2YC4C

Intraflagellar transport complex 25-27 from chlamydomonas
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
198
structure length
177
Chain Sequence
KPIDITATLRCKVAVVGEATVGKSALISMFTSVVAPVTIPDTTVSVELFLLDTAGSDLYKEQISQYWNGVYYAILVFDVSSMESFESCKAWFELLKSARPDRERPLRAVLVANKPPQRHQVRLDMAQDWATTNTLDFFDVSNPPGKDADAPFLSIATTFYRNYEDKVAAFQDACRNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Intraflagellar Transport Complex 25/27.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Transport protein
molecule keywords INTRAFLAGELLAR TRANSPORT PROTEIN 25
total genus 52
structure length 177
sequence length 198
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2yc4C00
2AFHE 2REXB 5DNYB 4HB3A 1GILA 5AJVB 4BFTA 2JLSA 5KO2A 1JXMA 4Z1MA 3RNLA 5FBWB 4H1UA 1D2NA 4OJKA 2BMJA 4DLSA 2GJ8A 2R2AA 1RW4A 1U8YA 3QG5A 3CF0A 1D6JA 1T91A 3KKQA 3IEUA 3WMFA 4CEIB 3ASZA 4Q4LA 3EZ7A 2C2HA 2EWVA 1M1YE 2G77B 2XB2A 2ONJA 5FOTA 3KUCA 1YJ5A 3QUSA 1E32A 3QXCA 1P72A 1Q1ZA 1H8ED 4AYWA 3LBHA 5FOXA 3EW9A 2Y8EA 3UANA 1E9DA 2P5TB 3DM9B 3LQQA 4G0NA 3TNFA 2GHIA 3VKGA 1IQPA 1GL6A 1DAMA 2A3RA 2DCUA 2JGNA 1W0KA 1W44A 4M4SA 4MKFA 4OJQA 3BJIC 5GJBA 1E9FA 1GAJA 1WP9A 1XEXB 3KKMA 4UKDA 3X1DA 5ANRB 4X8LA 2IUSA 4PAOA 1U2RA 2JDIA 4I1OA 1KTVA 3CF2A 3H4MA 4QOSA 2J9RA 3Q7PA 2DWOA 2GCOA 1FX0B 5F9HA 2QRZA 1E94E 3U44B 1VYUA 4LBWA 4P0TA 3C8UA 4HB2A 4RCZA 3EX7C 3AF4A 4DCNA 1T0HB 1J7KA 3VR4A 4RVCA 3FKSA 2C96A 1SVSA 4HEJA 5DYIA 3PUZA 4F91B 2ERYA 1L4YA 3P27A 3L0SA 4GMXA 2J0SA 3QEJA 4G5OA 2IYQA 2P65A 4LPSA 4NE2A 1XD2B 1T8TA 3QBVA 1NRJB 4MITA 1Z3IX 2PZEA 5DYGA 4DZZA 4A36A 1JR3A 1Z6XA 3N70A 4JVMA 1VIYA 4MDFA 2V1XA 1Q57A 2AFIE 4IFEA 1MH1A 2W6ID 2EVWX 2GXQA 4Q1CA 1S96A 1F60A 5J47A 1P2UA 2KBFA 2GETA 2PZGA 1E2MA 4Q7JB 4TMTA 3W6OA 2IS4A 3UATA 2QPTA 5CIQA 2ZYVX 5CLQA 1MO5A 1IHUA 1WBBA 4Q9HA 2CL0X 1ZAKA 2QMHA 2BJVA 2YOHA 3BXZA 3T35A 5FTNA 4Y0VA 5J5CA 2P5SA 4RJLA 1KO1A 3U3RA 2RGXA 3I62A 3V9PA 2EFEB 1XTSA 4URUR 1VCNA 1T4GA 4PZYA 3A6PC 3G5UA 4P4SB 2ZRIA 2A2ZA 3LVRE 4CT4B 1YE8A 3CH4B 2D3WA 4UNNA 4C7OA 1E2JA 3PUVA 5HKKA 5JWOA 2WKPA 3CO5A 1ZNYA 3AF1A 4Q4HA 3ZS9A 1RIFA 4ZIRA 3LY5A 2KI5A 3QXXA 3A1WA 4M1YA 2BKEA 2HJGA 1OXVA 3PCRB 4IOLA 1VDZA 4MYCA 5CJPA 4PC2A 3SYKA 5IT5A 1AS3A 3WRYC 4C7OB 1JAHA 4KSCA 2ZUBA 1EFRD 1XJ0A 2JJ2D 4HLQB 3DMDA 4O2LA 4ZIRB 3IILA 5G3YA 2QM8A 4QL3A 2V3CC 2FOLA 1TX4B 4KJZA 1XEXA 5CYPA 2J59A 2NZ8A 5EXSA 4LYJA 1XJQA 4MGZR 5AUOB 2PH1A 3R20A 1NG9A 3MJHA 5J4HA 4QXAA 2OV2A 3GLGA 3CWQA 4N0EA 2IW3A 3OF5A 1OXXK 1Z0FA 3AVVA 5LDDC 2OILA 4XVUA 4JKIA 1DVRA 1GM5A 4F93B 4BLTA 3EZ6A 2PT7A 1E9AA 3PG5A 5F9FA 2CK3D 1XTIA 3TGPA 2Z0MA 2QRNA 1SULA 1Q22A 1YZKA 2GNOA 2CLDX 1ONBA 2N42A 2AKYA 2VA8A 1X8JA 2ZQ5A 4G5SA 5IK2D 3AF3A 4PQFA 3TSZA 5BN4A 3TQFA 1V5WA 3TSOA 3KXLA 4Q4AB 4IEEA 2V6JA 3UIEA 4D25A 3B6EA 3H0KA 4DLRA 4AIIA 5BWMA 2WWXA 5SZHB 2VHTA 1GNPA 3BK7A 3DMNA 3MGCA 4QGAA 4P31A 3RRMA 5P21A 3HDTA 1FL9A 5C4MA 2XOKD 3CBQA 3D3QA 2ZRJA 3LWNA 2LWIA 5C18A 4ZDWA 3VNUA 4Q4AA 4ZI3A 5FI0B 1UFQA 5A4JA 2F7SA 2DFKB 2NPIA 2WJIA 2RGBA 3Q9LA 3THXA 4NMMA 3MG9A 1EFHA 3I1FA 2XTZA 2VTKA 3PUWA 2FPKA 2FZLA 1ZC4A 5FFMA 1GL9B 3LO5A 3TIFA 2PEYA 4TLDA 5DI9A 3CNLA 4N0DA 1N6KA 1DEKA 4DKXA 1M7GA 3EZ9A 3C5HA 4IXNA 2P0EA 1XF9A 2UKDA 4PSAA 4CEHB 4URYR 5EJEA 2ZRHA 1YVDA 3NDPA 4WBSA 3ADCA 2RKOA 5JS7A 3AQ4A 1DBSA 2DY1A 3B8HA 5CJ2A 4EIWA 1D9XA 2YNMA 4AURA 4ZCMA 2W0MA 2IS2A 3EPJA 2ZRFA 1JB1A 2WSSA 1EFUA 4IVRA 1AQYA 2XOKA 3B2EA 1UBCA 2IYLD 3ADDA 4B44A 4B48A 5HPYB 4BZQA 4G5GA 2ZR0A 1P7CA 4V0NA 2GWHA 3R8CA 4BFZA 1S9DA 4Q7KA 2JEOA 4D0NA 3GLFB 1CTQA 1GFIA 1KDTA 4Q48A 3FHOA 1WQ1R 4BQSA 2BDTA 4L9WA 3E70C 3BB3A 1IJFA 2BOVA 4LOAA 4QBGB 1S9HA 3I8XA 4FMBB 5A0FA 1LTQA 1R0ZA 4C0HA 1GKYA 3KQUA 2JLUA 4M2LA 5JSZB 3FKQA 4PQYA 2IHBA 4KFRA 5FPYA 4JYBA 4U02A 3GLFA 2XNDD 3VHLB 3U6KA 3RSOA 1QDEA 3R9XA 3SQXA 4PZZA 1UBGA 2GKSA 4UNPA 5DI3B 2BHRA 3TBKA 3NWJA 3GD7A 4KHZA 4C2UA 1G16A 2GJ9A 1P4SA 3QJYA 1XMVA 4BFSA 2IYXA 5FTKA 4P4UA 2G1KA 1FUUA 2JLZA 3KJHA 2GEVA 3GEIA 4Q1FA 2FFBA 2O8DB 4Z8YA 3RABA 4CW7A 1II0A 2C98A 5FOSA 2DFLA 1Q3HA 1GVNB 4Z8XA 1NMYA 3T61A 3WXMA 3P20A 2NO9A 1AM4D 4NYJR 5DH9A 2Z4RA 4LJ9A 4M8NE 1FP7A 3IBYA 2GESA 5EUQB 4M9SA 1XB2A 4EDHA 4V03A 4KVAA 4OK5A 1NG1A 2KB0A 2GCNA 5TARA 1JBKA 3T34A 2P6UA 2ZSBA 4D2IA 1NY5A 3FDIA 4BLPA 2VH5R 2B7CA 2JLQA 4RD0A 3IEVA 3FOZA 2QAGB 3L82B 3SEAA 1XXHB 3K9HA 3SOPA 3IHWA 3SDZA 4L9SA 4B43A 2QY9A 2ODBA 2W0SA 3DZ8A 5AUPB 5J4VA 1VIAA 4JBYA 1UEJA 3BAFA 3Q5DA 1UKVY 4F4CA 1KO8A 3T15A 5EXXA 4BLOA 3CPEA 3F8TA 4Q5IA 1GRRA 1S1MA 5IHPA 1ZM2A 2FX3A 3LDAA 1I4TD 2X2EA 2FU5C 3R7WB 2C04A 1NF3A 1XPRA 2GTPA 3OZXA 2NMVA 4NBSA 2BV3A 2ZRPA 5G41A 2HF9A 1XMSA 4LGMA 1R4AA 4TQAA 3RRYA 3AGPA 1R8SA 2BM0A 1PJRA 3PV0A 4A0HA 4CEHA 2CCKA 3WNCA 1TAGA 3C14C 3ZJYA 3IHLA 4YDHB 2IC5A 2I1VB 2HLDA 3AVOA 4YMVA 4XWOA 3BOSA 1DELA 3VX4A 1MT0A 1RRFA 1RRGA 2XXAA 3PXGA 1OPXA 4XD7D 2OAQ1 4PHFA 2O8DA 5JRZA 2ZS7A 2P3SA 1E2NA 1E2PA 4NHOA 3L43A 1P9NA 4NYIR 3S1AB 1W4CA 2OO7A 1KSGA 3P4YA 4RFSA 4TSFD 1N25A 1UM8A 5JI2E 3AB3A 4IOMA 2CEAA 1TU4A 3E5HA 3QF4A 2V54A 2DFNA 1U0HC 4MH0R 1N6HA 3GCGA 2QQEA 3LX5A 2JLRA 3IKJA 1NIPA 1VG1A 2HUPA 4CT5A 1AGPA 2HLDD 2YYZA 4JSYA 4B3GA 2VQSA 4XVQA 1G9XA 3WBKA 1P62B 3A8TA 1OB5A 3U2QA 1F2TA 1OFIA 2CCJA 2IT1A 3H1TA 3BC1A 4IKEA 1UAAA 3TUZC 4XD7A 2WKRA 2BBWA 3SJCA 1HEIA 1NN0A 4DCUA 2WTUA 3ICQB 1QG2A 3U44A 1G7RA 4LRWA 2IF2A 4BRWA 2FGKA 4HLUC 3GP8A 2VIIA 3TVTA 1KGDA 1DAFA 1MR3F 5BQ5A 4MYHA 2Q9BA 1GOTA 3ONWA 1G6HA 1G3UA 4NONA 3GLIA 1DAHA 3L0IB 4B33A 2EW1A 1G291 4TT3A 4HDCA 2VLIA 4I99A 4BEBA 1MO4A 1HURA 3FKSD 1P73A 4QJ3A 3DL0A 2B8TA 3THWA 4XOIA 1G4UR 5CLLA 1Z6GA 1E0SA 2OCPA 2XZPA 1QHGA 4YXWA 5L3QB 2O8FB 3W8NA 1LW7A 4ASUA 3HU1A 3CUEF 1OH5A 1LB1B 1G3IA 1MKYA 4PO8A 4CF7A 5JI3E 2RGEA 4BUJA 1KDOA 3BE4A 4ZDJA 1IBRA 1JJVA 4PR0A 1EX6A 4DLTA 1ZYUA 1G8YA 2WPDA 2QN6A 4LI0A 1UJ2A 2ZJAA 1W2HA 2FSGA 1JEEA 4LJ7A 1Z2CA 1X86B 2ZI3A 3DPUA 3NBFA 1ZM7A 3ICEA 3HPQA 2ZANA 1W0JA 3PEUA 3VFDA 1KJYA 4TN1A 1XXHA 3X2SA 3ZS8A 1VCOA 2ZU6A 2P2LA 4TMKA 1E1QD 8OHMA 2W00A 5GJVC 1OFHA 4QHYA 1Z63A 1E4YA 1Z47A 3RS0A 1TEVA 2G9NA 4BGDA 4GMDA 5HTKA 4TYNA 2VP9A 2MSCB 4II7A 1PUIA 2QTFA 3UXMA 1IXRC 5BN5A 1KO7A 4E03A 1SZPA 1U0LA 4MYUA 4LBYA 2VPPA 3DVLA 1KI1A 4A8JA 4LV6A 1UF9A 1FNNA 3MAAC 1JR3D 2ZRBA 1XD9A 1COWA 2J46A 1KI2A 3ZIAA 3A1TA 3K0FA 2FFQA 1N0VC 3EIEA 1W36D 5JHHB 2GBLC 1ZW6A 2KSQA 4HSEA 2KBEA 2ZJ2A 3NBYC 3DO6A 1W7AA 4ERNA 1E98A 2WHXA 4D4LA 4QGFA 5DIFA 2DBYA 2I3BA 2GF0A 2Z83A 1QF9A 2JASA 1FP6A 3CRRA 1DOAA 2DB3A 3K0FB 5AK0A 3WYAA 2QAJA 2F3TA 1R0XA 2QTHA 1XZPA 1KK2A 4LDJA 3VR2A 2PX0A 1TQ4A 2VHQA 2A5GA 3AVQA 4U00A 2R9VA 3D6TB 3HP1A 1D2EA 2CK3A 3SHFA 5L8VA 3U7EB 1KI9A 1L7VC 2FMXA 3RDPA 2IYWA 1XPUA 1G5TA 2Z5FA 3EARA 3NEJA 3Q8XB 4UQOA 4DSTA 1KAOA 4PO1A 2YWEA 5IK2A 4HUQB 1OFTA 1HA3A 4IFBA 2PEZA 1ZD8A 1LS1A 2VYFA 2WWWA 1QRAA 3WYGA 3QPWA 1HV8A 1R5NA 1TUIA 2ZR7A 4EFLA 1J99A 3BERA 2GK6A 3ZZUA 2QGNA 1LNZA 2PZFA 1TF5A 3MMPA 5FPHA 4D82A 4PC7A 1KHTA 1T8UA 4JVLA 3AKCA 4TTQA 2I1QA 4QGHA 1ZM4A 4AWXA 2GDJA 4CVNA 4DSNA 1C4OA 3T1VA 3ZVRA 2CLSA 1IONA 1NVVR 3HPRA 2P67A 4R2IA 3TE6A 5FPTA 4TZ6A 5DE3A 3K0AB 2JCSA 2Q3FA 3O8DA 4MKHA 1JR6A 2F1HA 3B1WA 4Q9IA 2YWHA 4P4TA 2ZYUX 4RD1A 3T12A 4RZUA 1KIMA 2CDNA 4G01B 1J90A 4OQLA 3UKDA 4FMDF 1A1VA 3TAHA 3WHLA 1CR4A 1RE0A 3KJEA 3ZZ0A 4HUTA 4TTPA 4EUNA 1NIJA 4IHQA 3B1XA 4PAMA 4CZ2A 3PFIA 4AG6A 2MSDB 3W5IA 1HYQA 2ZRCA 3RAPR 3SFZA 3K09A 4GT1A 3I72A 4IOJA 3CRVA 3B78A 5EE9A 3QKTA 4JMPA 2HT1A 1Z2AA 1Q44A 3U3MA 1G6OA 2F1JA 3RS5A 3B60A 2OBNA 5JJIA 1JQJC 1P61B 4PPQA 1E0AA 2HCBA 3AP2A 4KITB 1PLJA 4NYMQ 1T9HA 1TPZA 2E1RA 2QT0A 2VL7A 4DLYA 1XD8A 4LJ5A 2Q21A 1GZSA 4KV9A 2CXXA 2IYVA 2IYRA 3NDBB 3WRXC 4DVGA 3IGFA 5E7MA 2O52A 3MWLA 2BC9A 2VSFA 3PQCA 4A8JB 4HUQA 5LD2B 1GIAA 1DAGA 1XMIA 3ND9A 1TF2A 4DJTA 3GLFE 4A92A 2DWPA 1RYHA 4ITRC 4Q1DA 3ETLA 1Y3AA 4PPGA 4XTRA 1HE8B 2EFDB 2AK3A 1NLYA 2GBLA 4RD2A 2Q3HA 1KI4A 5L3RA 2IEZA 1E9SA 1N2CE 4PC6A 2JAQA 4RD3A 1G8PA 2QI9C 3RWOA 4AYXA 2FEMA 4U7DA 1Z5ZA 1AZSC 2CJWA 4LSGA 1IN8A 1U9IC 4M0LA 3GLIE 3O8BA 2BVNA 3K0AA 4PPFA 2UVQA 5AWFC 1TF7A 2OESA 3MLEA 5E4FA 2W2XA 1B0UA 1KK1A 1RYFA 1Q1QA 4MYTA 5C4GB 2CJWB 3K1JA 1KO5A 1QBKC 2FA9A 2HYDA 4FD2A 1F2UA 3MCAA 4G3XA 1A82A 2ZSFA 3CB4A 2IYYA 4ZKEA 1NVWQ 4MRRA 2WJJA 2G6BA 2BMDA 2GILA 4PFSA 1G8GA 1S8FA 3KL4A 3BIFA 4Q1AA 2WBLC 4PO9A 2WICA 4C0AC 3MD0A 1RKBA 3QKSA 1VPLA 3LQRA 4BECA 1XZQA 4ARZA 3LW8A 3I5YA 4TLCA 4AK9A 5B57C 4P4SA 1AS0A 3B5JA 1M6NA 4O3MA 1ZD9A 4A2PA 1U90A 3R7WA 4E5UA 2IBMA 1T0JB 4HDOB 5AJXA 3W3ZB 1MABA 2C8VA 5BYKA 3EZFA 2QT1A 1T5IA 2IXGA 1BIFA 3B7GA 1YR7A 5FBVB 1GNQA 1T3LA 1XX6A 3KXIA 4KAXA 4Q02A 4GZMA 5UKDA 5BW8A 3ADBA 1SVMA 3GJ4A 2MMCA 2O0HA 4RSGA 1Z83A 4EPWA 3T1QA 4LZZA 5H70A 4A6XA 4OHZA 1GDDA 2F43A 4QBIA 2OXCA 2XXAB 1VCIA 1BYIA 1PUJA 4JLBA 2BCGY 3GFOA 5JEDA 2ANBA 4GBMA 4PXAA 3X1XA 3FFBA 3FMOB 5DI3A 1E9CA 1E79D 1IM2A 1N6NA 1KI3A 1IAQA 2HV8A 3NBZC 4YMTA 2GVDC 5EP3A 3CKLA 2Z4SA 3JVVA 3WYFA 5D3QA 1QVRA 1G5PA 1BO6A 2BCJQ 1W48A 3SE0A 2YINC 5FL7A 1MO6A 3BGWA 3SJBA 3WMEA 1F48A 1QHNA 3P1JA 1JXOA 4LJ4A 3EIQA 3EZ2A 1NKTA 3Q3JB 3K53A 4DWJA 4IDNA 3KUDA 4TYPA 4JLDA 1PZNA 4V0ME 4DSUA 1P9RA 4CGZA 4JLPA 3FHTA 3I4LA 4RZ2A 1LF0A 4F92B 4BLRA 1IJEA 1COWD 3PEYA 1KDRA 1FMLA 3C15C 3VQTA 4IEIA 1CULC 2J41A 2J0VA 2VP0A 4C4PA 1GTVA 4B3BA 1W0KD 1YKSA 2JJ1A 2HCJB 2QORA 4S35A 2GK7A 2NGRA 4PHGA 1WXQA 4A8JC 1XTJA 3GFPA 5JZVA 1KI6A 4LV5B 1NMXA 5EZ5A 1W4BA 4AG5A 4D81A 2RHMA 3BWDD 3IPYA 5CK4A 3UG6A 5L3QA 1CJMA 1UDWA 3BB4A 2YWGA 4QJ5A 4UXIA 3VR3A 1FMJA 5KPJA 1CEEA 1P60A 4OHWA 3K9LA 2YKGA 3EAQA 2O8CA 1NVXQ 3H84A 4YMWA 2PX3A 4QKQA 2R65A 2EYUA 1KI6B 1NBMD 2G0TA 3FYHA 1GG2A 2FWRA 4DDWA 2X8AA 1G4AE 2X1VA 1Z29A 3H86A 4LYHA 5F3WB 2XTMA 2AWNA 3B1YA 1YZUA 4KFSA 4QHSA 2C78A 2YC4C 1W0JD 1Z0DA 2O8CB 2PBRA 1P9WA 1PV4A 1X1SA 1KNQA 4US0R 4L5BA 1GRNA 1W4AA 5EP4A 5HCNA 4OI1A 4TLAA 1EFCA 2WWYA 1OJLA 4M9QA 2BKUA 2W83A 2WV9A 4EPVA 4IDPA 3K70D 1YR8A 1NBMA 1X8LA 1N0UA 2HT6A 2VBCA 3HYRA 4X8OA 2WJYA 1Q0UA 4QNRA 3SFVA 4X8HA 5JFGA 2OE2A 3QVUA 1UADA 1GKUB 4ABYA 2HJVA 4CEJA 4F4JA 5DSZA 3SBDA 1RJ9B 1G1MA 1KJWA 4Q9JA 3V4FA 3AM1A 4EPYA 1XTKA 3AKDA 5EE1A 4A2WA 3AGQA 1W36B 2X19A 1TADA 4Z51A 4TL7A 3NEYA 1SHKA 1G8HA 2MSEB 4KBFA 4M1TA 721PA 4DC9A 2NO1A 4I1VA 1DO2A 3W34A 3KQKA 4CEJB 1D2MA 4DDVA 2BMFA 4IVQA 1XP8A 2ZTSA 3C41J 4JJZA 3VNVA 4JBWA 4EFMA 3RSLA 3IUYA 1VHTA 4HDQB 2AXPA 3TLXA 3ZVLA 1X3SA 1K5DA 3OAAD 2WZQA 4XJXA 4NL4H 2CHVA 2DFTA 1ZRHA 2ERXA 2VEDA 2ZAMA 4Q7LA 1R5OA 4EJSA 2C9CA 5KDOA 421PA 2OFWA 2ZRDA 3KKNA 4HLCA 5FL3A 2WSMA 4JT4A 2VO1A 4DB4A 4JL5A 4Q4JB 3QXJA 1Z22A 3SQWA 4GOJA 4IDOA 1WA5A 1XU4A 4M1WA 3CPJB 1CJTC 1JALA 4DEYA 2O8EB 4JL6A 1US8B 1ZJ6A 2VRWA 3N2IA 3J81k 5JRJA 3MWJA 2RHDA 3B1VA 5GJWC 2ZUCA 5GVSA 4H1VA 4OK6A 3F3YA 4BPBA 1UKZA 5FBQB 2QTVB 1VG0B 5KDDA 1VECA 2R8RA 3AUYA 4PHTA 5D3MA 2ZJOA 2AWOA 3MUFA 1OFUX 4JJKA 4O2RA 5ELXA 3OEHA 5EE0A 4HB4A 3RS4A 3LLMA 4DRZA 3TH5A 4URWR 3U6BA 2J7PD 3FVQA 4US2R 1F2TB 1I4DD 1EXMA 2CL6X 3EPLA 3KKOA 2WMOB 4DB2A 1NBME 2GVZC 4EAQA 4XTCS 5CITA 3QF7A 2IK8A 4GP7A 3BH0A 3ECCA 4NPHA 3UMRA 4B35A 4FMCF 4HZUA 1E0JA 3QY0A 3DKVA 4Q1EA 4HZIA 1MO3A 4NCKA 2IF0A 2ATVA 2Q0HA 2H1LA 4JLOA 4NCJA 3U61B 1BS1A 2QAGC 5CB8A 2A5YB 3K70C 2ORVA 4ZI2A 3I73A 3NXSA 2CCGA 3NBXX 2WAYA 4Q18A 2W6IA 1ZIOA 1W1WA 2O8FA 3REFA 5IDVA 3ZQJA 5HZKA 1J8YF 1A5TA 2G1JA 3SNHA 2OSBA 1SVKA 1KK3A 2RB4A 1IXZA 2OAP1 4LJ6A 4Q47A 4D4MA 4C0SA 2QROA 4TL9A 1M2OB 1NLZA 1WB9A 3CNOA 3QSYA 3TJZA 1Q12A 2ZE7A 3CRQA 3LXXA 4MUBA 3LBNA 3VKWA 4JYCA 1NVUQ 4POAA 4M21A 4O0MA 3O8RA 4BFXA 4DBLC 1GSIA 4DIEA 2XITA 1BOFA 2ZI4A 2XSZD 2H16A 2FSFA 2O8BA 3I3SR 3PVSA 4PQRA 1KKMA 4RFSB 3WBJA 2QU8A 2XAUA 1FNMA 4A2QA 1ETUA 2TMKA 1W4RA 1YR9A 2V8OA 1SQ5A 3QE0A 2CE7A 2VP6A 3QNUA 1YU9A 1U94A 5JLJA 1Z08A 1XXHE 1CIPA 2QL6A 3W90A 1E3MA 2ZRNA 2DPXA 2ZSAA 2D06A 3I8SA 1VG9B 3AEZA 4ZCIA 4V0LA 3THOA 3P4XA 1P5ZB 4BWYA 2D4HA 3A4LA 4LY6A 2ZJYA 2FGJA 1N6IA 4MRPA 1CRPA 1NKSA 1XNJA 2FPMA 2Q3MA 1OKKA 1GWNA 3SJZA 2XEXA 3SYLA 1W5TA 1OB2A 4TZ0A 2OXRA 5KU1A 4C0BA 3B9QA 4XSHA 2C77A 3A1UA 5EP2A 1XEWX 2KJQA 3X1WA 2ODEA 5HE8A 4P33A 2R6DA 3VU9A 2A5JA 1NP6A 1LS6A 2XB4A 1KYIA 2YVUA 2IX3A 3AP1A 3RWMB 2WJVA 3TSWA 3G82C 4KVGA 1DAIA 1R6BX 1U9IA 4B3XA 4TLBA 1D9ZA 4A0RA 2BEJA 1I2MA 3UWKA 1N3BA 4IVPA 2GCOB 4R2HA 1E1RD 3M6AA 3ASYA 2F9MA 1SXJA 1VHLA 3SC3A 4B6EA 4NCIA 1SGWA 3VU9B 1AKEA 3LV8A 4D0GA 2O8EA 1NVVQ 3TKLA 1EX7A 3CIOA 2OLJA 3I5XA 2E9SA 4WA7A 3Q85A 1JPNA 1ZNXA 1CU1A 1KJZA 3QKRA 4FMDB 2BBTA 2CMKA 4UNRA 1IY1A 2JJ8A 4C0LA 1DG1G 2RAPA 2OUKA 4CEIA 1QHHB 1DS6A 1BMFA 1M7HA 1N6OA 2ZI5A 2LCFA 3LD9A 4GOXA 3WNDA 4B47A 4DIDA 4US1R 5FPKA 1ZC3A 3L2OB 3B85A 4UXJA 4TMVA 2GJKA 1ZMXA 3I61A 2HEIA 4CIDA 1VKJA 1W47A 4B71A 2B92A 3WP0A 4LYFA 3OIVA 5FTMA 1S4QA 1V43A 1YZQA 1G41A 3L0OA 4XVRA 2WVJA 3OEEA 3R8FA 3WHKA 2PCLA 2CBZA 2CE2X 4E22A 1TNDA 2EU8A 1ZP6A 3EWSA 3FGNA 1QZXA 3BFKA 4FWIB 4GSYA 3JVUA 4OHVA 1SVOA 2AN9A 4WIAA 1KO4A 3RS7A 1G19A 5EQTA 4DUGA 2OHFA 4YLGA 4M9XA 1E9RA 2RMKA 2VHJA 2W6JD 2ONKA 2QEQA 2Z6VA 3AV0B 1GKIA 3BRWD 2G88A 2GAAA 3K0CA 3IIMA 4NP6A 1OV4A 1Y63A 4PZLA 3VX3A 4AKEA 5KYKA 1OYYA 1N6PA 1FW6A 5BXQC 2JLWA 4KODA 5JMTA 3H2YA 5F98A 3OESA 2JDID 3QI2A 1M34E 3GJ7A 3U3OA 2IWHA 2H17A 5JEEA 2VSXA 4TQ9A 4M1MA 4A82A 2QP3A 3OFND 2OFOA 5KUTA 4LCBA 2WIAA 1IY2A 1A2KC 2NO0A 4PSVA 3PUXA 3AVXA 2NIPA 4KO8A 2QG6A 5FI1B 3ZH9B 3AVPA 3UWOA 1S2MA 2JIZA 1SXJC 4OHYA 4XWAA 4AYTA 4N3NA 1YZNA 1F6BA 3A58B 1XWIA 2BWJA 2G3YA 4CDGA 4EQ6B 2XZLA 5HCIA 1KY3A 1TQ2A 2FE4A 2GEUA 4HAZA 4BFYA 2ZEJA 3AP3A 4AC9A 5JCZA 3CRMA 2IEYA 3QOFA 2AKAB 1JJ7A 1JECA 2REOA 2J7KA 4URVR 1XJCA 4MGKR 3QENA 1VCMA 2GEDA 4V02A 1II9A 1YR6A 4DXAA 2H7VA 4JLMA 3HWSA 3DKPA 1R0WA 4BZPA 1E2EA 2F55A 2X2FA 3QVVA 3KTAB 4DLVA 5FH9A 1ZU5A 2QMOA 1WBDA 1NJGA 3SBEA 2LKDA 4HATA 1VTKA 4NDZA 4XWKA 1SVIA 4PSKA 4RY2A 1OLOA 1W49A 2YJTD 1R7RA 4OKSA 3LRPA 2OCBA 3FTQA 2DWQA 3IPXA 2AD5A 2FFHA 2IHYA 2IUTA 4KLNA 1A7JA 4KXFB 3SZRA 4QM6A 1S3GA 1NN3A 2ZSDA 3BORA 5CM8B 4WZBE 5K8LA 2O0JA 2OLKA 3EIHA 3TAUA 1NSFA 4B76A 4KLZA 3VR6A 1XDBA 3QKUA 2PJRA 4C0JA 4KFTA 3IO5A 2ZROA 3GJ8A 2WOJA 4HLDA 3TVDA 2GXUA 3IIJA 2VF8A 4A0FA 4JVSB 4B6FA 2CHGA 1CP2A 1E2KA 5C46F 2QBYB 1VG8A 1KSHA 2ATXA 5FBRB 5JJKA 4PTLA 4QBFA 1AN0A 1C1YA 1JEDA 4KFUA 2RGDA 4DEXA 4DDUA 1FFHA 4D80A 5G3ZA 2DR3A 2O0KA 3NC1C 2EWWA 2WMNB 1ANKA 2H57A 2OG2A 4FINA 2ZITA 1GRQA 4B3FX 3QBTA 2BJWA 1KSJA 2QBYA 4JLJA 3T1OA 1DAKA 3O8CA 1Z8FA 1QVAA 5KSOA 4AKHA 1RJ9A 4M1OA 2QMEA 3LVQE 2ORWA 1N0WA 5JBQA 3OE7D 2QP9X 4JBXA 4ZV4A 1NL3A 3LFUA 4NCNA 1LV7A 3CONA 1MOZA 4TYYA 4FCWA 1EK0A 4TMZA 3MFYA 5FTLA 2JA1A 5BYJA 2JLXA 1SKYB 4BFVA 3ZD6A 4PX9A 3U3JA 3HYTA 1OIWA 2IXFA 2V7QD 4JSTA 2YC2C 2IA5A 1G17A 1U8ZA 3FMPB 4V0OA 1NI3A 2J3EA 2GA8A 4XSGA 4UXHA 4E07A 4JZKA 3UK6A 4DLWA 4F4IA 5KSZA 2HF8A 3LH5A 1R8QA 2CHQA 4TT3D 3LAWA 2GF9A 3KDSE 4BLSA 3TMKA 3B13B 5J4LA 3RC8A 4HAWA 4HI0E 4KYUA 1R2QA 4LUCA 3U7FB 1OH6A 1SHZA 1CBUA 3LXRA 4PPNA 5KTYA 3U7HB 4MRVA 5AJZA 3REGA 3TR0A 1IOZA 1U81A 2OM2A 2IS1A 2A7QA 2HXSA 2P6NA 3FPAA 1P75A 1F3OA 1P2VA 5JWHA 4LX0A 4W9MC 2ZIAA 1IN6A 5JHGB 1QHXA 2A5DA 1OE0A 2BBSA 4PC1A 2B7BA 3C4JA 4Y0AA 4B75A 1CR2A 4DCTA 3U7GA 3TW8B 4OL0A 3ZQ6A 1NN5A 3EPKA 4Z1MD 1GNRA 3HR7A 1R0YA 4IJMA 1E99A 1W36C 1EG7A 4ACAA 5DHAA 1XTRA 3BFVA 4QGGA 1CR0A 4LC1A 3QXSA 5FR2A 4TMXA 1J8MF 4CRWB 621PA 4MUAA 5JECA 3RC3A 1WDTA 3W8RA 4KI0A 5DN6A 1NSTA 2ZREA 3THYA 3CR7A 2REBA 3OAAA 1ZCBA 3T06B 4JIMA 2NOAA 2PLFA 4Q66C 2NPFA 2AHOA 4HB0A 2ANCA 3CF6R 4WAUA 1T5LA 3LA6A 4C0QC 4D26A 3GJ0A 3ZIAD 1BKDR 1GUAA 2RGNC 1U99A 4OQNA 5FBLB 5CDFE 4AKGA 1HH4A 4TWZA 5EP1A 3ZVMA 4HAVA 3GLGE 5HR5A 4Q03A 3OEHD 3SHWA 4AKIA 4EPRA 1G8FA 2QM7A 3WY9A 1HQYE 3ZD7A 1E4VA 2QQ0A 1E9EA 2W2VA 1G3RA 3AUXA 3EXAA 2JATA 1G3QA 2ZM5A 2ZR9A 2J7PA 1OXTA 1E2DA 3KFVA 1Q1BA 3AKEA 1E2GA 4Q21A 4ZCLA 4TYWA 2WPDD 1XFAA 1FQKA 5GJCA 4GNKA 4OI2A 4NH0A 5KPDA 1E0KA 4Q19A 4BASA 2KE5A 2V7QA 3MWKA 4I4LA 2YWFA 4LJAA 3QG1A 3AH8A 5EE3A 1ZU4A 2A5FA 2PL3A 2FDCA 3T5DA 5DN6D 3EC1A 2C9YA 1N5KA 2ECKA 3RS2A 2FG5A 5G40A 1HTWA 1CRQA 2OFXA 3PJRA 2GCPA 3CLVA 3KFXA 4B73A 1G7CA 2QSYA 4HLUA 3KB2A 4EJSB 4QBHA 2QAGA 4QRHA 1H8EA 2ASEA 3S1AA 1Z0AA 1OKKD 1OYWA 3NHBA 1BYUA 4NCHA 1FQJA 1UPTA 4GDFA 1ZM3A 1RZ3A 2G0NA 3VMFA 2XTNA 2JLYA 4LYAA 2YV5A 3R9WA 4ESVA 2EQBA 4F7WA 3QEOA 1Q20A 1KK0A 2G83A 4L8GA 5JS8A 2FJUA 4GP6A 2VSOA 1AZTA 1PLKA 2IS6A 2ZI9A 5TV2A 2PJZA 4JT2A 1PLLA 2ZYWX 1JAIA 4A15A 1DARA 1E96A 5SZIA 1SVWA 3P26A 4AI6A 2C5LA 4BE7B 3TW4A 3GFTA 4UNQA 4QG7A 5L3SA 1XTQA 4DSOA 4F38A 1OIXA 1P2TA 1RFLA 4C2TA 4JS0A 3C16C 3KXKA 4FMCB 3HJNA 2AXNA 1G21E 2HYIC 3SU8A 2D2FA 2QMUA 1K6MA 1E6CA 3ZLJA 3C5CA 4M9ZA 1TTTA 3U4QB 1EFRA 1Z0IA 4HZUB 4LJYA 2ZAOA 4WZ6A 5FOUA 4HYYA 1TEXA 2SHKA 1BMFD 2WKQA 2WSSD 4C0KA 1G7SA 1IN5A 1X6VA 5J4KA 821PA 4ZDIA 3BFXA 3RANA 4J0QA 5E3HA 1T6NA 3WNBA 3RYTC 3A1SA 1TU3A 4AD8A 4TQUS 4AY2A 3OEED 2EFHB 1N6LA 2VF7A 5K8UA 4WVFA 3N2EA 1Z06A 4LHXA 5KNCA 1EWQA 5LB4A 1FTSA 1E2HA 5DLQC 5FUXA 4DCSA 1M74A 1NY6A 4W5HA 5FR1A 1EGAA 3U3KA 4R71A 4IDQA 5KDLA 4DDTA 2J0UB 1E1RA 2VHCA 1Z0JA 2ZJ8A 4EFNA 1KI8A 2VP4A 2CLCX 3ND8A 1KI7A 2PCJA 3C7KA 1FTNA 1OW3B 5DO9A 3W3AA 5TY0A 2DYKA 2L0XA 4LHYA 4A6PA 4OQFA 2GJAA 2RGAA 4TL8A 1UEIA 3IQWA 1J70A 2A9KA 2QP4A 2FSHA 5CB6A 3FMFA 5KNDA 1IN7A 3DEFA 1E79A 1GITA 1QHIA 2BM1A 4A9AA 4I1SA 3SS8A 4D6PA 2IYTA 1DADA 1JPJA 1ELOA 4PC3A 2JIZD 3X1YA 4D0LB 1KSFX 1L4UA 4LWZA 4MDEA 1O3YA 2MMGA 2OZEA 3CW2A 4Q4JA 5FPSA 2AR7A 4M53A 5K8TA 1E2QA 4YXWD 5EUMA 2WM9B 1YQTA 2PT5A 2QGZA 3RVBA 4B2LA 4TTRA 5TB5A 2ORIA 5HZHA 4EQ6A 5DGXA 5A5GA 2GJSA 2XJ9A 4Q00A 4W5JA 3UMSA 2OEPA 3DHWC 3L0PA 1UBFA 1AQUA 1T3HA 4K8OA 2IWRA 3A36A 4O25A 2QE7D 1Z6AA 1SXJB 2W58A 1JI0A 3IQXA 1XRJA 1B23P 2CVHA 2QA5A 1R10A 2VHUA 1BH2A 3NG1A 3NTUA 1XCPA 3I92A 3SJAA 4B3DA 2WAXA 5EXPA 3KTAA 3PIRA 1MRNA 1OIVA 3GEHA 2ZE6A 3BS4A 3SN6A 2NO7A 2J0QA 1QHHA 3QXHA 4ACBA 2ODWA 2D7DA 1XBTA 3GQBA 3PUYA 1NN1A 3V00A 1ESMA 2B21A 3AVYA 2XNDA 1D5CA 1YZLA 1E2LA 4Q9LA 2EYQA 3ZYCA 3NVAA 4G5QA 1N6RA 3BBPA 5H68A 5KOYA 3K0EA 1W5SA 3ZZTA 1OHHA 1S0UA 1G18A 4MQBA 2VP2A 1SVLA 1R5BA 2PMDA 3A1VA 3FHCB 4NYMR 4RFVA 1Q21A 1ZINA 3MJRA 2C99A 2ZETA 3MRSA 5C2JB 3U4QA 3PEVA 4OI4A 2V6IA 4KSBA 4LC0A 1X8KA 4BFWA 3GLHE 3GLGB 4EJSC 4YMUA 3GJ5A 4M1KA 5CK5A 1CKEA 1RRPA 1Z0KA 2VP5A 4NKRA 3SYNA 4S2EA 4RKFA 5CIWA 1LY1A 4C9BA 2IYUA 1G7TA 1Z28A 1ZVQA 3K70B 3AVWA 2JLVA 2OBMA 4ZPXA 1CS4C 1ZUHA 2LKCA 4UJ3A 3TR5A 3VKHA 2YOGA 4D4KA 1TQDA 1G20E 4R9UC 4RZ3A 4TSFA 4RZXA 3HU2A 1KDPA 2FSIA 5BN3A 1RRCA 3A4NA 1EESA 4ON9A 3RRNA 3CPHA 1OHHD 3CX6A 2FF7A 2O8BB 1EWRA 4K46A 2PLRA 4IDHA 1FPMA 5EXTA 3DZDA 2F6RA 3TUIC 2ZVPX 1DPFA 1WMSA 2D74A 1QG4A 1Z6TA 2V4ZA 5CDFA 1CF4A 2PMKA 4DCVA 3TQCA 2B6HA 2RGNA 4V0KA 2A78A 1IXSB 3RHFA 1ZNZA 4Q7MB 3CNNA 3JZAA 3ZVNA 1ESNA 2F9LA 4Q4HB 2JJ1D 2ZSEA 1J2JA 4E09A 1KAGA 3Q7QA 4JLKA 3FB4A 3EG5A 1YZGA 4KCGA 4JKYA 3FFAA 4L15A 1HT2E 3WMGA 4BZXA 1OF1A 1ZD1A 1ZUIA 3KX2A 2YZ2A 1AA9A 3RRZA 3W6PA 4HAXA 3BH6A 4IXMA 3N5CA 3D31A 4HAYA 3KZ1E 4ZO4A 3GJXC 2C03A 5AJWA 4NU0A 5B64A 2F1RA 3EA0A 3UMFA 2V9PA 4FCTA 4PANA 4B2PA 2EFGA 4WOPA 1YHNA 4MRSA 4X8MA 2R62A 1LFDB 2ZJZA 2BEKA 3QPUA 4Q01A 2ZPTX 3QKRB 1TQ6A 3VAAA 3EWAA 3AF2A 1OH7A 4OI0A 1JNYA 3MWYW 4YDSA 1CLUA 1P6XA 3PEWA 3AVTA 1KNXA 3LLUA 5KSYA 3FWYA 3LW7A 1U0JA 2ZYTX 4WXRA 5GADl 1YRAA 1ZNWA 2F1IA 4TLEA 3K0CC 1IY0A 1F2UB 2H5EA 3GLHA 5CYOA 1P2SA 1OXSC 2AL7A 5FUYA 2FPLA 1MRSA 4EPXA 4I81A 4EPTA 1YRBA 2QNRA 2R44A 4W5WA 4LK2A 4Z54A 4QNMA 4TMWA 1W2GA 3HR8A 1RVDA 2B8WA 4YONB 4U5XA 3W6NA 5L3VA 3TK1A 3V4RA 1CJVC 1G5RA 4GL2A 5IF9A 4GOKA 4C30A 1JQLB 1HT1E 3NKVA 4MA4A 1HUQA 3RLFA 1E9BA 3ADKA 2ZRLA 5B58C 4URXR 3PENA 1M7BA 3LX8A 2N46A 3NC0C 4GPTA 1SXJE 1MABB 6Q21A 3AVUA 1H65A 2BBOA 1LVGA 1AIPA 2ZE8A 1E2IA 1I4LD 5F2EA 1G3MA 2ZRMA 4YQFA 1JR3E 4QHTA 3E2IA 2W2TA 4B2IA 4PAQA 1DO0A 2FZ4A 3UPUA 4RKEA 1FX0A 2FN4A 3PITA 1EFTA 4NYIQ 2P6RA 2OT3B 1S1CA 2F43B 2XJ4A 4QC2A 1AKYA 4MKGA 2D62A 5KSPA 2GRJA 4DLXA 1A2BA 4PHHA 2K5UA 4ESHA 1CJKC 3RS3A 2D7CA 5AUQA 2GXAA 4L4UA 2FFAA 2JJ2A 1VMAA 2Q9CA 4RD6A 1A4RA 1GP2A 3VTKA 1AGRA 3GJ3A 5EE5B 2UZ3A 1T3SA 2ZUDA 2Q6TA 3M4YA 4H9GA 3QPVA 5IRCD 4LHWA 1C9KA 2ZU0C 1ZIPA 2GAOA 4Q9KA 3CZPA 3GEEA 4TYQA 2H92A 3A4MA 1N5IA 3QKSB 4UNSA 3IDQA 4C3ZA 2DHRA 2ZVQX 4ARZB 1K5GA 3KQHA 1OT3A 1KMHA 2ZS8A 4IOKA 4DLUA 1DAEA 1KKLA 2H18A 4OK3A 2XGJA 3M0EA 4ZKDA 2RH5A 1VYTA 5J40A 1L2TA 5JWRA 1PVOA 2CNWA 4FCVA 4GZLA 5DHFA 5HKKD 5K8IA 1WE2A 4M1SA 1U98A 4IW3B 4K81B 2ZRAA 2GXSA 3I32A 4MRNA 4OHXA 3OIWA 2FV8A 2J1LA 2WWFA 1SXJD 5E7JA 121PA 4R7ZA 5LB2A 2IL1A 4V0MA 4QJ4A 5AJYA 3Q72A 5TVKA 2NO6A 5B30A 2QSZA 4URZR 1SKYE 3THYB 2AD1A 4A1FA 2BMEA 1S3SA 2ODNA 221PA 4ASUD 1N5JA 1KOFA 5KHOC 2UZIR 3B1ZA 1OH8A 4LHZA 3T1TA 4LV8B 3GJ6A 1UKEA 2AX4A 4KU4A 5AR1A 3MSXA 4UJ5A 2RGCA 3NH6A 3L8ZA 4DHEA 3HU3A 1W46A 4FI3C 1ZBDA 3GMTA 2V1UA 4GFDA 3LNCA 3NIBA 3KQLA 3CH5A 5EZ6B 4P32A 2CNWD 3VHXA 3OIYA 1YZTA 3P32A 1SKQA 2IYZA 3GLHB 3GPLA 2ZI7A 3IBGA 4M22A 1HQCA 5DISB 2XSZA 2QZ4A 3JZMA 4A4DA 3W9YA 4BFUA 5C1BA 2N1BA 4YMSA 5FOWA 3W5JA 3R9IA 4DT1A 1XCGB 3E1SA 5AUNB 1NMZA 4NTZA 1DTSA 2W6JA 3B9PA 3Q5EA 1H8HD 3QQ5A 5E7IA 1WCV1 2C9OA 3EA5A 1FUKA 2R6FA 4G5RA 4ILEA 2WWIA 4KBGA 4L16A 4LBVA 4LPKA 4HAUA 1RC8A 2C95A 5FUWA 3ZDQA 4XIGS 3BH7A 2KWIA 3KB1A 5G53C 2CL7X 4GRAA 2QENA 2WJHA 3CM0A 4WW0A 5H8WA 1FOEB 1UKYA 2FH5B 4BRUA 2NQ2C 1DG3A 4IRUB 2D2EA 5LBIA 1KZGB 2R6GA 4ZDKA 1CJUC 3VR1A 3THWB 4DLZA 4TL6A 2IXEA 2ZE5A 3KJIA 1L8QA 1QHYA 2R6CA 1MV5A 1P3JA 1NJFA 5FUVA 3THXB 5FOVA 5H1YA 1UDXA 2WWHA 4JLAA 3ZGXA 1OSNA 1Q1EA 5M04A 3O47A 4I1UA 1OXUA 2QE7A 4QFMA 2QUZA 3B82A 2YOFA 3CZQA 4B32A 4NZYA 1QHSA 1U8AA 3EASA 3T5GA 5LD2C 3SR0A 1VYVA 1HE1C 4WZAE 2GZDA 1H8HA 3NHAA 3FMIA 4YC7A 4MKIA 2IYSA 4G1UC 2ZS9A 521PA 4JLVA 2HXYA 1US8A 4P3YA 2QPOA 1TMKA 5E95A 2ZXUA 2F3RA 1D8TA 4JLNA 4A0GA 4FWTA 3X1ZA 2E87A 4FW9A 1KMHB 5SZKB 3CRW1 3DM5A 3KKPA 4RD4A 2OCAA 5FL7D 2EFCB 1ZCAA 2X77A 5FTJA 2ZJ5A 3TRFA 1CR1A 3K8YA 5GVRA 1WF3A 1XMJA 1M8PA 3L8YA 1TUEA 5LPNA 3A37A 3CX7A 3IO3A 3EPHA 4MGIR 2HDNB 2WIBA 3EC2A 1XCMA 4RCYA 3DOFA 4DUGD 2J5XA 2J45A 1Z6YA 3OHMA 4FIDA 4LJ8A 2XZOA 4GI7A 5JCPA 5JSZA 4B34A 4EKDA 5L3SB 3KJGA 2H8KA 1AK2A 3KQNA 2AK2A 2I4IA 1KZ7B 3WP1B 4WXPA 4OQXA 4D4JA 5JJLA 1G64A 4R98A 3QIAA 1KY2A 3QF4B 2IUUA 4OYHA 3UG7A 3U5ZB 3OFNA 1I2DA 3K09C 3BD9A 1KMQA 1O87A 4OBEA 5D3MB 1DE0A 2WOOA 3D7MA 1AS2A 4LHVA 4XH9B 3G0HA 1Z07A 2NG1A 2R6AA 5TDHA 3IIKA 1NLFA 2OBLA 3K9NA 1RPZA 4B3CA 1E2FA 3VR5A 4N1AA 4CYMA 3TUJC 1E69A 5TMPA 1ZM9A 1LF5A 1II8B 1XEWY 4JVNA 2RGGA 4W7SA 1GL7A 3F0TA 1CXZA 5HE9A 2XNSA 2GZAA 4DT1B 3GLIB 3FE2A 2A30A 1FZQA 1WRBA 4FN5A 3CX8A 2BIFA 1XPOA 3CR8A 3OE7A 4Q1BA 5CM9C 4FXPA 4BLQA 1NNEA 2XX3A 1II8A 2WWGA 3LBIA 3AKYA 1IN4A 3AF0A 2J0UA 2V55B 4MGYR 3SI7A 4OQMA 5J4YA 2ZRKA 3OIUA 5TXGA 2NTYC 1AJEA 2Q9AA 1F5NA 2YHSA 2ZRGA 2Z43A 1E1QA 1ODFA 4QM7A 1XD2A 4BEJA 1X1RA 3DOEA 2NZJA 2WJGA 1UBEA 2RCNA 3BB1A 2O5VA 3U60B 3M1IA 3NH9A 2CVFA 3K9GA 1XEFA 2ZI6A 3K0SA 3D8BA 1HY3A 4JL8A 5KNBA 2J87A 3F5FA 4KYIB 4NYJQ 4LBZA 2ZJBA 2QPAA 3CWZA 1TL7C 2FNAA 3PR1A 2GZHA 1K8RA 2OCYC 4B74A 5SZJA 1ZUNB 5B2ZA 1Q3TA 2FEOA 1N5LA 3DDCA
chains in the Genus database with same CATH superfamily
2AI3A 3ZLUA 3GUVA 3UH1A 4HB3A 2P27A 1ZONA 3P9PA 4NAUA 5AJVB 2QVXX 2JLSA 1A8PA 1NXWA 3P96A 5KO2A 3DL7A 4XGNA 4Z1MA 3LXMA 3A0UA 2R3SA 1D2NA 3VPSA 2IX9A 4Y30A 4DLSA 2GJ8A 4JY7A 3TVYA 3JQEA 4PTYA 3QG5A 3CF0A 1D6JA 2DPMA 1NHGA 1T91A 3KKQA 1G2IA 5FORA 5AJHA 2Y0BA 4QDKA 3WMFA 4DTCA 5C7OO 2C1EA 1XIVA 3I1YA 4KTTE 3OJFA 4I9HA 2EWVA 1WZUA 3FUTA 3TG8A 1KA9H 3KUCA 3T0GA 1JVBA 3OZVA 1P4HA 1TM1E 4Y9RA 4F72A 2BHLA 4HDNA 5BN1A 3O38A 5CDUA 1Q1ZA 3WGMA 2RKWA 1H8ED 4AYWA 3RIXA 2CNNA 2WF7A 1EAYA 1PEAA 3U80A 3OT4A 4IDAA 1IY9A 3F5MA 1ZSYA 2GPBA 3LQQA 1CUDA 4G0NA 3TNFA 2V59A 4CHTA 4KBYA 1QUEA 4PSUA 3AESB 1USVA 1W0KA 1W44A 2B2CA 3OHSX 4MKFA 4BQOA 3ZLBA 8AT1A 5GJBA 3B51X 5CR9A 4OB6A 1WP9A 1XEXB 4I3GA 4UCXA 1MDBA 4UKDA 3RSZA 5LZ9A 1SXGA 4X8LA 5HF9A 3GMSA 3PD7A 4Y2PA 2QRKA 4BCBA 1PZMA 2Y4OA 2AI2A 4Z9BA 3H4MA 4FT2A 1J0EA 1UXKA 2Q0XA 4QOSA 2J9RA 3Q7PA 5FHRA 5AKHA 1FX0B 4TOIA 2QRZA 1E94E 3H19A 3U44B 3S8EA 4JUFA 2FF5A 1O96B 1DIOB 1LX6A 1TMGE 3MWDB 3AF4A 4RCZA 4MW5A 1T0HB 1UMDA 1XN4A 3I9JA 2ZATA 3FKSA 4FYIA 1U1EA 3MPUA 1JMYA 2OHIA 3PUZA 4F91B 5JANA 2ERYA 4J0HA 1QIJA 4W5RA 4ARVA 1XQXA 4G5OA 2IYQA 2P65A 4LPSA 3FDZA 3GFSA 2JK0A 4NJEA 4BE9A 4MITA 1Z3IX 2PZEA 5DYGA 5ER9A 4UMFA 4DZZA 3USZA 4JVMA 5EERA 3NBKA 1PFUA 2V1XA 1OBHA 2AFIE 3QOWA 4IFEA 2OQIA 4R1TA 4L1KA 4BN0A 2WQ7A 2WQZA 4HAOA 4JITA 2GXQA 3ZG6A 3OC0A 3GRVA 1PSDA 4B5LA 1F60A 4TMTA 4U7PB 3E18A 2EKBA 1DFIA 4YV2A 2IS4A 2QPTA 1YGYA 4ARIA 2ZYVX 3UT0A 4KC0A 2O5RA 4H4EA 1XHLA 4BMXA 3GD5A 3PL1A 4Q9HA 1R4MB 1ZAKA 3WKAA 4A2CA 1BD4A 2HFKA 4TTAA 4BASA 1MZVA 4HXEB 1C0IA 2P5SA 1WUKS 2VZLA 3U3RA 3KR2A 4MR7A 4XLLA 4XX1A 3L92A 4ZTBA 3I62A 1OAOC 2EFEB 2HGZA 2PGXA 1XTSA 3ZI4A 4URUR 3GGJA 3ER6A 3IQHX 3FOBA 1VDMA 4G85A 4QEKA 1WQ3A 1PCXA 3GDHA 1E5XA 4YCMA 3E3NA 3OQ1A 3RV4A 1LA2A 1E2JA 3PUVA 3H1PA 1EIZA 2WKPA 5B1SA 4HH3C 1EX9A 5I4BA 1R66A 1Z62A 3AF1A 1XJWA 1ABFA 3F7NA 3ZS9A 1THGA 3QXXA 1YR2A 2N0SA 1Z5UA 1IULA 1VDZA 1PT5A 2IYEA 2VRBA 3ENQA 4OF4A 1EZ4A 4NR0A 1YMUA 3ULKA 1KYTA 3LC2O 5IT5A 2Q7DA 2EZUA 1AS3A 4HDMB 1GPUA 2Q45A 4LTMA 3B52X 4HOYA 3RT1A 2ZSJA 2PRKA 4JJEA 1EFRD 3RYFA 5LL6P 2JH9A 3HCDA 3NU1A 4DLBA 4HLQB 2WM2A 2Z6QA 4O2LA 1FA9A 3C3CA 1OWLA 4ZOAA 2M6LA 2FOLA 1GNLA 4KJZA 2FXVA 5CYPA 2GB4A 5KJ6A 3O31A 2YHIB 1NKVA 3LYAA 1HL7A 2X8BA 1JDTA 4MV0A 5FUQA 1MF7A 4YDQA 2OV2A 5J4HA 3PNKA 3AHCA 1AQ6A 1T2UA 2ZBQA 4I1RA 4U2GA 5LQJA 4JB0A 4HGYA 1I24A 1X38A 5C1IA 5K2MA 4XVUA 1W0CA 4JKIA 1TYEB 1DVRA 3DDSA 1GM5A 1SCAA 4RDIA 2H65A 1E60A 1T8WA 2QD2A 1M1XB 1E9AA 1NW4A 4F3NA 3PG5A 4TXLA 3VR4D 5F9FA 3ND6A 3KR0A 4U2BA 2Z0MA 1V5FA 1GXSA 3CJQA 4LYEA 1QCCA 3K05A 5F7ZA 1ONBA 3RUDA 1R37A 1V7CA 5TGTA 2NVUA 2VA8A 3BJMA 4BKMA 4OH1A 4I55B 3HB9A 1U8EA 1GPNA 3V48A 3AJ9A 4PQFA 4MYSA 3OPQA 3TQFA 5A03A 4ZREA 1MAVA 5BN4A 3DDNA 3TSOA 2RHCA 1GG9A 1UBMS 2V6JA 3QH4A 4FHGA 2KQUA 2DX7A 4IEEA 1UJNA 5A3RA 2JGDB 3PTAA 4JVOA 4KO3S 1UK7A 2ODTX 3MGCA 1INLA 3DV9A 5L3ZA 3WGGA 4G81A 1NZFA 3L0DA 5DGIA 4EB3A 4NBKA 5BNWA 1QH9A 1QS0B 1RM3A 4OYLA 2WE8A 1EVIA 2XYHA 2DQ4A 2I3ZA 3H04A 4ZDWA 3AX6A 3ZPXA 5F7XA 4ZI3A 3M3PA 2NQTA 3GHHA 3ZDFA 1JLKA 2WJIA 1X1EA 1MEEA 4ZANA 2G25A 1Y9ZA 5ALGA 1LJ8A 1SNYA 3MG9A 4B6OA 3I1FA 1XQ6A 4EYGA 5CVTA 2YIJA 2QVGA 2XTZA 2BGTA 1YJCA 3IUNA 3PUWA 4L08A 4NE7A 1GL9B 3C85A 3LO5A 4BO6A 3U56A 2IHZA 1UXJA 1MV8A 1UXIA 5JCJA 4P4NA 3EZXA 3HBMA 3CNLA 1IJBA 3GGGA 3OLWA 4TLDA 4BB5A 4N0DA 1N6KA 1I5EA 1Z25A 2V4MA 1DEKA 3WLLA 4FJ2A 4DKXA 5EZYA 3ILXA 4HGQA 4IXNA 2UKDA 1PNQA 1ZK3A 4YCAA 4WBSA 5IP5A 4KE6A 4B0OA 2ISSD 3VUFA 3TRKA 3ADCA 4YO8A 3RSQA 1L1RA 1UK6A 2DY1A 1OC4A 2XNJA 5CJ2A 4EIWA 3DZIA 4AURA 4BMVA 4U7WA 3DHVA 2PLAA 4LDPA 1VYHA 3WGIA 3EPJA 3SX0A 1CEQA 3CYFA 2ZRFA 3JWGA 3OO0A 2XOKA 3B2EA 5K9ZA 1AB6A 5HPYB 3TX2A 5EWJA 3RYIB 1DKOA 4RGVA 2EJWA 3P5BA 3O0TA 3UK2A 3QBDA 5TPZD 3FCSB 2FMHA 2QRLA 3JD1A 2JEOA 4OJTA 4OM8A 2W93A 1CTQA 4L4YA 4ZVTA 2L18A 1ZXLA 1KDTA 4UEQA 5CU7A 2C2GA 3FHOA 4KQHA 4D8XA 4L9WA 1HDGO 1RWKA 1D2GA 1RXIA 1Z2DA 4QBGB 2EHDA 1WD5A 2WZBA 1ADJA 3EQ8A 1R0ZA 4FMBB 4CKEB 4E5NA 3GEPA 1GKYA 3GT3A 1RJFA 3D2LA 4HRAA 4PZDA 1KIAA 3ES9A 2QNBA 2XA2A 4R41A 2FMUA 4ZOEA 4EHDA 2JLUA 2JFZA 3H99A 5T64A 4KFRA 3OD1A 1QB8A 3RKUA 4EB6A 3VHLB 4CI0B 5ADUS 3U6KA 4GDMA 1F20A 1XHFA 3SQXA 4UNPA 1V4BA 2GKSA 5LKAA 5LMCA 5BRJA 4RBNA 4NJOA 4G0ZA 2I2DA 2GJ9A 4YRCA 3JQFA 2MSWA 1Y3IA 1FVOA 1P4SA 2H9YA 2JD1A 1YVUA 3KP1A 1U9ZA 2X13A 3E2MA 2SECE 2G1KA 3LLCA 4IIGA 4P4UA 4G24A 1SUSA 1ZGAA 1PL0A 3SC2B 4CF6A 1YS1X 3QPAA 4Q1FA 3CCCA 2P3QA 2OVFA 1RXVA 4B17A 3JWPA 3IT0A 3RABA 5JO9A 5AW9A 5JISA 1PZEA 3VC1A 2C98A 4OQDA 5BYAA 3OE5A 2OHVA 4D3SA 4E15A 1EVKA 1HPLA 1TTHA 2NVOA 5EEHA 1M1UA 4U3JB 3QVOA 5HFAA 4BNUA 3P9QA 1NBWB 2GSDA 3HN7A 5H02A 4RH3A 4Z8XA 1JFLA 4DJAA 1P8JA 2FJPA 4P1ZA 4P7JA 3T61A 3V33A 3WXMA 1VHWA 2NO9A 1AMUA 1FU4A 2MCFA 3WV5A 1AM4D 1HQKA 4M76B 4NYJR 1GUFA 2XMRA 4WKOA 3RK1A 3T7AA 3GJYA 4M8NE 4FFLA 5KHAA 5EIBD 5HJ7A 1XNRB 3H2BA 4M9SA 2ZCUA 4EDHA 3P2JA 4OK5A 1NG1A 4RANA 1YS9A 1XDDA 1E5DA 1RXUA 4DQDA 1OZFA 2C9MA 4JKOA 3H97A 1VE5A 1NY5A 3FDIA 1Y4ZA 3N8DA 4FFOA 1Q17A 4BLPA 1ULUA 2VH5R 2HD4A 4C6SA 3FX2A 4RD0A 4RORA 1JDJA 2XUQA 4JT9A 1IWOA 1Q95A 2DP4E 4CCSA 2HNAA 1P1CA 1SXIA 2CDBA 4WNIA 2QAGB 4DEVA 2PXAA 3L82B 5HQ3A 3QNMA 5TS3A 3DDZX 2DHQA 1PFQA 2DHEA 2NPOA 3JQ9C 1ZISA 2W4QA 3IV6A 3DPIA 4P38A 4P2BA 5FAXA 5SYNA 5YASA 3PE6A 2ZULA 4MUKA 3DZ8A 3OO1A 3KKLA 5A2GA 3LC0A 3AUFA 2VN8A 1FSPA 3V2IA 1UEJA 2ZWIA 1YJAA 4PQGA 4L74A 2VYNA 2YIMA 4BGUA 4JHXA 1I01A 3ZGOA 4P0PB 3QKWA 4IRMA 3N2NA 1A9YA 3E5RA 3GVCA 3EXEB 1UMBA 2GT1A 2PA0A 3W7BA 1THTA 1S1MA 2UUPA 4ZU1X 5IT4A 2IDMA 1L5FA 5LN1A 4IS3A 1NF3A 3BWEA 3MAGA 4P5EA 1IM8A 2WYVA 3VI4B 4EGFA 5MFPA 2JAPA 1MTOA 5EJ2A 5E2AA 4GLOA 5I47A 4EG7A 1IBCA 4N3BA 2XQKA 3KYCA 1NBEA 1PJRA 4P6VF 1DQNA 4DMGA 3DE3X 5EHNA 1SUBA 4ZZIA 1YBAA 2P30A 4YDHB 2XUFA 4QOEA 3ZY4A 5IJXA 4ZAXA 3GAMA 4CM9D 2E4WA 2ZXEA 3KXPA 1FRQA 4YMVA 3EHDA 3ZUPA 1NJ6A 3BOSA 1CJCA 2XMCA 3MN1A 4M1ZA 1GQFA 2VJBA 4PHFA 1DKLA 1N2SA 3QLUA 2PD4A 2ZS7A 4ZU3A 3UHAA 1J24A 5GOTA 5DNCA 3Q8KA 2NTNA 1VJ0A 2JZCA 1BJKA 3L43A 1P9NA 1VKHA 3W5DA 3S1AB 1W4CA 1P0IA 4ZJPA 3AFHA 1NPTO 2ZUSA 4O59O 1KSGA 4CM8B 5E1OA 4RFSA 1G1AA 1UM8A 5F1YA 3QVXA 4CUJA 1LLDA 4IOMA 3JQAA 4R16A 4RPHA 3SC6A 1AC5A 3E5HA 4LNAA 2IHKA 4RVUA 1CT9A 1U0HC 4ICIA 5AKKA 1M0SA 3HXPA 4ZZ3A 2QQEA 1UBRS 1NIPA 4YPFA 1AGPA 4L72A 3EDRA 3ZXSA 4B3GA 4XVQA 3NRBA 3R6TA 2A4KA 1T4CA 4JJIA 1GYRA 1X7YA 1UAAA 5DIZA 3BC1A 1FJXA 1IIBA 1DRUA 1LPOA 1UM9B 3TUZC 4Q3CA 1Q0PA 2G06A 1YRHA 4WINA 1NN0A 2GK3A 1AK9A 2VJNA 1HRKA 3G0OA 2IF2A 4NBVA 3X2EA 1RWMA 3A27A 1UT6A 4BNIA 1JG4A 4JX8A 4TMYA 1XZAA 2YVAA 3M70A 4G36A 5B37A 5BQ5A 3TLBA 3ONWA 4NONA 3FVRA 3OPVA 4I2VA 1FTQA 3L0IB 4RJIA 5IEBA 4B33A 4DL9A 1G291 4BJ3A 4I99A 1EVJA 2Y4NA 4FYXA 3FKSD 1CWUA 1EBUA 1JVNA 3SYRA 2C20A 1DXHA 3LG2A 4GVLA 3WLPA 1G4UR 5EJGA 5T4HA 4HTAA 1RKXA 1E0SA 5KIAA 4JNCA 1MIOA 1SEVA 2OCPA 1FDOA 2XZPA 4U4AA 4YXWA 5TF0A 4BO5A 4U7TB 2P5YA 1ONOA 1UUFA 3PC4A 1P6UA 4ASUA 5BR1A 1MLDA 2X15A 3CEPB 3E0XA 4KNWA 3PJEA 4YJFA 4C88A 3PICA 3CUEF 1LB1B 4NMWA 3OEWA 1L8XA 1OROA 2EGHA 2ZYSA 3LOUA 4X1OA 4XDYA 5E9QA 4KQGA 1KBQA 5IYZF 2YCBA 2X0JA 4RWZA 1BKYA 4ER5A 1ZMBA 3R7LA 3FWHA 3PL5A 1I80A 2W71A 4HVTA 3ZE1B 4F7DA 1O94A 1VJ5A 2BZ0A 1JDNA 2QN6A 1A5SB 4K03A 4LI0A 1JEEA 4U9HS 2ZI3A 1AGNA 1YR1A 3IUPA 1ZM7A 3NBFA 5TGDA 4DY4A 4FILA 1VBMA 1JQEA 3MMNA 1V1JA 4R31A 1Z73A 3AZOA 3ZGYA 4DRXB 3JQQA 5E2BA 5BSEA 2J4CA 3BXGA 3H5LA 4MHTA 1JUDA 4TN1A 3I1JA 5J9FA 3ZS8A 4LISA 3E7WA 4TTTS 1OWOA 3PQ8A 4TMKA 1QP7A 3JTEA 1RTKA 2W00A 3ZE7A 1OFHA 2PL9A 5J5VA 1E4YA 1JDZA 2OCLA 1D6NA 5FWDA 3S8MA 1Y34E 4GMDA 4OQYA 2XF2A 3SIRA 1M34A 2MSCB 4GI5A 4C4YA 3ETNA 1PUIA 1T3ZA 1A9RA 3ZHXA 1PGNA 4C1NA 4D57A 1K27A 3WXBA 4F71A 5GINE 4MYUA 2GR9A 1GAWA 3DVLA 3S2SA 4LVOA 1QU3A 4KFCA 1OU0A 4INPA 5I5EA 2RI0A 2X0RA 2Z2YA 1P19A 3PGXA 1UF9A 3L8CA 4R2JA 3MAAC 2ZPAA 4LQ4A 1KYQA 4TVOA 2B82A 1GGEA 2J6BA 2J46A 3AU9A 1KI2A 4NEGA 4F12A 1EBFA 2OOSA 1PWEA 5LQCA 5JUWA 3QX9A 4WA8A 3EXIA 3FMGA 2FFQA 1KDVA 3HUUA 3UMMA 4EX6A 4IXDA 1ENYA 2KSQA 4CKBA 3B1FA 1UINA 3NBYC 2X8JA 4RTOA 1GD1O 3W04A 3RSSA 4ERNA 2C4VA 4QGFA 3DYBA 1MC4A 2J9GA 1CY1A 1J97A 2VCEA 3PFCA 1QF9A 2EC5A 3F5SA 4KXWA 1FP6A 3ZLVA 1DOAA 2AI1A 2O7QA 2VH1A 3DZCA 5B36A 3MJCA 1IDN1 5AK0A 2WF8A 4BVEA 3WB1A 1QGAA 3VR2A 2GKGA 2PX0A 5A4KA 4CKBB 2F4VB 1TM2A 2VHQA 3BDIA 1WABA 3C8DA 3LXUX 4A3SA 3CUYA 4OL9A 3R23A 4BFLA 4KR0A 1D2EA 2MSLA 4B4VA 2PYDA 4G0MA 4EH1A 5I8WA 2C2ZA 1RYNA 4E3ZA 1KI9A 2FAXA 2Z1MA 2IYWA 1XQYA 3C3WA 4OQEA 5JJCA 4HGPA 3D81A 1XXLA 5JNUA 2VZEA 2WUEA 1OFTA 3MA0A 4IFBA 2CXTA 4RPIA 3S28A 4RACA 2WWWA 4LSWA 4YJDA 1NM5C 5DCLA 4UTNA 3WYGA 2GYWA 3DE7X 5K3FB 1YFKA 3GEGA 3KS9A 4EFLA 3P19A 1I3CA 1J99A 2F17A 3BERA 1R4NB 1SQFA 3N6VA 4IHAA 5DSTA 5FAKA 1NF8A 4UARA 3Q7RA 3KV3O 3T7RA 3B6ZA 4FB5A 4Q3OA 3BVPA 4OHOA 1KEWA 3U16A 1Z13A 4MP8A 4PC7A 2VJCA 4Q3LA 4X00A 3TOXA 1G55A 1TAHA 4PS1A 2FSVA 2F2TA 3ESRA 2Q3LA 4QYXA 1JAZA 5AT1A 1NNUA 1C50A 3BF8A 1GZHB 2HADA 3R5SA 1NVVR 2WD7B 4R81A 4R2IA 1T26A 3PFFA 1DMSA 2QV7A 2ZTLA 3K0AB 5JAQA 3D3EA 4AUKA 2CY0A 4P7KA 3NR2A 4C6RA 3HJFA 4YRGA 4MVJE 5BMOA 1YB5A 2WE7A 3T99A 2BDUA 3WV4A 4EUKA 5JAOA 1ZIDA 3DAFA 1J90A 2O2ZA 4YI5A 1N34B 1CCWA 4OQLA 3UKDA 1RSZA 4EELA 3LYLA 4U6SA 3KYDB 1RE0A 3IUEA 2I66A 4GZ3A 2Z98A 4R2WA 4TTPA 4XRGA 1NIJA 4PAMA 4KX3A 2MDTA 2B30A 4RDHA 4AG6A 5HUJA 1A50B 1L4KA 5KQMA 4MTCA 4XX0B 1HYQA 1V25A 2ZUTA 1FNCA 3L6DA 4EW2A 3ZJTA 1M0WA 2H3EA 3W05A 4QTUB 2BAGA 1QO7A 3T7IA 3KYDA 3W7VA 5FWXB 3SY8A 4LZOA 1D03A 1A5ZA 3QKTA 4JMPA 5BR7A 5I7RA 4AF6A 3F78A 1NR5A 4MA5A 3BQMB 3ZV3A 2X40A 2XUHA 3EULA 3MBKA 1ZO8A 2BFWA 3KO8A 3O4RA 4GX5A 3WJ2A 1PZXA 1JQJC 2WFLB 3RSCA 3ZV5A 4R9VA 2WUWE 3ZYZA 4PPQA 5MN5A 2ZIGA 3KVVA 2BMAA 1B16A 2VT3A 3I04M 4QYIA 2ZAYA 4RKQA 1DCFA 1RZVA 3NHLA 1F7UA 2B36A 1TPZA 2ZBVA 1QQTA 1GA6A 1CPYA 1GZ5A 2XGMA 3WGJA 2EKLA 4YJKA 3TIGA 3V8NA 1DOHA 3BWVA 3DD1A 3F6YA 1GZSA 2HBYA 4KV9A 1U0FA 5DHRA 1PNVA 1FDRA 2IYVA 3OMXA 3VGPA 1SD2A 1Z5VA 1Z9BA 3DV0B 1PHPA 2CLKB 3RD5A 3RHSA 1ZRMA 2VSFA 2JK1A 1WMBA 3EODA 1EU1A 2P9CA 1TF2A 3GWZA 4QYIB 3FXAA 3WOVA 1RYHA 2SCUA 1IQUA 2R87A 3C0KA 4KWEA 4HC4A 1L7NA 1C7FA 2JGMA 4Q1DA 1TOAA 3I23A 5IDWA 1HE8B 2VQFB 1J23A 1Z2OX 2AK3A 1X87A 5KNBH 3AZQA 3Q1LA 3K0KA 4PLTA 9ATCA 2I55A 1YDHA 1E9SA 1FYEA 3QEMB 1M8JA 1PG5A 3R4VA 4I9GA 4GRIA 4YUXA 3GVXA 3AY7A 3I6YA 4FMPA 5TQ0B 2P9EA 3RWOA 1RHQA 2R7NA 1P44A 3K4QA 1NPDA 3OBIA 1ISIA 1O94C 4JAVC 1AKRA 3R3JA 4WZBA 1U9IC 3RYCA 4BS9A 4M0LA 3MMZA 1ZH4A 4PPFA 5K0LA 1FTWA 2OXFA 5D85A 1BDIA 5AWFC 2YZNA 4N5IX 3P71T 3MLEA 4H7PA 2HRCA 1TCUA 1KK1A 2NO5A 1HDYA 1R3UA 1Z4MA 2HMUA 3FNBA 3QMVA 1Q77A 4REOA 1DU4A 3U26A 1NOJA 4IIXA 4GPIB 1M6HA 1GNVA 2ZLBA 2OBFA 4NV3A 1S7GA 3CINA 5TT1A 2WA2A 3K1JA 4LS3A 2IPMA 2FA9A 4M98A 3DOOA 10MHA 1Z5GA 2UUBB 3DFFA 2XMZA 1TUBB 3CB4A 1DIRA 3ILHA 4EMTA 1N2BA 3EGDB 1NVWQ 2IQIA 3MRXA 5JPIA 2WJJA 2G6BA 4JASB 4B3MB 3VSDA 3PJDA 2ID8A 4S24A 1AGYA 3S5JA 3TI9A 2F59A 2D6FA 4PO9A 1GQOA 3CUVA 2DE0X 3AI7A 1E3SA 3BUSA 3DLPX 1PSWA 4HT3B 1XZQA 1V8BA 3KNZA 4BO2A 4P4SA 4UUNA 2CHUA 3JW8A 1JPUA 1AS0A 1XAIA 2IOFA 2VDJA 3C7TA 1Z82A 4TS3A 1M6NA 3VSCA 3OPNA 2LD4A 3HUEA 4CM3A 1U90A 3R7WA 5ED4A 1XCBA 4HDOB 4QDUA 5EPEA 2DFDA 5B3KA 2C8VA 4TWBA 5BYKA 5IAGA 1SB8A 1CDEA 2QT1A 3V1UA 5FBVB 1MEOA 3R5JA 5JTTA 2FOIA 1SBQA 2KW5A 5UKDA 4JH0A 3ADBA 2PXHA 3I42A 3LLVA 1H93A 2YXBA 3SPXA 3GJ4A 3AW8A 3E9DA 3ZIDA 4EPWA 3WGZA 1ZSNA 2PA3A 4P93A 3T1QA 2RBEA 5D7BA 4JUIA 4Y1EA 1QH8B 3IP8A 2F43A 1QR6A 2A94A 1BD3A 2O3UA 1YIAA 2XXAB 1BYIA 2OK8A 1ZS9A 1YBHA 1V3QE 2GTIA 2EL9A 2VDQB 4ISCA 4X7BA 5EUCA 2OORA 1JILA 4WY8A 1BDMA 3FB1A 3JASB 2CVQA 3FMOB 5DI3A 2EARA 1X7WA 4BBZA 4L8WB 3DSRA 3TNYA 2VYVD 2J9YB 1N6NA 4AJKA 4HNUA 1T25A 4F60A 1KI3A 4MWTA 1C1XA 1SUFA 2GVDC 5EP3A 3CKLA 2XCOA 2Z4SA 2UZ4A 4GR5A 3WYFA 1ZHOA 5D3QA 1LEHA 1P7YA 2JRLA 4YBRA 2BCJQ 4BJ1A 3SE0A 1E4OA 3SJBA 4C07A 4L3VA 2IGTA 4ID3A 4QUDA 4LJ4A 3EZ2A 3OQVA 3G13A 1NKTA 3Q3JB 4AU1A 4F11A 3SLGA 1WKVA 2ORYA 4JLDA 1PZNA 4ARBA 3VDRA 3BHJA 3GP3A 5U9CA 4IG4A 2YMQA 4BLRA 3IEPA 5CLGA 1EX1A 2J9FA 3PEYA 1KDRA 4MQ4A 4R2MA 5DXAA 3O90A 1DZ3A 3CMCO 3DDOA 3NONA 1U5AA 3VQTA 1CY8A 1GGJA 2VP0A 3OLXA 1GTVA 1QOQB 5KQSA 1V2HE 1ZD3A 3IBTA 5TC4A 3ZHSA 1UPAA 2BM8A 3H5AA 4NNOA 3PXCX 1H1LB 2NGRA 4O2AA 4A8JC 3U4DA 4H59A 3HBNA 3C3AA 2H7XA 3N86A 4MEJA 1FJGB 1J1IA 1IWBB 3O2JA 4ZHSA 1NMXA 2JNWA 3ICPA 1RCFA 2PWZA 4MO9A 3UENA 1OLXA 1TKRA 1Z8DA 4HG2A 4RY9A 4EUSA 1GPDG 3MILA 5ULLA 4X92A 5L3QA 1NC1A 5CK4A 5JC8A 3BB4A 3COWA 4UXIA 1V35A 2YWGA 1SCUA 2CVOA 3S6JA 4D3ZA 4MUYA 4P81A 1CEEA 1C3JA 2FEAA 4OHWA 3K9LA 3TB4A 4RAQA 1LVUA 1NVXQ 2I3GA 4FONA 2VXBA 2HA6A 4NV1A 4QKQA 1EP2B 4RXMA 4RK1A 5JLJA 2R65A 1WUIS 1D7OA 2FMTA 3FYHA 5JZ9A 4DDWA 5JAPA 3PC7A 3KLMX 3KDPA 3RYHA 2DETA 3NETA 2DULA 4U9UA 2V65A 2Y3IA 4I2NA 4PX5A 4PLPA 2CZGA 2E4ZA 1JFFB 2IU4A 4ZMBA 2NUAA 4KO2S 3I30X 4ETWA 1KNQA 2NNWB 3OUUA 4WKNA 3MYRA 1T0PA 3JAMA 5HCNA 1W4AA 5EP4A 3DAPA 4OI1A 4L78A 1EFCA 2C4TA 3M1AA 4BP9A 3VJRA 4DGQA 1ZH6A 5A9TA 3T0IA 6AT1A 4YRBA 2W83A 1Q83A 2AXQA 4KNVA 4KUHA 1YR8A 3K2IA 1NBMA 2VBCA 1N2JA 2HT6A 3HYRA 4PO3X 2XTAA 4X8OA 4YRZA 2B6NA 2WJYA 4GD3Q 4UZFA 4A0SA 3D6JA 1WB5A 2XMDA 4LWPA 3ADPA 4ZQBA 3ZV6A 2C5GA 4CV2A 4EG1A 3F1LA 4Z1OA 1SU7A 5E4YA 1GKUB 4Z0TA 2HJVA 4FEGA 3KK0A 1FFAA 1FYVA 3SBDA 3I4CA 1MC8A 4RE5A 1G1MA 1KJWA 2LVBA 4BV2A 4N7RA 1PJ2A 1GLGA 1CETA 1XTKA 3HZOA 1R15A 5EE1A 4EPYA 1W36B 3C1TA 2D4AA 1TADA 2QZ9A 4I19A 3NEYA 5KTOA 4M1TA 1IJKA 1E6UA 1KR2A 3AINA 4DC9A 2XOXA 3OTOB 3FLBA 3TF5A 4XEHA 3KQKA 4DUYB 3LFTA 4H6XA 3C41J 4IVQA 4PN7A 4TM7A 3DVRX 1ZI6A 1VLLA 4JBWA 1XROA 3IUYA 3BMOB 5F76A 1IEVA 4GX0A 3SQOA 1KZHA 1X3LA 2NACA 4JI7B 1DBVO 1RQGA 2CHVA 2H29A 4NL4H 3SXPA 3KU4A 2UZ1B 4EJSA 3L4BA 1JBQA 3LA8A 4OD0A 4CG2A 5KDOA 3NOXA 1U3DA 4BBPA 4MUMA 4F1JA 4HLCA 4GPBA 4Q4DA 1G8AA 1ICEA 2I4MA 4RHFA 3RBXA 2P4QA 3BSYA 3BGOS 3QXJA 5HW0A 1Y6QA 2CMDA 3VR5H 5C52B 1GZVA 4F96A 2YASA 1JALA 1BH6A 3F90A 1IUPA 4CT0A 1EP3B 1US8B 1UP6A 3H6KA 1HEUA 1OBOA 1TRKA 4I9UA 5GJWC 4DTIA 5GVSA 4IHJF 2VDWA 1T8SA 4H1VA 4AZ3A 1NGSA 1P0CA 3OQPA 1NZDA 3UJ7A 4YN3A 5LWQA 3ZCTA 4C03A 1OTYA 4JJKA 4F04A 2FEKA 4DA6A 3JAKA 2PZBA 5SYMA 1MFPA 4KP7A 2QW1A 3R24A 1I0IA 4KXYA 1PFWA 3ABOB 1JHQA 2WG2A 4ZVPA 4HEA1 3WB9A 3MSCA 3AXSA 5CTAA 4DRZA 5A3QA 5IF3A 3PPIA 3OCZA 2DWCA 2C5FA 4TV8A 1Y7IA 3EQ9A 3I0MA 2P35A 3VO2A 4EARA 1N7IA 1QCZA 3ETCA 5K3BA 1RAIA 2C83A 2BFCB 3AFNA 3KM0A 1NUSA 1E66A 1KPHA 3Q3IA 4XTCS 5CITA 1QTNA 3QF7A 3KOMA 1VFNA 3T9CA 3H17A 4I5DA 2Q8QA 5EVJA 3UMRA 5J58A 4D9HA 4AZSA 4KR7A 3QY0A 4XDZA 3QWHA 2IDJA 2ISCA 1EJBA 1PJSA 1AG9A 3QPDA 4FBMA 5BV2P 2DHDA 1URPA 3DMTC 4IJWA 3JQ6A 4KUGA 2ATVA 1YASA 2WJ4A 2H9IA 1V11B 4IWYA 1QAQA 4FYYA 3WTCA 5JD4A 4KR3A 1B7GO 3U61B 4EBFA 1OWPA 3K96A 1ZGCA 1C7IA 4L7VA 2LIPA 1DFHA 2QV0A 3R44A 4AJLA 2O4UX 1A2OA 1WMEA 4Q18A 2GN8A 3EZYA 1M2HA 1JYFA 1ZIOA 1C0KA 3A3PA 4HGRA 2R11A 4QPPA 1Q1AA 3EVCA 1FFYA 3BGDA 4YAEA 3VH2A 1E89A 2NU9A 4R2KA 2J3LA 3PRHA 1SVKA 2RB4A 1G63A 1IRIA 1J07A 3RT9A 4L2IA 1JKJA 4Q47A 4AL4A 2OSVA 1GCOA 5FBZA 4C7BA 2XUOA 2UYCA 2FSSA 5C35A 3CNOA 3O75A 3TJZA 1ISMA 2BLNA 1PBTA 3JQ8B 5JT1A 3CRQA 4MUBA 4G84A 2Q3CA 2WTMA 4Q3DA 4BP3A 4EHBA 3M5WA 2RAUA 4LF4B 1EEHA 2JFWA 2RBKA 2OGTA 4FYVA 4M21A 4O0MA 1R00A 1Y7HA 3GAFA 5CNIA 4F56A 4QVKA 2XMSA 2XSZD 4ZQIA 2FSFA 3IUQA 4RJKA 4ESOA 2PUDA 4MVCA 5LBTA 4PQRA 2XBMA 2O8BA 2QU8A 2XAUA 3R0XA 1XDWA 3OBBA 5A5DA 1W4RA 4A73A 4H27A 3UPTA 1SQ5A 3QE0A 5IM4A 4OMUA 3U7IA 2VP6A 4BVBA 5KNDH 3ABIA 3QNUA 4LRUA 5CFNA 1NATA 3W90A 1NBAA 1NMEA 1UR5A 2ZSAA 1UZNA 1VG9B 2QF7A 5IKOA 4ZCIA 4V0LA 3THOA 3P4XA 4RHXA 4HF7A 2FGJA 1N6IA 1CRPA 4HRVA 3HBJA 2PSSA 1UXHA 4UE6A 4EJMA 3BDAA 1T35A 4I9NA 3DW1X 2VXCA 3UJCA 1OB2A 1K4YA 2AJLI 5KU7A 3UWDA 3NP7A 2DPYA 1XEWX 3X1WA 2W2KA 3H2IA 1XNGA 5HE8A 1UKAA 3HGTA 2PXCA 4J2TA 3VU9A 5BNIA 1F0YA 1QE0A 1DLIA 2GH1A 2G9ZA 2XB4A 4MB6A 1X9HA 2VWHA 2YIDA 3Q0IA 1RI5A 2WHQA 3GV0A 2E55A 4DJ5X 2QUJA 3Q98A 3R6DA 4B3XA 4TLBA 4DCPA 5D01A 4JC5A 1FQOA 1OFUA 3W5BA 2W6PA 1E1RD 1BCRA 3ASYA 1X15A 3MBIA 1SXJA 3TQQA 4FDTA 2WF9A 3FYDA 4BB0A 3VU9B 1KR5A 3M3DA 5F5NA 5I7SA 4D0GA 1NVVQ 3MEQA 3TKLA 1T1JA 2OENG 1QXSA 1GHTA 2JFPA 3HL4A 2RE8A 2J4DA 2QUBA 1ZNXA 2I54A 1WHSA 2AFHB 3HBAA 3GLTA 1IFXA 2CMKA 4FMDB 3R7DA 4DQXA 4C0LA 4BVJA 2OUKA 2CGEA 3EVBA 1QHHB 5H5JA 1M7HA 1N6OA 3LD9A 3THRA 1UMCA 4B4OA 4B47A 1CG6A 4US1R 3UGJA 1GEGA 1PK7A 2GLXA 4Q39A 3SVLA 4KXLA 2HEIA 2QHXA 4TTVA 3NUZA 3GF4A 1NXOA 4IH1A 4MXDA 1W47A 4O0LA 3WP0A 4ZMRA 2VP3A 3BD6A 4LYFA 5FTMA 1S4QA 3UK1A 2PSJA 1YZQA 4JBHA 1OLUB 2EAUA 2NTVA 3QU4A 1Y81A 2NXCA 2C9ZA 2YV4A 1YCGA 3KQSA 4BNYA 5JZBA 5EMMA 4UMDA 4E22A 4RA9A 4BKOA 5EIOA 1Q0LA 2P9QA 2PJDA 2K4MA 4BIIA 4DW8A 1E7QA 1QZXA 3IE0A 3KZVA 4OHVA 1GQSA 2ACWA 1YHZA 2AN9A 1CUFA 3QTBA 4IUYA 2XNKA 1PS9A 1U2TA 1YZYA 4QDXA 4V1CA 4M9XA 3OLCX 3USES 1ZY2A 3FNGA 3H3JA 1E9RA 2QXUA 3G0DA 3IAXA 3ORQA 3ZHYA 2BUCA 3ANYB 3B5IA 2HRZA 4YA6A 2ONKA 2Z6VA 3QOXA 5C81A 2MINA 2JJQA 2G88A 2GAAA 2AX3A 3K0CA 3PQ6A 1LCIA 3FWPA 4NP6A 1ZSVA 4QU9A 3RTDA 3TIIA 1T0BA 3E4CA 1NXXA 1OV4A 3S4YA 4PZLA 1IBKB 1FQWA 4PFQA 4FFRA 2RGUA 1N6PA 2YV3A 4GO1A 4P83A 4BGVA 5JMTA 3ROPA 2X7XA 5TQ2A 1A8IA 4M86A 3IIIA 5EMJA 3DMFA 4AJJA 1K1EA 5IMBA 3DE5X 3RYFB 4F86A 5JEEA 1AQJA 4LFAB 4A82A 3AETB 3A9SA 3H4IA 5KUTA 4QECA 1XEAA 2Q5JA 4LCBA 1IY2A 2O2IA 2A14A 2NO0A 4PSVA 3RSFA 4CBVA 1VLJA 1JMVA 4U5QA 1O7JA 1XRQA 3CW8X 3PUXA 2NIPA 4G07A 1H9CA 2AR0A 3URKA 3PSHA 3C3PA 3ZH9B 2V9CA 3SX4A 3IHTA 4J43A 3IA7A 1QTRA 1YZNA 1EQUA 2XGOA 4H6VA 3V1KA 1WVGA 1IHOA 4N12A 3D9QX 2BGUA 3PX7A 2WFMA 2G3YA 3RC2A 1E92A 1TECE 2OM6A 2G36A 3NHRA 5FWYA 3LWZA 2FE4A 2GVNA 4D9NA 3ZBQA 5JMWA 3DYIA 4AC9A 5JCZA 3N76A 5FUMA 4DV2B 1JJ7A 3CEHA 2QN2A 1JECA 2FN3A 3BTUA 3BA6A 4URVR 1NMQA 4D8TA 3EY4A 3UAVA 5DM70 3B20A 4UU1A 4QG3A 1RQ7A 4JLMA 4Z4FA 1R0WA 1E2EA 2LRHA 2WF6A 3N0VA 1FFWA 2JGDA 2PKCA 4KSYA 4L57A 4WNYA 5FH9A 4RJJA