2YC4C

Intraflagellar transport complex 25-27 from chlamydomonas
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
198
structure length
177
Chain Sequence
KPIDITATLRCKVAVVGEATVGKSALISMFTSVVAPVTIPDTTVSVELFLLDTAGSDLYKEQISQYWNGVYYAILVFDVSSMESFESCKAWFELLKSARPDRERPLRAVLVANKPPQRHQVRLDMAQDWATTNTLDFFDVSNPPGKDADAPFLSIATTFYRNYEDKVAAFQDACRNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Intraflagellar Transport Complex 25/27.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Transport protein
molecule keywords INTRAFLAGELLAR TRANSPORT PROTEIN 25
total genus 52
structure length 177
sequence length 198
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2yc4C00
2OFWA 1W46A 3I3SR 2VSOA 2ZETA 4QNRA 2BCJQ 2PCJA 4P3YA 3CLVA 4BFZA 4DDVA 2GBLC 3LQQA 3SJAA 4NCHA 3ADBA 8OHMA 2X2FA 1Z47A 1KSJA 4EFNA 2IWHA 4GPTA 4WZBE 5G3ZA 1OH8A 5D3MA 1NY5A 2FSHA 1M1YE 4M1TA 2JJ1A 2F55A 3KKMA 2BJWA 3T12A 1EFCA 4WXRA 1II0A 1ZD1A 4W5JA 3U3OA 1NN5A 3E2IA 1GFIA 1W48A 2YWEA 2ZI5A 4BQSA 5A4JA 2LKCA 2XX3A 3AF2A 1Z6TA 2W0MA 4OHWA 3CPJB 3ZZ0A 3HPQA 4NHOA 1NG9A 5DI3A 3T61A 3TNFA 3K09A 2ZRAA 1N6NA 4CDGA 4R2IA 1U94A 4MYHA 2W83A 2BM0A 2AWOA 1SVSA 1KSHA 4Q1DA 2F3TA 1MABA 3U4QB 4C0KA 4EQ6B 5KSYA 2F1JA 3W9YA 3CZQA 1XMJA 3HJNA 3AUYA 2ZRBA 3JVUA 3B1ZA 4TZ6A 4DDUA 1J7KA 1W49A 3MUFA 4WAUA 2G1KA 3IQWA 4Q4AA 2RMKA 5B64A 5DIFA 2R6FA 521PA 1ELOA 2RGAA 2Q9CA 3CRRA 1CJMA 4DCUA 1UBGA 2DPXA 2V54A 5J4YA 3BH6A 2WIAA 4F4IA 1GKYA 3CPHA 2AD5A 2C98A 2V7QA 2R8RA 3VKWA 5TMPA 1RKBA 3GEHA 4KO8A 1A82A 2ZYWX 1AK2A 3QKRB 2B92A 1HT2E 5FOUA 1Z8FA 1CIPA 2VHUA 5BYJA 2YC2C 1E2KA 3Q8XB 2O8BB 1KI6A 2AHOA 2NMVA 4KSCA 1H8ED 3W6PA 2AL7A 3LBNA 2BBTA 1ZUNB 4DUGD 1OE0A 5DI9A 3ZQ6A 2QAGC 2BWJA 4EFLA 4LHXA 2QM7A 3KFVA 2DWOA 4IHQA 4KV9A 4Z8XA 1B23P 1S96A 2XXAB 1E69A 5L3SB 3GLFB 4IOLA 4I1UA 4OK5A 2VEDA 1ZC4A 2HLDA 4F93B 3P26A 1U81A 3W6OA 2O52A 3MWLA 4R2HA 1VMAA 5J4VA 1M74A 4BRUA 1XXHA 1OPXA 3MLEA 1JQJC 2OLKA 3VU9B 4PPQA 1KK0A 3D3QA 2UZIR 1ZJ6A 2QN6A 2H57A 4NTZA 1OHHD 2DBYA 1UBCA 2R9VA 3VKHA 2ZJBA 4RZ3A 5E4FA 2XNDA 1M7GA 1NSFA 1Z0DA 2DWPA 4A6PA 1AQUA 1D2NA 2X19A 3THOA 4EJSB 2IYLD 1RVDA 4P0TA 1H65A 4WBSA 5KHOC 1OB5A 3W5JA 2E87A 5JSZB 1ZM4A 2O8DB 3O8BA 3OIYA 4OHXA 1CULC 1YR9A 2XNSA 3C4JA 4NONA 4LJAA 1ZAKA 5FR1A 1OFIA 1RPZA 5FI1B 2BCGY 3KQKA 2JA1A 1I2MA 2YC4C 4C3ZA 1WBBA 3U7EB 1QG2A 4B35A 3U3JA 5FUWA 4PSVA 1SGWA 1KDOA 3U4QA 1HT1E 4HAYA 4JLOA 3VR4A 1VCNA 3KB1A 2QE7D 4D0NA 3T06B 3T1OA 2REOA 2JATA 3A1TA 5JJKA 1T0JB 3JZMA 5EZ6B 3PEUA 3DMNA 3NHBA 2OHFA 5IT5A 1XD2B 3FMOB 4A2PA 5LDDC 2V3CC 2VP9A 2C9CA 2NG1A 4B33A 1FQJA 3SC3A 5JMTA 3K0EA 3P20A 1KI8A 1UF9A 3GCGA 3QVVA 2EFHB 4AKHA 1XP8A 4WVFA 2O8FB 3FKQA 2PZGA 2J7PA 1JPJA 4IVQA 3LX5A 2A5YB 1DO2A 3NBZC 3KQHA 3CR7A 3L0OA 1S1CA 1X6VA 5KYKA 1XB2A 2F43A 3UKDA 1UM8A 1YQTA 4BWYA 3MMPA 4L9WA 4JYCA 1TL7C 2IS2A 2CDNA 4ZIRB 5CK5A 2ZSFA 2WKPA 1N25A 1R5NA 4M9QA 1VG0B 4EUNA 3KJEA 5EXXA 4C9BA 2ZM5A 1MT0A 1RRPA 1M7HA 3GLHA 3ZVMA 5EP1A 1WBDA 4TMTA 1L2TA 4AURA 1W4BA 2YKGA 2GZDA 3PV0A 3SYLA 2WKQA 3C8UA 3U7GA 4WZ6A 4QKQA 2ZRKA 4E09A 4RKEA 4ZI2A 3P32A 3CRVA 3O8DA 2RGXA 3FE2A 5L3RA 2JLVA 1CRPA 2CLDX 4KU4A 4DCNA 3T5GA 2RHMA 1Q12A 2J59A 4QNMA 3VQTA 3I4LA 1TPZA 3L0SA 3IBGA 2W00A 5JHHB 5HE9A 2WWGA 4KXFB 5G53C 3RS5A 1N5LA 3A1SA 3WMGA 4B6EA 4OK3A 3FOZA 1E0JA 1SVMA 1ZM2A 3QQ5A 3NBFA 4TQAA 1XMIA 4MH0R 5GJVC 5JCPA 1GKIA 3QPWA 2G83A 1E9FA 4GMXA 1NVWQ 1NN0A 3RABA 1N0WA 4DHEA 1RRCA 3EG5A 3KDSE 5H1YA 2XZOA 3U60B 2HCBA 1E4VA 5FTJA 3TKLA 1CLUA 5AUNB 4XSGA 5CM9C 1I2DA 2KE5A 2XXAA 2V6JA 1R7RA 2W58A 1R8QA 3N2EA 3C41J 4ZIRA 1ESMA 1UKEA 4DCTA 4M21A 4PPFA 2QZ4A 2HYIC 2H5EA 3LXXA 2VA8A 5FFMA 4IOKA 3DKPA 2YV5A 3PFIA 4TQ9A 4WA7A 4V02A 1N3BA 2JASA 5TXGA 3WNCA 4TMXA 5JJLA 4LK2A 2Q21A 4IVPA 3ADCA 2IK8A 1M34E 3DOFA 3PXGA 5F3WB 1P6XA 2B8TA 2LCFA 1UAAA 2JLWA 3RVBA 4LYHA 2MMGA 2Q3MA 3GJ4A 4TL8A 4BLOA 2O8CB 4ARZB 5AJYA 1CEEA 1EGAA 2ZSDA 3BE4A 3V9PA 1DAHA 3SQWA 3K09C 2VP5A 5E95A 4F7WA 1IN6A 5CYOA 1M2OB 4GZMA 1AM4D 1GG2A 4MKHA 2R6DA 3NKVA 4ESHA 3BJIC 3BRWD 4GOJA 4LUCA 4PQRA 3B1XA 1J90A 4URUR 5DLQC 1GVNB 3PEWA 5C1BA 5CM8B 2P6UA 4MGIR 2IBMA 4M1OA 4MUBA 4BFWA 3TAUA 2WM9B 3KTAA 1FQKA 2ZJ5A 1WXQA 2ZUBA 4PHGA 2QTFA 1NF3A 5FUXA 4IFBA 2WWHA 3KJGA 4FCWA 5KOYA 3EARA 5CJPA 3RDPA 1UPTA 5J47A 1BIFA 3CX8A 4UNSA 2BKUA 1ZM3A 1XTSA 2X2EA 4F91B 4C7OA 5DSZA 3IPYA 4JL5A 3U7HB 4GRAA 4CEHB 1E2HA 1WP9A 2PX3A 1U8AA 4A9AA 2AWNA 2F1RA 3IO3A 2C96A 4X8MA 5KO2A 3I32A 2IT1A 2WAYA 4PANA 2FU5C 3SJCA 3LWNA 5KDDA 3OFNA 4Z1MA 3ZGXA 4BUJA 5EZ5A 3AM1A 2AX4A 2XJ9A 3CUEF 4G3XA 1E9SA 1OFHA 2N46A 2QMOA 5HCNA 4RD2A 3AGPA 4TYWA 4MKIA 5B57C 3JZAA 2CXXA 4I1SA 1MOZA 4LJ5A 2A5JA 3WBKA 3EX7C 5BN4A 1PZNA 1YR8A 2PT5A 4JLAA 4PO9A 5JI2E 3QXHA 4JBXA 2R65A 2ZAOA 4IW3B 5FOVA 1C9KA 1IN5A 4DLZA 1P2VA 3GP8A 1G21E 1AS3A 4JLVA 4KFUA 3RAPR 1MO5A 3OAAD 4FD2A 1KK2A 3R7WB 2V8OA 5CIQA 3T5DA 4LI0A 4M22A 4V0OA 4V0ME 1N5JA 4B3GA 4V03A 2AN9A 4K8OA 4TSFA 4EJSC 1EFRA 2YZ2A 3Q72A 2QPTA 4DLUA 3U7FB 4M53A 2IYRA 2IUTA 5KSOA 5F98A 2IXEA 4NBSA 2J0SA 2H1LA 1MV5A 4CVNA 2HCJB 2O5VA 3DHWC 2ZJ2A 3B60A 3L8YA 2ZROA 2IXFA 3A1UA 1ZC3A 4E03A 2HV8A 1M8PA 2BEJA 2P67A 1S8FA 2W0SA 3R9WA 4NCKA 2FJUA 1JEEA 4HYYA 1IY0A 3MWYW 1J8MF 2VP2A 1GWNA 4DB4A 4EAQA 1E2DA 1VG1A 4UXIA 1BO6A 1QHYA 1ESNA 1OW3B 3GQBA 5J5CA 1JXOA 4LBZA 4TT3A 4Q5IA 3CWZA 1G4AE 4N0EA 1LV7A 2OM2A 121PA 3IHLA 3QF4B 4LJYA 4UJ5A 4D4KA 2GAAA 1US8A 2OSBA 1DG3A 3PQCA 4AKIA 1Q0UA 1E9BA 3F0TA 1QHGA 3I62A 1SKYB 1Q1EA 4OKSA 3UG7A 1SXJE 1G3MA 3TBKA 4G01B 1XPUA 2WICA 5L3QB 2QM8A 1W2HA 3HYTA 2JIZD 3WNDA 1YRAA 3FHCB 1SXJB 4JL8A 4KJZA 4RY2A 4YLGA 4EPRA 1P61B 3H2YA 4IOJA 2YWHA 3UIEA 5B2ZA 3RRZA 2JLQA 4UNRA 1R0WA 3K9GA 4AYXA 4V0KA 2KI5A 2Q0HA 3H86A 2Q9BA 3WMFA 4MGZR 2FA9A 1UKVY 3PENA 2G1JA 1TTTA 2QPOA 2V1XA 4KYIB 4TLAA 3ZLJA 3FVQA 1U8YA 2FG5A 2ZRDA 2CCKA 2J46A 4EPYA 2IEZA 3QKTA 4FMCF 4JSTA 4JLDA 2GVDC 4BEBA 2J3EA 721PA 3QE0A 4W7SA 5EE3A 4ACBA 3CH5A 4QFMA 4Q9LA 4DZZA 3P4YA 3V4RA 1W5TA 2B7CA 4LHWA 1KY2A 1OFUX 1FUKA 3LVQE 1HV8A 3ZVNA 1E0AA 5IF9A 2FMXA 2YYZA 4KBGA 2Q9AA 3NC0C 2E1RA 3EPLA 3KKPA 3HU2A 3T15A 1J99A 3WY9A 5K8TA 3AP1A 4JKYA 4W5WA 2P5TB 4Q21A 1YVDA 3QJYA 1HEIA 2IW3A 3CH4B 1ZYUA 4Q66C 1U99A 1FPMA 1G9XA 4MYUA 4RVCA 1W5SA 1Q3TA 5SZHB 3QSYA 4YMSA 2WBLC 1G7CA 4AYTA 5BN5A 5G41A 1YKSA 1G18A 1SVLA 3AF4A 4HLUA 4LOAA 5FL7A 3UMSA 4B44A 1N6IA 2W2VA 1QRAA 3WNBA 5C2JB 2VP0A 3L8ZA 3ZS9A 1VCOA 4E07A 4GMDA 2QG6A 4DKXA 2EYUA 5EXSA 1N6OA 5FTMA 2AK3A 1DADA 4L5BA 1E32A 3X1ZA 1DARA 1VPLA 4NYMR 2GCOB 3TVTA 2O8EA 3P4XA 3UWKA 3ZYCA 1IONA 2ODEA 3DZDA 3GLGA 1D2MA 1W36B 1G8PA 4LDJA 3GLHB 5CB8A 3O47A 1Q1ZA 4HATA 3SBEA 4ON9A 4ZV4A 1L8QA 3U61B 3MSXA 2RGNC 2J7PD 2ZR7A 3TIFA 1NVXQ 1ZM9A 3Q7QA 2REXB 4MRSA 2PMDA 1KZ7B 5KDOA 4AG6A 4G5SA 3QVUA 4QM7A 4I4LA 4B3CA 4B6FA 3RSLA 4X8HA 1HA3A 4B3BA 4MDEA 4U02A 4B34A 4D82A 4Z8YA 2CHQA 2WJJA 4XVQA 1DO0A 2EYQA 3K70B 2ZR9A 2OBNA 3EZ6A 4LRWA 2ZREA 1KO7A 5DI3B 2PH1A 1YE8A 1RJ9B 2V55B 5IHPA 1Y3AA 2C8VA 3I8XA 1T4GA 4JBYA 1NVVQ 5HR5A 4RZXA 1OIXA 2WIBA 4P32A 3GLIA 4HLUC 5A0FA 1OXTA 3AKCA 3EZ9A 4QXAA 4RD1A 4QGHA 5G40A 2NO7A 2HXSA 1NJGA 2FPKA 2J45A 3KTAB 2KSQA 4Q18A 4LV8B 4RD6A 1FOEB 3I92A 3CBQA 4TYQA 2FE4A 2F6RA 4XH9B 3FMFA 4XJXA 1VIAA 1MO4A 1NMXA 1Z6XA 3B78A 3AF1A 2G9NA 3CIOA 4A0RA 1AZSC 1IBRA 1R10A 2B6HA 2OG2A 4KFSA 5E7IA 4HUQB 3MD0A 1W4CA 1AIPA 4YDHB 1WCV1 4OI1A 2RGCA 1FNNA 4C0SA 4M1SA 1NN1A 1CS4C 4P4SA 4AKGA 1YZLA 4TT3D 1NJFA 4FMCB 1JQLB 1SXJC 4YMVA 4ZDJA 1E79D 2NPIA 1VCMA 4FXPA 2JLSA 4MKFA 1G41A 1BKDR 4DLRA 4LPKA 1OH7A 1CJKC 4A0FA 4OQNA 2BOVA 5JZVA 1OH6A 2C77A 4QG7A 3X2SA 821PA 2C78A 1B0UA 1XEWY 2KBFA 5ELXA 4PSKA 3K9LA 3L0PA 4KHZA 1UFQA 5B30A 2CVHA 1CR4A 2NQ2C 4DJTA 1T5IA 1NBMA 2HF9A 3TGPA 1FNMA 3HU3A 4PAQA 4A4DA 2XB4A 4AD8A 4NYJR 1E9CA 1I4TD 1XTKA 2QGNA 2PT7A 1Q1QA 4QJ4A 1P2UA 2D62A 2GJSA 2IYUA 4A92A 3EPHA 2LKDA 1II8B 2WJVA 3CPEA 4XOIA 2Q3HA 2UVQA 5GADl 4A8JC 1JECA 3ZIAD 4Q4JA 4OHVA 2RAPA 1JR3D 4BLSA 3VMFA 5EE9A 2RGEA 3CX7A 3L0IB 4Q4HA 2G3YA 3SOPA 2WKRA 2EFCB 1Z07A 4JVLA 4OJKA 1GZSA 2FX3A 3GFPA 4GOKA 2HDNB 2ZJYA 5JECA 3NWJA 1NN3A 3RWMB 5HKKD 2ERYA 4MUAA 1UKYA 2HF8A 1TQDA 4MA4A 4XSHA 1E2PA 1KI1A 2GILA 4IDOA 2OCYC 4LYJA 4TYPA 1FMLA 2PZEA 3LLUA 4W5HA 3IEUA 4Q47A 2QRZA 4TLDA 1XJ0A 1UDXA 1GUAA 1N6RA 2WWWA 3GJXC 3I73A 1LW7A 2I1QA 4JVSB 2FEOA 1VDZA 2MSCB 2DYKA 3PITA 1E9AA 3PJRA 2ZRJA 5TDHA 2XITA 4JZKA 2Z4SA 4C0JA 4ESVA 5UKDA 3VX3A 4NP6A 5BQ5A 4HLQB 1SHKA 1GSIA 4EKDA 1IQPA 5K8LA 5HPYB 3BS4A 3QPUA 3NBXX 4OQFA 3LFUA 2KB0A 3GEEA 1G1MA 1E6CA 4Q7MB 1E2EA 1KMHB 4QGGA 4EJSA 4B3XA 5M04A 4JLPA 3IPXA 4UNNA 1XCGB 3ZDQA 4KAXA 2IUUA 2F43B 2WJHA 3O8CA 3BXZA 4DBLC 2OBMA 1II8A 2W2TA 5JHGB 3K0AB 1EG7A 2ZSBA 3AKDA 3FKSD 3PUVA 4IJMA 2B8WA 1G17A 1OXUA 5C4GB 1KI7A 1NI3A 1AN0A 2BJVA 2NGRA 1E2MA 1D9ZA 1XMSA 2NO6A 4Q1EA 3CRQA 1E9RA 1Q44A 2NIPA 2C04A 5LBIA 4DSNA 4JYBA 2O8EB 5KDLA 5CDFA 3EIHA 2OBLA 2ZRGA 4CGZA 3H4MA 4URZR 4LYAA 2JJ2D 3BFVA 4HZUB 4HI0E 2DHRA 2QMHA 4RD3A 3W90A 4D0LB 1KJWA 2CCGA 4NDZA 2ZRIA 1XD8A 1YJ5A 4LCBA 2EWWA 5AUOB 2X77A 1A2KC 5FTNA 2PMKA 1ZNZA 5JFGA 1IM2A 5FBQB 3CZPA 4B76A 1KI6B 2YJTD 3QXJA 4XVUA 4M4SA 4CT5A 2ODBA 1U2RA 2XNDD 4LC1A 5JS8A 1NIJA 2K5UA 1T91A 1ONBA 4HB0A 2OAQ1 1IN4A 2BMDA 5FH9A 3GJ5A 3TAHA 2C2HA 2QRNA 5FTLA 1E1QD 4AYWA 4IEEA 1GDDA 1XXHE 4OHZA 3IIJA 4BZXA 3THXA 2IS6A 1JR6A 2ZI4A 1KYIA 3OEHD 2YOFA 3PVSA 3LDAA 1ZU4A 1T0HB 3RC3A 4O2LA 1E2JA 3FMIA 2DY1A 2OXCA 2VHJA 1R0ZA 3GFTA 1KK1A 2IYZA 1XNJA 4BE7B 3VTKA 2O0HA 1IXSB 1QG4A 1NLYA 1N5IA 2ZI3A 4DLSA 1RC8A 2F9MA 5KNBA 3OHMA 2O8DA 2FV8A 1NVUQ 4IOMA 2XJ4A 1KSGA 4PZYA 3C7KA 4B2PA 2HT1A 2PX0A 3TR5A 3RRNA 4JIMA 2ZTSA 3RS4A 3RS7A 4D0GA 2IS4A 2C9YA 4XTCS 1WB9A 1AA9A 3ASZA 2J0QA 4HUTA 2FN4A 4WXPA 5KNCA 2QL6A 4JS0A 4LHVA 4KYUA 3UXMA 2I4IA 3IILA 4Q1BA 5KSZA 1G19A 1P7CA 2O0JA 3LA6A 3RC8A 4DSOA 1ZMXA 1ETUA 2ZAMA 2BBWA 5FOWA 4CEJA 4PZZA 5DO9A 4Q1FA 4TTRA 4MYTA 4JMPA 2GAOA 5DN6D 1TQ2A 2WWXA 4IDQA 4FW9A 1S3SA 2ZRMA 1JR3A 1OKKD 2BBSA 1G6OA 2H8KA 3P1JA 4ZI3A 2F1HA 1CRQA 2CMKA 4PC7A 3WYFA 2FSIA 4QJ3A 2ZJAA 3IIMA 2ZE6A 4DLYA 2JJ1D 4M1YA 2XAUA 1XJQA 1R0XA 2WSSD 4MYCA 2DWQA 2P3SA 1GRRA 3SR0A 1P9NA 4LX0A 4A8JA 3AKYA 3V00A 4CEHA 4ZCMA 2XOKD 4D4LA 2MSDB 1CR0A 1D9XA 1R6BX 2FPMA 4D80A 4U7DA 2ZR0A 3TLXA 2PEZA 4PXAA 4QBGB 2B7BA 1XU4A 4JJKA 4DB2A 2J9RA 3W3AA 2WPDA 3UMRA 1K8RA 1KO4A 5EP4A 5A5GA 2J0VA 1G3UA 3AQ4A 4JT2A 1OXXK 1PJRA 4PZLA 1XDBA 3TK1A 2JLYA 4RFSA 3EZ7A 3CNLA 4RCZA 3DM5A 1NSTA 2DFTA 3LH5A 4ZKDA 4OI4A 4XIGS 4LJ8A 1SKYE 1IXRC 5CDFE 4LHZA 4B3FX 4G5QA 1NVVR 4GZLA 1LTQA 4GBMA 5EE1A 3VKGA 1QHHB 3BAFA 4Q4LA 5GJBA 3NDPA 2GCNA 1Q22A 4HZIA 3H84A 4BFUA 4MITA 3W8RA 3X1WA 1DPFA 4NCNA 4LBWA 4TMZA 1EESA 1FTSA 1MABB 2ZS8A 1XEWX 2QA5A 1OXSC 1G6HA 4LGMA 3PUWA 4A82A 4BZQA 2O8FA 3AVTA 4PFSA 3K0CC 1Q57A 3VX4A 1G291 2HJGA 3ZIAA 2F1IA 1KAOA 3HWSA 3NEYA 3SU8A 2BEKA 2YVUA 3FKSA 1WA5A 2WAXA 2QU8A 1XX6A 2ZSAA 4E22A 1ZIPA 2CCJA 3RRMA 1NBME 2MSEB 4M0LA 1TAGA 2FEMA 4IVRA 3TQFA 1R5OA 4ASUD 1GILA 3VAAA 4C2TA 2WWYA 4BGDA 4LJ4A 1G3IA 1Z0AA 1TF5A 4GP7A 1ZP6A 4GOXA 5CJ2A 1KDPA 2F3RA 3DM9B 3PG5A 1LVGA 1U98A 4POAA 3F3YA 3A4MA 3DEFA 1R8SA 3GJ3A 1Z63A 4GL2A 4E5UA 1NP6A 1E1RD 2VO1A 1L4YA 4O0MA 3MCAA 4QJ5A 1TUIA 4HB3A 3SQXA 1CR1A 2ZITA 4NH0A 3G0HA 1EFRD 2G6BA 3M4YA 4Q4JB 1ZM7A 2X1VA 3KKNA 4IXMA 1QHNA 1TNDA 4XTRA 3FFBA 2IYTA 4B75A 1RIFA 1YZQA 4G5GA 4FINA 3ONWA 1GNPA 4O2RA 1GNQA 1ZNXA 4OYHA 1QDEA 5FBWB 3TR0A 5FOTA 2W2XA 1KJZA 3NBYC 2VF7A 4ZDKA 2VF8A 3A37A 3MAAC 2GEUA 1LB1B 1X3SA 2QROA 2ZSEA 3GJ6A 2GVZC 4U00A 2ZXUA 3LBHA 1AS0A 4NL4H 4BEJA 3B85A 4TWZA 4CEIB 4FCTA 3G5UA 3KJHA 2QT1A 3KUCA 4M2LA 3TSWA 1MKYA 5CB6A 4KLZA 5GJCA 3ZJYA 1QZXA 2AD1A 2UZ3A 3CRMA 5LD2C 1IHUA 1RRGA 1CXZA 2IA5A 3U44A 3CWQA 1JEDA 4Q9JA 5AJZA 3FDIA 4II7A 2PCLA 5EJEA 4MRVA 2REBA 2QMEA 2D2EA 4HDCA 3WYAA 3D31A 4V0NA 1OXVA 4Q48A 2IX3A 2ONKA 5FL3A 4IKEA 4LJ9A 5HTKA 1YRBA 1N0VC 1P9RA 1ZD9A 1AKEA 3B5JA 2CHVA 1Z6GA 3OF5A 1COWA 1ZW6A 2LWIA 2CE7A 2WMNB 2FZLA 3SN6A 1GL9B 2RGBA 4NPHA 3D6TB 3AVUA 3K9NA 2YWFA 1G8YA 2GK7A 3QUSA 2DFLA 2FFAA 1T6NA 1VYUA 2C9OA 3KUDA 1ZNWA 3LBIA 2E9SA 5P21A 2VH5R 4Q01A 3I1FA 1J2JA 2OFXA 3JVVA 1XPRA 2BKEA 2IYQA 1BH2A 3QXSA 4B3DA 4EQ6A 1FX0B 2P0EA 3IIKA 3ZQJA 3E70C 3FHTA 2QAGB 4DIDA 3EASA 1QHSA 1EK0A 2XZPA 4C0BA 2FNAA 1NBMD 5JRJA 4Q4AB 1KKLA 4OL0A 1KI2A 1E3MA 2CNWA 1P62B 1JI0A 3BORA 3CNNA 3THWB 4S2EA 3V4FA 3ADKA 1E0KA 2Z0MA 5JI3E 2ZI7A 1VG8A 2GJKA 1U8ZA 2JIZA 2R62A 3SJZA 5K8IA 3UMFA 2Z43A 2EFEB 4YMTA 2EFDB 3M1IA 3VU9A 3WBJA 3K0FB 1P2SA 3ZZUA 2FFQA 1QVAA 3KKQA 2IC5A 2CEAA 1E2IA 1S4QA 3BOSA 2QNRA 4BZPA 5EP2A 3OZXA 3OIVA 3K0FA 1Q21A 2ZS9A 1KK3A 1R0YA 1T8UA 2A7QA 3AEZA 3OIUA 1NKSA 3TW4A 1D5CA 1MR3F 3EA0A 2J87A 1GTVA 1HQCA 4Q1AA 1RZ3A 4PX9A 2WJIA 3EW9A 1NRJB 1J70A 2KWIA 3QXCA 5GVRA 3U3MA 2H7VA 1U0LA 2ODWA 3E1SA 5L8VA 2PLFA 3GFOA 1BMFD 1GKUB 5CLQA 4CW7A 2H17A 3VNVA 1RJ9A 4DLXA 5IRCD 1WRBA 4KODA 4HAVA 4WOPA 2OO7A 2HT6A 4RD0A 2B21A 2CL0X 4QGAA 3PCRB 4XVRA 4DEYA 3L2OB 5BXQC 2G0NA 2ZUCA 3WYGA 5DHAA 3QKUA 3B1WA 3QXXA 5J4HA 1CBUA 1E2NA 2ZRCA 2C03A 3A58B 1FFHA 3KZ1E 2CK3A 2Y8EA 1S3GA 1VECA 4B48A 4NYJQ 3QKRA 5LD2B 3CNOA 5FL7D 2QTVB 3NH6A 3A4LA 2GETA 1N6KA 4BLPA 5CITA 4BFVA 1CJTC 1SVOA 4B73A 1KNXA 1YZNA 2J41A 1E96A 2ZRLA 3CB4A 1JXMA 1UADA 1XFAA 1ZUIA 1AQYA 3NXSA 3SHFA 4OI2A 2QSZA 2CL7X 4MGKR 1F6BA 5ANRB 4PC6A 1T3HA 3OAAA 3AVYA 3DDCA 3VHXA 3DO6A 4Q4HB 4FMDF 5AUQA 1XEFA 5FI0B 2P6NA 1O3YA 1IY2A 3ZVLA 1G4UR 4AI6A 3CF6R 2ANBA 2JLRA 1MH1A 3TSZA 5KPDA 4A15A 2QMUA 1P9WA 3HPRA 4TL7A 4C0HA 3SJBA 3OEHA 5K8UA 3F8TA 4AIIA 3FHOA 2VTKA 4ZDWA 1TADA 1TQ6A 4XWAA 1DAFA 1E1RA 4NCJA 3LVRE 2I1VB 1Z28A 3PIRA 1E99A 3ASYA 3MWKA 1XTRA 2ZI9A 3MJHA 4WW0A 3QG5A 2QPAA 4D26A 1DAIA 4AY2A 1E9EA 2EW1A 221PA 1DVRA 4TMWA 4RD4A 5L3QA 2ZE8A 3GJ0A 2GESA 3HR8A 4MQBA 3K70D 3AP3A 1S0UA 4QM6A 1P4SA 2CVFA 1W1WA 4UQOA 2ATVA 4A1FA 4PO8A 3K9HA 2ZE7A 5AR1A 5EUQB 3AP2A 3W6NA 2ZANA 3OE7A 2Z83A 1Z06A 4C7OB 3SI7A 4PC2A 3SYNA 5FPTA 4DLTA 1CU1A 2D2FA 1RYFA 2F7SA 3Q7PA 4JSYA 1EFTA 5D3MB 3RHFA 4ERNA 4Z54A 5KPJA 2GWHA 3TW8B 1S2MA 4QGFA 2W6IA 3D8BA 3KQUA 2OFOA 4ABYA 1XMVA 3QNUA 1A4RA 2OCBA 4P33A 3R9XA 2RB4A 1UEJA 3C5HA 1U0JA 3R8CA 4A6XA 3CW2A 3AVQA 1I4DD 4XWOA 3WRYC 1GRNA 4LYFA 3ICQB 3UWOA 1M7BA 4HB2A 1VG9B 2ZRPA 4TSFD 3SBDA 2VHTA 3O8RA 2EWVA 2WJYA 4ITRC 3T35A 4KITB 2OUKA 3SHWA 4G0NA 1OIWA 1F2UB 4OQXA 4RFSB 2Q3FA 3Q5DA 2TMKA 3BB4A 2H18A 4H1VA 4Q00A 3J81k 4QHTA 1AKYA 2ECKA 1P75A 3KXKA 4K81B 3I5YA 2ORVA 2J5XA 2JDID 2ZI6A 1HQYE 1LS1A 4D6PA 5DNYB 4D81A 2RCNA 4M9SA 4CZ2A 4DVGA 4FN5A 1TEXA 4TQUS 3N5CA 1X1RA 2H16A 3AVOA 3WP1B 4C0AC 2GHIA 5FOSA 4LBVA 1HY3A 4B32A 3B6EA 1G5RA 4FCVA 5HCIA 1ZNYA 2Z5FA 3KX2A 3Q3JB 3OESA 1ZRHA 4CYMA 1W0KD 1EFHA 1FL9A 4FWIB 4FMBB 3W3ZB 4F4JA 1Z0KA 1EWQA 4KLNA 3RS2A 1Z0JA 2VIIA 4L9SA 4HEJA 4PR0A 1PLKA 3LQRA 1COWD 1TUEA 5AUPB 5FPKA 1OJLA 3R9IA 4DXAA 3PEYA 1GRQA 2BBOA 1IJEA 3Q9LA 3HR7A 1KI3A 3L82B 1HE8B 1G16A 4A36A 2NZ8A 2ZIAA 4LWZA 2WPDD 3GPLA 1DEKA 2A5FA 4ILEA 1WQ1R 1AGPA 1E2QA 2OESA 5EQTA 1A1VA 4KFRA 3QEOA 4ZDIA 4PHHA 4F92B 1W0KA 2RKOA 4NE2A 3UATA 3IEVA 2QGZA 3EPKA 4TYNA 2ZRNA 2BMFA 3NH9A 3DPUA 4TYYA 5JJIA 1K6MA 2DR3A 2BM1A 2P2LA 4D4MA 1QF9A 2FSFA 2GRJA 3QKSA 4PHTA 2V7QD 3NG1A 4Q19A 1XTJA 2HLDD 2ORWA 3ICEA 5HKKA 1P72A 2W6JD 3QOFA 4PPGA 4JLNA 2QQEA 1QBKC 3BERA 1Q3HA 1ZU5A 1EWRA 4EPTA 2KJQA 2XZLA 3GLGB 1T8TA 4HB4A 4EPXA 3SE0A 1FP7A 3AVXA 2IL1A 4RJLA 3R7WA 1XRJA 2OEPA 5JEDA 1FZQA 1G3RA 2WMOB 4PC1A 3ZVRA 3GLFE 2WWFA 4R9UC 3QF4A 2VSXA 2WTUA 2BIFA 2CK3D 3KKOA 4M8NE 3G82C 3NHAA 4ASUA 1W36C 3NEJA 3FTQA 1GP2A 2UKDA 4Q7JB 4TMVA 3X1XA 3EA5A 2GZAA 4GDFA 1GM5A 2OXRA 4WZAE 1KGDA 2JEOA 1S1MA 3I8SA 5IK2A 3W8NA 3B1YA 4JVNA 2DB3A 1SXJA 3WHLA 4DRZA 1FP6A 3UK6A 4UNQA 3IUYA 2PBRA 4DDWA 1N6LA 3VNUA 1XPOA 2JCSA 3CKLA 3KB2A 1T5LA 3HU1A 5BYKA 4RKFA 1Z08A 4H9GA 3AVWA 1NG1A 3BFKA 2DFKB 1PLLA 4L4UA 2A30A 2WOOA 1SHZA 4JT4A 5KSPA 2HXYA 4A2WA 3I5XA 5IK2D 2EVWX 1N2CE 2GA8A 3PR1A 1DBSA 1CF4A 4R7ZA 3K1JA 4B2IA 4LY6A 2D7CA 3MJRA 3RLFA 3K0SA 2W6ID 5TV2A 1UEIA 4B2LA 1VHLA 4US0R 3BFXA 2EQBA 5FPYA 3AB3A 621PA 1YZKA 2CJWB 4BLTA 3EZ2A 4G5OA 4GT1A 2ASEA 2ZYTX 3ETLA 2QEQA 2QTHA 2V9PA 3H0KA 1SULA 4LC0A 1RFLA 5FBLB 2NOAA 4FWTA 1G7SA 1UBFA 2O8BA 5DISB 1K5GA 3HP1A 5TVKA 1E79A 1ODFA 4I81A 3RANA 2VP6A 4HAUA 3UPUA 3SFZA 3K70C 4NMMA 4UXJA 1MO3A 2ATXA 3A36A 4RSGA 2ORIA 2KBEA 5C18A 4DC9A 2EFGA 3WMEA 3ADDA 4ZO4A 1NIPA 3ZS8A 3A6PC 2IXGA 3TRFA 5KNDA 4L16A 1VIYA 4CRWB 1EFUA 3M0EA 2QI9C 3GLFA 2XGJA 1KO1A 3NDBB 4V0MA 4QC2A 3REGA 4OBEA 4EPVA 4OK6A 1Y63A 2WVJA 4IRUB 3UANA 2GXAA 1YZTA 4A8JB 1E2LA 2FSGA 3GLIB 2XTZA 2RGNA 1EX7A 3BIFA 3EWAA 1NY6A 3U6BA 3ZD7A 2FFHA 1KI4A 1N6PA 1M6NA 2GTPA 4PO1A 4PQYA 3TUJC 3DVLA 3NIBA 3DZ8A 5DH9A 4YMUA 3GLGE 3CF2A 4S35A 2ZYVX 3QPVA 3T1TA 5H68A 1S9DA 2GEVA 1P5ZB 2R6AA 1IXZA 1KO8A 1YR6A 2XOKA 4C0QC 3KXLA 3BH0A 5DE3A 1E4YA 5F2EA 2DCUA 3DMDA 4GNKA 4XD7D 2D7DA 1LNZA 3SYKA 1Q1BA 4ARZA 1KSFX 1ZCBA 5JLJA 2ZU0C 4M9XA 1WDTA 3RS0A 4K46A 3ZZTA 1OB2A 2CJWA 4JBWA 4QBIA 3BB1A 3ND9A 4QL3A 1XEXA 3S1AB 3B8HA 1P3JA 3TH5A 2Z6VA 4BECA 1VTKA 2YHSA 3OEED 1ZBDA 2VPPA 4HSEA 4NU0A 2QENA 3UG6A 4DT1B 2QBYB 2ZUDA 4JLJA 3EIEA 4KVGA 4RFVA 2NTYC 4NYMQ 3DL0A 1X8JA 3LLMA 1H8HD 1G7RA 4WIAA 2VHQA 3AF3A 3IGFA 3C15C 1BS1A 1FUUA 4P4UA 4HUQA 1VHTA 1OFTA 2ZE5A 3A1VA 1DS6A 4C2UA 1HURA 4JLKA 4EFMA 3L43A 2CLCX 4MKGA 3U3KA 4MRNA 3CONA 5EP3A 4LZZA 1QVRA 1U0HC 2GJAA 3AH8A 2R44A 2CBZA 3W34A 3VHLB 3VR3A 3QKSB 5CIWA 4N3NA 5JS7A 2WSMA 3GJ7A 4D2IA 2EU8A 1Q20A 1HH4A 1GL7A 4Q9KA 5SZJA 2GF9A 3FWYA 5AJXA 4N1AA 1JAIA 1US8B 3T1QA 2GK6A 2JLUA 2NO0A 1FMJA 3Q85A 5G3YA 4KBFA 3SNHA 2GXQA 2IYXA 1TF2A 2OV2A 3N2IA 4D25A 1XD2A 4DWJA 2JJ8A 3HDTA 2P6RA 3MFYA 1IJFA 2VHCA 4NKRA 1F48A 2J1LA 4R98A 2GJ8A 4OHYA 1VCIA 4IFEA 1KIMA 2PLRA 2IF0A 2NO1A 1XCMA 4BASA 2J0UA 4JJZA 4JLMA 2OT3B 1RYHA 1SZPA 3CX6A 3MRSA 4ACAA 4OQMA 4DCVA 1PUJA 2GNOA 1LS6A 3IQXA 4DUGA 3ECCA 5EUMA 2JGNA 3B7GA 1XJCA 4Q03A 5SZKB 4PC3A 4Q1CA 2OCAA 1XZPA 4HAZA 3OE7D 5CYPA 3GLIE 4MRRA 5KTYA 4AK9A 3QBTA 421PA 1D2EA 1YZUA 3QY0A 4QBFA 2ZVPX 4NZYA 3LX8A 1PV4A 2IYVA 1KNQA 4U5XA 3EXAA 5DGXA 3BB3A 1C1YA 4URWR 1HTWA 5JRZA 1JR3E 5EXPA 2QUZA 4P4SB 4UJ3A 1UBEA 3AVPA 4QHYA 5FOXA 1IN8A 1KDTA 5DN6A 1DAMA 1OH5A 4Q9IA 2OCPA 5TB5A 4AWXA 2IEYA 2IYWA 1ZCAA 2FPLA 1DELA 1V5WA 4H1UA 1T3LA 2D06A 4BFYA 2AFHE 5JCZA 4LBYA 5E7MA 5JWRA 2OZEA 4KCGA 2C99A 4IDHA 1KY3A 4DEXA 1IAQA 2WSSA 2G88A 3BK7A 3TSOA 2R6GA 2GF0A 1BOFA 1J8YF 3DKVA 3LNCA 5L3VA 4KI0A 2ZPTX 2PEYA 3IO5A 4TL6A 1LY1A 4BFTA 3KFXA 4I1OA 5C46F 4Y0VA 4JL6A 1GITA 4QBHA 1K5DA 1XD9A 3K0AA 1XTQA 4CF7A 2BV3A 1UDWA 2WOJA 3NC1C 3OFND 4Z1MD 2FFBA 4OI0A 4L15A 1BYIA 2QP3A 1OV4A 1U90A 3M6AA 2P5SA 1OKKA 4JVMA 2L0XA 1E9DA 4BPBA 2BMJA 1E2FA 5CK4A 1F5NA 1KDRA 3KQNA 5EE5B 3PUXA 2QBYA 1SQ5A 2CL6X 4LV6A 1KOFA 3DOEA 1AZTA 1MO6A 4PQFA 3AV0B 3F5FA 3TVDA 3R8FA 3VR6A 1KJYA 2IWRA 4YONB 4B74A 2WZQA 1GOTA 6Q21A 4DSUA 4V0LA 1W7AA 3I61A 2G0TA 1AGRA 1IN7A 1BYUA 5AK0A 1DOAA 2A78A 5AJWA 5L3SA 3SFVA 5EE0A 2O8CA 1SVIA 2V1UA 2NPFA 4YC7A 4HAXA 2IYSA 2Q6TA 3EAQA 4EIWA 1QHXA 3CRW1 1X8LA 4TLCA 3LW8A 2QP4A 3D7MA 3SZRA 3BC1A 2IF2A 1TMKA 1NLZA 2ZEJA 5F9HA 1W4RA 2ZRHA 4DLVA 1Z0IA 2WV9A 4G5RA 2R6CA 2CNWD 5FBVB 4EDHA 1IOZA 3VR5A 1W47A 2A2ZA 2FGJA 3GD7A 5FUYA 2AXNA 2VP4A 1CKEA 2VLIA 2VRWA 4PSAA 1BMFA 3U44B 4N0DA 4RZ2A 1HE1C 3CR8A 1GIAA 1EX6A 2BHRA 1GNRA 1KHTA 2X8AA 3W5IA 1QHIA 3LRPA 4LPSA 4TN1A 1Z5ZA 2CLSA 4PAOA 1X86B 3QBVA 4AKEA 3THYA 1VKJA 1RRFA 2OAP1 1ANKA 5F9FA 4RCYA 2VQSA 3LXRA 3A4NA 1CP2A 1JBKA 2D4HA 2QSYA 4Q7KA 3RNLA 4Q02A 1KO5A 2GCOA 4TZ0A 2FF7A 4JLBA 1A2BA 4PTLA 4BFXA 2QQ0A 3LV8A 3RRYA 1T3SA 3EZFA 4MRPA 2IS1A 1SXJD 1OSNA 1ZD8A 2OLJA 2ZRFA 4PHFA 1WE2A 1W0JD 2ZJ8A 3BH7A 4A2QA 2JJ2A 3H1TA 2SHKA 4F4CA 3HYRA 1F60A 3OIWA 4LSGA 2QP9X 2ZQ5A 2AKAB 3GMTA 1UJ2A 4M1KA 4X8OA 5TY0A 4LHYA 1OF1A 2ZJOA 4HDOB 4TTPA 1AJEA 1JAHA 1TQ4A 1R5BA 2MMCA 3S1AA 4BLRA 2YWGA 1DTSA 1VYVA 4F38A 1PVOA 4GI7A 3QG1A 1SVKA 5FPSA 2GEDA 1QHHA 1I4LD 2J0UB 4A0HA 1JNYA 2N1BA 2XSZA 3A8TA 4UKDA 5JWHA 1W0JA 3KJIA 1DE0A 1L7VC 2FZ4A 1TF7A 2W6JA 2XEXA 4I99A 3B13B 1RE0A 4DCSA 3R20A 3THXB 1JPNA 4HLCA 1A7JA 2GXUA 4BRWA 3X1DA 2QY9A 1FTNA 3T34A 4ZCLA 1IY1A 1KMHA 3CM0A 2I3BA 3NVAA 3LD9A 3B82A 1CR2A 3SEAA 1LF5A 2PZFA 3GEIA 4G1UC 3PUZA 5H8WA 3QIAA 5DYGA 2A9KA 2ZS7A 3FGNA 4NYIQ 4O25A 1LF0A 1Z0FA 4TTQA 1ZINA 4YDSA 3TE6A 4URVR 2O0KA 2GKSA 2AR7A 4Q9HA 2XSZD 1SKQA 1T9HA 1Z6YA 4HZUA 3I72A 3K8YA 4FMDB 1II9A 1A5TA 3WRXC 4MDFA 1OT3A 4ZCIA 2CE2X 1ZUHA 4US1R 1DG1G 4BFSA 1MRNA 3WHKA 3AVVA 3RWOA 1YHNA 2PJZA 5LPNA 5FR2A 1JJ7A 2QT0A 2FGKA 1E98A 2XTMA 5GJWC 3BBPA 4KFTA 1XBTA 4URXR 1Z83A 2QAJA 2J7KA 4C0LA 2BC9A 1KMQA 3SS8A 2A5DA 4O3MA 3K53A 1TX4B 1F3OA 1KI9A 1N0UA 5KUTA 3U6KA 1OYYA 1XTIA 1YZGA 4CEJB 1D6JA 5JBQA 5KU1A 3B1VA 1G64A 1N5KA 1CTQA 1Z22A 5J40A 4ZKEA 1E0SA 2FDCA 5LB4A 3RS3A 1NNEA 1XZQA 1D8TA 1G5TA 1G20E 2Z4RA 3FFAA 4TL9A 5GVSA 1E1QA 2C5LA 4NCIA 4URYR 2WHXA 1NKTA 2ANCA 4Y0AA 4R71A 2IHBA 3THWA 1XEXB 2GDJA 3TMKA 1OIVA 4TLEA 2RH5A 1HUQA 4DIEA 3BGWA 3GJ8A 1KTVA 5J4LA 2GXSA 4MGYR 4P31A 2HUPA 4IDNA 1R2QA 4GFDA 3B9PA 2XTNA 2JDIA 4C4PA 1XF9A 3K0CA 1F2TB 2CHGA 1GAJA 1XXHB 2D74A 3IKJA 3B9QA 1JALA 5DHFA 3ZH9B 4UXHA 1Z29A 2WWIA 5B58C 1TEVA 1CJUC 3BD9A 1VYTA 2RGDA 1V43A 1PLJA 1O87A 1LFDB 2GCPA 2BVNA 2AXPA 2YINC 5C4MA 5D3QA 3C14C 2JAQA 1TU3A 4KVAA 3TQCA 4RZUA 1P73A 2OE2A 2P65A 5SZIA 4BLQA 1G8HA 4EPWA 5EXTA 1JB1A 5LB2A 1W44A 3LW7A 5AWFC 1H8HA 3VFDA 4D4JA 1NMZA 2XB2A 2BMEA 2VSFA 3X1YA 1DAEA 2V4ZA 4I1VA 1KZGB 3Q5EA 1G5PA 5HZKA 4B71A 5FBRB 4HLDA 4IEIA 5DYIA 4L8GA 2A3RA 5AJVB 4DT1A 2HJVA 4LJ6A 3AF0A 4LV5B 3KQLA 4JKIA 5BN3A 3EC2A 2C95A 3RSOA 1L4UA 4US2R 3SDZA 4GP6A 3ND8A 1CJVC 1OHHA 1G8FA 3U2QA 3B2EA 4Q7LA 3WXMA 2QAGA 2BDTA 4XWKA 3OEEA 1E2GA 1JJVA 2HEIA 5E3HA 1ZVQA 3TUZC 1X1SA 1NMYA 1R4AA 1RW4A 2QORA 1EXMA 3THYB 4QHSA 4IDPA 2VYFA 5HE8A 2JLZA 5FPHA 2WJGA 2FOLA 4HDQB 2FH5B 4XD7A 2F9LA 3EIQA 4J0QA 3FMPB 1YU9A 4A0GA 3FYHA 3PUYA 4IXNA 2D3WA 4FIDA 2PJRA 1AS2A 2IUSA 3EWSA 1OLOA 2AKYA 4YQFA 2VL7A 3LO5A 3KXIA 2A5GA 2GJ9A 2GZHA 4DSTA 1F2UA 1OYWA 3VR1A 2QE7A 2R2AA 1GL6A 4M1WA 1FX0A 2RGGA 1H8EA 1Z2CA 2IYYA 3QEJA 5IDVA 1FW6A 3N70A 1G8GA 2YNMA 3MGCA 4OJQA 3C5CA 1PUIA 2HYDA 1Z2AA 3MG9A 2V6IA 3C16C 3QENA 3WP0A 3IBYA 3GLHE 2ZYUX 5BWMA 4NYIR 3QI2A 2AFIE 2PL3A 4DLWA 3AUXA 3VR2A 1F2TA 2H92A 5TARA 3BWDD 4M1MA 4W9MC 2ZJZA 2OILA 4HAWA 5CLLA 1W2GA 4TLBA 2YOGA 1WMSA 2RHDA 4CEIA 2NO9A 5JSZA 3PEVA 3U3RA 3AGQA 2DFNA 2FWRA 4P4TA 4AG5A 3CO5A 3QF7A 1HYQA 4YMWA 1NL3A 1G7TA 5E7JA 2YOHA 2IHYA 3LAWA 2ONJA 3EC1A 4KSBA 4FI3C 4PPNA 2ODNA 1U9IC 5HZHA 3IDQA 3KL4A 3TJZA 5FUVA 1P2TA 2GBLA 1Z6AA 2G77B 4CIDA 5JEEA 1W4AA 2N42A 1DAKA 1UKZA 3P27A 1KKMA 4YXWA 1N6HA 3RYTC 4AC9A 4TMKA 3ZD6A 2VBCA 2ZU6A 3NTUA 4QRHA 3CF0A 4B47A 3IHWA 1DAGA 4Z51A 3LY5A 4DDTA 1ZIOA 3E5HA 4C30A 3REFA 2ERXA 4X8LA 3MWJA 4OQLA 4ZPXA 5BW8A 4M9ZA 1P60A 1MRSA 1KAGA 3AKEA 4PAMA 5FTKA 1E94E 3A1WA 5JWOA 1NLFA 5H70A 3FPAA 5J4KA 4QOSA 3U5ZB 1YR7A 2ZVQX 1SVWA 4UNPA 1W36D 1U9IA 4B43A 1TU4A 1XCPA 3FB4A 4GSYA 4LJ7A 3T1VA 3TUIC 4YXWD 3EPJA 1WF3A 1XWIA 2JLXA 2NZJA 4CT4B 1S9HA 2AK2A 1G3QA 1X8KA 1C4OA 1Z3IX
chains in the Genus database with same CATH superfamily
2PFSA 5U4XA 3RHTA 4BMPB 4M49A 2CBXA 4QNRA 2QL9A 4NOMA 1EP3B 2RH8A 3N1UA 4ZQCB 1QDUA 4PAGA 1TJ4A 4AJPA 1QAOA 3SJAA 1DAOA 2ZJ0A 3ADBA 3HL4A 4BV8A 3PLAE 2OA0A 3EE6A 1FP4A 2IWHA 5BWOA 2JAXA 3O1LA 5DNVA 4F4HA 4BAGA 3KKMA 2BJWA 1E1KA 3GZ4A 1TAUA 1JQKA 3IX7A 3LQFA 2RK6A 4KUGA 1W8IA 1MLDA 1JG3A 4RS3A 4BE9A 1P2GA 1JTEA 1CY4A 1GFIA 2ZI5A 2EP7A 3WIOA 3RYIB 2I3AA 3BMCB 3U62A 1CUUA 3AF2A 2X5JO 1QRRA 3CPJB 3D1LA 3ZV7A 4R5MA 3VR6D 1NG9A 2BP7A 3IAXA 3MHTA 4F2HA 3KC2A 4ZTBA 5LU9A 5G0VA 1FE8A 2TSYB 3K09A 4KKVA 5IEJA 3QU7A 5AH0A 2F55A 3R9KA 4BGIA 2W83A 2CMDA 3PFBA 1SVSA 1Y48E 1E5VA 1OGYA 2VDWB 4Q1DA 1D6NA 1MABA 2F3TA 3ORYA 4XLZA 4IFIA 1SHUX 4OQYA 4WOBA 4ZXPA 3JTMA 4B84A 5EMKA 2EQAA 4DDUA 1J7KA 1W49A 3LY9A 3ZCTA 2QLMA 2Y71A 3DKKA 2RMKA 3IQWA 4H4CA 5B64A 2RJOA 5CA1B 5DIFA 1OBHA 5GV8A 2R6FA 4N0PA 4IDFA 1WQ3A 5E3JA 4I1RA 1ELOA 5BNTA 4IHJF 3IP1A 3DT8A 2FZVA 3EIWA 3CRRA 3FYUB 3UPTA 2PLNA 1UBGA 1U7UA 1JQ3A 3I9LA 3KSUA 2YUIA 2FLVA 3R24A 1SB9A 3B51X 4LE0A 2X1HA 3I1JA 4PZDA 3HLKA 2A59A 2EL7A 1SXIA 2PNJA 2J9FA 3DDNA 2AD5A 1O6FA 3GUHA 1BG6A 5EUCA 1ATZA 3QYFA 3TWOA 1U4OA 1XK6A 2BM9A 5LM3A 5TMPA 4YUZA 4P3NA 2ZYWX 3NAQA 4WGGA 4D57A 3FSRA 2AOXA 1Z8FA 1MENA 2RHJA 1CIPA 3CVYA 4GQAA 5K01A 3QHQA 2R1TB 5KYUB 1E2KA 4F60A 2XQVA 4LF8B 4QT4A 3D9QX 1KETA 3I9KA 2RGRA 4HGNA 1VL6A 5F12A 3W6PA 4BXOB 2BBTA 3D6AA 5DK6A 1D1PA 1ZUNB 1HGXA 2CF5A 4Y2RA 4W1SA 1OE0A 1XDWA 2FDXA 2QAGC 3ORRA 4UM9B 3E4CA 3Q41A 3O3OB 3ZE0B 5K0EA 2DWOA 3JZDA 1B23P 4OP2A 4M37A 4MV5A 1IAVA 2XXAB 3Q8KA 1MFZA 4UPVA 1FVXA 5ALRA 4NG4A 4IRMA 3F8WA 4IOLA 3OJEA 4OL9A 2W42A 3MINB 3SS7X 3HCRA 1NOJA 2QRLA 2VR1A 3WGJA 3H9GA 4F93B 3RKSA 3I09A 1U81A 4J0KA 4DRXA 3M5CA 1E62A 3N2NA 2A1UB 4R2HA 3UENA 4JJAA 1M74A 1ZEMA 2DLNA 4YALA 4C7XA 1QR2A 1I2BA 1OPXA 2QXTA 2VTEA 3RD5A 2R84A 1JQJC 4DG8A 5BWBA 4OVKA 3P4UA 1EE2A 2I80A 3BXFA 1KK0A 3HB9A 3JVDA 1ZJ6A 4JEMA 4MHSA 4UUAA 1XP5A 1UUFA 3CSDA 2FCRA 1NJ1A 1Q7GA 2XMRA 4NTZA 4XDGA 4D8VA 5I7EA 5I8PA 5GZ6A 2Q6OA 1M1NA 3NTQA 4YRZA 1Z0DA 5CDUA 3OZSA 1B8NA 1I9GA 1D2NA 1IEQA 2VBGA 3MFQA 2F1KA 4MR7A 4Y6PA 2BGKA 5M2QA 2WINI 4AJIA 1WBJB 4KX3A 3SSOA 3EGDA 1H65A 3IJEB 3GA0A 3OZTA 3W5JA 4WD3A 3KALA 1CK4A 1FNBA 2EP8A 5I5EA 4QQFA 3VI4B 1HPLA 1X19A 1WNTA 1VSUA 5DHTA 2XKJE 3C4JA 3U31A 4CM4B 5A62A 3VO8A 1ZAKA 2K6GA 3CEAA 1OFIA 1G4HA 5FI1B 5JDCA 1J49A 5KWEA 2JA1A 2R1VA 4LN1A 5AVTA 3JY6A 3QBDA 4B35A 5AVJA 3EZXA 1SGWA 4Z4GA 4MVWA 1KDOA 1E3QA 1L8AA 2QVLA 2AEMA 3B3AA 3IL2A 1DFGA 3EJWA 5LZ7A 2NSDA 2I76A 1NM5A 2REOA 3V42A 5CAEB 1T0JB 3JZMA 4DMGA 5BQPA 1SY7A 1QE5A 3BYZA 3H6GA 3IHTA 4BTEA 1QGAA 3KQMA 3OM1A 1XD2B 3FMOB 4J07A 4OQZA 4X6YA 3BT7A 3R9XB 2VP9A 3FNIA 2C9CA 4B33A 4MMYB 5GM1A 2G04A 4WFIA 1FQJA 4KO4S 4RMHA 1UF9A 3GCGA 3OUTA 2PX4A 1DMRA 3JWEA 1U6IA 1LBSA 3FRJA 3ORSA 2PZGA 3PNLA 1JPJA 4LF7B 2BHLA 1IHYA 4HOYA 3GV0A 3A1FA 4MQUA 4BQPA 5B3AA 3KQHA 4CUJA 1HQKA 2Q5JA 3AV3A 5KYKA 3O93A 4CN8A 1FNSA 2WT9A 1TL7C 2HNAA 2CDNA 5K0LA 5MF6A 4XGQA 1N25A 2DBZA 3G5MA 4LZPA 1NVGA 3U4IA 1YFJA 4F9GA 1WDMA 3T9AA 5EXXA 2POQX 4KXNA 2XZDA 1J20A 1BXRA 1IIBA 4TVOA 1RRPA 5EUBA 2I03A 2YX1A 3T9DA 3ZVMA 1DDGA 2BFWA 3OPMA 2OQVA 4B09A 1L2TA 1FDWA 1SIUA 1JU3A 3JATB 2MWMA 2PSEA 2I33A 2X3FA 3GLTA 3B2QA 4HPWA 3P8ZA 3X2EA 4AO6A 1DIOB 4RKEA 4EL0A 3OFSA 2L17A 3LL4A 3FPFA 3P32A 5L3RA 3O8DA 3L8GA 5CBPA 3H83A 4JVOA 2FLKA 2D5IA 1TYDE 2H3HA 3T5GA 2VAVA 3CJQA 3T7KA 4ZGBA 1Q12A 1A5BB 2J59A 5KYTA 4CTKA 3I4LA 1WXWA 1TPZA 1JG4A 2G67A 2YQ4A 3L0SA 1WCXA 1DJQA 3OCVA 4KXFB 4YK7A 2OQRA 4GX2A 2Z6QA 4MW7A 2V5AA 5AK3A 1N5LA 4A73A 3EDQA 4E14A 5FLKA 3HYNA 2FUG1 5AYVA 2OWEA 2GVNA 3LIIA 3FOZA 4WFJA 1E0JA 2FRXA 3GWGA 3IT3A 1AG9A 1P0MA 1EMDA 2C58A 3JWIA 2B2XA 4QFCA 3NBFA 3L7NA 1UK8A 4MH0R 1GKIA 3QPWA 4HNAA 1XDGA 4GMXA 1J2RA 5HFJA 2XNHA 1DHTA 4FR2A 1C7QA 1JQBA 2L2QA 3BGIA 3GARA 3P5BA 4TXHA 2XZOA 1IOVA 2HA0A 5FTJA 3G23A 5IBQA 1I33A 5IHXA 4F9TA 2BZGA 1I2DA 2GN4A 4JYMA 1EINA 1QYXA 3HCDA 5EKSA 2UYYA 1R7RA 2R85A 2CFOA 3AEKB 5E9AA 5IG2A 4IQFA 5JAHA 3BRQA 1MOPA 3BX1A 3D8NA 3EEBA 1B6TA 3N2EA 4IIUA 4D44A 1X0XA 2I66A 2KLBA 3UWDA 3WQSB 1CS0B 3F1KA 5C53B 1EFVA 1I9CA 1ZWKA 3KQSA 3T9CA 5FFMA 4IOKA 1NRWA 1ZW1A 4HVAA 5B1IA 1SZDA 4FLFA 5ENZA 2GZSA 4TQ9A 1NKVA 2YN4A 1YBFA 4HRAA 4QOJA 3WNCA 1UM9A 4TMXA 1CY0A 1ZN7A 2Q21A 2ZT7A 4IDBA 4IVPA 3K4QA 3EAGA 4MOWA 2IK8A 1M34E 4UEJA 3PXGA 3S0JA 3WOVA 1NTOA 1TW2A 3G1UA 2C61A 3RSSA 2VJNA 3OH8A 3QEMB 4EO4A 3P0IA 1YVEI 3RODA 2RARA 1UAAA 1N78A 3MELA 3UMCA 4TL8A 4P3OA 1LK7A 2F3PA 1J2EA 4GOLD 5AJYA 3BMOA 4ARZB 1PR5A 3L7IA 3BE4A 4OA8A 3IVCA 1EYZA 2HA7A 3G2QA 3EA4A 4PYMA 4CLRA 2YZMA 5CYOA 4YYEA 1U3GA 4EGFA 4KMSA 4MKHA 4ESHA 2R6DA 3H5OA 3BJIC 3BRWD 2XDQB 4ZZ0A 2REQA 4DC1A 2A5LA 3T7SA 4PQRA 1CUFA 4C0WA 2GTHA 4WN9A 4DQKA 5HZMA 2N1MA 4URUR 1MTOA 1GVNB 1U9ZA 5GIPE 5TEVA 2IBMA 1CRZA 2I7DA 4CHTA 3KTAA 1A0OA 1YDFA 4MXDA 2W8ZA 5TGDA 3UMVA 2ZJ5A 5HIMA 5C8YB 4L0MA 2CV0A 1WU7A 2UVDA 4JENA 4W9NC 1T9GS 4JOSA 4C3VA 1TCCA 3H65A 3KJGA 5KOYA 1QGYA 2CZQA 3EARA 4JWKA 3NM4A 4Q3AA 4YFYA 1RXVA 5J47A 3PQ4A 4UNSA 2BKUA 4I50B 3OM9A 3WMXA 1XTSA 2O2DA 3IPYA 4LZWA 4GRAA 4LEIA 4WLOA 1OX4A 2ID7A 3EK2A 2JBHA 1WP9A 4CEHB 1KQNA 2AJTA 1JHZA 4C6HA 1U8AA 5CCDA 2C96A 3PXCX 3TS1A 4E5DA 4ZYLA 3NHPA 2FU5C 1U9JA 5AVZA 4Z7JA 3PXXA 3DW1X 5A4IS 3OFNA 2EP5A 4IZ6A 1SRRA 1QFMA 2ONZA 1OU4A 4Q9DA 1WXDA 2AX4A 2XJ9A 5TJ9A 3OFKA 1OZAA 1U8FO 4LG1A 4EJ0A 5A5DA 1OFHA 5IVIA 1NXQA 2QMOA 1AUVA 3GUVA 5HCNA 4GS5A 4RD2A 4PYOA 3SEAA 1WIWA 4I66A 1EH5A 3W5SA 1V47A 4BTVA 3NOVA 5LP6A 3DE4X 3G49A 4QU8A 2Z8YA 3H9CA 4PXYA 1AUQA 5CMLA 2BFPA 4EP1A 4IICA 3WBKA 3EX7C 2O1XA 4DLPA 2O2HA 2W9XA 1PZNA 4JY7A 2B7LA 3QXHA 4ARCA 1JLHA 3T9FA 1FDVA 3O8NA 3HRIA 5JS2A 4L8VA 4DLZA 4F6LA 3ZPXA 2PMWB 5CVTA 4OHOA 1G21E 1Y9ZA 4KXLA 4OQDA 1MO5A 1Q11A 1NQ5A 2V8OA 4REQA 1RLIA 4M22A 4OGWA 5DT9A 4V0ME 4BS9A 1HDCA 5IAAA 4B3GA 1O95D 3QI7A 4K8OA 3NJRA 3AU9A 1ADBA 2IHVA 2Q62A 3MGAA 2IPLA 5CA0A 1JG2A 1M0TA 3U7FB 2HJWA 4X6LA 2W6PA 5J23A 1TO6A 5KSOA 3ET4A 1SB8A 4NFLA 3T95A 1TJ5A 2H1LA 2PLAA 3DMFA 5K09A 1Y6ZA 1DX4A 1QO0D 1NZJA 1T3TA 1GQQA 2ZJ2A 3OCCA 4L76A 4NZNA 3M9XA 4RUKA 4CV0A 2ZROA 5A4DA 2XYRA 5EMHA 3A1UA 4H6PA 2ARKA 2I1LA 3WL8A 4E03A 2HV8A 1W85B 2PWBA 2Y2VA 1JZQA 1RI2A 4HFNA 2BEJA 1CJCA 1PJQA 1SOWA 5JZ9A 2EC5A 3WC4A 2W0SA 4LA4A 4Q7QA 2MT9A 1T9CA 4I0WB 3R9WA 4KUHA 2HA3A 3UQYS 3ZOZA 4ZGGA 1JEEA 4HYYA 1WSWA 1IY0A 3EGEA 3CINA 4ENUA 3RYFA 5ALMA 1HYBA 1HLFA 1GWNA 1OASA 4DB4A 3G8CA 4I4TB 2VNHA 4LFAB 3TPCA 3LPLA 2P4EA 3IQGX 4PYRA 4RPIA 3CMCO 3RCBA 1BZYA 4LE1A 1ZN8A 1N4AA 3LT2A 1JXOA 4TT3A 2YRFA 1ZZGA 3GGSA 1LV7A 1V6CA 4FVTA 3E03A 2Q6VA 2BR4A 4KQGA 5IAOA 1LGYA 4R1TA 5TRTA 1ISMA 2VNAA 3L7KA 4OFWA 4RM3A 4W7HA 6YASA 1US8A 1BE0A 2C3YA 4EYGA 4FZ3A 2VQDA 4CPDA 3PQCA 4AKIA 1KRXA 3ED1A 1QHGA 4J3FA 1UFOA 3CA8A 3I62A 1SKYB 1Q1EA 4OKSA 2QG9A 4WKBA 1OXKB 2TMGA 2C54A 3OZWA 2P78A 2D4AA 3ABIA 4J75A 1W5FA 3VPHA 3OCUA 3FXAA 2VTDA 3OZGA 1YSCA 2G09A 3U9SA 1DUVG 3CUYA 1UC5B 3WNDA 3J80A 1ZICA 4DSAA 2V65A 1XK7A 1P61B 3MILA 4O4JF 5IABA 4DA4A 1T8WA 2WD7A 3GU3A 4JT9A 4FTWA 3UIEA 1S5PA 5FQNA 5SY4A 4J9UE 2JLQA 1AB5A 1QIMA 1VB3A 1R0WA 1TZKA 2O48X 1RZVA 3K9GA 4KAFA 4LNUA 4V0KA 5D5HA 1UPBA 3QZUA 3VDQA 1JAZA 3UMJA 2FQ1A 2C2MA 1JA0A 4Z0HO 1KBQA 3UMGA 2AXEA 3L1KA 5EKTA 1HTBA 1YB5A 2V1XA 4G5YA 4TLAA 1RMYA 4XXHA 2ZSKA 4MULA 3ETNA 2H7XA 4MR9A 3HKDA 3O26A 3WFIA 4BEBA 2GYVA 2GVDC 3EVZA 4JLDA 4N9WA 3CUVA 1N2SA 2QIPA 4ACBA 5KNBH 4QFMA 3RADC 3O9MA 1ODKA 3NDJA 1JYSA 4RCVA 3P0JA 3V4RA 2PMFA 4FE7A 2B7CA 5C9ZA 2BE9A 2O3UA 2QJWA 2QPLA 3E9YA 4C21A 1RDFA 3FH0A 3MJ4A 3L79A 2ZVDA 4BNYA 3FVVA 2FMXA 2ZBPA 2EBUA 4NFYA 5DBFA 2NP6A 4RMIA 4ZZ2A 3G85A 2VRCD 1UBOS 1TM2A 2XMPA 4TRMA 5EXEA 3HU2A 5CJJA 2QE6A 3WY9A 4BCCA 3HE3A 4J3NA 4U2FA 1DRWA 5KVCA 2H4JA 4M6WB 1PAUA 1YVDA 2ZUTA 1U99A 1FPMA 4MYUA 3R0QA 1Q3TA 2A35A 2FW9A 4BHTA 2W43A 2QYOA 2WBLC 2A9PA 3SGLA 5BN5A 3AG5A 3PNVA 3WB2A 3TEJA 5JH7B 4RLHA 4BZZA 4F3TA 1G18A 2OHOA 2J6IA 2PWAA 1YRYE 2VJLA 3F67A 4HLUA 3UMSA 2JKYA 3U56A 1QRAA 3WNBA 1GTG1 2NX2A 4HMQA 1CT9A 1XWWA 1VCOA 3L1HA 1FJXA 3DTVB 4GMDA 1WSDA 2VRCA 1JSZA 3C98A 4DKXA 2GWRA 1JKIA 2YYSA 4P93A 2AK3A 4UMDA 3X1ZA 2COUA 2B0JA 5D2CA 4YJ3F 2C4WA 3D5TA 3P96A 4NYMR 2LE0A 3NOXA 5FWNA 3NCHA 1VLLA 5GWXA 3TVTA 2ZYRA 3S27A 1GCAA 1RHMA 2DWCA 1L4LA 4WKPA 1SXPA 2ODEA 1KJIA 5CT8A 4YLYA 1CEXA 3OMLA 3UWMA 1W36B 2RG1A 1QS0A 3BMNB 2I3GA 4OHFA 2HIGA 2HSGA 1Q1ZA 4HATA 2YFQA 3I5UA 1AKNA 2QRMA 3TIFA 4EB6B 2ZR7A 1ZO8A 3FUWA 1RYYA 1ZM9A 4CDNA 5HQ3A 2PMDA 4G5SA 4K8RB 1BGVA 3QVUA 4QEKA 1OREA 3I6QA 3SZOA 5KTNA 4M7PA 2BLNA 3RSLA 4FFMA 4NDNE 4G56A 5IJZA 3E2MA 4U02A 4AWAA 1RBMA 3ORHA 1I3MA 1QKKA 3AXSA 4B6OA 3H5RA 5CEFA 4XVQA 2EYQA 4R31A 3DMTA 1WF6A 4LRWA 4Z3DA 2YWBA 4LNAA 2A0WA 4BX2A 1YE8A 2B20A 2YYYA 3C8HA 3HU5A 3L6BA 1KZHA 2C8VA 1BW9A 1C3OB 3HEAA 1T4GA 3GXOA 5HR5A 2O2GA 3NHKA 3PL1A 4HLUC 2H7YA 3DL2A 3GLIA 1CC1S 4MRMB 4QXAA 4RIGA 3HY3A 4AX4A 1V4VA 1WPXA 4HDNB 1L4KA 3HVRA 3HLTA 1NJGA 2FPKA 3C4QA 1AF4A 1QK4A 4EHLA 5JNLA 4LSZA 3TI7A 2YV1A 3SYMA 1YR3A 2F6RA 3HUUA 4NQZA 4E1VA 5LCXA 1IBKB 1EUCA 4TMFA 4XJXA 1SO8A 1Z6XA 3GNQA 3R76A 4ATNA 4YPOA 2QUKA 1T2NA 1MAHA 5KTMA 2IH5A 4X1KA 5ALUA 2CLLB 2HRZA 5T7BA 1PNVA 3BF8A 4YDHB 5EJ6A 1EHIA 3B1FA 1FNNA 1TOAA 13PKA 1EK1A 3D4IA 5JARA 4HQRA 5IBPA 4C6TB 4CCAA 4C14A 4QUHA 3U3XA 1VBFA 3I23A 821PA 1H0KA 2AI2A 1NJFA 1PP4A 1QFZA 2PWPA 3JRNA 5E8JA 4CKCA 1N7GA 2NPIA 2WSBA 4MKFA 3DLBA 1BKDR 2HMYB 4QEZA 1TDJA 1EJBA 2PRSA 4ZALA 3LTNC 1A04A 1CJKC 5LJIA 2VHYA 4OQNA 4G9BA 4PINA 3A6KA 3MS7A 2PMBA 2WZDA 4OMFG 2DUNA 2C77A 3F4KA 2EGUA 3X2SA 3ZHZA 1MEEA 2BUBA 3KZNA 3PJEA 4JAVC 3TINA 3U7IA 4CKBA 3N2KB 3HA7A 4MUEA 3DXZA 3HB1A 2CVHA 3QWAA 2NQ2C 3LC2O 1O9GA 4MPJA 4DJTA 3H9EO 1L8XA 3U80A 4E32A 1V45E 2I7TA 3HU3A 4X45A 6PFKA 4A4DA 4AD8A 4YUVA 4DDKA 1E7RA 3M33A 4WPGA 1XZDA 2IUFA 3PJGA 3W7AA 3KKEA 1UODA 3M3HA 1HORA 2PT7A 2QW8A 1JPVA 1Q1QA 4FBGA 1SBIA 4MUGA 4QJ4A 3ZU4A 4ZXFA 2XXJA 3EPHA 4MP8A 4YWJA 4UHDA 4UVHA 2WJVA 3CPEA 4XOIA 5JC1A 1M5UA 1K9VF 5GADl 5K2OA 3IR6A 5IXSA 3Q9UA 2P2NA 3NTVA 3OP1A 1YI1A 5FFFA 4OV6B 4E88A 1Q19A 2OUIA 1ULUA 1IWOA 4FQ7A 3VMFA 3KOZA 2CLHB 1Q16A 4I4NA 4GF5A 3CX7A 2YIVX 3L0IB 4PBSA 4Q4HA 1X7GA 2AJLI 3HFJA 1JKMA 1G55A 3VU0A 2EFCB 4IR7A 3ISTA 4G2NA 3X43A 1JEQB 4DMCA 3QV2A 1NVDA 1Z07A 2G5TA 3VNQA 1HSZA 2ZJYA 2WF7A 3OC0A 2ZYDA 1QNFA 1Y4DE 1RWPA 1S2DA 1NN3A 3NWJA 2XE8A 4G0PA 4FGKA 4XSHA 4EHIA 2GILA 2QYTA 4LYJA 4TYPA 5F4BA 2PZEA 4C5AA 3HMQA 5ERYA 2Q2OA 3V1YA 3EXHC 2EW2A 3HY6A 4GWKA 5ESDA 4ZJYA 3I73A 4JYZA 3HABA 1J8VA 1LBQA 1UKCA 3A31A 1ZJWA 4EF5A 3DDZX 3Q40A 3PITA 1UCFA 1QIEA 4QYWA 4CQMD 2O4CA 4PO3X 3H17A 5T8KC 3OWOA 3G02A 4JZKA 2Z4SA 4C0JA 5UKDA 3LOPA 4B4OA 2R11A 3F47A 4U9UA 2QTRA 3BRCA 1FRZA 1SHKA 3ER9A 1GSIA 2EHDA 4DY4A 4N41A 4D7AA 4DCOA 3AI7A 2ZIFA 3NQ41 3TKAA 3CLRD 4NNOA 2CJXA 4HH4A 4OQFA 6AT1A 4P0QB 4EUFA 3DONA 3GFGA 2PX8A 5EERA 5EL0A 2GCGA 1G1MA 1YTUA 4CMEC 1H05A 4W8GA 3RYHB 1KMHB 4MKRA 3O1JC 4LTMA 1FBTA 1E1CA 3MT0A 3B9RA 4LQ4A 4F45A 2RI0A 4JLPA 5I01A 4JB8A 2NVWA 4I36A 1V8PA 1QHEA 1QU2A 5L3ZA 1BH6A 3LGXA 3DKIA 4QDZA 3O8CA 3M9WA 3R5JA 3KSMA 1II8A 2W2TA 1QUEA 1R0RE 1GPBA 3K0AB 3AKDA 1G8JA 4IDEA 4RAOA 5LUBA 1DKRA 2B8WA 5C4GB 2FWPA 1NI3A 2B36A 1AN0A 1HZZC 2E3JA 2NO6A 1E2MA 4QARA 1XMSA 4UUMA 4Q1EA 3DEAA 3O1HB 4MEBA 2YRWA 2X0JA 4K2AA 3V8EA 1B3BA 3JQFA 4FEYA 4JXXA 2AN3A 4QULA 2OBLA 3FLEA 1UQTA 2C59A 3SF8A 3UV7A 3TRJA 1R12A 3AFHA 2E37A 4IXWA 2QMHA 3W90A 1O95C 1T2UA 3KJQA 4WY5A 1M8KA 4G67A 3PD0A 2ZJ7A 3SX4A 3PSAA 4BGEA 3ILHA 2ZJFA 4LXIA 5EKXA 3QU2A 4UE6A 4F2DA 3C3KA 1ZK1A 3T3OA 3OO0A 3CZPA 4LS3A 2ZIWB 4CE6A 4FKZA 1VBNA 3QXJA 3B38A 3SM9A 1TT5A 3BEDA 4ZYXA 3QEAZ 3QWFA 4G0QA 2P91A 4D6XA 1NIJA 4MI1A 3H04A 3KKLA 3JWPA 1T91A 2HLHA 2EZ8A 3CUTA 3C5EA 4HB0A 1IN4A 1E2UA 4MJ3A 4ENRA 4QE3A 2VPYA 4TRNA 2NXJA 5CDGA 1FRNA 2D0PB 1S8NA 5IT0A 1I0ZA 3M89A 2C2HA 3L40A 2BJHA 3ZWPA 4LXHA 5FTLA 1GYQA 4GC5A 1GDDA 2PV0A 3IIJA 2PUJA 3VZSA 2IS6A 1PF7E 1PO7A 3KZXA 2ZI4A 3PPVA 3ESCA 3K92A 3ZBUA 3LDAA 1J97A 1T0HB 3FPBA 2VPIA 2ST1A 5TQ2B 1ECBA 4DA0A 2AZXA 3ZBTA 1UKAA 2OXCA 3FMIA 1R0ZA 1EHYA 3QFTA 4XARA 4TSRA 1QFJA 2Q4RA 1JU4A 1PGNA 4QGBA 4YV0A 1IXSB 3FN4A 3RU3A 1ZL2A 1PTJA 2BFFA 2G4VA 2GEJA 2DSNA 4C76A 3MGKA 3P9YA 3W8FA 1AZWA 5KNBA 1C9JA 3ESYA 3DLPX 3BD6A 5A0TA 1NVUQ 1VYHA 2XJ4A 4BUCA 4YRBA 2HT1A 3QQPA 3RS4A 4P3PA 2IS4A 3LGSA 4XTCS 4CTOA 1VIMA 1AA9A 3ASZA 4QUIA 4BIMA 4HUTA 3EYWA 1L7XA 4ZFNA 3H8VA 4CKEA 1I4WA 2H59A 1MB0A 3CT6A 4NMWA 5KSZA 1HM5A 2O0JA 4I9HA 1JLLB 4ZI5A 3EFOB 2WUDA 2ZGVA 4F04A 3A28A 3BWVA 2BI7A 3U7QB 1YS9A 3V1NA 2IIVA 2ZAMA 2DCMA 4GYWA 5DHRA 4PQEA 1XGKA 4TTRA 1S3FA 4G8DA 4B46A 3U4HA 3SC2B 4UREA 4JMPA 5I7SA 2GAOA 2QYSA 1Q1GA 1TK2A 2B1IA 5KWJA 2HNKA 3DT9A 1RS0A 4DCPA 3ON5A 4G5XA 1X9GA 4TKZA 1OKKD 3S1SA 4MS3A 1DIAA 4JIGA 4F84A 4R69A 4ZOEA 4U2BA 1Z16A 2FSIA 1VMKA 2ZJAA 4ECAA 1YCDA 3IVGA 3PKJA 3STYA 3IIMA 4WVLA 4GH5A 4H4DA 5DWVA 4NDZA 2FPXA 1K4YA 3GNTA 3TQRA 1Q92A 1V1RB 3N3AC 4X84A 3AHEA 4GZ5A 1GRRA 3RVOA 3SR0A 3ZJVA 4U2EA 3AKYA 3LSTA 4KAAA 3LQYA 1CR0A 5KYUA 2E21A 1JVBA 4D80A 2ZR0A 2PV7A 4ZCSA 3TLYA 3H3XA 2HU5A 2J9RA 2QR2A 3MQ4A 5FF9A 4Y6GB 3OD1A 3HACA 1JDJA 4W1PA 3T8YA 3R0XA 2G1AA 6GPBA 5SY6A 4H59A 3TLKA 3H0EA 4IMIB 4PPYA 3P7MA 2J0VA 1G3UA 3EULA 4JT2A 4BX3A 4UEQA 1P9LA 2PYDA 3EZ7A 3HJAA 3CNLA 4RCZA 4MCIA 4QPDA 2Y27A 5IVDA 3B3JA 3LZDA 2C3PA 3HMKA 4J4HA 2ADFA 2FWIA 2IZ0A 3QHAA 4YJKA 3OIDA 3DWEX 3DFFA 4K9DA 2A8YA 3MJFA 5C1IA 5C1OA 5LMZA 4B3FX 3RQIA 2Q49A 1LTQA 3VKGA 4Q4LA 4IUBS 5GINE 1E8NA 4KK4A 2B83A 1NTRA 3UK7A 4BP1A 2ODAA 4HZIA 4E2YA 3GT3A 2ACEA 4XWGA 1XQVA 1A9XB 2J9XB 4XIIA 3WGTA 4FJ2A 4NCNA 4B83A 1MP0A 2PUGA 4LY0A 4LZOA 1A4XA 1BS9A 4KWEA 2ZS8A 1XEWX 2G9QA 2VDNB 2Z1MA 3A70A 4LGMA 4A82A 4FZVA 3G9ZA 1TM1E 3IBSA 3OJLA 4WECA 3EPPA 1B2RA 2WU0A 2ATIA 5C32A 3KQPA 2JCXA 3L1IA 1PCXA 1N3LA 2R751 1QYDA 2HK7A 4Z7OB 2X9LA 3GVIA 3HWSA 3INYA 5DASA 4YP9A 1ABBA 5K6RA 2QU8A 3BFPA 2CCJA 3QX7A 4QTUB 4G8JA 1TAGA 2FEMA 3RV4A 2XKBA 5TF4A 3TQFA 4J6FA 4MMXB 1JHXA 1R5OA 1R8JA 3P9SA 1GILA 3R0IA 1V8BA 5GOTA 3VAAA 2WWYA 5ES4B 4BGDA 1P9OA 2H4FA 3HADA 5FWYB 1TXGA 3S29A 1H2YA 3WVNA 1CUIA 2JIQA 3O3MB 3EDCA 3Q8LA 1TCVA 3WLQA 1ZCFA 3VNBA 3WHIA 2YJGA 5JNTA 4R2JA 1KH2A 3A3OA 2I5PO 3U4DA 3DM9B 5C8YF 2W8BB 3R2JA 2XADA 2GPAA 3RTBA 5I3CA 1YTLA 1I3CA 2PGAA 1YVUA 1Z63A 4GL2A 1J5PA 4E5UA 5JASA 1NP6A 3H99A 4NZ9A 2ET6A 1L4YA 2YDYA 4C06A 3ZKWA 4XX1A 1CR1A 4ZODA 3NTOA 3G0HA 1PJTA 3V5NA 1ILWA 1X1TA 3QLJA 5ICFA 2YY6A 2H2WA 1SHJA 1ZM7A 4HNQA 4IXMA 2XBMA 1QHNA 3DC2A 2PXXA 1TNDA 4XTRA 5EHNA 3O8QA 2H8GA 3FFBA 3HNRA 3SD7A 2GI4A 4WKNA 5HF5A 4B75A 3KTOA 1T9KA 1X2EA 4E46A 1AURA 3ONWA 4MS4B 3U4CA 3LXMA 3V8VA 1GNQA 1L0BA 1ZNXA 5FBWB 1OBCA 3ELBA 1AGYA 1DC8A 4NCXA 1Z25A 2WQZA 2CYAA 3FPLA 3LCRA 3EVGA 1OT5A 1O9BA 2O2XA 2WNIA 3D0KA 2QROA 3A2NA 1RC1A 2GVZC 3GJ6A 4U00A 4PN7A 4BEJA 2GHTA 5AXDA 4M2LA 4RIEA 2DMRA 3OT1B 2R87A 4OA5A 2Q4TA 3GLVA 3ENZA 3PXDA 4X85A 2ERCA 3BSWA 1EPUA 2D8AA 3SQDA 3SZ3A 1NAIA 1RRGA 1CXZA 1JPUA 3OOYA 3PB3A 4RHYA 1R0BA 3U44A 4RETA 5BN3B 3VVLA 3FDIA 1B6RA 1CEQA 2REBA 2FMTA 5BYAA 2QMEA 1NQTA 2YFKA 4HDCA 2C2WA 4UM8B 4PGGA 4V0NA 2Q0SA 3WLKX 2JFHA 1HF3A 1X42A 3V8QA 1TM4E 5EGNA 4I50A 4G1BA 4IKEA 1RVV1 3GYGA 3K9WA 3JCZA 5D7NA 3RB8A 1CNMA 2GPJA 2Q0XA 3EH2A 3QKWA 3MOSA 1P5JA 2Q45A 1JFRA 3CRZA 4AB1A 5C4IA 2F8SA 2ECFA 1COWA 2FEAA 4MQ6A 1JL3A 4F1KA 2F00A 1PS9A 1X15A 4EB3A 2EOAA 1U11A 3D6TB 2ZLBA 3HBLA 4J76A 4PVCA 4MV3A 3ILVA 1C0IA 2EJCA 4KRFA 2JI4A 2X5NA 4QPNA 1N5OX 2JFBA 1TTPB 4ZO9A 1XLWA 4YYZA 3AIKA 3C7CB 3LBIA 3LPDA 4DGSA 5HRAA 5BVHA 4WNAA 3CMMA 2PRKA 4OMUA 4MW2A 4UFOA 1QX3A 3QLUA 2QG4A 1TUGA 2OFXA 4EX7A 4RVFA 1M83A 1S7CA 2IPNA 2EJUA 5FV7A 1BH2A 1NUHA 4EQ6A 5CFNA 1T4BA 2P0EA 3OZBA 3LQKA 4RC9A 1X7YA 4D02A 3PQ8A 3ETCA 4C43A 3ZJTA 4DIDA 1QHSA 4FGZA 4P53A 4C0BA 4OXIA 1NBMD 3DVSX 5ADUS 5JRJA 1KKLA 2SNIE 2ZM6B 3GLKA 2JAOA 3HI6A 1PI3A 3PHCA 1KI2A 4ZZ1A 2CNWA 1JFTA 4Q3BA 1JI0A 3C24A 3KE9A 3I0NA 1PBTA 5H3CA 2B3TA 2K2QB 1XL1A 4W6QA 5MDHA 2XUGA 4FZJA 3CVOA 3MBKA 3GAFA 4XD2A 3SJZA 4J7XA 4ZYVA 4XI9A 1Y7PA 1RI1A 2CDAA 2PUHA 2EFDB 3R7AA 4CR7A 3RJ5A 1GRVA 2QD1A 1G8SA 1PFYA 1BA3A 2IZZA 5JRDS 4HH0A 5IC6A 4ADSG 5IZ4A 5JC8A 2AF4C 1GN9A 1ODCA 1EFVB 3C1OA 3FUTA 1VE1A 3OM8A 2OG1A 1BD4A 3NS7A 3BOSA 2A7XA 2QNRA 3L6CA 1J8DA 4HH3C 2O2YA 5EP2A 3K0FA 3KK0A 4I8XA 5CW1A 3O1IC 3H8SA 3ENNA 3A6FA 4OCZA 1J39A 2XTAA 4JJ7A 4Z4FA 1D5CA 1B3RA 3EA0A 2J87A 2HREA 1HQCA 4Q1AA 2C92A 3F6EX 2FSSA 3LDFA 4YEDA 2H31A 2QY6A 2WG2A 1NRJB 2ZB8A 3H2SA 3QXCA 2J3IA 2CJPA 1VL5A 1NNI1 1U0LA 2FUG6 3E1SA 1H6CA 2PLFA 4QLOA 2VNKA 4YH1A 2OD9A 4CBVA 4EYQA 3GFOA 5C3MA 1Y6GA 2H17A 4MJXA 3OQIB 1RJ9A 3GI1A 3DD5A 3FFTA 1F7VA 3RE1A 1ZCZA 3KOWA 3ILSA 2BH9A 4G37A 2VPZA 1JFFB 4LIPD 3UAYA 4DAEA 1RNLA 4FFPA 3RK4A 1L7BA 4WXYB 5B36A 2WTAA 4M86A 4RD0A 4PWYA 1MC8A 2B21A 2Y99A 3ILYA 4QGAA 1QTRA 2QJOA 1CZNA 3DDUA 4YP6A 2WF8A 4MCJA 2FG6C 4H3SA 3QKUA 4GYYA 3B1WA 4P34A 1HDIA 1CBUA 2ZRCA 4PNPA 4J0IA 1YFLA 4RGQA 4AG3A 2PTGA 4LOKA 5G1OA 3AIIA 2CK3A 5F2OA 1VECA 1TMYA 3PGKA 3ZY6A 2BZ1A 3C1UA 3P71T 4BB5A 3LUJA 2IH4A 2EFJA 3B6KA 3NH6A 2ZJ3A 4HAOA 2WF9A 5CITA 5CW2A 3R0JA 5ALYA 2BYTA 1SVOA 2IYPA 4RHTA 1RQXA 1KNXA 4GM4A 2J8ZA 2J41A 5SV2A 3H18A 1JXMA 1GNTA 1WCYA 2AZDA 1XFAA 2CYBA 1Y3IA 2XOEA 4N39A 4U2CA 3SHFA 4AO8A 3DHNA 4N5LA 5F35A 4DCCA 3GB9A 2I99A 3C0KA 2ZWAA 2AR9A 1WQ4A 4TVBA 4DR5B 3CF4G 3SJ7A 4EK9A 3JZIA 5ADWA 3M34A 5BT8A 5C3UA 2DQKA 1X1AA 5TX7A 1PVVA 2P6NA 5FI0B 1JU9A 4AUEA 1IY2A 3ZVLA 1YWGO 2YMMA 3F98A 4PCUA 1DCTA 4AI6A 1SC6A 3F5MA 1V0JA 2ANBA 1MJGA 3QNWA 5FDFA 4A15A 4XVHA 4YY3B 3AESA 3WXBA 1P9WA 2B78A 3CURA 3GDOA 3HPRA 4J29A 4QOEA 1MB2A 4UTVA 3ZKAA 1TT5B 4G2TA 1Z38A 4XWWA 1V11A 2PSDA 4AIIA 3IERA 3JAWA 4ZDWA 1TQ6A 1DAFA 4BDSA 4KW7A 4DCGA 4ZQBA 3DP7A 3MTQA 3PIRA 3V7FA 4G4GA 2D5AA 1MEJA 2H4WA 2Q4OA 1ORRA 1OFVA 2YWCA 4JBHA 2IPOA 1FA9A 3QG5A 5BV7A 1E9EA 2G9RA 3KDAA 221PA 4HX5A 4B3HA 3I01A 3D5QA