOJA 4FN4A 2FEWB 4DWJA 4N3GA 4WBNB 4IYJA 4EMTA 5I7UA 4DNPA 4IFEA 3RVDA 1HGXA 1MMFB 4XTCS 3EGIA 3DBHB 2DJIA 1KVQA 3R0VA 3BRWD 1NXXA 1WPGA 1QFZA 1LJLA 2HLNA 1UZNA 3A3PA 4IVQA 4PLTA 4W5HA 1OIVA 2HQBA 4EJSB 5I9IA 1RLTA 1SH7A 2IYFA 3HGTA 2C4VA 2IH4A 1P18A 4EFKA 3VV2A 5AW8A 4L6CA 4PSAA 1V8OA 5GTDA 1Q12A 1X80A 4EKIA 1LRLA 1DO2A 2C8LA 3ETGA 3PPYA 2GEFA 2HLHA 3SOPA 4F1JA 1ILEA 2GJ4A 4K1XA 1BMDA 1GZVA 1YC5A 3LRXA 1ECPA 1U65A 3B1ZA 3OZSA 4ZAZA 2OXIA 4X63A 4DHEA 4B3SB 1X1EA 5H3CA 1ZD3A 3HU2A 1OFHA 3O0DA 1A98A 2EATA 4XWWA 1L5WA 2NAPA 1P8JA 2OQIA 3NO4A 5AKYA 4QU5A 3VKFA 2GETA 3JALB 3LYAA 1XCMA 3RVLA 1G3QA 4MK4A 1DWQA 1ABEA 1SU6A 4WEOA 3QEAZ 1QH8A 4X7RA 4EJSC 2WBLC 4L22A 4BNLA 1SKBA 4J6EA 4X90A 3MLEA 2HWYA 2WJIA 4CDNA 3AL0C 3G68A 1AF4A 2VJOA 2ZYIA 2BKAA 3FZNA 3LYUA 3UH0A 3ZCVA 4XX1A 2RIPA 1MEOA 4Y2TA 5DM1A 1IN8A 4KU4A 4Z9XA 3BCSA 1NTOA 1PD1A 2DWQA 1GUYA 3HCNA 2QQGA 4N76A 1N2BA 4HDRA 1AQYA 3A6FA 3B53X 3V8EA 1Z06A 4D4MA 3NTRA 4DUGA 1PZGA 2UXDB 3NNDA 3VKGA 2BHTA 4KODA 1L4KA 4O4JA 3L8FA 4ND8B 5JS8A 1I7NA 2XXJA 1LC3A 5IK2A 3TDMA 2PMBA 3CNBA 1ZVMA 1EFUA 1FFBA 2YBDA 3IO5A 3JZFA 2PYDA 3B5EA 1GNTA 2WYIA 1NNSA 4ZEWA 5BRNA 3BC1A 3VUFA 2HU7A 3BE5A 3L8ZA 4C5AA 3K8OE 1PR9A 3LCJA 1HFEL 2EX0A 3ZWDA 5EWMA 4GPIB 5HGXA 3H1FA 3MNFA 1ZR4A 4L02A 1WF6A 2FPRA 2Z3VA 3FNFA 2EYQA 4QVKA 3N2ZB 4YH1A 2YDYA 5E1DA 5FUQA 821PA 2UUBB 1QRUA 4UU0A 5KZMB 3QMVA 2O8BA 3PQ4A 3UJ9A 2WUEA 3J81k 3UQZA 2FETA 1TMKA 3VNVA 2WKSA 4MKFA 5DISB 1KZHA 4M1KA 1IWBB 3O1IC 4FW8A 3V1NA 3NDBB 3RRYA 4YUYA 1RBZA 1RCUA 3C87A 3HKCB 1WZUA 2VUTA 1K4KA 1FU8A 1Q74A 1B6SA 3GV0A 2X0EA 3THRA 4CE6A 1S7GA 1HLDA 4NAUA 3AERA 3TOXA 4QBTA 3PX7A 2B35A 2AWNA 1YI0A 3OQPA 3VDMA 1CP2A 3CVJA 1M73E 2V0CA 5CH8A 2FKNA 5HIAA 3NLLA 1KERA 3EASA 3STWA 3BILA 3WZMA 4O2AF 3QE4A 9LDBA 2RH9B 4UTZA 1ZOPA 5DLQC 3MELA 2B1IA 1SKMA 5DULA 1KO5A 1KMMA 1P45A 3BRCA 3QYJA 4WASA 1XL1A 3ZYCA 2V0GA 2DCMA 3A26A 2FZGA 1YNSA 2JDID 1WUKS 1H5QA 3JCZA 4I8DA 1QQ5A 1YBAA 1P7VA 4Q24A 2ZTUA 2NUTA 4L8VA 3UAVA 4AO8A 3GJ5A 3U62A 1HL3A 2LD4A 3I2HA 3KKZA 4OHPA 5G53C 2H5IA 2X0RA 1JVSA 3MJHA 2YTZA 2C9MA 4Y2SA 2P2ZA 2Q1TA 3U4GA 4OBEA 2C96A 1ZNQO 3PX2A 4JLAA 3SHVA 4Z5XA 1MW8X 1VKNA 1WW3A 1K5GA 1RPAA 2RKWA 2X40A 4XWGA 1I4DD 1QK4A 4L95C 3VNQA 1FNBA 2AI3A 2PK3A 2X15A 2UZ0A 3QVGA 4KIUA 9LDTA 1U3UA 2QZSA 1Q1QA 2GD1O 3BREA 4PWZA 2PNJA 1S2NA 3LT2A 3FHLA 2X8JA 2ZBQA 1P62B 5AHOA 4KFCA 5AVUA 3H5OA 4JFRA 4OMCA 1ZMXA 4IIVA 3RJMA 1U8YA 1MKYA 3H8SA 1TYCA 2L2QA 2B1JA 4NZZA 4TVBA 5AJXA 1WZEA 3ESYA 4GX1A 2VNIA 3IAS1 3QPCA 4FCCA 2XDYA 1U4NA 1SC4A 1K0UA 4X6UA 1YKFA 3EJWA 3EPRA 4D8XA 1G4UR 1IUOA 3WICA 4TLCA 4XVHA 4MS1B 1J21A 1YS9A 3TQFA 4CMIB 3WO0A 3RRMA 2YICA 2AC4A 1Y9EA 3FOFC 3A04A 1KWKA 2BTEA 4L78A 3GLQA 1YL5A 3VYSB 3R3JA 1NI4A 3RRNA 3UAZA 4MS3B 3WNBA 1YR6A 3HJGA 3K0AB 1GNLA 2IKSA 2W6QA 1UK7A 2J33A 3N2KA 1WY7A 3ESBA 3WJ7A 4A6EA 1YJXA 4R8LA 4BNDB 4J07A 4BU0A 5EZQA 2VAMA 3AKCA 4NPAA 3NTLA 4XGIA 4P7GA 4K6MA 5LB4A 4V0RA 4EPXA 4EM6A 3CBGA 5CVVA 2FP4B 2OCPA 3NDJA 2A0KA 2FUG6 1P7ZA 4OMFG 1NW8A 1XA0A 3BB1A 1X7WA 3JR7A 3Q0IA 4N7BA 2GYWA 3ZX4A 1J2YA 1V26A 1J24A 2VK2A 1RZUA 4OL0A 4IM7A 2XRZA 4JI2B 1WSWA 1YB4A 5DXAA 2BM8A 4BYMA 1OFIA 2VHCA 4C6SA 2WMDA 3LW8A 4PEVA 5TPWA 3ZW8A 2FZKA 5JJ5A 4GR4A 1I6WA 4V0KA 4ROTA 2O7VA 5EP1A 4KSCA 1WQ4A 2FGJA 2FLKA 4OHFA 5DSXA 3U4QA 3LVRE 1E2BA 2FXVA 1FLVA 4R8RA 4PBSA 3B8HA 3DOOA 5A02A 4BO8A 4EI9A 2BKLA 1LLQA 5J3JA 3QLVA 1ECLA 1AXGA 2NU7B 1G0NA 2IP2A 1NOKA 2R7KA 2RC6A 3EARA 3IV9A 1ZGZA 2O1WA 3L84A 3R77A 4OHXA 3F2VA 1KJYA 4GFDA 3AEUB 4B0OA 3VA7A 1MQ8B 4L7QA 3ZWNA 3DMTC 3NKFA 1ATZA 1SEPA 4I9HA 4QHTA 1OXSC 4E2XA 1B2LA 1KETA 3H2HA 1OHHA 2CLSA 3IHWA 3KBOA 4IGAA 4S1WA 2YY5A 1WSAA 1ECFA 3EGXA 3PF9A 3PUXA 5JSYA 2VRWA 2ZOSA 5K3DA 3RUAA 3WMXA 3EFBA 5CJ2A 5IM4F 4JL5A 3QX9A 4CLRB 1QB7A 1ZNZA 4K9LA 4OM7A 3KSRA 4EHIA 3ZH9B 1DEOA 1W93A 3ZDRA 2DKNA 1JAHA 3ETNA 4OBWA 3X43A 5KWIA 3OLYA 4HS4A 4GBMA 2E1RA 3VHLB 1TK9A 3QMWA 1ZGBA 3FWZA 3PYLA 3MLAA 4MROA 5C8VA 5CT8A 4PQEA 5EKUA 1JHUA 2OHXA 4BGIA 3N8IA 1JS1X 1JX6A 1DOAA 1BGVA 3ICCA 1DUSA 1JDSA 2QI9C 3MBIA 4B2PA 3IODA 4MKHA 2JLYA 2QJRA 4U39A 5IANA 5DBFA 2FRDA 1M6HA 4R31A 2FSSA 2OD7A 3DBVO 2F8TA 4M99A 6AT1A 5HKKD 4XB1A 2IDJA 3QHQA 4JI5B 1WU7A 1SG9A 1U3FA 1B6TA 5JZVA 4V24A 5ILOA 2QLJA 1OPXA 3NI2A 4HDSA 4ZQCB 1MV5A 2C78A 1HRKA 5FLYA 3OX1A 4L5CA 2FU5C 4AC9A 4E33A 2F43B 4HEHA 3HE3A 4UUQA 3GLSA 4WKNA 1WHTA 3EJ6A 3V2HA 2VCYA 4YMWA 5EE1A 2B6NA 3GGSA 2YYSA 4KTTE 1TM4E 3MWKA 4J0JA 5CP8A 2IV7A 5G1NA 3SHWA 1R66A 3H13A 4JEIA 2XMPA 1EE1A 4TXMA 5EEHA 3AESA 3STHA 4YRBA 1JIJA 4A2PA 2H7YA 3IXMA 1SOWA 4IVPA 4I4TA 3G1UA 5K6AC 4HNAA 5JE8A 1P2SA 3G2NA 3RYTC 3DE5X 4KWCA 3VVMA 1DCTA 5IKXA 1E3WB 4I5EA 4MVJM 1JAXA 1LBSA 2J4CA 4Y0VA 2F3SA 4M49A 1G0OA 2RI1A 1G8JA 4X1IB 1E66A 2Q8NA 3KKNA 1VJ0A 2DSNA 3W3AA 3UV7A 3WP1B 2LZ0A 1YVDA 3IO3A 1P0PA 1N0IA 2WU0A 3LQ2A 4ZCPA 3DVAA 4NYIR 4AZWA 1E5TA 1AT1A 1AXEA 1N3IA 1ULAA 1UMBA 5JBNA 2OB2A 5ALSA 4R0VA 1ZO8A 4MUEA 2AXNA 1XR3A 3WSWA 1EHIA 1X6VA 1NLUA 4JT8A 3EG5A 1OMOA 2WYVA 1S4MA 2XMSA 2Z8YA 2IY8A 1MH1A 3FUWA 3U3JA 1KY4A 1EGMB 1M2GA 1NQ5A 1WCIB 4IJ5A 3TUJC 1SHJA 4EI8A 3A1FA 3A31A 1R10A 3K0CA 2CLIB 2HZ7A 4CFSA 1T4CA 3DNPA 3CB2A 3MA0A 4YI3A 1M76A 2NTVA 1IZ0A 3A3YA 1K86A 2V9PA 1V16A 1TVKB 3K35A 3P0JA 4H31A 4N8SA 4CWAA 1QH1A 1Q77A 1JG2A 1QK3A 5K0LA 5HZKA 1P1IA 5JALA 3OZGA 1M2OB 1IM8A 3EG9B 2ATCA 3NTVA 4JIGA 2JLAA 2P27A 1X2BA 2P2DA 5GZ1A 1WPQA 4NAVA 4BIMA 2XMDA 4I1IA 2WINI 3DC7A 3O6VA 3OIFA 4JBLA 2ZZKA 4NU8X 3AHGA 4YAOA 2CFSA 3KPWA 4FWIB 3PHCA 1I7PA 5KOIA 2I6UA 3LUBA 5LMZA 1YNOA 3BULA 3JPYA 4HB3A 4RV4A 4CMKA 3G8CA 2QRMA 4ND3A 4QYIB 1UWCA 5BSVA 2G17A 5HE9A 3LAWA 3F9CA 5ENVA 4XQ9A 1IXKA 5BQXA 3ZWAA 3LPCA 1ZCZA 2PZKA 1DPGA 2LDBA 4ERNA 3R75A 4Q03A 2ZRMA 2IIQA 4GMFA 5FI1B 3PEVA 3FOZA 1R9JA 1SVMA 2J3HA 1JEYA 2YFQA 5D3ZA 5MFPA 1XJCA 1ES9A 3NT2A 4JGBA 4NBRA 1IOVA 1QX4A 2Y05A 3WWCA 4BEVA 1Y7HA 4EG7A 4XM2A 1VRCA 1DHTA 2VRCA 4EFNA 1Q7CA 2B4TO 1USIA 1UZAA 2JB9A 1ULBA 3FJ1A 4GZLA 4UBNA 1JIKA 2I1VB 4H1TA 4BMCA 4DDUA 5JAHA 1GKKA 4PRZA 3TSZA 4TYNA 1LVUA 2G07A 1PF7E 5TMEA 1GAQA 2ZYAA 1CU1A 1AV6A 2AN1A 5AVWA 1OAKA 5HSGA 1NKSA 1Q0PA 3ECSA 4MIKA 4R2IA 4A0HA 1PVOA 5JD3A 2ZTMA 4M1SA 1UKYA 4W1PA 2B2NA 3AP3A 2VF4X 3JQFC 3Q7IA 4RJKA 3OIYA 5ESDA 4G41A 1G8SA 4I4CA 4Z6KA 1W2GA 1UBEA 4XJVA 4JLWA 3W2EA 2VIIA 1DSSG 2O8CB 4D2IA 1EK0A 1JAIA 1P6XA 2P3LA 2GVDC 2C7VA 1Q0UA 2PBZA 2GF9A 3BWMA 4TM7A 5TC4A 4EVIA 4MAFA 1PUJA 4W7SA 4KPFC 1XRNA 3HZRA 4OKSA 2IF0A 2VJQA 2P91A 1KOJA 2VXBA 2ZJOA 4JJ8A 1WPXA 2WSMA 4MJXA 4Q5IA 4IXWA 5AXAA 4Z86A 3HP1A 3LQYA 4EJ6A 3OCWA 2ZUCA 5DSTA 4R6XA 5JH7F 1B8VA 3ZWPA 4PHTA 3M6XA 3VDNB 1JAYA 5KTYA 4AQYB 5AI8A 3AI1A 1US8B 1VLHA 4N5IX 3TIGA 4BMOB 4EYSA 4EGAA 2AKEA 3WL5A 4BASA 5IUKC 3GLGE 1DKUA 1QDEA 3PE3A 3QJGA 1EE2A 2QMEA 3AH8A 5KREA 2XX3A 4UCFA 4NK5A 4EGCB 2JIDA 1EVJA 2Q1UA 3B52X 3GMIA 1R27A 1NBAA 3GVCA 4BWFB 4F6RB 5LU8A 1XLVA 3GCZA 2OHFA 3ZLJA 4PSDA 3W79A 4GRIA 4BBPA 5E3HA 3D3KA 1EK6A 5FOSA 4D7AA 3LZ6A 4HQLA 4W8GA 4B4WA 3EPJA 4C1BA 3A9WA 3L6RA 5JS2A 4JVLA 1P1HA 4WUTA 4FIZA 4BVLA 1F06A 3IMKA 3NGLA 1ZVJA 4Y2JA 5G3ZA 1XQ6A 1MAHA 2PSEA 1T8PA 4QJ5A 3WYCA 1QHEA 1DQYA 2F1JA 4KN5A 1JBKA 4W5RA 3WGKA 1GPH1 3ZJTA 3WGTA 4JA2A 5INTA 3VR4H 2NSYA 4FMCB 3N87A 3ZZ0A 5FRDA 4XLLA 3CUTA 3E9QA 3KSMA 1VGRA 2A67A 3N2LA 3CW9A 3A4TA 2GCEA 4OATA 1KR5A 1IBKB 4ENRA 1VLJA 1VGQA 2F3PA 4P3YA 3W5IA 3K70C 2O8FB 2BFWA 1QVRA 1XTJA 2HIGA 2I6SA 3H6KA 3ND5A 3QKSA 4D9NA 4DCMA 4OUDB 3V1LA 1G3RA 4DQLA 3KU1A 3BD6A 3KJEA 2M2IA 3NOOA 4UM5A 4MQEB 5CNJA 5IM5A 4G5RA 5L3QB 1NRWA 3DYBA 5D3MA 1CR2A 2Y1GA 1X80B 4F38A 2FSVA 2ZTHA 1ZD8A 1XK7A 2R7AA 2C0CA 1PW7A 3KHSA 5AKLA 3L0SA 1CF2O 1D0SA 1P2FA 3FJYA 3ODPA 3EIQA 3BIWA 4IQ8A 2ZB3A 3EA4A 4LTDA 5AK4A 5DM0A 5AOCA 3RU9A 5JNWA 5B1EA 1L4HA 3EGEA 2Z30A 4DKXA 2Z4RA 2QKYA 2W6JD 3RUEA 1H4TA 2VHJA 3O4FA 1NI3A 2WF9A 2QD5A 4HDMA 4ZQEA 2HHAA 3LV8A 4N6NA 4CIYA 3KKPA 2GT1A 3QPDA 4UHJA 4HBZA 1L4YA 3ROQA 4TSFD 3PC6A 5KUTA 3X1XA 3ZTWA 4BJ6A 2FN4A 3DB2A 1KAGA 2F59A 2DU8A 4D56A 1V8ZA 2AR7A 2HMWA 2V97A 2Q9UA 2Y6UA 4JQYA 2OAEA 3GRRA 4CM1A 3SVLA 5GM1A 2N46A 4UDOA 5IF9A 4R6WA 4CDRA 2ATVA 4FXPA 1GAEO 1HT1E 1RM5A 4DV0B 1UMKA 4IMRA 3VPSA 3MMXA 4CM3A 4PZLA 1IN5A 4LDZA 3GI1A 2NZUG 3O1LA 4WVLA 1ZM3A 1XEAA 1FYFA 1HX7A 4ZRNA 4DUYB 1P9WA 1TOAA 3A4YA 4OQEA 3W8DA 1L3BA 4O4JF 3JVDA 2XQIA 5KVAA 1Y9JA 1G9XA 3E8SA 4HDNA 1OQAA 4UUBA 3V7WA 5DK6A 4HFRA 1DAOA 1JJAA 4YROA 3VJLA 1CEQA 2DPYA 2DUUA 2RBGA 4PG6A 5IYZA 3A4VA 4ZO4A 1JIXA 4HTFB 3FIJA 3HN6A 1LV7A 3N8GA 1ZCJA 1N5MA 4RYDA 2AR0A 1WCV1 3UFBA 1NC3A 1PVVA 3NGMA 2WF7A 2QNBA 3FFTA 4PYNA 1J2RA 5CR9A 4LY0A 2JAQA 5DGDA 2N75A 5HFAA 2ZDHA 4GBGA 3BH7A 4ERXA 2JJMA 2GNAA 4KXMA 4O1HA 1TZBA 4ZQFA 5C8YF 1G5PA 3IIMA 1PQYA 3DMTA 3G88A 4E2ZA 2WD7B 3CXUA 3LYHA 1W4RA 4NQZA 1W581 4M1OA 1NMZA 1VDMA 1YE3A 4O02B 2QXUA 3STXA 3GA5A 3WWDA 4KAAA 3GP3A 4RQBA 4EG4A 3EIWA 4PIMA 1N5DA 1E1NA 1BG6A 3OP1A 1KK2A 4XGKA 5HBGA 1ZI9A 3FKJA 4MQ5A 2P9QA 3TW8B 1A9OA 3E6AA 1TAUA 1BEZA 1YGYA 3QENA 4LGVA 4JQOA 3RUCA 3E5HA 1IHPA 2CVFA 4B6FA 3ML1A 2VJDA 4TTQA 5AXDA 5DNYB 2R62A 1ZOLA 1LKZA 1YQXA 1PZXA 2RONA 1CCWA 3ONDA 4RZIA 5FUXA 4DV1B 2O8NA 3K1TA 5IJXA 4O59O 3WGJA 5JTUA 4KH1A 3R3UA 1P2DA 3LC7O 3PJRA 3EVGA 1H65A 3GGOA 4H35A 3H1AA 1SELA 4HQRA 4UEKA 5KYVA 1YTUA 1FCJA 2DQZA 4MR8A 2H85A 4J43A 1CQXA 4JSTA 5A5EA 4LY9A 1N9GA 3V42A 5LPNA 2A58A 4N41A 4R7GA 2DCUA 4V0SA 4R1UA 2GNOA 2XTMA 2GOYA 3LL7A 3DV0A 5AHRA 2G4CA 2A4MA 1X7YA 1KDZA 2XADA 4C03A 4P54A 2PH3A 4V0QA 1W5FA 3UJBA 1GP2A 2HQ1A 4IINA 2DUJA 5TQ0A 3KYJB 3ZZ1A 1DFIA 1KY5A 2R8ZA 2DAPA 1B8NA 1QOQB 4AF6A 3A1VA 2X5KO 2XGSA 4OQXA 4DGQA 5CX1B 3WBJA 4L1KA 3G5UA 1G6HA 2FOLA 3QPUA 3W1EA 4BV9A 2AI1A 4LQLA 4MTLA 3CLRD 3IBSA 1IMJA 5F21A 2W2LA 4HWKA 4WIAA 5AJVB 4RQUA 3OHSX 4YJKA 1ZQ9A 1GGFA 4X00A 5TR9A 1ACJA 5LC1A 3R8XA 4G9EA 2ZBEA 4HD8A 2QRHA 3BWXA 5J59A 1IXZA 4LJRA 4FC7A 2F64A 2Y1XA 3HYCA 1T2CA 1KGSA 4R8VA 4GZMA 2GNPA 3PQ3A 4LS3A 1MN6A 3HP7A 3KJIA 5DO9A 5CVEA 2FQYA 4PZCA 4R51A 3DEHA 5AVJA 4CF7A 2VNSA 1JB1A 2ZIUB 3PT9A 3CF4A 1CY0A 4L85A 4PG7A 2YASA 1O1YA 1E1LA 2CWDA 2O1XA 2XB6A 4HEJA 3T1YB 4DMCA 4KIWA 4DRYA 1VLQA 4BLTA 2ZRQA 1J8VA 5JAUA 1KMCA 2CB9A 2IUSA 3GBVA 3R0XA 4OB8A 4RFSB 3SQDA 1GDDA 1XFDA 3H2BA 3AKZA 1NW7A 3UCFA 2JZOA 2PRYA 3GFQA 3K9QO 4N0MA 3JQBC 2ZRCA 2BGJA 5CFNA 3K0CC 3PNLA 5BN3B 3HCFA 1KO1A 3FAZA 2IJGX 3UJ3X 4KP7A 2IY9A 3SDZA 1JQLB 1ORVA 2GQ0A 3DEKA 5B58T 2Y1KA 5KWEA 4TKZA 2EWVA 5K0EA 2OAQ1 4OHKA 2P79A 1HLGA 3LCMA 2X4GA 1GPLA 1DAEA 2LGJA 3OQHA 2XE7A 4FD2A 1T8SA 3HGQA 3RHFA 4KFSA 5KJCA 3KZNA 2DERA 4QG3A 2R97A 4CIAA 2A1TS 2XTZA 3NEJA 4NBNA 3G89A 5CW2A 2IHVA 4BJ3A 5DGTA 3O1JC 3AY7A 2NO0A 2ZJ5A 3ISTA 3ADKA 5IFLA 3L7IA 4LNUA 2DPLA 4KR7A 2OCYC 5G4KB 1E92A 4JCCA 4JLVA 4IF4A 1NOJA 4Y2XA 2L19A 1CQJA 3Q10A 4WK6A 3HC7A 4LRYA 4MPRA 3RLIA 1PZMA 3UT6A 1E58A 1GIAA 3FDJA 1I5EA 3PDWA 3JZMA 4QE3A 4RD3A 3O93A 1YCHA 5IDXA 2JH3A 2RI6A 1YRAA 1K97A 4RK0A 3WA6A 1UKBA 1WVIA 4HSEA 1MQAA 3Q40A 4CTKA 2E2WA 5JTTA 1R00A 3QKTA 4N0QA 4RYLA 3TZQA 1HQCA 3RAJA 5EA2A 2OILA 3O90A 4NBTA 1QHIA 4EUHA 2ZZMA 2H51A 3F8TA 5LCXA 4AJOA 4JODA 3PG5A 1L4EA 4L8FA 2Q7DA 1D8TA 2QTZA 5A9SA 3ESCA 3L0IB 1W8DA 4MPJA 4IDOA 4TTVA 4BNXA 1GWNA 1EUDA 5MGNA 3C1AA 1C9MA 2FUKA 3E1SA 3IIKA 2FAXA 4L6IA 5J63A 5JNUA 4BQNA 2QLFA 1J23A 2CHUA 1U28A 3NZEA 5I45A 2ZI9A 2WHPA 4K9MA 4L6AA 5CTJA 1QH9A 3W4JA 4EDHA 2OPBA 1FQJA 1XTTA 1ZH0A 3PIRA 5GY7A 1NYRA 1ECCA 2LKCA 2AQ8A 1SVLA 1I1NA 2HA0A 2YINC 2RGEA 4OFXA 1Z2NX 5LYJF 4GP9A 1FDSA 2G88A 4D9IA 5JZMA 1GPYA 3T8YA 4JJ7A 1EUZA 2ZYWX 3K73O 3QTBA 1ISGA 1Q1NA 4GQAA 2ANCA 1I4LD 1I6KA 1WB9A 3MHTA 1C2YA 4YIKA 5DYGA 3ZD8A 1N2SA 2G7ZA 3EG9A 1F51E 5EG5A 1LRJA 1AIPA 4XD2A 1AZSC 3M83A 3M4YA 3TL2A 4K9RA 2VJMB 4YCBA 1LZKA 5BYBA 1QC5B 1TUGA 1UMDA 2D3TA 2YXNA 4WLEA 1NBMD 2HU8A 4IIJA 4PS0A 4ZVVA 2E4AA 3O7MA 4F8YA 1XLWA 3E3MA 4RNDB 1KWGA 3ILXA 2NVUB 1SUSA 3WAJA 1ZN9A 2O3QA 4GNKA 1T29A 4HK4A 3KUUA 1RLJA 4K81B 1MABB 2FWNA 1VBNA 4RO0A 2I71A 2R87A 4NFLA 5IEJA 1QPZA 1KAHA 1V7QA 1KDVA 3U7EB 4NECA 2D06A 3L4BC 1DADA 1B42A 2O2YA 1EBUA 2H2DA 3IPRA 3DHYA 3LLSA 1SA0A 4BX3A 3Q98A 4M8SA 1VXRA 3RJTA 2FX5A 1H2WA 3RNLA 3G2OA 3HHPA 4C0LA 1LA2A 4LFCB 4RTPA 3Q3HA 1XROA 3DMPA 5DNDA 3AB8A 1YZGA 3LLUA 1N2EA 1QVAA 2Q9AA 5SYMA 3DVRX 3GZNA 1SFRA 4YMIA 4BAZA 1QRSA 3BXOA 3HH8A 4IZHA 2ZREA 4TVKA 4ZARA 4A23A 2QX7A 1OT5A 2PYIA 4B6JA 1KI1A 2G5GX 4E5PA 3QFCA 1V35A 3E22B 3PGJA 3GEHA 4V38A 2FWAA 1YZKA 3FCEA 1NR5A 2EEZA 2IEBA 3H8VA 1DZIA 1GRQA 4H16A 4KRGA 4KXVA 3TNFA 5LDHA 3V6MA 3VR6H 2ONYA 3MOSA 4TZTA 4CN9A 4EO4A 1YVUA 4XTRA 5SZIA 2CXPA 1E4OA 3GBSA 5ALVA 1KJ8A 3MPUA 3C7AA 3T5PA 4LF7B 4FR5A 1QHHB 5EEGA 1P0FA 1NZJA 2H1LA 3HR4A 3VX4A 4RVHA 1SHUX 2ZS8A 4BP1A 3CEMA 3VH2A 1ZBQA 4D9MA 4YJ2A 4I7EA 3Q7EA 5K2OA 3ONNA 4DLWA 1NVAA 2BEJA 2AB0A 1N5JA 2HMTA 3RKUA 4MDYA 4K8OA 1FX0A 4TMYA 1RPJA 1YCFA 3OQOA 1GCUA 1WA5A 1PJZA 3FSJX 2PRSA 2DXIA 1I3NA 2CVZA 4NMMA 1AH2A 2CZQA 2CL6X 5IASA 1W34A 3WWZA 4YUXA 1YHNA 1O9GA 3HKDA 3MG9A 1B1AA 1ETUA 4QA9A 4R81A 2QT9A 4G81A 4AMUA 1AG9A 2BE7A 5TXGA 1GV0A 3BQ9A 4II2A 1JJ7A 2D5AA 4LYYA 4JYZA 4NENA 1ZUNB 4KHZA 4KO3S 3SK0A 4YBRA 1R8XA 3LQRA 3PF8A 2SNIE 3P0RA 3TXXA 4QHYA 1EHYA 2QQEA 2L0XA 1C29B 2A1IA 3WYDA 1Y1LA 5DYYA 2I29A 5BQ5A 5EZYA 4LVOA 5DHUA 2ONZA 3S2SA 2O8BB 1LLDA 4TYMA 2V7EA 3KAJA 1H22A 3KVNA 3SBOA 2PS9A 4BEBA 4Q93A 3CA8A 4PBRA 1C3XA 4R3WA 1S02A 1ECGA 4RDHA 2GPWA 4JASB 4DC0A 4J1SA 4LJ4A 3L6DA 2FA9A 4YRPA 3UOWA 4C0KA 4XI9A 4OLBA 2B61A 2OHJA 2Y0BA 1AZLA 4YJ2F 1QGDA 1CERA 1YHYA 2SCUB 5FPPA 3C3PA 4LGCA 2HDWA 1JQEA 2JFNA 1XDZA 3B9QA 3R7AA 4C88A 1QU2A 2RGCA 1WX1A 1SKYE 1QBGA 4ZI7B 1TK3A 1ISFA 3E4DA 3DVSX 1I4TD 2EVWX