2YC4C

Intraflagellar transport complex 25-27 from chlamydomonas
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
198
structure length
177
Chain Sequence
KPIDITATLRCKVAVVGEATVGKSALISMFTSVVAPVTIPDTTVSVELFLLDTAGSDLYKEQISQYWNGVYYAILVFDVSSMESFESCKAWFELLKSARPDRERPLRAVLVANKPPQRHQVRLDMAQDWATTNTLDFFDVSNPPGKDADAPFLSIATTFYRNYEDKVAAFQDACRNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Intraflagellar Transport Complex 25/27.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Transport protein
molecule keywords INTRAFLAGELLAR TRANSPORT PROTEIN 25
total genus 52
structure length 177
sequence length 198
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2yc4C00
3B2EA 4GZLA 1D9XA 2MSCB 3HPRA 5SZKB 1EFUA 5ANRB 2ZRBA 4ZO4A 1OFTA 4LWZA 2IHBA 2GXUA 1T4GA 1GKYA 4M9ZA 1UBFA 4ZCMA 2ZE8A 3OE7D 2VLIA 3GLFB 3BH0A 1XFAA 1JXOA 3Q85A 2AFHE 5C4MA 3AVQA 3NBXX 4D80A 3K9LA 2OFWA 4EJSA 1DS6A 4RD0A 2A78A 3SE0A 4GPTA 4ESVA 4LOAA 2NZ8A 1EFHA 5L3VA 4KCGA 4JLPA 3PVSA 2EFEB 2PLRA 3EWSA 4IDHA 4EPWA 4LJ5A 2L0XA 5A4JA 3Q7QA 1F48A 5BYJA 1IONA 4ZCIA 2N1BA 5C4GB 4AYXA 1XMJA 2KJQA 4OHVA 4R9UC 4OKSA 4Q7LA 3K09C 2REXB 2C04A 1M1YE 1XF9A 2PX3A 2YJTD 1BO6A 1JPJA 2QTVB 2GCOA 4M9QA 1AQUA 3SC3A 4C0LA 4BLTA 2QE7A 1AQYA 4JIMA 1KI8A 5AJZA 2Z6VA 1TUEA 1W0KA 2AD1A 3BH6A 2MMCA 3D3QA 4KFTA 5TV2A 3PXGA 2NQ2C 4GP7A 4V0OA 3CZQA 3GQBA 4FCWA 1FQKA 1I4DD 2CL0X 1N6PA 1ZUNB 1GKUB 5EP4A 3SYNA 1JBKA 2QI9C 2ZR0A 3KKNA 2AR7A 3TAHA 1NP6A 2OG2A 4F93B 4Q48A 1BKDR 3V4FA 2R6DA 1IY1A 2UZIR 5EP3A 1R5BA 1VG0B 3OFNA 1YQTA 4F7WA 1YRBA 3S1AB 1DBSA 1ZRHA 4CT5A 2GJAA 2OEPA 1Z07A 1G5RA 1BMFD 3MWKA 2ZVPX 5C1BA 1QBKC 4Q7MB 5L3SA 4Q9JA 2ZREA 5BQ5A 3RDPA 2W6JD 4IHQA 1AS0A 3BB1A 2IYTA 3B60A 3IIKA 4HZUA 2XITA 1SXJC 2FPKA 2Z43A 5DHFA 3C5CA 1DO2A 2G3YA 3K53A 1GRRA 4R98A 1GNRA 3DO6A 1OXSC 5FPSA 3A4NA 3GJ4A 4RCYA 3PIRA 2AK2A 3KKPA 3DOFA 5B57C 1AM4D 1E0SA 2ZI5A 1WBDA 1OXXK 2D62A 1YR8A 2QRZA 2XZPA 1UEIA 4FCTA 3Q5EA 2C95A 2CLDX 2YNMA 1JJVA 2H5EA 5B58C 4HDCA 3CRMA 3PJRA 2H92A 4A0HA 1O87A 4DDVA 2Q0HA 1XD2A 4JVNA 3B9PA 3BFVA 2C78A 1UADA 2ZI9A 3K8YA 1SZPA 1TADA 1TF7A 3KKMA 4G5QA 1DG1G 5FOTA 2OBMA 1NN0A 4Q9HA 5L3QA 3KB1A 2G0TA 3CWZA 4GRAA 2Q3HA 4HAXA 3TUJC 2RB4A 1HT1E 1Z83A 4IDQA 1RRFA 2HLDD 3UXMA 5A0FA 4Q4AA 2LCFA 4LGMA 2ZXUA 3IUYA 2OAP1 4DZZA 4ABYA 4N0EA 2X77A 1RFLA 3RLFA 3ZDQA 1T8UA 1RYFA 3SFVA 4JLJA 4V02A 3SJZA 2VHUA 2EFHB 5J4HA 1UEJA 3MJHA 5LDDC 2ZSAA 1KNXA 1G18A 4KBGA 1KDPA 1WA5A 2J7KA 4F4IA 4RZXA 3NC0C 3OIYA 2YHSA 1XX6A 2YOFA 5IT5A 4QL3A 3TR0A 3KQUA 4I1SA 1Q20A 3SHWA 3VAAA 3GLFA 1JJ7A 4XD7D 2FGJA 2NGRA 4PPGA 2FWRA 4M53A 3AP2A 4NCNA 4ACAA 1ODFA 2CK3D 3HU3A 2MSEB 2IYQA 1C9KA 2QGZA 1Z6TA 4PPQA 3TMKA 4JYBA 4HLDA 3Q5DA 3QF7A 1OH6A 4A36A 2I3BA 2QG6A 5JS7A 4NYIQ 4L9WA 2IF2A 2DCUA 2WWXA 4Q02A 2QMHA 2CCKA 2PJRA 2XEXA 5KU1A 1E2HA 4PAQA 4KXFB 5BN4A 3FKSA 4IVPA 3LW7A 1Z6GA 2QA5A 3IQXA 1P6XA 3E1SA 1P7CA 5DI9A 4HEJA 1NBMA 3DPUA 5JWHA 4TMTA 3VKWA 4TLAA 3MD0A 3A36A 3PCRB 4L5BA 2ORWA 3U2QA 1U8YA 3UK6A 2V7QA 3A37A 1US8A 1ZIOA 4UNPA 1KMHA 3AKCA 2XB4A 3LBHA 3QI2A 1LS6A 2P6UA 3GEIA 5GJBA 1JAHA 3EZ2A 1TPZA 2ZJZA 1IOZA 1W2HA 1LNZA 4JVMA 1HQCA 4WBSA 4MITA 2P67A 2ZRIA 4HB3A 4EKDA 5DGXA 1W36D 2W2XA 1G7SA 3ZZUA 1JQJC 4DLYA 2DBYA 1K5DA 1S8FA 5TVKA 2QPTA 2ZYTX 4M0LA 2IW3A 4HUQA 4DLTA 2BKUA 2LKCA 5C18A 1MO6A 2BWJA 4CT4B 3OEEA 2P65A 2PMDA 1HUQA 1LV7A 1CR2A 4OI4A 4A1FA 1ZVQA 1KK0A 4JLKA 5EZ6B 5SZHB 5FR1A 3FMOB 4Y0VA 2EW1A 1KSFX 4Q4HA 1G5PA 1XP8A 4EUNA 4IOKA 4IW3B 4KHZA 1Z2AA 1D8TA 1XTIA 2J3EA 1VCMA 5DE3A 2VIIA 4PPNA 1XWIA 4TLEA 4TMZA 3W9YA 1F2UA 4HI0E 3SN6A 2G1JA 2EU8A 2WMOB 1N6RA 3DKPA 1H8ED 3LLUA 4JZKA 6Q21A 4WVFA 1KMHB 4US0R 2BBTA 4Q4JB 1E1RD 2J7PD 4AG6A 4AIIA 3CONA 2FA9A 4AC9A 1CS4C 1G8FA 2GZAA 5JMTA 1G3IA 1DTSA 3RYTC 1W7AA 3LDAA 4JLNA 2RGGA 2ZAMA 3W8NA 3X1YA 4BWYA 3V9PA 4MH0R 1G6OA 4XWKA 2IS1A 1VHLA 3ZIAA 1GRQA 1L7VC 5TXGA 3FHCB 4ZKDA 4F92B 4HDOB 1X1SA 4B47A 1T3LA 1M8PA 2QT0A 1ZUIA 3BIFA 4LBZA 2JLUA 4IOLA 4A8JB 3THXA 2IUTA 8OHMA 1YZTA 3H0KA 4XWOA 2OBNA 4WXRA 3CUEF 1WRBA 2UKDA 4LV8B 2KE5A 3LVRE 2VP5A 2IYLD 2C96A 1DG3A 2ZRAA 3RC8A 4CGZA 1G64A 3KFXA 3O8CA 1D5CA 4KI0A 4QHYA 1VMAA 2O8FB 2JJ8A 2WOOA 2XNDD 3HR8A 4URYR 2IF0A 3O47A 4D25A 1A5TA 4PANA 1GFIA 2HV8A 4ZI3A 4R71A 1Z47A 2H17A 1T5LA 3OEHA 3EC2A 1Z6AA 4MYCA 3SZRA 1I4TD 3AH8A 4QKQA 4ZCLA 1G8PA 3L8ZA 4DT1A 3UANA 2CLCX 1MABA 1J8YF 1G3QA 1KJZA 1OLOA 2IYSA 2A5GA 4QNRA 2VQSA 1XTKA 4JL6A 1SXJB 3NH9A 2HT1A 4NCHA 2ZYVX 1CJUC 1E2LA 2VSFA 3DVLA 2C5LA 3MSXA 4DLUA 3GLHB 3GJ7A 4US2R 2R6AA 5DHAA 1MKYA 2OCBA 3KB2A 2AXPA 4TLBA 3TSOA 1X8JA 1GIAA 3B1ZA 3RS7A 1G7TA 2JGNA 1JB1A 2RGNC 3P20A 2VTKA 1NKTA 5HE9A 1T5IA 4I1UA 2I1QA 2HT6A 3L0PA 3I62A 5FI1B 1TQDA 2QBYB 3U3OA 3B1XA 1YR6A 2Y8EA 4XJXA 1XCPA 4YMWA 1E6CA 4RFSA 4FMCF 1KI4A 2RKOA 3LY5A 1NSTA 1CJTC 2FSFA 1KAOA 2Q3MA 3CR8A 4MQBA 5KTYA 4CEIA 3WYFA 4HAWA 4IRUB 3J81k 4KFSA 3PEUA 2EFCB 3N5CA 2CL6X 4BE7B 4P4SA 4B43A 2HDNB 4FD2A 3NEJA 1DAMA 4V0MA 1MT0A 1KO1A 4V0LA 3SQWA 3R9IA 4ESHA 4PHHA 1N6LA 2W6IA 2ZI7A 3CM0A 4TLCA 3THYB 5F9HA 1U99A 4PHTA 4TMKA 1LF5A 1KSHA 1NNEA 4D26A 5DH9A 1Z0AA 2XSZA 4PSKA 2HYDA 3SI7A 421PA 1V43A 1N2CE 2ERXA 2OAQ1 1KAGA 1RW4A 1E9CA 1QG4A 3AKEA 4MUBA 4NYJQ 4UNNA 3EPHA 2O8DA 3H1TA 4W5WA 2ZRPA 1IXSB 4OQFA 5BN3A 3ADCA 3WMGA 4AD8A 1E0KA 3NBFA 2BBOA 1J99A 3B82A 1F2UB 3FB4A 2F55A 3IGFA 4NTZA 4IXMA 2WIBA 3CPHA 3GLIB 3RRNA 4JYCA 1GDDA 1X86B 2FNAA 2MSDB 3WYAA 4L15A 2NO7A 3UWOA 5L8VA 1ELOA 3OZXA 3ZGXA 2IA5A 3PV0A 4G3XA 2JJ1A 5E7JA 2IYYA 1YJ5A 3SNHA 2F9LA 4TTQA 2BBWA 1XTRA 2PLFA 2BOVA 3W34A 2Z0MA 3U6KA 5DNYB 2X2EA 1QHHA 1T9HA 4LHVA 2OZEA 1F5NA 2ZR9A 5IHPA 3UPUA 3MAAC 4DEYA 3R8CA 1GILA 1Z3IX 2IUSA 3BBPA 4MKGA 1LY1A 4ERNA 5CITA 2CBZA 2IL1A 1XMIA 4M4SA 2F43A 1M34E 1Q44A 4PQFA 5FUVA 2GETA 3WBJA 4C0AC 1A2BA 1IN7A 1P9WA 4HLCA 2HYIC 1IY0A 3FFBA 4BECA 1Z2CA 1IJEA 5D3MA 4Z54A 4AKHA 1GTVA 3SDZA 4DLZA 2J41A 2DFLA 1E4YA 2IXEA 3LW8A 2QTHA 1JQLB 3B13B 1S0UA 4P4UA 3KQNA 1QHSA 4JL5A 4RZ2A 5E7IA 1GL7A 4JS0A 4PQYA 1P5ZB 2OXRA 2WTUA 2XTMA 5EUQB 5HPYB 4R2IA 4TYWA 2J46A 2WKRA 3MRSA 2FEMA 4JLVA 3VMFA 2CL7X 4EIWA 2NO6A 1GUAA 1G4UR 1YZQA 4LYFA 4FMBB 4EFLA 3SU8A 1E9FA 4UJ5A 5H1YA 3NHBA 4B3GA 4D82A 2WPDA 2KBEA 3GJ8A 2G83A 4IKEA 2HF9A 3QQ5A 4POAA 1DARA 4Q01A 4Q9KA 3T34A 1L4YA 4M8NE 5JCZA 2GXSA 3WHKA 4DJTA 3PUYA 1CR0A 1X8KA 3KQKA 1KI7A 2R8RA 2J1LA 3SYKA 1Z0KA 2GEDA 1QVRA 1T91A 4JLOA 2BVNA 2FFHA 1ZIPA 1XCGB 1JEEA 4FCVA 4URZR 1ESNA 1Z0FA 4ILEA 1KY3A 5TB5A 4M1TA 1NG1A 1AS2A 2H16A 3K0CC 4GFDA 3FVQA 4QXAA 4EQ6A 2BV3A 5EE9A 2GJKA 3GJ5A 3JZAA 3BERA 1FW6A 2P3SA 3T1VA 2C9YA 2IXFA 1N3BA 2PEYA 3W3AA 2WJGA 2D74A 4EFMA 2YWEA 3GJ6A 2ZS9A 3FKQA 1UAAA 1JNYA 4X8OA 1EFCA 2ZSEA 4IEIA 1Z06A 2PZGA 4LHWA 3WHLA 3SQXA 1NN3A 1GP2A 2F9MA 1M74A 3KTAB 3UIEA 1E96A 3CH5A 1Q22A 4BEJA 2NIPA 4GOJA 4D81A 3M1IA 5FOXA 4A8JC 1XCMA 4GDFA 2P5SA 1UBGA 2OSBA 2YINC 4RD4A 2BM1A 1AKEA 2DWQA 5KSPA 2I4IA 1G291 3OIUA 1P3JA 3QF4A 4TTPA 5TMPA 3QKRA 3RAPR 4JKIA 1AK2A 4DVGA 3TVTA 2FE4A 5JLJA 1JXMA 2GHIA 2XJ4A 2N42A 3WP1B 3WY9A 3U7FB 3THXB 2B21A 3PUVA 1ONBA 4MRVA 1KSJA 2AXNA 4XTCS 3RRYA 2O0KA 3EZ7A 2W00A 3VQTA 2ZROA 3L43A 3F0TA 1XEXA 1HA3A 4QM7A 1AZTA 1KK1A 1XD2B 1KMQA 1Z08A 3K70D 3AVTA 5G41A 2W0MA 1KI6B 1TL7C 2O8CA 2REOA 2O8FA 3QPUA 3AF1A 2FV8A 2AKYA 1HURA 3ONWA 5P21A 3L0OA 4E5UA 1N0UA 2F3RA 2RCNA 1LS1A 3K70C 4RFSB 1EFRA 3IO5A 4HLUC 2QUZA 1NJFA 1W5SA 2EWWA 2EQBA 5BXQC 1MH1A 2FGKA 4NYJR 1N25A 1G3MA 4TQAA 1UKEA 3D8BA 2VYFA 1R4AA 1CULC 3AF4A 2QPAA 2V4ZA 1COWA 3TR5A 1E9DA 3LQQA 1R0ZA 5G3YA 1YR9A 4KO8A 5DN6A 1LFDB 1FUKA 4B75A 2JJ2A 4QGFA 1GG2A 3A4LA 4LJ9A 2NPIA 4KVAA 4OK5A 3KUDA 1Y63A 3C5HA 1Q1BA 1G3RA 1OSNA 2F3TA 3B1WA 1NJGA 2AL7A 1DVRA 2JEOA 3UKDA 2JLRA 1UBCA 1XEWX 3REFA 4IEEA 5L3SB 3HYTA 4IDOA 5FL3A 4LV5B 1QZXA 4D4JA 4RJLA 3SEAA 1N5LA 3ECCA 5JSZB 3MLEA 4Z1MA 5GJVC 4BFZA 3KKOA 2Q9AA 2WV9A 1BIFA 4C0QC 3PG5A 1P9RA 1QG2A 2P0EA 1ZM4A 4WZBE 2Z4SA 2OFXA 1P2VA 3VKHA 4O2RA 1OIXA 5KPJA 1XBTA 4D4KA 2HUPA 1R0YA 1OH5A 5KHOC 3A1TA 3THWA 3BE4A 5BN5A 3PR1A 1PUJA 1KJWA 5SZIA 3TJZA 2IYXA 3NG1A 4DUGD 3V00A 1RKBA 4B3BA 3A1VA 2WWHA 1D9ZA 4GOKA 1RRCA 3KJGA 2RGCA 4GMDA 3PENA 3EC1A 4QBFA 3AM1A 2AHOA 2WOJA 4HATA 4FMDF 2UVQA 5JEDA 1G8GA 4LYHA 5D3MB 4DSUA 2DFKB 2O8DB 1GL6A 3CNLA 1AA9A 4G5GA 4JVLA 4Z1MD 3BC1A 1W36C 3A4MA 4G1UC 4JSTA 4Q4AB 3W90A 4IFEA 3R8FA 3I92A 4Q1BA 4RY2A 4KFRA 5CM9C 1QVAA 3D7MA 1AJEA 1UFQA 3GLIA 4URUR 3LD9A 3VTKA 1NVVR 4L8GA 4ZI2A 3ETLA 5CB8A 4YONB 5FUYA 2X2FA 2BCJQ 3IKJA 3TBKA 3BJIC 3AGQA 2JJ2D 3I1FA 1ZCAA 5DN6D 4ZDKA 1MV5A 2D06A 1R0WA 3SJAA 1S9HA 1OKKD 5DIFA 2NMVA 4TQ9A 1DAEA 1GL9B 4HLQB 1S96A 5EE0A 3T35A 5HZHA 1Z6XA 221PA 2LKDA 2QAGB 3FDIA 3P27A 3EG5A 3TW8B 3LH5A 5L3QB 1ZINA 1GRNA 1XJ0A 2XGJA 2A30A 2A9KA 3CRRA 4IJMA 2IS2A 4HAVA 3I5YA 2OLJA 3CX7A 3L82B 4BEBA 2VSOA 4H1UA 5HCIA 2A2ZA 3TAUA 3QF4B 2FZLA 2QQ0A 4JVSB 3BS4A 3M6AA 1OIVA 4JT2A 3SJCA 4BFTA 1T0JB 1SKYB 4QJ4A 5CK5A 1WF3A 3BAFA 2ZJBA 5CDFE 2JDID 4Q5IA 4KYIB 5HE8A 5JS8A 5JWOA 1QF9A 1NMXA 1HQYE 2ONJA 4UKDA 1YKSA 2ZRKA 1MOZA 1VG9B 3RS3A 4DHEA 3Q3JB 1US8B 3LXRA 3WRYC 1SVIA 3G82C 4DLVA 3NDBB 2ZI3A 3ZQJA 3LO5A 2JDIA 4ON9A 4TL9A 2WJIA 3REGA 4DC9A 3K0CA 3GJ3A 4H1VA 521PA 2R65A 1OB2A 2YYZA 2DFTA 3ND8A 4CEJA 3RRMA 2CMKA 2QM7A 5FBLB 4QBHA 4EFNA 1PZNA 3I72A 2LWIA 4NL4H 2ZUBA 4Q18A 1NLFA 5AK0A 1YE8A 3IPXA 1GNPA 3AF2A 4Q4JA 3QXJA 1FQJA 4B48A 4GL2A 1R8QA 1X8LA 4LDJA 5EUMA 1ZD1A 2QRNA 1XXHA 1G4AE 3AVOA 1CU1A 3LRPA 3T15A 3B1VA 3A1UA 3QKUA 4MGKR 1OKKA 1V5WA 2B7BA 2MMGA 4GI7A 4QG7A 4YC7A 4D0LB 3PUWA 5GADl 2XXAA 2QP4A 4YMUA 2JLYA 2A5YB 4IFBA 1R2QA 1F2TA 4YLGA 1YVDA 2VH5R 4A8JA 4EPVA 4A92A 2QMOA 4LJAA 2FPMA 1FX0A 3ADDA 1XEWY 4N3NA 3U3KA 4L16A 5ELXA 2HCBA 3DZDA 3AP3A 5CM8B 5TDHA 1Z63A 1S2MA 1YZUA 5JJLA 4DBLC 2FN4A 1E2PA 5EE3A 3DHWC 4DCTA 5J47A 3EARA 4GZMA 3UMSA 4CEIB 2ZS8A 1FZQA 1IHUA 3QKSA 4ZKEA 1E2QA 2ZAOA 1E4VA 1F6BA 3D6TB 2CE7A 4WAUA 4OHZA 2W2TA 5FOWA 2VHTA 1R10A 2WWFA 4UNSA 4DUGA 4YQFA 1NF3A 3RS5A 4PAOA 2IYWA 4HLUA 4OI1A 1OPXA 3TH5A 3FOZA 1NLZA 5BW8A 3VR3A 5HR5A 2PCJA 2ANBA 3T61A 1DO0A 1YHNA 3I8SA 4IDPA 2EFGA 1D6JA 1EXMA 4MUAA 3AVWA 3AB3A 4KLZA 2PL3A 2GXAA 3LBNA 1LVGA 1E2DA 3C41J 5LPNA 3U7HB 4Q1FA 1Z29A 4A0RA 1P4SA 5G3ZA 2ZI6A 5H70A 4N0DA 1HTWA 4QOSA 2AK3A 4UXJA 3PFIA 4NCIA 2D7CA 1S3SA 1U0JA 5FUXA 2JJ1D 3MG9A 1XMSA 2FF7A 3K0SA 5L3RA 3T1TA 4US1R 1HYQA 3O8RA 5KUTA 1MO3A 4DCNA 4PC2A 3OIVA 5CYPA 1JPNA 2BIFA 4BZQA 1IXZA 2VPPA 4Z8XA 2WICA 3FPAA 4BLRA 3M4YA 1S1CA 1AGPA 3H4MA 2DHRA 4NU0A 3MWLA 4MGYR 1MRSA 1AS3A 2HCJB 3TVDA 4YMVA 1Z22A 2GNOA 2QL6A 4NDZA 4X8LA 4AKGA 2J0VA 4CIDA 1COWD 1OW3B 1N5IA 5J5CA 2B7CA 4ZDJA 3ZVLA 4FMCB 4Q00A 3EA5A 1T3HA 1EFRD 1A2KC 3ZH9B 3QUSA 2W6ID 1E2GA 2DFNA 2HJVA 1YZKA 2J59A 3E5HA 5AR1A 2NG1A 5EXPA 5EXXA 4CW7A 3B6EA 1KGDA 3GP8A 3AUXA 2ZS7A 2FFAA 4PXAA 4TYYA 2GF9A 4MA4A 4TL6A 5K8IA 1ESMA 1Z5ZA 2GEVA 3W6NA 4B3FX 4CZ2A 5KO2A 1W36B 2DB3A 3CX6A 1PJRA 4RSGA 3BFKA 3N2IA 2AX4A 4BRWA 3TRFA 1E2MA 5FPYA 4II7A 1WP9A 2NO9A 4HB2A 2F6RA 2C77A 2DYKA 4B3XA 1B23P 1DELA 2BHRA 3Q7PA 4ARZA 1KOFA 1TF5A 3LNCA 1X6VA 2FG5A 1UDXA 3IIJA 2QT1A 2WJYA 4MYTA 1RIFA 3EPKA 3PUZA 2PT7A 4B33A 1XPOA 3W8RA 1QHGA 5HCNA 5EJEA 1XEXB 2ZITA 3ZS9A 3F5FA 1D2EA 1D2MA 2G0NA 1ZU5A 2ZE5A 4YDHB 3NDPA 4RD2A 4XTRA 4UNRA 2QTFA 2YWHA 2BBSA 4P32A 1I2MA 4LK2A 4OJKA 2YV5A 2JASA 2GEUA 2EFDB 1PLKA 1RYHA 3GEEA 2FMXA 2V1XA 5AUQA 3TSWA 1U0LA 3P1JA 2ZU6A 1WQ1R 1FX0B 2GKSA 3ZZ0A 1NLYA 2F43B 2YOGA 1U98A 2JLQA 2NZJA 2Q9CA 4U02A 4B2PA 4EPRA 1VPLA 2XNDA 4CEJB 4DT1B 4DLSA 4R7ZA 3KXKA 2BJWA 4DIEA 1FFHA 3MFYA 4YMSA 3QG5A 1KJYA 1VHTA 1W47A 3RC3A 2VHCA 3B9QA 2BC9A 1N6KA 1OE0A 2GBLA 4RD1A 5JHHB 4A6XA 2PX0A 2ORVA 5LD2B 5DO9A 2QQEA 4PHGA 1OH8A 3CF0A 3B8HA 5FR2A 2JLZA 5JZVA 3K0FB 4BQSA 4RZ3A 4ZV4A 4P3YA 3LLMA 5AUOB 3CF6R 4A2PA 2ZE7A 1E9AA 5LBIA 3MCAA 2GVZC 3ZVNA 3QKRB 4HAUA 4NCJA 2WPDD 4CEHB 4LC0A 2ZYWX 5KYKA 1NN1A 1M2OB 3TE6A 1ZNZA 1ZUHA 3D31A 1NY6A 2BM0A 2J7PA 3I8XA 3RABA 4F4JA 5K8TA 2FX3A 5F98A 1H8EA 4BFSA 3QEJA 4KVGA 4BZPA 1E9EA 1ZNYA 1TU3A 3CRQA 4AI6A 2OUKA 4LPKA 4B76A 4HZIA 4P33A 5FPHA 2GCNA 1E2IA 1TEXA 1U8AA 3C8UA 5LB4A 4D2IA 1D2NA 5EP2A 1KZ7B 4TZ0A 1OXVA 1SHKA 2ZETA 2KSQA 3AP1A 3LXXA 4YMTA 1CLUA 2JLVA 3WRXC 3HYRA 3SHFA 3CR7A 3CRVA 1AGRA 5SZJA 3CPJB 1WMSA 5KDOA 3NTUA 3WXMA 1KY2A 2GXQA 2IEYA 1K8RA 1UBEA 4TN1A 4TL7A 2YZ2A 4G01B 2IS6A 2D2EA 2ZUDA 4KLNA 4FW9A 1AKYA 3SS8A 4C9BA 4JJKA 3KX2A 1NRJB 1CF4A 3MWJA 5UKDA 3U3RA 5A5GA 3JZMA 2NO0A 1NVWQ 5FBVB 4MKHA 4JLBA 3I32A 5H68A 3ZZTA 5BYKA 4BFXA 4XSGA 2P2LA 3TUIC 1T8TA 1OB5A 1QHYA 2WJVA 4NP6A 2BKEA 3RNLA 1SVMA 2ZPTX 1ZC4A 3TNFA 2CHGA 1AN0A 1OV4A 3E2IA 4WW0A 1G1MA 1VCIA 1QHHB 1KZGB 2VL7A 3O8BA 4U7DA 1XMVA 4LJ8A 3OF5A 3VKGA 2DR3A 2GTPA 3QEOA 1EWRA 2ZRMA 2XSZD 1FUUA 2KWIA 3KKQA 4LJ7A 4QM6A 1XRJA 5H8WA 2IYUA 3U44A 1Q12A 4MRSA 5F2EA 2KB0A 2WHXA 2JA1A 4BZXA 5GJWC 2R44A 2ZU0C 4PR0A 4D4LA 1RRGA 1TX4B 3U4QB 1OJLA 1U0HC 2OCYC 4LHYA 3HJNA 1KDTA 2QAJA 1W4CA 1OT3A 2JLXA 3CKLA 5EZ5A 1GM5A 4LRWA 2Z5FA 3CF2A 1SKQA 1U2RA 2BMFA 2WBLC 4IDNA 4Q4HB 5DSZA 5EE5B 2DPXA 4C0JA 4M1WA 4RCZA 4J0QA 5M04A 2BEJA 3KTAA 3EW9A 1F60A 4A82A 3C7KA 4K81B 1DEKA 3AQ4A 2J0SA 3QSYA 1OYYA 4O25A 4LJYA 3KUCA 3FHOA 3QY0A 5JFGA 3VHXA 2IT1A 2CCGA 1UPTA 2QZ4A 5EP1A 4QFMA 2D7DA 2C99A 2IEZA 2IWRA 2R6FA 1XTJA 4M9SA 3NHAA 3RHFA 4P4SB 1E2JA 1MABB 2DWOA 2REBA 4LZZA 1E2FA 2VP9A 2ZVQX 5HZKA 2H18A 1E9BA 2ONKA 5DLQC 5K8UA 2SHKA 1KDOA 4OQXA 2WIAA 4Z51A 2HLDA 2QORA 1JAIA 3FMPB 3QXSA 3QVUA 2ATXA 2AWOA 2HF8A 1EWQA 2IYVA 1XXHB 121PA 3B5JA 3AGPA 2RHDA 1ZM7A 5JRZA 3PEWA 3OEHD 3R7WB 1U9IC 3QIAA 5GVRA 1W5TA 4I99A 4A0GA 1LB1B 1PLJA 2GVDC 4C3ZA 3HU1A 1A4RA 4NKRA 1OXUA 4M1KA 3ASZA 5FH9A 1G8HA 1SKYE 2IYZA 1IM2A 4DXAA 3KJHA 4A9AA 2IYRA 1IN4A 4QJ5A 3ZS8A 4IVRA 1CP2A 3U7EB 2ZSBA 1U81A 3K0AA 4E03A 2IX3A 2WSMA 1CBUA 4HZUB 4OQLA 4Q66C 2FH5B 2V6JA 1WB9A 4AYTA 2O5VA 821PA 3F3YA 1XZPA 3CNOA 2E87A 3N70A 3ZQ6A 3ZIAD 2OM2A 4OI2A 4NPHA 3L0IB 2CEAA 1SVOA 2F1HA 1HEIA 1KHTA 1MO4A 1JEDA 1HV8A 2CVFA 2WWGA 1TQ2A 1VYUA 2V55B 1E69A 2GESA 1J2JA 2VSXA 4PZZA 1WBBA 2ATVA 1ANKA 4V0ME 4DDWA 1W4BA 1Q1EA 1E1RA 3UWKA 4B71A 1G19A 5FBRB 1BMFA 4DWJA 2EVWX 1W1WA 4B6EA 1J8MF 3CX8A 1JI0A 2B8WA 2FEOA 3BORA 2CJWA 4LHXA 1KKLA 1P9NA 4D4MA 4B35A 4TTRA 1W48A 1NVUQ 1VTKA 2ASEA 1H65A 4FMDB 3TQFA 1HT2E 1PUIA 3BGWA 1UM8A 3WBKA 3NEYA 2WKPA 1WE2A 2ECKA 5C2JB 2ZRGA 5G53C 1TAGA 4A2WA 1U90A 2GZDA 3LAWA 4JLAA 4M1YA 4LUCA 3AVPA 3EA0A 3WNCA 4DRZA 2H57A 3GJXC 4OHWA 3PEVA 2RGAA 2DWPA 4TMVA 4DEXA 3VNVA 2O8EB 1KIMA 4RFVA 1TQ6A 3QPVA 4OQNA 3QBTA 2HJGA 2Q3FA 1G3UA 3OEED 1A7JA 5IF9A 1HE1C 1U94A 2EWVA 1VCNA 1VCOA 5FI0B 3A8TA 4QRHA 1JR6A 2OHFA 4URXR 1Z28A 2ZJ5A 3B7GA 3IDQA 4TYPA 3T06B 4PHFA 2VHQA 1II8B 2ZJ8A 3RWMB 4C7OB 2Q6TA 5JRJA 4I81A 5KDLA 4ACBA 1IAQA 4PO9A 4DLXA 4KBFA 2JAQA 4DLWA 1YZNA 1NG9A 3NC1C 1DAGA 1YU9A 3EPJA 1M7GA 2V8OA 1Q57A 4W5JA 3SBEA 3THYA 1SVLA 3KL4A 5KSZA 2PZFA 3OE7A 2JATA 2V7QD 1XTQA 3IHLA 1G7CA 2OXCA 1IJFA 2CJWB 4I1OA 5FOSA 2GRJA 1P61B 3N2EA 1NBMD 4BLOA 1KI1A 1Q21A 3FMIA 4U00A 3FTQA 1JALA 1SGWA 4MYUA 3VR5A 5AUNB 3FKSD 4OYHA 2XZOA 1RVDA 5JJKA 1VYVA 3PUXA 3IPYA 3T12A 2WJJA 3QKTA 3TQCA 4Q21A 4JBYA 3R20A 5FTMA 3AKDA 1VG8A 4BGDA 3IBYA 4V03A 3TUZC 1JECA 1G8YA 1E79D 1A82A 4AURA 1KDRA 5B64A 2IBMA 2CK3A 3PITA 3EZ9A 3EAQA 3SYLA 3OHMA 1PV4A 4XIGS 4BLSA 1XPUA 2VP4A 1II0A 4XD7A 4EJSC 3HR7A 4F38A 2W83A 2ZRDA 1DPFA 4LC1A 4MKIA 2ZSDA 4C0BA 5KNBA 1R0XA 1W4AA 3EZFA 4LPSA 2RGEA 3U60B 4L9SA 2O8BB 1G16A 4QBGB 4LY6A 1KI3A 1Q3HA 2VA8A 4IVQA 4GT1A 5FTJA 3I61A 3KDSE 3R7WA 2A3RA 2YKGA 4EPTA 5DISB 5DI3A 4LCBA 4BUJA 3BB4A 2QU8A 4EDHA 2O8CB 1I2DA 2E9SA 2H8KA 2FZ4A 3GFTA 4JL8A 5IRCD 1W0JA 2AD5A 3Q8XB 3LBIA 4IOJA 4OQMA 4DDTA 1DAFA 3FE2A 2ZR7A 1S1MA 1ZAKA 2R62A 4WIAA 5J4YA 1DAHA 3U44B 2PZEA 1OFIA 3C16C 2IXGA 2ZRCA 1QHXA 4KU4A 5E4FA 1UKYA 1PVOA 3SFZA 4MDFA 4NHOA 1TQ4A 3GMTA 1OF1A 4PZLA 5CLQA 4MKFA 1G41A 3L2OB 2QNRA 3JVVA 4Q47A 2V9PA 1ZP6A 3GLGE 4GSYA 4HB0A 5EQTA 3VR6A 3AVYA 2RGNA 4BFYA 2VRWA 3EASA 2ZRFA 2ZJOA 4QGAA 5J4KA 2WKQA 4QHSA 4XVQA 2XAUA 2NOAA 1KI6A 1W49A 2HEIA 3E70C 1KO7A 2QSZA 4GNKA 4E22A 2KI5A 4Q1AA 2IC5A 2G1KA 4JLMA 4OBEA 2W6JA 4EPXA 3F8TA 3BH7A 4X8HA 2RGBA 1M6NA 1HY3A 1KSGA 4PO8A 4CYMA 1NSFA 4XWAA 1Z0JA 5FBQB 3W5JA 4D0GA 1OIWA 3OFND 3KQLA 4QNMA 2OLKA 2Z83A 2OE2A 3SR0A 5B30A 3I5XA 3U3JA 3RS0A 4B3DA 5J4LA 1FTNA 1ZD9A 4CF7A 4JBWA 1FP7A 1WCV1 2YWGA 2OILA 2G9NA 4KITB 1II9A 1P73A 5B2ZA 1W0KD 4PC1A 4DCUA 2ZM5A 1II8A 2QE7D 4PC7A 2P5TB 3FFAA 3DM5A 1CRQA 4D0NA 4F91B 4TT3A 2VO1A 4Z8YA 3L0SA 3VU9B 4JSYA 3GLGA 4C4PA 1IY2A 1OH7A 1W44A 1HH4A 1GNQA 2PH1A 3R9XA 5AJWA 1UJ2A 1F2TB 3GEHA 3RSOA 2XOKD 1MRNA 1P75A 1I4LD 3KXLA 3LX5A 4Q03A 2ZRNA 1X3SA 2GCOB 4DIDA 4W9MC 3U6BA 2ZANA 3G0HA 4HAZA 3IIMA 3RS4A 2QEQA 4NONA 4NYMQ 3VX4A 5HKKA 5KDDA 2ORIA 3TW4A 5FPTA 4JKYA 4BASA 4V0KA 4MGZR 5DYGA 2VP6A 1YZGA 1Y3AA 4B74A 1P60A 4KODA 1C1YA 3RVBA 1MO5A 2H7VA 4P0TA 1E94E 2B8TA 1Z0DA 1G17A 1GOTA 3KXIA 4Q1EA 5JSZA 4IOMA 2WZQA 2J45A 4HUTA 1N6NA 3EIQA 2P6NA 2R6CA 5K8LA 3UG7A 4HSEA 1CJKC 4PPFA 1N5JA 4DCSA 3A58B 1ETUA 2BMJA 2K5UA 4OL0A 3WMFA 4BLPA 1S9DA 5CK4A 1JR3D 2UZ3A 2OT3B 3AV0B 4LX0A 2VHJA 2WVJA 3C4JA 2WJHA 1SVKA 1EFTA 4GMXA 3O8DA 5CJPA 1CRPA 2J5XA 2WSSA 3MJRA 4I4LA 1BS1A 3BFXA 3RSLA 5IDVA 4AK9A 4JBXA 3DMNA 4FINA 3TK1A 3W5IA 4K8OA 4M1OA 4LV6A 2Q21A 1SVSA 2CLSA 4DB2A 1G5TA 1NIJA 1E1QA 1UF9A 2BMEA 3C15C 1DE0A 1Z0IA 2R9VA 3AF0A 3VR4A 3VFDA 1Q1QA 3W6PA 1ZMXA 4YXWD 5KNDA 1TEVA 4AYWA 4CDGA 3DDCA 4B2LA 2RGXA 1XNJA 1ZBDA 4TSFD 4B6FA 2IS4A 1RE0A 1A1VA 1Z6YA 4HYYA 4ZPXA 2ZTSA 4L4UA 3SJBA 3K09A 2WWYA 3LA6A 3THWB 2CNWA 4HUQB 4PX9A 2R6GA 4CRWB 2ZI4A 4KSBA 4RVCA 1ZJ6A 4RKEA 4G0NA 4RD3A 1FP6A 3KJIA 5AJXA 2CXXA 2HXSA 3CRW1 3GLHA 2O8BA 2X19A 2GZHA 4LYJA 1Q3TA 2O0JA 4RKFA 2JCSA 3IEVA 4GBMA 1TMKA 1P2SA 2C03A 3NVAA 1KK2A 3K1JA 4OHYA 3U4QA 2P6RA 3SBDA 3NWJA 2GJ9A 1S4QA 2J87A 3CNNA 3S1AA 4DKXA 2ZSFA 4E07A 2RMKA 3P32A 2ZJYA 4DSOA 4OJQA 4JJZA 4QGHA 4DSNA 3PEYA 1OXTA 3NH6A 1VECA 4WOPA 3HPQA 2JLSA 4ZIRA 2ERYA 3IEUA 4B3CA 2GJSA 4NYIR 4CVNA 1L2TA 3AVVA 4LI0A 1ZM3A 1SXJA 2AN9A 3G5UA 3B85A 2FSIA 2OBLA 2C2HA 3DEFA 1CIPA 5KOYA 1K6MA 3T5GA 3ICQB 4EJSB 4BFUA 4E09A 2OESA 4AY2A 2G88A 1N0VC 1ZC3A 3DM9B 2F1JA 2G6BA 3ADKA 4NYMR 3WNBA 1SVWA 2W2VA 3GCGA 2V1UA 5F9FA 3NKVA 4A2QA 1EX6A 1W4RA 3BRWD 3QJYA 5E7MA 1NKSA 3QG1A 4FWIB 4TMXA 5CIQA 3AVUA 1SULA 2JLWA 4TL8A 4TYQA 5JJIA 1GSIA 2I1VB 2QP3A 4C0HA 3U7GA 2QBYA 2QM8A 1R5OA 5FTLA 4P4TA 1E99A 5FL7D 1XJQA 2J0UB 1P62B 4PQRA 2FPLA 2J0QA 5IK2A 3RWOA 3VX3A 1L8QA 4OI0A 2HXYA 3KQHA 2QSYA 3QVVA 1QDEA 1DOAA 1CJVC 1ZM2A 4UXHA 3Q9LA 3IQWA 3CB4A 4Q9LA 3OAAA 4H9GA 1RRPA 3AF3A 2JIZA 4LJ6A 2BJVA 3RRZA 1QHIA 1IQPA 3NBZC 1ZM9A 1T6NA 4B44A 3P4YA 1GITA 1QHNA 4B73A 1ZNXA 3NBYC 4B2IA 3P4XA 1NMZA 4D6PA 1XEFA 5JHGB 4QC2A 2N46A 3UMFA 1H8HA 1YR7A 2D4HA 2ZEJA 1LW7A 2GDJA 2Q9BA 5CLLA 5FUWA 4W7SA 3EZ6A 1NI3A 4G5RA 4OHXA 4P31A 4WA7A 3X1XA 2Z4RA 3ZVRA 1GAJA 1IBRA 4S2EA 4V0NA 3ZYCA 4MRPA 4B32A 4TWZA 2V3CC 1KTVA 4ASUD 4S35A 2C98A 2RGDA 1CTQA 2VP0A 1YRAA 3CBQA 1KO8A 3DZ8A 3EIHA 3RS2A 3MWYW 1E2KA 4FWTA 4Y0AA 2J0UA 3NIBA 1EGAA 1W2GA 1NBME 1PLLA 1XXHE 2GK7A 4XVRA 1RC8A 3H2YA 5FOUA 2F1RA 1N0WA 1LF0A 2FSGA 1U9IA 2NO1A 2AKAB 1ZNWA 4AKEA 4ASUA 3I4LA 4MYHA 1Q1ZA 1BYIA 2GAOA 5HTKA 4MGIR 1IN8A 3TGPA 3IILA 1T0HB 2XTNA 3THOA 3QENA 4QBIA 3CWQA 1WDTA 1NL3A 1WXQA 3CZPA 3QBVA 1FPMA 2GBLC 1TNDA 1KNQA 2ODEA 2CHVA 2FOLA 5CB6A 4C2UA 2KBFA 3TLXA 4G5SA 4Q7JB 3P26A 3T5DA 4BPBA 5DYIA 3H84A 1R8SA 2F7SA 3K9HA 1KYIA 3MUFA 4EAQA 1RPZA 1R7RA 1S3GA 1G9XA 1UKVY 2IHYA 2TMKA 4UNQA 2X8AA 3SOPA 1CR4A 2A5JA 3QXXA 1C4OA 1W46A 3T1OA 3A1WA 3CPEA 4KFUA 1XPRA 3X2SA 3WP0A 2ZIAA 1ZYUA 3QXCA 1BH2A 1N6IA 4FIDA 3FWYA 2BEKA 1BYUA 2GCPA 1G21E 1DAIA 4KAXA 4PC6A 3QNUA 2RHMA 3LX8A 5FL7A 5C46F 2VEDA 2GILA 2ODWA 3OESA 5AWFC 2J9RA 3LQRA 2XZLA 4N1AA 3AEZA 3IHWA 4FN5A 4QJ3A 4XVUA 3GJ0A 2PBRA 2ANCA 4FXPA 2RAPA 4XH9B 1L4UA 3WYGA 4DCVA 5FFMA 2FSHA 3ZVMA 2FFBA 5CIWA 1G7RA 3HDTA 3T1QA 1E9RA 4WZAE 2OFOA 5JBQA 1CR1A 1ZD8A 2YC2C 5EXSA 1VIYA 721PA 4BFVA 3EWAA 1OHHA 4NH0A 1T3SA 4NCKA 1ZU4A 5F3WB 4URWR 4LBWA 3BOSA 1RJ9B 2PEZA 4BFWA 4C0SA 4ITRC 1G6HA 2WAYA 2PMKA 2QPOA 1OHHD 4OK3A 4C2TA 1P72A 4M1MA 1AZSC 1Q0UA 1N6OA 3CW2A 3NXSA 4QHTA 1FL9A 4HB4A 1AIPA 1TTTA 5E3HA 1J70A 4ZIRB 4AG5A 1JR3E 1KI2A 4R2HA 2W58A 3CIOA 3K70B 1X1RA 4Q1DA 3FMFA 3TIFA 4KJZA 1FNMA 3GPLA 4Q9IA 5EXTA 2OCAA 2ZUCA 3GFPA 4O3MA 3U61B 2E1RA 2NTYC 2WWIA 4LBVA 4KYUA 5JEEA 3L8YA 5FBWB 4I1VA 4PAMA 5G40A 3VU9A 3GLGB 2AFIE 4M22A 2XB2A 3X1DA 4ARZB 2CNWD 1E98A 4LJ4A 3OIWA 1KI9A 3KFVA 5CDFA 1IN6A 3EPLA 1MR3F 2ZYUX 3DKVA 4LYAA 5KSYA 3AVXA 5J40A 4W5HA 4TSFA 4A6PA 2O0HA 5TARA 3BD9A 4RD6A 3K0AB 4YXWA 1J90A 1E9SA 1NN5A 3EX7C 3I73A 1R6BX 2ODNA 1VYTA 1E1QD 2VF7A 4NMMA 3ZJYA 4A15A 3HWSA 4AKIA 2IUUA 3TKLA 4B34A 4MRRA 2XJ9A 4DDUA 1EG7A 4HAYA 4Q4LA 4A4DA 1ZW6A 4JMPA 3GLHE 1XD8A 2QY9A 2NPFA 3EXAA 3K0FA 2G77B 2ZRJA 1JR3A 1P2TA 3RANA 2BMDA 4K46A 2A5DA 4A0FA 2QGNA 4X8MA 1DADA 1IXRC 1GVNB 1VIAA 1B0UA 1GZSA 5DI3B 4BRUA 2WM9B 3A6PC 1E0AA 4C30A 2C9CA 3AKYA 3LWNA 5JI2E 4UJ3A 3BB3A 1XJCA 1GWNA 4Q19A 3X1WA 1FOEB 2O52A 3GLIE 3ASYA 2AWNA 1RZ3A 4XOIA 2BCGY 2GK6A 621PA 5KNCA 2QENA 2PCLA 1O3YA 5FPKA 3C14C 2FU5C 2OCPA 4ZDIA 4NBSA 4M1SA 2QMEA 2B6HA 1OFUX 2O8EA 1E0JA 5HKKD 1DAKA 4CEHA 1XD9A 2H1LA 3W6OA 5TY0A 1EK0A 2F1IA 2YC4C 5JI3E 1H8HD 1R5NA 4TZ6A 2GF0A 4KV9A 5BWMA 2ZQ5A 1NVVQ 2QROA 2XOKA 4QGGA 2ZRLA 4PSVA 1UKZA 4EPYA 3DOEA 2ZJAA 3VR1A 1KK3A 2EYQA 2XTZA 3ZD7A 1IN5A 2WMNB 4NZYA 4C7OA 1NMYA 2DY1A 2EYUA 3HP1A 1VG1A 4M9XA 2JIZD 3WMEA 1UDWA 3FHTA 3VNUA 4TT3D 3OAAD 4OK6A 3UG6A 3CLVA 3PQCA 3WNDA 1RJ9A 4PTLA 1G20E 4EQ6B 3CO5A 4UXIA 1E32A 1OYWA 3K0EA 1SXJE 3HU2A 1Z8FA 5D3QA 3JVUA 3QPWA 3QXHA 1E2EA 5IK2D 3LVQE 2RH5A 5CYOA 2WAXA 4PFSA 2D3WA 3ND9A 4M2LA 4Q7KA 3Q72A 1E3MA 2ZE6A 2GA8A 2OO7A 1FMLA 2W0SA 2CHQA 2CDNA 5GJCA 2V54A 2XNSA 5EE1A 3R9WA 1NVXQ 1U8ZA 2GWHA 1SHZA 3IO3A 4LBYA 3B78A 1TUIA 5AUPB 1FNNA 2C9OA 2QAGC 2QMUA 2XX3A 5AJVB 3KZ1E 5FTKA 4YDSA 3K9GA 3U3MA 2GJ8A 3QOFA 1XZQA 4FI3C 4NE2A 4WZ6A 4GOXA 5JECA 3W3ZB 3ICEA 2QAGA 3VHLB 2PT5A 3DL0A 2R2AA 3GLFE 3UMRA 2FFQA 4HDQB 1FMJA 5FTNA 4DB4A 2X1VA 1NY5A 1J7KA 1CKEA 3X1ZA 3FGNA 3H86A 1K5GA 1SXJD 4GP6A 3UATA 5AJYA 2XXAB 5FOVA 4JLDA 1N6HA 1TU4A 4WXPA 3DMDA 4TYNA 1KO4A 2CCJA 2GAAA 2YVUA 1XDBA 3EIEA 1LTQA 4ZDWA 1FTSA 2ZRHA 2YWFA 3VR2A 4PC3A 1XU4A 4PZYA 4C0KA 5LB2A 3QE0A 5CJ2A 1SQ5A 5E95A 1CEEA 4F4CA 2VP2A 1NIPA 1XB2A 3CH4B 3GFOA 3BK7A 1ZCBA 1CXZA 4MDEA 3BXZA 3MGCA 3KJEA 5JWRA 2ODBA 1W0JD 4U5XA 5GVSA 3TSZA 2QP9X 4O0MA 3LFUA 3AUYA 4TMWA 1P2UA 5LD2C 2ZJ2A 3LV8A 2IK8A 4M21A 1KKMA 1HE8B 2B92A 2VF8A 3MMPA 4LHZA 4IXNA 2WWWA 2IWHA 1M7BA 5KPDA 1M7HA 1VKJA 3K9NA 4G5OA 2FDCA 3M0EA 3BWDD 5JCPA 3FYHA 2BDTA 4MRNA 2VBCA 4PO1A 2D2FA 1EESA 2C8VA 4DLRA 4AWXA 2PJZA 2OV2A 2CE2X 3QKSB 3U5ZB 4UQOA 3ZD6A 2A7QA 4TLDA 1F3OA 1XTSA 3GD7A 1KO5A 1N5KA 1OFHA 1CJMA 4RZUA 1VDZA 3IBGA 2YOHA 3B1YA 1QRAA 1E79A 4KSCA 2WSSD 4URVR 4Q1CA 3I3SR 2V6IA 1E2NA 1BOFA 1GKIA 4LSGA 2QN6A 1YZLA 4JT4A 2FJUA 4XSHA 4DSTA 2CVHA 4TQUS 1EX7A 4O2LA 5J4VA 3A1SA 1TF2A 5KSOA 3ADBA 3ZLJA 3V4RA 2A5FA 4PSAA 4BLQA
chains in the Genus database with same CATH superfamily
2WIJA 1L8XA 3JQAB 4GPBA 1GG9A 1D9XA 3HPRA 4YAUA 3EQ9A 2OL4A 3CVUA 2GXUA 2JW5A 1GKYA 2VPYA 4DM4A 2IU3A 1H1LA 1PNTA 1RTTA 2G8LA 3GT7A 4QPCA 1IZZA 3KEGA 3EF3A 3SSMA 4DNFA 4DMHA 7ADHA 2KQUA 1XL1A 5C4MA 3H6KA 4EHNA 3G5LA 3D2CA 1KERA 4DV2B 1VJCA 4ZVQA 1DS6A 1ODSA 3D8SA 2PRJA 3NHJA 1D2RA 1N57A 4IJUA 2JGRA 4LOAA 1EFHA 4PYMA 1BVYF 2PLRA 5B3LA 5H9WA 1J5EB 2L0XA 3K35A 4ADSG 1SWVA 2FDRA 3KPYA 2DCMA 4IX9A 5C4GB 1XMJA 2RAFA 4OKSA 2F00A 1RC1A 4QEKA 3H9CA 1LJLA 2C04A 1M1YE 3V8BA 1BO6A 2QTVB 5KNBH 4YO8A 3KR9A 1XELA 1NC3A 3SC3A 1F14A 4D79A 4O2BB 1FJGB 4YV1A 4QJIA 2PKYX 2Z95A 4JYMA 6REQA 4Z4EA 5IMBA 1WZIA 3NLLA 3C3WA 4WJZA 3EPRA 5TRTA 1PO7A 3R5HA 5DBEX 4F46A 1TUEA 5TV2A 4Y1RB 1TM2A 1TAHA 4NI5A 4V0OA 3VUFA 3GQBA 4FCWA 3MS4A 4DLNA 2CL0X 3L40A 3IR5A 1OFGA 2Q9UA 5EP4A 4JX8A 2RIPA 3FLEA 3I9MA 2OG2A 4MVJF 3V4FA 1BKDR 4QYMA 5DWDA 1Z38A 3WLFA 4D0SA 2C94A 2BGWA 3QLVA 1VFPA 3D02A 1L8LA 4L4XA 1XJWA 3GGJA 2XGGA 2GDZA 1YRBA 3S1AB 3DBRB 1BXRB 1P1FA 2OEPA 2XV1A 3AL2A 3M3HA 3R5JA 1BMFD 5U9CA 1SCQA 3EXHC 2C0CA 2DOKA 2IU6A 1J24A 3MWKA 4JZYA 3I5UA 1CV2A 4HG2A 3ACDA 5DLYA 4C89A 5L3SA 1KEVA 3Q0EA 2J9FB 4IHQA 4QATA 3EEFA 1JW9B 1LDNA 3EXHA 2AZMA 3IVMA 4HDSA 4DY4A 1SXJC 4ND8B 2P2SA 2BDEA 4I36A 1PHPA 2FZEA 4X85A 5CW2A 1K0FA 3K53A 2EBUA 5BNTA 1C8BA 2SKDA 3DQPA 1HQDA 1GNRA 2DWCA 4UDYX 2UU9B 3GJ4A 4RCYA 3PIRA 1GCOA 2ROQA 4ZO9A 2PZAA 3H13A 4QDUA 5HRAA 2X9GA 2ZI5A 3MOIA 4KLAA 1LPAB 1HYBA 5CPBA 3FGPA 1HTTA 1OBVA 5JYDA 1NOJA 1QGUA 1ZONA 3ICWA 4FDAA 1UEIA 4N3BA 1H0KA 4WECA 1NASA 3AR8A 1SUBA 1O97D 2CLDX 2YNMA 3HKEB 2I7XA 2AR0A 5K0ZA 5AKJA 3JQCA 4X3PA 3UJPA 2DPYA 2QMZA 4BO3A 1P19A 3IVAA 2PZKA 2W7TA 3EIFA 1N4AA 3SOZA 5L7WA 4AJOA 1L4GA 2E4ZA 3B9PA 3K8YA 2ZI9A 2R1TA 1CUDA 4KQ6A 1NRXA 1Z12A 1SZPA 4OSOA 3VO9A 4NMHA 2EKDA 3FFWA 2OBMA 2R1VA 1O8CA 4Q9HA 3HXMA 2G0TA 3SD7A 4PS0A 2HA3A 2OM6A 2I78A 2RB4A 1ENZA 1I10A 3F46A 5F1YA 3GVHA 2WJAA 3HGQA 4Z86A 4C21A 5K2MA 4R7TA 1GTJ1 3BD7A 2JD0A 2C29D 5A0FA 3W7BA 2VUUA 5HRUA 1OGYA 2LCFA 4LGMA 2ZXUA 3VH2A 4B6OA 4GQIA 5EJ7A 4N0EA 4CLEA 1RFLA 4N82A 5HQ3B 1LUAA 3KQWA 2ZW9A 1RYFA 4J7AA 5AJHA 1NXXA 2XNCA 3LQ4A 3T4UA 1QWOA 5E6UA 2HU7A 3ZE8A 3GFQA 1SG0A 4JLJA 1DEOA 4CQLB 1OWMA 3SJZA 1UEJA 3SI7A 3UHPA 1KNXA 2H4WA 4WESA 1WA5A 1ORHA 1SQ6A 2HXGA 5IT9A 4I1PA 2AR9A 3NC0C 3KB8A 2YHSA 1XX6A 2WKSA 3LPCA 4QL3A 3ZHOA 2CYAA 4MRMB 1V1JA 1TA4A 4NBRA 1SB9A 2OVFA 5KNBD 1RXCA 3PFFA 4MWGA 1C7QA 1QH1A 3HNOA 4EHDA 3DD5A 1K5HA 4M54A 4MX8A 5LDGA 4QUEA 3EAFA 5L45A 3P94A 4A7PA 3KVNA 4NCNA 3KPWA 4K87A 4AY4A 1K8ZB 4GI5A 1O94C 2P0YA 2XD9A 3MOSA 4HQ0A 1X3LA 2HIHA 3AHEA 3OICA 1ZL0A 3WG9A 4HLDA 3QF7A 4A36A 2IGTA 4EG3A 4UU1A 2WWXA 5BUSA 1FQOA 2PJRA 2ODAA 1P6UA 1R18A 2XEXA 4DW8A 4L8LA 3PBKA 2GYYA 3TZCA 4FQ7A 3FKSA 5KAMA 3IAXA 1Z6GA 3FJYA 5CUQA 2OMEA 2QA5A 1DKOA 4LRUA 2VLBA 3DVQX 1QMPA 2JEYA 4C76A 3HFGA 3ITDA 4JELA 3QU9A 4TMTA 3VKWA 4FDVA 4IL5A 1SUPA 1M1ZA 4F06A 1OLSA 3E9NA 4NSNA 2CN1A 3MD0A 3G9TA 4H16A 1BCRB 4L5BA 2ORWA 3U2QA 1U8YA 5IBCA 3A37A 4YVFA 4UNPA 3AKCA 2ZIEA 5JO0A 2XB4A 4EHHA 2QRPA 2YYSA 1TK3A 3M8KA 4UTOA 3ZOKA 2P6UA 3GEIA 3TMYA 3IQEA 4YJ2A 2V6MA 1JAHA 3E3AA 5A0VA 4CKBA 3C48A 4YRMA 2WE7A 2ZJZA 4LMBA 1IOZA 5CA0B 2RK6A 3EG9A 1W2HA 3C8MA 3ESZA 4JVMA 1PHRA 4MWBA 4TTAA 3ED1A 3FNEA 4P2GA 3UW3A 2RD2A 2WP8J 2V0NA 4HB3A 4NXMB 3MTIA 1W36D 1MAUA 1OX4A 1RJGA 4QOHA 4OVKA 3N0VA 5MFPA 3KS9A 4GR9A 2J0EA 4R8KA 5TVKA 1CIJA 2ZYTX 4M0LA 3V7YA 3ES9A 5KEIA 2PV7A 2PAFA 2ES4A 4HUQA 4LI3X 3FJOA 2PKWA 1A96A 3K8QA 3ZI7A 3KRTA 4XVRA 2CNNA 3HHPA 3HZHA 5ESWA 1LV7A 1WB6A 1W5BA 2ADOA 1B8NA 4FGWA 5CT6A 1X80A 1ACLA 1EVYA 2QRUA 1NJ1A 4PYKA 4JLKA 2BRUA 5EZ6B 5H3LA 5SZHB 2ZDHA 1G9SA 2EW1A 2XKBA 5K6RA 1ZKMA 1LH0A 2OR3A 1D8TA 4L8VA 4RPGA 3TTSA 1Q7RA 5BNIA 1ZDMA 2Q3DA 3MJSA 4PPNA 3ICCA 3W4IA 2AZXA 1BWRA 1SXPA 1ODKA 2ZUUA 2RHJA 2EU8A 1LTKA 2H48A 3DKPA 3FHJA 1NQTA 3R0VA 3LLUA 4RE6A 5A1TA 4GZ6A 1EUYA 1BFUA 6Q21A 5HR5A 5IFLA 1WB4A 2BBTA 2O8VA 4Q4JB 4AG6A 2WF7A 3CONA 1JA0A 4YHBA 3UN1A 3PC3A 1HFEL 1YQQA 1CLEA 2X23A 3LDAA 3FTCA 4RVHA 1YQUA 2RGGA 1R6VA 2ACWA 4YRFA 4GE3A 3V9PA 2FR8A 2EXXA 4QICA 1GN9A 1RAIA 4DLWA 1L7VC 4D9MA 2IOFA 2QTAA 3M9XA 1EVLA 2W6NA 1X1SA 4XGIA 1T3LA 4QGSA 2PUGA 1DHRA 3BIFA 3E8SA 3CLSC 3HZOA 1N2EA 3NTOA 1XWFA 8OHMA 1TCCA 3H5NA 3SMVA 1NW3A 4MI9A 2KE5A 3ILYA 1DIOB 2G5GX 2C96A 2ZRAA 4K3VA 1IDN1 4Y2TA 4UAJA 4UCWA 3KFXA 1Z7WA 5AO9A 4L3WA 1R1DA 4X7PA 4KFCA 4XWYA 1DC4A 2Q7XA 2WOOA 3HR8A 1V0JA 1KVSA 4NJMB 2UYQA 2A7XA 4YIKA 1EYZA 2Q07A 3TINA 1GFIA 2AA3A 3GPDG 1WJGA 2C97A 2HV8A 4IXTA 4B4DA 1L5WA 1K06A 4I1RA 1Z47A 3UB2A 3EC2A 1Z6AA 3C7DB 1RNLA 3AUTA 3AR2A 3BICA 1I4TD 1U11A 1WNFA 3A0UA 3DLAA 3L8FA 4BO9A 3M3PA 4QKQA 3IUSA 4PINA 1QANA 1OLOA 3NS7A 4IIHA 5TC4A 1K8YB 2C0QA 5CLHA 2VQSA 4TTSA 4OKIA 2XVXA 4W4TA 4C4TA 4JL6A 5CFQA 3OZ7A 2ZYVX 3DMPA 4WZAB 1V1RA 3L1VA 2TECE 5NULA 1F7UA 3DVLA 4P80A 3AFNA 4JASB 3Q98A 4I55A 3AG5A 2XYRA 1WY5A 1UODA 4HNSA 4PCVA 5CCBA 3U7JA 2OCBA 4GOMD 3STTA 4NQZA 1UPCA 5ECYA 4C1BA 5TGTA 1FVXA 4GLLA 2IEBA 1X8JA 3MWDB 4D3DA 1F9AA 5EKUA 2YVAA 2AOTA 1E7RA 1IJBA 1JB1A 2RGNC 4L50A 1NKTA 2FAXA 1T5IA 1SUDA 3L01A 3L0PA 4QE3A 4TKUA 2QBYB 3ZCUA 2WWTA 3BRQA 3DZIA 1PZHA 1WM1A 5GZ1A 1XCPA 4YMWA 1NAHA 5MF6A 1E6CA 3FYUC 1PZGA 2YYYA 2Q3MA 1CJTC 3E0XA 1K63A 1K92A 1E6KA 1W5EA 2YHIB 3CR8A 4FE7A 4MQBA 1X1DA 3WYFA 4CEIA 3PEUA 4Q3KA 2EFCB 4OPMA 2CL6X 4BE7B 2QF7A 3CFYA 3D6MA 3I58A 3GY0A 3ZV7A 3R5KA 2A0WA 4BKMA 3C39A 4BVAA 4JB2A 5IP5A 1M2EA 3NEJA 2QTBA 1B76A 1YA8A 2GI4A 2JKVA 4X1KB 1MT0A 1KO1A 2CNLA 3SQMA 4YMHA 2E3JA 1N6LA 2W6IA 3CM0A 4TLCA 1AQJA 3THYB 3TQIA 2H2GA 2Z1NA 3EBPA 4BO7A 1X1EA 4Q4DA 4UM9D 4TMKA 3S40A 3U31A 3QU2A 1QFXA 2Q8PA 3IA2A 4FQ8A 4PSKA 5DH9A 5FBKA 1AHHA 3ORQA 1U28A 1R27A 1V71A 4JJ8A 5DASA 5J1TB 5ES3A 5T3YA 2ERXA 2NTVA 1BX3A 2PMBA 2X6RA 3AKEA 1QG4A 3NUZA 2H8GA 3O8NA 3OJXA 4IJVA 1Y3CE 1CUCA 1EAYA 2LNDA 3P9NA 4UDXX 4W5WA 2W2KA 5F33A 5HOEA 3BIXA 4IQ0A 1M1YB 4A0QA 1XUOA 4IILA 3WMGA 2FN9A 1Y4AE 1JZTA 2HX1A 4D8TA 1QZUA 2XBLA 1QPBA 3PGVA 4NTZA 2GPAA 3IQFA 4IXMA 1HETA 1V5EA 3NEPX 3LU1A 4JYCA 1E3TA 2FNAA 2MSDB 4YUAA 3MQ2A 2V8BA 2WUEA 4L15A 2NO7A 5E6SB 3UWOA 1TM7E 2WJ6A 3JZFA 5TF0A 3VJKA 1NW8A 4WKGA 1Y42X 5A9TA 1M2KA 2JJ1A 3ZWBA 2H1OA 4H4CA 1JT2A 1Q0LA 1S8NA 3N1UA 3N2YA 1QF7A 2HFJA 4I6GA 4XUEA 4MMZB 2BBWA 4N7JA 2PLFA 1Y6RA 2Z0MA 4BRZA 2X2EA 3N0XA 4RZIA 1JU9A 1TYDE 2OZEA 5IHPA 1JJFA 2DHDA 3UPUA 2O54A 5TQ2B 2C31A 2XRMA 3R8CA 3PUHA 2IUSA 4IGFA 4UCQA 3K4PA 5CITA 1T5BA 1U3UA 1HKUA 1G20A 1X9HA 1XMIA 4ESOA 4LY3A 5H16A 1CUXA 4C0AC 1W9MA 1HFJA 4GMKA 4P35A 1L7PA 3ILSA 1WVGA 5D01A 1PNOA 4FGUA 5IXYA 1GTVA 5CXXA 4Z6KA 1RQPA 3SDZA 4CTJA 4JOSA 5IAAA 1DKQA 2DFLA 4UC0A 2BFFB 1ZWLA 1EUCA 1KVUA 2IXEA 2QTHA 3LW8A 2FK7A 3NTQA 4K9QA 1RQGA 3OFKA 4ND1A 1LDGA 1VP3A 3L6RA 3AIOA 4ICIA 1ZWKA 2JFHA 4IDFA 2XTMA 4BJ1A 3DHEA 4G65A 1TD1A 4R2IA 3MRSA 2BEUB 5EWMB 5HPYB 3FAZA 2VT7A 3L7NA 3QX3A 2B0JA 1K8QA 2NO6A 3CLSD 3G5AA 4PIVA 3W6UA 4LYFA 2JGKA 1L7XA 2D00A 5H1YA 3U1VA 3MMXA 4D82A 3L4SO 5AM2A 3WB0A 3QQ5A 3OFVA 4POAA 1YS2X 5F2KA 5B1DA 1NV8A 1WLSA 2XCLA 2OZVA 4E32A 1U1CA 2GXSA 4Z9BA 1T8SA 4R1OA 3EBLA 1K7XB 2HADA 4N7MA 3JSAA 1Z9BA 5AVSA 2R8RA 4RVFA 3SYKA 3TIXB 4CMIA 2Q8QA 2NXEA 4R6WA 1T91A 4JLOA 1ISFA 1T0IA 2RHLA 1EUZA 2CLOB 1ZIPA 3KOOA 1JDSA 5CDTA 5IZ4A 2LUOA 4N0QA 4ZARA 1SCIA 3G2IA 1E3IA 2IELA 1U3GA 4URZR 2GFIA 1U04A 1FUYB 1RI3A 2LIPA 5BWLA 4MQ4A 4ILEA 4MR7B 1C0KA 4IP0A 3A3KA 4S1WA 1AS2A 2EF0A 4KDEA 4OSEA 3QMMA 3E8MA 1X1BA 4WASA 4QXAA 5BRNA 2BV3A 2YMMA 4EQ6A 1N5RA 5G0SA 1CQJB 1I2ZA 3KKEA 5ALXA 3JZAA 4G85A 2WEKA 2P3SA 2VWQA 1EFLA 2PEYA 1N3BA 2VN8A 2UZAA 3KQPA 3U3DA 1MJNA 5L3ZA 4HDNA 1M2WA 2JPDA 3COZA 4L0MA 2YWEA 8GPBA 1YKGA 3OWOA 4BGUA 4ZAGA 1QRSA 3NORA 1UAAA 3O9ZA 4EENA 1EFCA 4JUDX 3KTDA 2VZ8A 4PQGA 1JH9A 4D8VA 4GYYA 4IEIA 1PU2A 4EY8A 3H2SA 5F4BA 3ZDDA 1C30A 3I45A 4DXHA 1ZFNA 2PZGA 4LHWA 1O6FA 1GP2A 4BNZA 1M74A 1RC0A 3S6JA 4IICA 5EMMA 2VH2A 2PXAA 4BEJA 4D44A 1UOEA 3M1IA 4UAGA 3MJEA 1EDEA 1XCMA 3SX0A 5HGXA 3Q2IA 3KM0A 2DWQA 1B3RA 4EW2A 2JI4A 3EFBA 3VJRA 1P3JA 2V65A 2SKEA 4P98A 1H66A 3SF8A 1KOGA 2UXDB 3VSEA 1J23A 1DOZA 1L4MA 1WEHA 4I55B 5EQFA 4YPFA 4UTXA 4E5VA 5IKPA 1JXMA 1K2WA 1YB1A 1XCJA 3WY9A 1WMFA 2HLPA 1KSJA 4ZYYA 1M34B 1OBHA 3F1LA 4DQ0A 3UFXB 4CU2A 3V8EA 2QLLA 2H85A 3L43A 1L5ZA 2WE8A 2AX3A 1XEXA 3F0TA 3N3AC 1Z08A 1AZTA 1KK1A 4ER5A 1L7QA 4LX8A 1Q95A 4M88A 1KI6B 2B69A 3W9BA 2Z6UA 2O8CA 2VJLA 2VJBA 2REOA 4J0HA 1B41A 3QPUA 2C2WA 3AF1A 1VL0A 3AMVA 2GYUA 3LXUX 3TBFA 4Z3KA 3ONWA 1PFYA 2P62A 3FRHA 3UQYS 3AF6A 1Y5RA 2O2JA 4E2ZA 1KZ1A 4YMIA 1N25A 3D4LA 4RX1A 3U16A 1UKEA 3TLGB 2VYFA 3AF4A 2HBQA 2OMKA 3BT7A 2VK2A 3D4PA 3LQQA 3CCFA 2OGZA 2V3WA 5G3YA 1YR9A 4RZHA 1G42A 2Y77A 1TIBA 2L69A 5DYYA 1I36A 4QGFA 5CURA 1P17A 3ZHBA 4EA9A 4RV4A 5C81A 4P92A 4KVAA 3EYWA 1I0ZA 3GZ4A 2HMYB 2QQGA 2XZLA 3PDJA 1BU5A 2JEOA 1DVRA 4K03A 1WSAA 5L51A 4J9VA 2CUNA 4RDIA 1XEWX 3LUAA 1Y1LA 5E4TA 4Z7NB 1IPEA 1TCBA 3JQ7A 3ORYA 4IEEA 2Q1UA 1H22A 3LK7A 4IDOA 3L3BA 4LV5B 4LGYA 5IW8A 4RJLA 3RC2A 3NUQA 3ANLA 4FBMA 3U4HA 3R3VA 3SEAA 5JSZB 3ECCA 2A1UB 3CJTA 3DDNA 1DUVG 3O7MA 4MPRA 1Q0PA 5TMDA 4UCXA 4BJ3A 4BFZA 4J49A 2PGJA 4FLFA 4DSAA 1PE0A 3BSYA 3O6VA 5JMPA 2C07A 1ULZA 2DHCA 1JDJA 3IVGA 3IAEA 2OCKA 2C7PA 2AW5A 2AEEA 4TV8B 4WZBE 4JBIA 2Z4SA 1N78A 2GBGA 4P58A 5FHQA 3DB1A 4L8WB 1OZFA 5BSFA 1P2VA 1BGXT 3V4ZA 1PN3A 2B4AA 4O2RA 1YBAA 4NICA 4M0EA 4UBJA 4F8JA 5AW1A 1E4EB 5M5BA 3C5EA 1ZJ5A 1NHGA 1DQPA 1ZW1A 3BE4A 3GGDA 4PX2A 1FSGA 2IHJA 4Q3LA 1KDZA 3TL3A 4QZVA 4YHHB 3TJZA 1XHEA 1V4VA 1YFKA 4EHIA 1KFBB 2LGJA 3G5TA 4DUGD 1XTTA 3V00A 1RKBA 4IH1A 3VV2A 5LMNB 4OB8A 4B3BA 1J33A 1D9ZA 1O7JA 1R4NA 2QRKA 1PI3A 2GM5A 2RGCA 2WUDA 2YRXA 1LD3A 4GMDA 3SLRA 2HH9A 2XADA 5FWXA 3Q12A 3IUBA 2A9QA 3K1AB 2UVQA 3IDSA 1G8GA 2J9GA 5AVUA 2DFKB 3WQSB 3H8WA 4WN3A 3WGVA 2QJFA 1UZMA 4PLGA 1AA9A 1X70A 4HN2A 1KPGA 2FWMX 3A4MA 4UHHA 1GGFA 3AUAA 3W90A 3WMWA 4H1WA 3OFJA 3I92A 4Q1BA 4U7TB 4CM9A 2MDTA 1ORDA 4FHGA 2DQYA 2W2QA 1ZGJA 3FYSA 4KFRA 4QBKA 4EKYA 3JQBA 3RVMA 1UFQA 1WU7A 3FCEA 3GLIA 1FFXA 2Z2ZA 1JH8A 5IWAB 2R7MA 3VTKA 2AN5A 4L8GA 4B84A 1EFAA 5FB3A 4YONB 1G8MA 3R5SA 2BCJQ 4CIWA 2BHNA 3AGQA 3I1FA 4QBTA 4ZCQA 3S1SA 2BONA 1ZCAA 4DGQA 4YPVA 1MV5A 2D06A 3KQTA 3TQHA 5ELLA 2ZBUA 3SJAA 3ZI0A 2JS7A 3HKEA 5DIFA 4TQ9A 1XDZA 1U80A 4BDSA 3VU8A 2W9XA 1E3EA 5EE0A 4ZAYA 4BCDA 2P2YA 1XLWA 3FUUA 2VRCD 5IU6A 1BD3A 4EM6A 221PA 1TW2A 2LKDA 3FDIA 3O8QB 1RXIA 2WFAA 3P27A 4CBVA 2Y1GA 2GVNA 3LH5A 2VCEA 3B7PA 1ZINA 5C5CA 5L3QB 1XJ0A 5FT9A 1AHIA 3QBDA 2B37A 3SK0A 3UPDA 1R00A 2ZZMA 2XGJA 3B5EA 3I5YA 2OLJA 1N0HA 3CX7A 4RSHA 3DYIA 2GPSA 3MA0A 3UKJA 4EVSA 2VSOA 4F56A 2HFKA 3T9FA 5H3CA 5TQJA 3QF4B 4WV3A 1KS9A 2B99A 1M1NA 3LY7A 5IUKC 2Z2KA 1OIVA 1G6Q1 4C4OA 4LAFA 4BFTA 1T2NA 5IN5A 3AOEC 4L9AA 1HGXA 5JWOA 2JDID 4XDGA 5HE8A 3D1LA 1NU6A 1NMXA 1QF9A 1PD1A 4FW8A 3HKDA 4MDYA 1W93A 2D0IA 3AI7A 1GGEA 1OLUB 1OREA 4Y2UA 4E2XA 3WLKX 3ZV3A 5AVWA 5KCZA 3HXOA 1HFWA 2R751 3ON5A 2H06A 4KACA 1US8B 4TZKA 5KS2A 2FUKA 2FY8A 2LIVA 3EGXA 3G82C 1CY8A 2AHRA 1Z4IA 4J7XA 3A6DA 2NX2A 3UENA 1D2CA 3V7UA 3LUHA 2JJMA 4ON9A 3K1TA 4GGPA 1GKKA 3DFUA 3L8MA 4JUCA 3I05A 3AC0A 3SQDA 1H0RA 1U1IA 2OKGA 2LRHA 521PA 2RARA 1TQ8A 4HNQA 2GBIA 4CEJA 3RRMA 4XDZA 3DKIA 3HCOA 3Q41A 3G8YA 4LYYA 1PQUA 4C88A 1JQDA 1Z4JA 3IPXA 4J2HA 2ZDQA 4Y2VA 3TNDA 5H59A 3W3AD 4FYMA 3P0RA 2RI0A 4E7PA 3KDPA 3EGDA 2RK4A 2BSAA 2W70A 3QXJA 4REQB 4GL2A 1R8QA 4RK5A 1MPTA 3EVZA 2PQ0A 3ISVA 4BFCA 4TYMA 1NZDA 2BUBA 4LDJA 1ZD1A 4FC6A 4YLYA 4KPUB 4GX5A 3GZNB 4IIYA 2FPWA 2CJYA 3V4LA 5JZMA 3HB5X 2L17A 1EM8B 4ML3A 3LRPA 1QX4A 4HGQA 3T15A 3B1VA 4CV0A 1E18A 3A1UA 4D0LB 4QG7A 3WGUA 3JATA 3PUWA 4D6YA 3QLJA 4EL5A 4AICA 3PDIB 4X6YA 4PRZA 1R2QA 3WFJA 4D74A 3RIMA 1T0PA 3JQ8A 1YVDA 4EPVA 3VA7A 4R8LA 5YASA 4YYEA 3F96A 4XWWA 4QARA 3WIEA 2QMOA 2GPBA 3F47A 1FX0A 3OPVA 1JIQA 4N3NA 4WH0A 2NV0A 5AI6A 3T7AA 2VHXA 4ND3A 2PLNA 1KAHA 1YCDA 1L7OA 3ZGOA 4KO1S 3UV3A 4KE9A 2PUAA 3DZDA 2P4SA 5KKAA 1Z63A 1S2MA 1YZUA 5JJLA 1ATIA 1JDPA 1UM9A 3HKBA 5SY9A 1E2PA 2NXCA 2G63A 1DNPA 1EM6A 2P5YA 2QXUA 4DCTA 3DHWC 2QZSA 2WJPA 1Z5NA 2P35A 3PNQA 4EKEA 3GFVA 4AY5A 1FZQA 1PJLA 4YUVA 2INGX 4RO0A 1B73A 3QKSA 4II3A 4ZKEA 3RVQA 1RHQA 1FTQA 1E4VA 4IIDA 3AJRA 2VHTA 2X8WA 3OZFA 4YQFA 1ZR2A 5D8DA 3RAGA 3RS5A 3FOFC 1OPXA 2Y71A 3SJUA 5KHLB 1NLZA 2QLFA 5BW8A 3ZE2B 1OYOA 2WU1A 2XUKA 2PCJA 3BQMB 5ALHA 1YHNA 4F2WA 1KU0A 1Z82A 3LFTA 4R84A 1YJ8A 5A02A 3T94A 5IJWA 1PYDA 2EFGA 2OQIA 4RK4A 3IB6A 5LA6F 4KLZA 3LDUA 1HT0A 1T1EA 4KQGA 1T4BA 1BMQA 1PSWA 2CFOA 4PLWA 3AOEA 5LQDA 2C7VA 2LBPA 3I9OA 3DOJA 1P4SA 5G3ZA 1CK4A 1QOQB 2P5UA 7AT1A 3QBJA 4FGKA 5B7PA 3EUEA 4YGYA 5DXJA 3PP8A 4AROA 1H9BA 4JYAB 2EG9A 1AKMA 2AZTA 4J1QA 4KNYA 4LRQA 3K0SA 1EEXB 5AK6A 3W1VA 5KUTA 3AB8A 3ODGA 1MO3A 2M32A 3OIVA 4P86A 2BIFA 1VRVA 4BZQA 1YIAA 1W6RA 4LGCA 5F9MA 5DV9A 1OX4B 2PM8A 2VPIA 4J43A 5CX4A 2B4QA 3RGWS 5I8ZA 3ROXA 1CF9A 3DUFB 3H6HA 4R3WA 4EF6A 1CSEE 2GNOA 4NDZA 2DMRA 2V0CA 3H1PA 4CIDA 1Y9ZA 2WVHA 1B00A 1M5TA 4P5DA 2BGGA 4RK0A 1N5IA 4CHGA 5BW5A 4ZDJA 1RP1A 1QRDA 2ZQZA 4Q00A 2QMQA 2Q0QA 1CX9B 1A2KC 5BN3B 2EX1A 2X5OA 2DFNA 1JWLA 5EXXA 2VYQA 4ISCA 2NG1A 3ZK9A 3GP8A 3B6EA 4FCCA 3UJCA 3AUXA 4F11A 1MHPA 2ZS7A 2O7SA 2ZDGA 4JFAA 4NAHA 5IYZB 1GSHA 2WD9A 3PHGA 5F64A 2PNJA 2D2XA 3VO1A 3WSWA 4DA7A 4ZO8A 2QRGA 1P74A 1NJ2A 3KLNA 4DTIA 3CSDA 1LGYA 5KO2A 3W6NA 1TCUA 1C9MA 2BT4A 4UHDA 1PK9A 4B3FX 4CZ2A 4DR6B 4ND5A 4RSGA 4BYMA 5BSTA 2JHGA 1F4LA 3HM9A 2KYRA 4MW7A 2G9RA 4HWSA 2OHOA 4BB9A 3FSRA 1L5SA 4FK8A 3TOSA 2F6RA 4YEDA 2DYKA 1T36A 2C2GA 1B23P 2AVNA 3B2QA 1DELA 4ARZA 1Q5PA 3HCDA 1MB4A 2DERA 1LQ2A 3LNCA 3PIDA 1X6VA 4MUEA 3TOXA 1I9CA 2HSZA 1RWKA 2WIKA 3LTEA 3IIJA 3OJLA 4J4HA 1T4CB 4AU1A 1U2SA 3DZHA 3WLIA 3UH1A 1YS4A 2ETXA 3FUXA 2O8FA 3PUZA 4F8EA 1YOVB 3IVRA 2PT7A 5T41A 3UO8B 1UBTS 4B33A 1TD9A 2VF2A 2VWGA 1ZGZA 2E82A 3WIVA 2PXXA 1RT9A 2QM3A 2FPGB 3FZYA 4LN1A 5K0GA 1WLYA 3DUWA 2CY0A 2IZ0A 3GJSA 4KH0A 5SYAA 3K92A 5JNWA 3NDPA 1UFOA 2OB1A 1JJIA 1MOPA 1RM4A 4OHBA 4UNRA 4FPXA 4YRIA 4MK4A 4F9FA 3OD1A 1RYHA 2J3MA 5LYJB 2Q3EA 3GG2A 3K73O 4X54A 2V1XA 5AUQA 1U0LA 2BGJA 5ICCA 1VZ2A 3KIPA 4B6FA 1NLYA 3C3JA 3BE5A 4B2PA 1G2PA 5FJJA 1FSPA 2BAGA 1VPLA 2H51A 3IEMA 4BQRA 3TM4A 3QLTA 1Z73A 2R85A 4YMSA 1BTOA 1W47A 4H08A 5U1PA 4L02A 2JK1A 3U7RA 5HHTA 1VSTA 3MSCA 2VHCA 3U1BA 1EINA 2BC9A 4ZVSA 2GOYA 5LD2B 1OTYA 2H2DA 3PC7A 4A6XA 1AHNA 1T1GA 2ORVA 3ROFA 2QQEA 4PHGA 1A7KA 4UUBA 5FR2A 4NF2A 1FXWA 5F12A 4IYJA 1IZ7A 3G02A 1MB2A 4OKNA 4B3JA 4ZV4A 1WZ2A 3KZNA 3LLMA 4PU0A 3W7AA 1XQVA 4TWBA 3R5TA 5AUOB 3FTDA 4AJEA 3V4VB 3MWDA 2PD6A 2ZWMA 5LBIA 2ZYHA 3ND7A 1PL6A 3ZZMA 4UBIA 4BMYA 1EP9A 3ZQ4A 3W5BA 3O8OB 4CEHB 3OLZA 3GJZA 5HVNA 1ZKDA 4LXQA 4AQDA 3RVLA 3SX2A 4PZ0A 3KL2A 2BM0A 2E2WA 3JTMA 3UFXA 4ED9A 5BR7A 4RTKA 1BDHA 4G23A 1EWVA 5K8TA 2FX3A 5AKIA 1DBQA 3CNQS 3OE4A 2G72A 2IH5A 3QEJA 4TPKA 1DG9A 2NU7B 4AI6A 4FYKA 3VDRA 1CFJA 4LPKA 5JCXA 4EAAA 2I03A 5BV0A 3BGSA 1E2IA 1TEXA 2EZ4A 5LB4A 3GR6A 3OT5A 4D2IA 4TN5A 1A0OA 2PLWA 4PYRA 3DVAB 1OXVA 2ZETA 5I5EA 1FNBA 2KSQA 3AQIA 3LXXA 1CLUA 3C74A 5E0OA 5JLAA 1W8DA 5LM3A 2O2GA 1UXKA 1S02A 4NU8X 3REQB 4AECA 4BNNA 1OQAA 1QPZA 3RYIA 5SZJA 3WV4A 1TJ3A 1YKFA 1KY2A 2GXQA 2IEYA 3EOAI 3HCNA 3PL1A 4I3GA 4PZDA 4XA8A 1V47A 4F2HA 3CURA 3JARB 1A5SB 2ISSD 4O4JB 1GG8A 2I2DA 1CUYA 2E5WA 1LBTA 4C9BA 5ITZA 4J7CA 2BKAA 5J9FA 4JJKA 3V32A 1PRYA 2IZOA 2M1ZA 2WSIA 3EQ7A 2YXDA 4YJFB 1Q77A 3BTOA 1FS4A 3CH7A 1QG0A 2G25A 3PYLA 2NO0A 3KK0A 4NECA 1E1KA 4EYOA 5BYKA 3MUEA 4JLBA 4KWCA 3ZZTA 4BFXA 5IFKA 1AGNA 4ZQGA 2CXSA 5EFOA 5JDCC 4S2UA 4FLEA 2WJVA 1JLHA 5B1IA 4OB6A 2WDZA 1F20A 4X97A 1P1IA 4EHJA 1GY8A 3SC2A 1HLDA 4U2EA 3SE7A 4RJJA 4HFRA 3EVGA 2EBWA 5LMUB 3VZDA 1VCIA 1QHHB 4FR2A 1WCIA 1C9EA 1KZGB 3C1AA 2VL7A 4AUMA 3P52A 1XMVA 2RHTA 4BAZA 4F6LA 4QD3A 1J0BA 4U7DA 3VKGA 1ULHA 3QEOA 1EWRA 2XSZD 3KKQA 1EVQA 2CMFA 3HKCA 4JJFA 1ODLA 3DVAA 1QRTA 4U6QA 1KR2A 4E4YA 3E9QA 4GP9A 3DD1A 4KWIA 1OFVA 2JHAA 2ECFA 4GD3Q 2RH9B 2WY2D 1KS2A 3RVSA 1RRGA 1UP7A 3U4QB 3ESRA 1U0HC 3WGJA 1QQTA 3HJNA 1AOXA 3JZDA 2XR1A 4JD5A 4YRRA 1DBWA 1YTLA 1THGA 3CKLA 2JLXA 2AKEA 4IDNA 4Q4HB 4EA7A 2BMFA 2WBLC 2ZIVB 5DSZA 2YDXA 3T3IA 1VQ1A 1QP0A 4RCZA 3RRXA 1L4BA 4ZTBA 3KTAA 4JI3B 1OC4A 3LXMA 2G4CA 4DDKA 3HVJA 3D5TA 1L4EA 1LZLA 1DEKA 2X9LA 2J0SA 2UUBB 2E1PA 4W1QA 4C7VA 1PFQA 5B3KA 1ZHFA 4WKCA 3RKRA 5JFGA 4UUMA 2IPLA 3AR5A 5E8JA 3PA8A 3DG9A 4KTTE 3IOBA 2C3YA 3CPSA 5EP1A 2K4MA 4QFMA 1MLDA 2ALJA 4R2KA 3UM9A 4DREA 1KRXA 2P9TA 5JC1A 2OGTA 2H29A 1XTJA 4RQTA 4M9SA 2ZBEA 5TX7A 3W2FA 3OWHA 4DCCA 1E2JA 1MABB 2DWOA 3MOGA 2JCBA 4K26A 5ENDA 3EDRA 3ZPXA 2ZVQX 3WLTA 4C7XA 1JHQA 1GAEO 4XXHA 5DLQC 4ZMBA 3E4CA 4AS1A 2SHKA 3ZCXA 4OQXA 1AUVA 1GVHA 4WNAA 5D1HA 3FVRA 2QORA 4AFNA 4ER7A 1MZPA 3WKAA 3QXSA 4NENB 3QVUA 1XJ5A 1RI4A 2IYVA 5DNDA 4MAAA 1A76A 3PEWA 3ZGVA 4KAJA 1PT7A 1PJ3A 1RKXA 4FUQA 2R86A 3OTHA 4I99A 4A0GA 3IAM1 4NBTA 4R2LA 4YTEA 4C3ZA 3SZ3A 5C5EA 2BTQA 2EJCA 3O03A 4E4RA 4LNUB 4QU8A 3AJEA 1G8HA 4NZ9A 4F8YA 1SKYE 3Q8MA 4X94A 5DHSA 4A9AA 2D59A 3DKRA 2V7VA 4L5YA 1IN4A 4QJ5A 1HE5A 1JU3A 1B4DA 4KQ9A 3BULA 4AZ0A 4PLFA 3ZS8A 4IVRA 1U3FA 3DONA 1CP2A 1NDQA 3B3AA 1U81A 2J3IA 3OOHA 2VBIA 4HVAA 1NRWA 2WSMA 1ONOA 1RM0A 2BEWB 3IFSA 3JALA 2G76A 4MEBA 3HNRA 3FM9A 2B30A 4CLOB 2C2ZA 4DTCA 2AUTA 1WB9A 5AKYA 2O5VA 2IJGX 4NABA 4V24A 5AXDA 1XZPA 1KAQA 3CNOA 3N70A 2GZSA 5DVZA 1V7ZA 5JXWA 5ADVA 3U4IA 4BJ5A 4ND4A 2YYAA 3NYRA 1GUBA 3L0IB 4NCAA 1HEIA 1MO4A 4QSHA 2XW6A 4C43A 2PKXA 1TQ2A 4XUCA 1XKQA 3RIXA 2GESA 1YS6A 3ZD8A 1WP4A 1XF1A 4IIBA 4JNCA 5I48A 4DDWA 4NMLA 3MC1A 1E1RA 2O3QA 2XUDA 3D3WA 4B71A 1G19A 4FEGA 4Q3DA 3OCUA 3OQIA 1NXOA 5F7JA 2B2NA 2G06A 1W1WA 4B6EA 4NHEA 3L5OA 4R1MA 2FEOA 4RQAA 2JRLA 3RUDA 4B35A 4EABA 4KIWA 1W48A 4OP2A 2CB9A 3V8PA 2DKFA 1VTKA 2H11A 4E31A 2GK3A 2I3AA 4HDRA 5LP6A 1PUIA 3HRHA 3ZXYA 2QUHA 1DV2A 2H31A 5BQ3A 3BGWA 3F97A 5KOJB 3NEYA 2WKPA 1WE2A