2YC4C

Intraflagellar transport complex 25-27 from chlamydomonas
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
198
structure length
177
Chain Sequence
KPIDITATLRCKVAVVGEATVGKSALISMFTSVVAPVTIPDTTVSVELFLLDTAGSDLYKEQISQYWNGVYYAILVFDVSSMESFESCKAWFELLKSARPDRERPLRAVLVANKPPQRHQVRLDMAQDWATTNTLDFFDVSNPPGKDADAPFLSIATTFYRNYEDKVAAFQDACRNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTRAFLAGELLAR TRANSPORT PROTEIN 25
publication title Crystal Structure of the Intraflagellar Transport Complex 25/27.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Transport protein
total genus 52
structure length 177
sequence length 198
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2yc4C00
3BOSA 2BCJQ 3WMFA 1CU1A 3TSZA 3I62A 4WIAA 3WHKA 4BLRA 1XPUA 1VECA 2GKSA 3LXXA 2H16A 2ZYWX 2XXAB 3RC8A 4UJ3A 3W34A 2IEYA 3LBIA 1J7KA 3FYHA 1Q57A 4ARZB 4LJ6A 5FBRB 3TKLA 2H17A 2RGGA 4B2PA 1KYIA 2FGKA 4JIMA 2ONJA 3QPUA 1NBMA 1XEXA 2FDCA 4M21A 1NN1A 5A4JA 3OZXA 4EPWA 3PVSA 2B7CA 3M0EA 4QJ3A 2GVDC 4GPTA 2C78A 1G7SA 3X2SA 4BRWA 2A7QA 4LBWA 2WJVA 5HZHA 4KFRA 3VR6A 3LX8A 3V4RA 1U8AA 1FW6A 1U0LA 3MAAC 4AY2A 1QZXA 4MKGA 1R10A 4Q1BA 5KPDA 1FUKA 3T06B 2ORIA 4LZZA 1RRPA 1PZNA 5D3MA 4HB3A 4JYCA 3KQKA 4A9AA 3B7GA 4O25A 5JRJA 2ERXA 2J7KA 3SR0A 3HWSA 2ZANA 2R6GA 1XRJA 2ZSAA 3W8RA 4JMPA 5CB8A 4HUQB 3B85A 1NVUQ 5K8IA 2BBSA 2VHJA 4W7SA 1KY2A 1QVRA 1MRSA 3AKCA 2OILA 3VNUA 1FNMA 4EFLA 3GJ7A 3QQ5A 2GJAA 5FR2A 4WZAE 3BFKA 3EW9A 2G88A 3VU9B 1DO0A 5DI9A 4EAQA 2WV9A 4YQFA 2XX3A 4U7DA 1XMJA 1P3JA 3U5ZB 1CRQA 2EFEB 4DCTA 3GFPA 2HT6A 2FSGA 5DN6A 3L0PA 4B3BA 2OUKA 1X1SA 2ZYUX 2QG6A 2HXYA 4DSTA 2ZAMA 1H8HD 1TUIA 2CL7X 2OT3B 3C16C 2XZPA 3VFDA 4E09A 1N5KA 3TVDA 3NBXX 3GFOA 3RRNA 2IYSA 1HV8A 2IS2A 3EX7C 2HUPA 1W46A 1CKEA 5JWHA 2IF0A 4S2EA 4RCYA 4NCHA 3ADBA 4OI2A 4PSAA 5D3QA 5J5CA 2EYQA 1U9IC 2CE2X 3CR7A 1R7RA 1QHGA 4DVGA 3GLGE 3GEEA 2R9VA 4RFSA 4B6FA 1RYFA 2YOGA 3JZMA 3B5JA 2KI5A 2ZI4A 5UKDA 3ZVRA 2ZJ2A 3C7KA 3X1YA 2VP5A 4LPKA 1Z07A 1MABA 1KSFX 2PT7A 5CM8B 1J8YF 3VMFA 1ZNXA 3QKSB 1FPMA 3H84A 2QBYB 5BN5A 1KO8A 1WF3A 3FKSA 2FFBA 5A0FA 3U4QA 5FL7D 2FSIA 5KSYA 1JJ7A 1E98A 1NMYA 2RMKA 2UKDA 3CBQA 3RYTC 3SFZA 1NIPA 2YZ2A 2GZHA 2R6FA 5K8TA 1NMXA 4M9ZA 3AVUA 5KNDA 1KI2A 1VPLA 4Q47A 1CLUA 4C0JA 1W4CA 1XWIA 4F91B 2W0MA 4KLZA 2Q9CA 4AC9A 1Z0IA 2VP6A 4TSFD 3PXGA 2Q6TA 3THXA 4DLYA 1NMZA 4R98A 2IXGA 4NYJR 3DZ8A 5KNCA 4D80A 4B75A 3IILA 5C2JB 1RRCA 4UNSA 1YZGA 2IS1A 1QVAA 4LBZA 3EARA 2IEZA 1KAGA 3VTKA 4BE7B 2XXAA 1BKDR 4RSGA 2GXAA 4HDOB 3QPWA 2BIFA 4Q7MB 1A4RA 4ARZA 1E9RA 4CT4B 1DOAA 2RGDA 3OE7A 5FBLB 4IHQA 1IY2A 1NI3A 1KK0A 5LD2B 4FW9A 2FFAA 4IEIA 1CS4C 3MWKA 4A82A 2IS4A 2Z6VA 2VHTA 2IUUA 3O8CA 2QL6A 3IEUA 3RRYA 1OSNA 1RW4A 1XF9A 2FPLA 1IONA 2GRJA 3LQQA 3ND8A 5DH9A 1YKSA 1NNEA 2FJUA 5FOTA 3ZD7A 1JQJC 1P9RA 1SZPA 1ZU4A 1WBDA 2QQEA 2J87A 4QBGB 3PG5A 4C30A 2VP0A 2GXQA 4G5GA 2F7SA 1D8TA 2W0SA 1FOEB 3PUVA 4R2IA 2V7QD 1U8YA 4F92B 1XTKA 3HYTA 3CRRA 2WTUA 3DL0A 4NZYA 4NBSA 2NO7A 1LS1A 2OCYC 3LWNA 3SI7A 4B48A 4P31A 2VQSA 4R2HA 4TL8A 5CYOA 2ZS8A 1CR0A 1F5NA 1TEVA 1WQ1R 2ZETA 4NL4H 1JR3E 4BLQA 3B9QA 4HUQA 2D06A 3DPUA 3R9WA 2KJQA 4X8LA 2V8OA 2AX4A 4IW3B 3RANA 2J0UB 1E79A 3UMSA 4HAWA 4D4MA 2W83A 1SGWA 3I1FA 1JPNA 3X1WA 2FU5C 3K09C 4QGHA 4LHWA 4HLCA 4Q4LA 2BM1A 1Y3AA 1VG1A 1G8HA 1ZC3A 4II7A 2IWHA 4BLSA 3LO5A 3VU9A 3BAFA 1ZM4A 2RCNA 1E9BA 3EIQA 2Z4SA 4GSYA 4R7ZA 2P6RA 1KTVA 4OI1A 3LRPA 2V1XA 5E3HA 1YHNA 3CNOA 1ETUA 2ZR0A 1MO4A 2JGNA 1BYUA 2IF2A 5JCZA 3OEHD 3CWQA 1VCMA 1VCOA 1PJRA 1IAQA 1G7CA 2GTPA 4OKSA 2O8EB 4LCBA 3GJ3A 421PA 1SKQA 4F4JA 3EASA 5L3VA 2WMOB 5HKKA 3CPHA 2H18A 2QMUA 1D6JA 4V03A 1Q3HA 4Z54A 4IXNA 1GP2A 1ZVQA 4LBVA 4QBHA 2V3CC 2WVJA 1LS6A 2JLZA 1E32A 3MCAA 4Q1DA 1HT1E 3HR7A 3HU2A 3M6AA 4ZDJA 3QXHA 4D81A 1BH2A 1SQ5A 3BIFA 3NBYC 2NIPA 3GCGA 4DBLC 1B23P 4RKFA 1Q1ZA 4LHXA 3FMFA 3T1OA 4F4IA 1US8B 3AQ4A 3B8HA 1Z0KA 2AXNA 1KI6B 2QTVB 5EP4A 5KPJA 4TQAA 1UBCA 1DTSA 2CHGA 3MWYW 4AIIA 1TQ2A 3QKSA 5LPNA 2QBYA 4OJQA 1P5ZB 3QEJA 5DISB 1G16A 4MGYR 4PZYA 1VCIA 3VX4A 2SHKA 1R8SA 1GITA 2JAQA 1GL9B 3CRQA 5L3RA 2J7PA 1WE2A 4BFVA 4S35A 1T5IA 2P5SA 3TBKA 3EPJA 5CIQA 4RD6A 2E9SA 1YZKA 3R8FA 4LYFA 4O2RA 3A37A 4JJZA 1F2UB 3BJIC 1JR3D 4IEEA 1E0KA 4C0KA 1K5DA 5FOUA 4ZIRB 621PA 1QHIA 3W6PA 4DIDA 1OXSC 1RRFA 1ZNWA 2RHDA 4M1TA 3NTUA 1G7RA 3KQHA 1N5LA 3THWB 2IYZA 4LUCA 1E2QA 2XAUA 4RY2A 3LDAA 4JSYA 4B3GA 4FINA 2PX0A 1CXZA 3GLHE 221PA 1NN5A 3T1VA 3VAAA 1IBRA 2WWHA 1HUQA 4D82A 5JI3E 2VH5R 1J2JA 4I4LA 4DLWA 1CULC 4RZXA 5HPYB 1L7VC 4X8HA 1IQPA 1E2KA 1XX6A 5FBWB 2H92A 3F5FA 4TMVA 1CTQA 3CX6A 4PC1A 4TTQA 1DAIA 3CRVA 4IVQA 2GA8A 3IPXA 1VYVA 2FN4A 2HCBA 4NCNA 3SOPA 4DB2A 2QT0A 1UBGA 1OFIA 1GNPA 1W4BA 2G0NA 2JJ8A 2JDID 4RZ2A 2FA9A 4QM7A 3F3YA 3SN6A 1DAEA 2OE2A 4Z8XA 3A1WA 4WXRA 1Z6GA 5C46F 2WWWA 2O8BA 1FZQA 1KZ7B 3WYAA 4JT4A 3DOFA 3AKDA 5CJPA 1BOFA 3FMIA 3NH9A 3QY0A 4US0R 1WP9A 1TU4A 1MRNA 2JIZA 4LRWA 1SVKA 2GCOB 4NYIR 2FPKA 1A82A 4EDHA 3CPEA 2J0UA 3NIBA 4JBYA 1YRAA 4E03A 4IOJA 5BQ5A 4PHHA 3T35A 3LA6A 1KI9A 4FI3C 1KK2A 1E1RA 5KSPA 1E0SA 2GWHA 5CLLA 2PEYA 4GDFA 3T12A 2QAGC 4TT3D 1KAOA 5IK2D 1KO1A 4U02A 1F2TB 4LWZA 2ZUCA 4OK6A 1EFHA 1G4AE 1SHKA 3CH4B 4QGAA 2JLWA 5JHHB 1BS1A 1W0KA 2NQ2C 3RAPR 2WBLC 5DGXA 2IYTA 3UIEA 2J41A 1VHTA 5AR1A 3ZVNA 1DO2A 2BBWA 2ZJ5A 3LQRA 2Z5FA 4HAVA 2O8EA 1NY6A 2W58A 2PBRA 2XTZA 3AF3A 1KDPA 1JQLB 1ZMXA 4GOKA 1X8JA 3CO5A 4ERNA 2IBMA 4HLQB 2WHXA 2YVUA 4BFSA 1NN3A 1LFDB 1S4QA 4YC7A 2EU8A 4ASUA 2QQ0A 2VTKA 1CRPA 1CR2A 3BORA 2ZUDA 3ZZ0A 1JECA 3LLMA 2C2HA 4IVRA 3WRYC 2BMDA 1A2KC 1NKTA 3DKPA 5CDFE 3ADDA 4ESHA 4QJ5A 1KMHB 3IHLA 1SULA 1US8A 3THOA 3WNBA 1KI6A 4KFSA 1G3IA 5H68A 4RD0A 2IYXA 1BMFA 2ZM5A 1YVDA 3A6PC 1ANKA 3QVVA 1WBBA 2A5JA 4IDOA 5LB4A 1ONBA 2BKUA 2C9CA 2O8FB 3FKQA 4PO1A 3NH6A 3TAHA 1LVGA 1GM5A 3ZZUA 3BWDD 2NMVA 3O8BA 1Z8FA 2HYDA 4NCKA 1A5TA 5A5GA 3AVOA 4ILEA 4DT1B 2QU8A 4M1YA 1U98A 3B1WA 1QHHB 4FMDB 4KBFA 2ZYVX 5AJWA 3ZJYA 4AG5A 4XVUA 1N6OA 3EPLA 5F9HA 1FP6A 4Z1MD 1F2UA 4AWXA 3LV8A 4ZIRA 4EPRA 3X1XA 3BH6A 2GEVA 4WOPA 4DRZA 1OT3A 2QY9A 4PSKA 3THWA 1DAGA 1WCV1 4A15A 3Q9LA 2D4HA 1JALA 1NVXQ 2ZIAA 1UEJA 2PEZA 3ZZTA 4IJMA 2HJGA 4C0QC 4YMVA 4C2TA 2XNSA 3ETLA 5KHOC 1Z0FA 3E5HA 3AF2A 1OHHA 2DBYA 2XTMA 5CM9C 3K1JA 4Q1AA 4DSOA 3TUZC 2IHBA 2CNWD 2ODBA 4LJ8A 2VP4A 2XZLA 2EFHB 1EK0A 3CW2A 3O8DA 1S1MA 2REBA 4W5WA 4BQSA 4DKXA 2OAQ1 2BJVA 5CB6A 3ICEA 4PPFA 4W5HA 2YWHA 1HE1C 2Z43A 3L82B 3CF6R 1U8ZA 4ZKEA 2WPDA 1SKYE 2YV5A 5K8LA 1C1YA 4LV8B 1ZINA 3A58B 2OHFA 3VR1A 3D7MA 4OJKA 4DLUA 1COWD 2A9KA 2ZUBA 4M0LA 3N5CA 5J4LA 5H8WA 4HAZA 4CRWB 1RJ9B 3LAWA 1G3RA 3ICQB 4RKEA 5AUOB 1IXSB 2ZRPA 5FTMA 4HB2A 5FFMA 2ZRLA 4HI0E 3I5YA 1XP8A 1KDOA 2G83A 2W6ID 3UWKA 1YR8A 4FCWA 6Q21A 3N70A 3T1QA 2XITA 4URVR 2IUTA 3ZVMA 3BFVA 3K70C 2CK3D 4DLXA 4BFUA 4IFEA 2DCUA 2GETA 4DHEA 4MGZR 1ZJ6A 1XU4A 3PIRA 4AKEA 1YR7A 3SJBA 3PUXA 3K9HA 1SVOA 1F2TA 3RNLA 4DXAA 2JLUA 3KUCA 1KI3A 4IVPA 3LVRE 1EFCA 3G82C 3TGPA 3K8YA 3THYB 5F9FA 2EYUA 1DEKA 3GJ5A 1G3MA 5C4GB 3HR8A 3W6OA 4FIDA 4E07A 2DPXA 2YWGA 1G8YA 5HE9A 4BUJA 2WOOA 4IDPA 1FMLA 1GRQA 4FCVA 3ZS8A 1W0JA 2Q9AA 1G18A 4AG6A 2HV8A 1Q1QA 4C4PA 2OLJA 3QI2A 3U61B 4NU0A 3FMPB 2QRZA 4JLDA 1NJGA 3AF4A 1OYYA 3MFYA 4QL3A 1OLOA 2IYWA 4KBGA 2D3WA 3UATA 3N2IA 4JL8A 4EIWA 1M7BA 1TPZA 1HH4A 1JEDA 2GXSA 1N6RA 2JJ1D 2WJGA 3PFIA 1T91A 5SZIA 1Z0AA 1XCGB 4O2LA 3TSOA 2DYKA 1G19A 4DEXA 5KU1A 3KJIA 3OHMA 1KMHA 1OIWA 2OLKA 3TMKA 3QXXA 3DMDA 5B64A 2B6HA 1G5RA 1FL9A 4V0ME 5FPSA 1IN5A 3K9NA 3KKQA 3P20A 3I8SA 3QUSA 4BLTA 2A78A 2HXSA 5AUPB 2VYFA 4Q9HA 4XWOA 4YXWD 1ESNA 2O8FA 3K9LA 2ZRDA 4PSVA 1KOFA 1NN0A 3R7WB 3PR1A 1YZLA 2ZQ5A 4Q66C 3UWOA 3MRSA 2WJYA 1E1QD 5HCNA 1AM4D 1XBTA 2FFQA 2HLDD 3DEFA 3RS0A 1AA9A 1NVWQ 2QNRA 4DT1A 1NKSA 1E9FA 3K9GA 2UZIR 1R6BX 1EFRA 2IS6A 1QHHA 2RGBA 3BRWD 5L3SB 4BGDA 1NF3A 2YOFA 2YC4C 2G6BA 3WYFA 4LYHA 3NEYA 3NKVA 2QPTA 3I3SR 2GAAA 1OH6A 3VR2A 1E6CA 2O0KA 1XD2A 1OFHA 5IT5A 4AKHA 4F4CA 1M1YE 1C9KA 4A6XA 4DDUA 4V02A 3LX5A 3C5CA 3AP3A 1A2BA 4H9GA 3UKDA 1Q0UA 3W6NA 3IQXA 4JBWA 5EZ5A 3B1ZA 2EVWX 3RS5A 3REFA 3AVQA 1KJZA 5CK4A 2ZS9A 2ODWA 5AJVB 4PHGA 2XB4A 1Q12A 3KUDA 2H57A 4PAMA 2YHSA 1K5GA 1N25A 2GF9A 3QG5A 2BC9A 1KK3A 1UBFA 3WP0A 3GJXC 1D2NA 1GRNA 4NP6A 3NVAA 1IHUA 5AUQA 3QG1A 2KBFA 1V5WA 1W2HA 3QBTA 1YE8A 1VCNA 2OFOA 2ZRGA 3NHAA 4PO9A 1O3YA 1II9A 1Q1EA 4JLOA 2J46A 2BMJA 4Q19A 2GESA 1GTVA 2O8CB 1OXTA 4TMTA 2F55A 2ZRBA 4MYCA 5EP2A 5GJBA 3C14C 3KTAB 2ZRIA 4LJ4A 2OCPA 4GBMA 3VNVA 4B34A 3B6EA 2GDJA 1RJ9A 2ZI9A 3CIOA 4TL6A 3IO3A 2ZRMA 4M53A 3PUWA 3EPHA 1AS0A 4IDHA 2VP2A 5GJWC 2F9LA 4YLGA 5FTNA 2QP9X 4G5OA 1FX0B 1G5PA 3D8BA 5FUVA 1RC8A 1IN6A 2QI9C 3U7GA 2PCLA 4JVSB 3WRXC 1E2NA 1N3BA 2B7BA 5TVKA 3U3RA 1HEIA 1P2TA 2EWWA 2F43B 1KSHA 2ZJOA 3AKYA 3AV0B 3AVPA 1I4DD 1I2MA 4GMXA 1GAJA 4DLTA 2E87A 2QEQA 1GZSA 3THYA 3GLGB 3BE4A 1Y63A 3L8YA 2X1VA 3QE0A 1CR4A 3RABA 1UEIA 5FH9A 4M4SA 4GP7A 2VHQA 4U5XA 3TJZA 3QKTA 2AKAB 3QXCA 1CEEA 2NO0A 2NZJA 1Q20A 1ZD8A 1N6NA 4TMZA 4DDTA 4BFXA 3TUIC 4XWKA 4ZCMA 2QMOA 3RDPA 1VIAA 2OG2A 2V4ZA 1IN8A 4L4UA 2O0HA 4G1UC 2AFIE 1TQ6A 5FTLA 4ZKDA 1XEWX 4KFTA 4Q9LA 2FMXA 1ZP6A 5KDDA 2G1KA 2PT5A 3IBGA 1JBKA 2YC2C 4X8MA 2QUZA 4UXJA 4A2QA 3ZDQA 1H8HA 1Q44A 3QIAA 3BK7A 4A36A 3NHBA 3BXZA 1QDEA 4ON9A 2OESA 2QP3A 3LXRA 3I5XA 1LB1B 3EA5A 3AVVA 5JJLA 1VKJA 4CEIB 3U7FB 1E2JA 4QC2A 1P62B 2JATA 3LVQE 5J4YA 1AKEA 1SXJD 1QHXA 2BJWA 3R7WA 3RLFA 3S1AB 2FNAA 3HP1A 3RSLA 2OAP1 4Q1EA 5KYKA 4NCJA 4MKHA 4OQMA 3LD9A 3FVQA 4LJ5A 4KXFB 4LI0A 4HEJA 3BGWA 1P73A 2XOKD 1J99A 1VG9B 2RGAA 5L3SA 3WHLA 2DY1A 4POAA 5G53C 1Z6TA 1YRBA 4NPHA 3I72A 1GWNA 2XSZD 3QXJA 2FWRA 5TARA 1E2HA 2ZR9A 4CYMA 2ZJZA 2X2EA 3T34A 4KO8A 2WKPA 1DG1G 1XMSA 4PO8A 5ANRB 5LBIA 3IBYA 2W2VA 2YYZA 3Q7QA 4TLDA 4B3DA 1EFTA 1CIPA 3D3QA 4QXAA 1Z22A 3ZH9B 2N46A 4XJXA 1ZIOA 3TVTA 1NL3A 1TADA 1TMKA 2WOJA 4TSFA 4JKIA 4ACBA 4KHZA 4QHSA 3OF5A 2HCJB 4PPGA 2C5LA 3B13B 2IYUA 1AS3A 4KVGA 4M22A 4BECA 1DAMA 2UZ3A 2I4IA 2NG1A 4LK2A 1W36D 1Z6XA 2ZJAA 1G1MA 2VHCA 1FQKA 1SVSA 1ZM2A 4IKEA 5KUTA 1OFUX 3H86A 3KFVA 1G7TA 1E4VA 2GCPA 2O8CA 1DBSA 1ESMA 2J45A 4PPNA 2OFXA 2XEXA 8OHMA 3KTAA 4HDQB 2J59A 2BWJA 4UNRA 2PZGA 3W3AA 1MH1A 1U99A 3FKSD 3HU3A 1FQJA 3GJ0A 2V7QA 3AM1A 2C95A 4OHVA 1FX0A 2FOLA 4RD1A 4CIDA 5JBQA 4GOXA 3B60A 2JA1A 2JEOA 5CIWA 5FTKA 1S1CA 4LDJA 3FE2A 4FMBB 2QE7D 1Z06A 1G291 1OYWA 1VYTA 2OBNA 2F43A 2W6JD 5KTYA 4AYXA 2ZRAA 4GL2A 1PLLA 1GSIA 1P2SA 3AVWA 2ANBA 2AWNA 4KYUA 4UNNA 4KSCA 3GLGA 5JJKA 5JLJA 4LV6A 5FOSA 3RWOA 1M6NA 1G8FA 4B44A 2VF8A 3NEJA 2VLIA 1NVVQ 5G40A 4RD3A 2NO6A 5KDLA 4I1VA 1QHSA 2DFNA 2XNDD 2IYQA 5LD2C 2AK2A 4AKGA 2J9RA 521PA 4QGFA 1Z6YA 5DI3B 2CXXA 4P3YA 3LBNA 3VX3A 4ZPXA 4AYTA 5F98A 2WJHA 1JEEA 4TQ9A 2GZAA 3L43A 3CRMA 3WMGA 2B92A 1YZNA 2WWGA 1T3SA 2GJ9A 1E4YA 2H8KA 4PC7A 3VHXA 1ZNZA 4NONA 1CJMA 2ONKA 3KB1A 4OYHA 4A2WA 2WJJA 5G3YA 2V1UA 1JAIA 3TQCA 4D4LA 4F93B 1U81A 3FB4A 4JVNA 3EAQA 1G8PA 2OXCA 4B71A 4CEIA 1OF1A 3AH8A 1AN0A 3D31A 4TZ6A 3K0CA 4GRAA 4M9SA 4MRNA 4TLCA 2D7CA 5B30A 3S1AA 3HPRA 1X8LA 2ZU6A 2HF9A 3SYNA 4A2PA 3FHTA 1ZM3A 1CJTC 4DCSA 2EFGA 1HURA 1D9XA 3CX8A 3EWSA 2DB3A 4N3NA 3OFND 3ADCA 3KXLA 3FDIA 4A0FA 1E2LA 3OAAD 4C0LA 1OIVA 4TWZA 1OH7A 1EESA 3J81k 3GLIE 2JLVA 1NRJB 1G4UR 2CBZA 4JT2A 5E7JA 1JR6A 1FMJA 3LY5A 1ZW6A 1N0VC 2HDNB 3A1TA 4GT1A 4MUAA 3ZLJA 4KLNA 1AJEA 1EGAA 3CF0A 5TV2A 4LSGA 4DCUA 3UANA 2CHVA 4HSEA 4DLSA 1TQDA 3E70C 1UKYA 2WSSD 3D6TB 4EKDA 3GJ4A 2DWPA 2ZE6A 5HR5A 1H8ED 2QM7A 2PCJA 2KSQA 2PX3A 3EZ2A 3R8CA 3SBEA 4B6EA 3GLFE 2J0SA 4YDHB 1JR3A 4PTLA 4M1OA 3P32A 1GFIA 1GILA 3B1YA 4C2UA 2R62A 4BFTA 4DLRA 5HKKD 4CF7A 1G3UA 3B2EA 2CCKA 2MMGA 2OZEA 4MRVA 4RVCA 2AN9A 1E99A 3BB3A 2NOAA 3E1SA 1SVWA 1DADA 3IIMA 1P61B 4JL5A 5CITA 2WAYA 821PA 2ZREA 3AP2A 4BEJA 5FBVB 2RKOA 3PEVA 3KXIA 2FF7A 4OHWA 4K8OA 2ZSDA 2I3BA 5EP1A 3V4FA 5JMTA 2ZVQX 1JNYA 4KSBA 2PH1A 2C04A 5FOXA 2O5VA 1HT2E 1RVDA 3LFUA 3RWMB 1TTTA 2ZI7A 2BBOA 1KGDA 4N0EA 3HJNA 1EFUA 1EWRA 2QGNA 4FD2A 2MSCB 2ZROA 2JDIA 4HAXA 5JECA 4NMMA 1ZC4A 4CEHB 2IA5A 5SZHB 5KSZA 4A0HA 1Q3TA 3N2EA 1TAGA 2RGEA 2ZR7A 3U44B 4LPSA 3ZIAD 1Z2AA 5H70A 3RHFA 5J47A 5JJIA 1H65A 1XXHE 4C0BA 5FR1A 2FV8A 2TMKA 1ZD1A 4NYMR 1ELOA 3Q5EA 4LGMA 1TF2A 3W9YA 3Q72A 3ONWA 3PEUA 1Z28A 3X1DA 1AZTA 3ZD6A 3SYLA 3RS3A 3QPVA 4M2LA 2REOA 3TE6A 1OB5A 1NLZA 1KHTA 2MSEB 5AJYA 2PJZA 3ZGXA 4M1WA 4BZXA 1KO5A 1SVLA 3IPYA 4TLEA 3PQCA 4URWR 2JLRA 3A4MA 4EQ6B 1E9EA 4G5RA 5JI2E 1XTQA 4Q7JB 4QHYA 4TT3A 4Y0AA 3JVUA 3OESA 5DI3A 4OHXA 1DS6A 1R8QA 1XZQA 2LKDA 4PAQA 1N2CE 2WIAA 4JLMA 1OXXK 4EPTA 3ZQ6A 1LY1A 2ATVA 2D7DA 3M1IA 2GILA 3L0IB 3CNNA 4PZLA 1XPOA 4XTRA 2JJ2A 3GP8A 2XTNA 4N0DA 3C5HA 4YMWA 1G64A 1LTQA 1T3LA 2EWVA 3AGPA 5G3ZA 5JEEA 3UK6A 3OEED 1KI7A 3QJYA 3FHOA 3WBKA 4DEYA 3SNHA 5F3WB 4HATA 3MWLA 4MYTA 4NE2A 4E5UA 3VKGA 2QN6A 5EXPA 4JSTA 2Q3MA 1QRAA 2NO9A 2QT1A 2L0XA 2AD5A 3TNFA 5HZKA 4TZ0A 4LV5B 1HY3A 2ZRCA 1Z2CA 4R9UC 5DLQC 2DFKB 4C7OB 1TX4B 1P9NA 2ZRNA 2FG5A 1KJYA 1RIFA 2BEJA 2CEAA 2QMHA 4A92A 5EQTA 2VF7A 4QG7A 2AD1A 3TK1A 5DE3A 2JLYA 1HE8B 5FOWA 4D4KA 1W2GA 3CX7A 4JZKA 1E1RD 1GG2A 4QBFA 1SHZA 5IDVA 4W9MC 2VO1A 4FMCF 1E2MA 4Q1FA 2IX3A 3B1VA 1DPFA 4D4JA 4P32A 1JXOA 2RGNA 1ZM9A 2CE7A 1FTNA 3KKPA 2UVQA 3LW7A 3TR5A 1S3GA 4MQBA 2B8WA 3VKHA 4EJSB 1VDZA 2AHOA 1BYIA 2AL7A 4PFSA 1T8UA 2O52A 1TNDA 4Z1MA 3KQNA 3E2IA 3F0TA 4WA7A 4OQNA 3U6BA 2CL6X 1P7CA 2EFDB 3B82A 2PZFA 4G5QA 4KFUA 2GK6A 1YZQA 4HLDA 1Q1BA 3QKUA 2WMNB 2N1BA 3HDTA 2REXB 3WNDA 2ZTSA 4P4TA 2CNWA 2IT1A 3CF2A 1TUEA 5BN4A 3VR4A 1XD9A 4WAUA 1ZCBA 1G17A 3ZQJA 3O8RA 1AGRA 3ADKA 1QG4A 3TIFA 5C18A 2N42A 4WZ6A 1G6OA 1II8B 1ODFA 4BZQA 4US1R 4Q48A 4ITRC 5HCIA 3G5UA 4DIEA 4LHVA 4OK5A 5E95A 3AP1A 5H1YA 4HLUA 1X6VA 4BFYA 4M1KA 1YR9A 2NTYC 1QF9A 1Q21A 4UXHA 1FUUA 4JVMA 1PV4A 4CEHA 1XMVA 1E9AA 3T1TA 4ZCLA 3PENA 5E4FA 1Z63A 4Q9KA 1ZM7A 3U44A 1YZUA 1DARA 3K0AB 4O0MA 3EXAA 1COWA 1UKEA 1L4YA 3FHCB 3QSYA 5JEDA 2ZRJA 2XZOA 5JSZB 1TQ4A 3ASZA 1UKZA 5CDFA 3CH5A 2CVHA 4E22A 1OKKD 2D74A 3LLUA 2W6IA 4N1AA 1R0ZA 2GEUA 2WICA 3MGCA 3CRW1 1W5SA 4WBSA 4EPYA 3KB2A 2G77B 2GCNA 4EQ6A 1OHHD 1CR1A 4UQOA 3W8NA 4CW7A 2GCOA 4HAYA 5J4VA 4LX0A 4CDGA 1DAFA 2GF0A 2YWFA 4M1SA 1XJCA 3TW8B 3NDBB 1PLJA 3DVLA 1YQTA 4YDSA 3IEVA 2IYVA 4BLPA 1F3OA 2CCGA 3SJAA 3UPUA 2I1QA 4DCNA 4QKQA 2D2EA 2QAJA 5TY0A 4PQYA 1W47A 1CBUA 1BO6A 3I4LA 1E2IA 3TR0A 4B3FX 4DUGD 4I1SA 4BFWA 4BWYA 4LYAA 1S8FA 1OH8A 2ZI3A 3W90A 1LW7A 1T0HB 4NHOA 4C0HA 1E9SA 4D26A 2W00A 4J0QA 2CCJA 2NPFA 4MGIR 2ORWA 5EE0A 3NDPA 4Y0VA 1XEFA 1NG1A 4CT5A 1FTSA 1TU3A 2JJ1A 1WRBA 2F1IA 4YONB 1Q22A 1R4AA 1WMSA 5G41A 1W4RA 2PMKA 1Z47A 3Q85A 4A8JB 2OFWA 4F7WA 2WSMA 2GBLA 5C4MA 4C7OA 4JLBA 1Z29A 3LH5A 3I73A 3FMOB 1DAHA 4PANA 4PQRA 4V0NA 2AFHE 3PUZA 1FFHA 3W5JA 3CZPA 4YXWA 1E2EA 1GKYA 2ZVPX 5CK5A 1SXJB 2C9OA 4PAOA 3KKMA 4QM6A 3ZYCA 4IXMA 4OHYA 3OIYA 4B74A 2OCAA 4L5BA 3H0KA 4LHZA 2HLDA 3U3MA 1T3HA 2R6CA 1HTWA 4GP6A 2IL1A 4JJKA 2LWIA 2WZQA 4NH0A 4EJSA 1LV7A 5B58C 2ZJ8A 2KBEA 4Q21A 2F1JA 2ZI6A 3EZ7A 3OIUA 121PA 5FPYA 1GUAA 4DSUA 3GMTA 5ELXA 2P6UA 2ZJYA 2KB0A 3HU1A 3NBFA 1JPJA 2C9YA 1MO6A 4L9SA 2OBLA 2QROA 4JS0A 3GJ8A 4WVFA 4BRUA 4MDEA 4FMCB 4XVRA 4EUNA 4Q4HB 2X8AA 2VHUA 2OBMA 1J90A 4TL9A 5EXXA 2ODNA 4DC9A 1VYUA 2ERYA 1NBME 3M4YA 1UDWA 4ACAA 4XD7D 2C77A 2MMCA 2P5TB 4LJAA 1II8A 4JLPA 3TSWA 2R44A 1MV5A 3QF4B 3VR5A 4WZBE 2BDTA 1RRGA 5FTJA 1P6XA 1N5JA 1U94A 4IOKA 1KSGA 3C41J 2WAXA 4MKFA 4ESVA 1WDTA 2ZSFA 1W36B 2ORVA 1VMAA 2H1LA 4K81B 4XH9B 1XTJA 3SE0A 4AKIA 1DELA 2QP4A 2ZE7A 4QBIA 5AJXA 3EIEA 3FFBA 3K0AA 1CJVC 3TW4A 1OE0A 2YKGA 1K6MA 2V6JA 4B73A 4DZZA 1X3SA 2GAOA 4TMXA 5JSZA 4C0SA 1CJUC 1XEWY 2BCGY 2ZI5A 3L0SA 2F6RA 4B2IA 4V0OA 1L4UA 3A1SA 3I92A 1KDRA 3C8UA 1IY0A 3U6KA 4I1OA 2Y8EA 4QJ4A 2BMEA 4V0MA 4B35A 1IJEA 2X19A 3T5GA 4I81A 2QSZA 1KI1A 4RZ3A 3GEHA 2OEPA 3KJGA 1MOZA 4QHTA 1W4AA 3Q3JB 5IF9A 4Q1CA 1W7AA 4PPQA 3SU8A 1VTKA 2EFCB 2FSHA 4YMSA 4Z8YA 3EPKA 1ZUNB 3AB3A 4RD2A 4HB4A 1YU9A 3L0OA 2NZ8A 1P75A 3PEYA 3B78A 3A8TA 5LB2A 3SC3A 3K70D 3U3OA 1G9XA 1GL6A 4CEJB 1T4GA 3OIWA 4HZUB 3IIJA 5C1BA 1CF4A 1OV4A 3KDSE 4LJYA 5E7MA 3KJHA 4LHYA 5EE9A 2J5XA 4C3ZA 1EXMA 4QRHA 3BBPA 1GRRA 4I99A 5JRZA 3FWYA 4BEBA 2QZ4A 2LCFA 3U3KA 1GVNB 1EX7A 2KE5A 3EC1A 4PC3A 2ZEJA 1Z6AA 2P6NA 3SHFA 3MWJA 1X86B 2CMKA 4A8JA 4OQXA 3SEAA 1X1RA 2RAPA 2WJIA 1NBMD 1RFLA 1I2DA 4HYYA 4IOMA 5IRCD 5TXGA 1KMQA 2H5EA 4UJ5A 4TYPA 1E3MA 1S9HA 2CJWB 1U0HC 3NC1C 1N6KA 4KCGA 3QVUA 4B3CA 2D62A 3FFAA 4Q5IA 3X1ZA 4HUTA 3JZAA 3QXSA 4AI6A 1SXJA 4O3MA 2V55B 4OBEA 5BYKA 2VSFA 2JCSA 2BHRA 2IHYA 3RSOA 5B57C 3AUXA 2GJ8A 4OI4A 2ZU0C 5FI0B 5KNBA 1XTRA 2XOKA 3KX2A 3NC0C 3CLVA 2FEMA 1P2UA 1I4TD 1IN7A 5GJCA 2FSFA 4HB0A 4XOIA 3CM0A 5EUMA 1ZNYA 2XSZA 5SZKB 2BBTA 5KOYA 5IHPA 2J3EA 4ZDKA 2A5GA 4IDNA 2RGCA 4LC0A 1T0JB 2ECKA 1OJLA 4Q4HA 2AK3A 2YWEA 3F8TA 3MSXA 4URZR 4D25A 3T61A 2ATXA 3DM5A 1KJWA 5TMPA 5FL7A 3I8XA 1DG3A 4A1FA 3IIKA 1Z3IX 2C99A 3GD7A 2YOHA 1KO4A 4Q00A 1ZUIA 4RD4A 3B1XA 4WW0A 3K0CC 5J40A 3U7EB 5EE1A 1HQCA 5DN6D 3QF4A 2WM9B 1D2EA 3G0HA 2BMFA 3SZRA 1AGPA 2FE4A 4RZUA 2IUSA 2ZE5A 4UNPA 1KIMA 4KV9A 1M8PA 3GFTA 2FZLA 3MMPA 2ZPTX 4AYWA 2R2AA 2C03A 3VQTA 1IY1A 1VG0B 1KKMA 4XSGA 1QG2A 1M7HA 4M9XA 1RE0A 1A1VA 5DNYB 5FL3A 1R5OA 4Q4AB 4CZ2A 4BPBA 1TF7A 3BC1A 4OK3A 2IXFA 1FNNA 3LBHA 4P4SB 5JZVA 4Q4JB 3EA0A 3OIVA 3WXMA 2ZRFA 1ZAKA 4MYUA 1S96A 1DVRA 1KSJA 1R0YA 3VR3A 4DSNA 5JS8A 5BN3A 1UBEA 1MO5A 1U2RA 2DR3A 3AGQA 3HPQA 3WBJA 1DAKA 1OFTA 2ANCA 3H4MA 1S3SA 2QPAA 5EUQB 1NY5A 1T8TA 1ZIPA 2R6AA 4M8NE 1LF5A 1F48A 2QE7A 2W6JA 2OO7A 2BKEA 3EWAA 1NVVR 2ZSEA 2VBCA 3HYRA 4RCZA 5DHAA 4ZI3A 3MJHA 1GDDA 1Z83A 1OW3B 3P27A 1EG7A 2GXUA 5FUXA 2HYIC 1AS2A 3T15A 3FGNA 1F60A 5AWFC 1J8MF 3C4JA 1UAAA 1G41A 3O47A 4M9QA 1U90A 3GLIB 3SYKA 4CEJA 1ZD9A 1W44A 2XNDA 4B76A 5AJZA 4HZUA 4MRPA 3V00A 4QNRA 1D9ZA 5LDDC 3UG6A 2WWFA 1N6HA 2BV3A 2B8TA 2QENA 4FWIB 5EP3A 5EE3A 3B9PA 4TLBA 4D0LB 1OIXA 4P33A 4NYJQ 3KXKA 3QENA 3OE7D 1D2MA 4D6PA 3GLFB 5CLQA 2CVFA 4L15A 1XD8A 4CGZA 1Z08A 1UF9A 1Z0JA 2IXEA 3P1JA 1R0XA 2GK7A 2CJWA 3NWJA 2O8BB 3GJ6A 2WWXA 2Z4RA 2GEDA 3OEHA 3DMNA 4P0TA 3IO5A 3TLXA 1M2OB 2G9NA 3P4YA 3K0FB 2R8RA 1OXUA 1NG9A 1G21E 1KKLA 4V0KA 1YJ5A 2XJ9A 3OFNA 3TQFA 1M74A 4Q9IA 1P4SA 2YNMA 1XJ0A 2NO1A 3OAAA 2CLCX 4LOAA 1HYQA 2EW1A 2ZRHA 3GLHB 5FI1B 1FP7A 2X77A 3K53A 1W49A 3A4LA 1E2FA 4US2R 4PHFA 3UMFA 2QRNA 1NIJA 3A4NA 3A1UA 4MYHA 1E79D 1TL7C 1U9IA 2JLXA 2PMDA 1KNQA 1ZRHA 2FFHA 2RB4A 1N6IA 1MR3F 3ZS9A 4B47A 2AWOA 4BFZA 2QORA 4OI0A 1AQYA 3IGFA 2WSSA 4AD8A 1QHYA 2FEOA 1NLFA 2J0VA 4IOLA 1XXHB 1H8EA 2VP9A 5EE5B 3H2YA 4NDZA 5HE8A 4NKRA 3MG9A 2IYRA 4KAXA 1PVOA 3CPJB 3FOZA 2KWIA 1D5CA 2A2ZA 2R65A 1JB1A 2VSXA 2ZJBA 3RS2A 4L8GA 2ZAOA 2FPMA 4URXR 4GZLA 2EQBA 2Z83A 3BFXA 4YMTA 4ZDIA 2H7VA 4URYR 2IC5A 3K0EA 4JL6A 4FMDF 4B43A 2IYYA 3Q5DA 3H1TA 3KJEA 1SVIA 2XJ4A 3ND9A 3CZQA 5GJVC 5J4KA 3SJZA 4A4DA 3BD9A 4PC6A 5L3QB 3R9IA 4MDFA 4Q4AA 2D2FA 3WY9A 3UG7A 4PX9A 4D2IA 4P4SA 4Q4JA 2RGNC 3PCRB 5M04A 4XWAA 2P3SA 3P26A 2VL7A 3IQWA 4TQUS 3KKOA 1E0JA 4UXIA 2K5UA 1R5NA 4Q01A 4OHZA 4A0GA 3PITA 5DYIA 1J70A 2WIBA 3I32A 4GMDA 1N0WA 1XCMA 3ZIAA 1CJKC 3RVBA 1XZPA 1XCPA 1W48A 3GQBA 1OH5A 1IXRC 4IFBA 3JVVA 4A0RA 1AQUA 5BWMA 2Q9BA 5JS7A 4Q02A 4QOSA 2J7PD 5DYGA 1VG8A 4Q18A 1K8RA 1KNXA 3EZ6A 4KODA 4Q9JA 2O8DB 4JLJA 2W2XA 1XB2A 2A3RA 3EC2A 1O87A 4HDCA 4H1UA 3MLEA 4ZI2A 3CB4A 4IDQA 5JCPA 3GLIA 5KDOA 4GI7A 1E2GA 4C9BA 3IDQA 1UJ2A 2OM2A 1ZBDA 3Q7PA 3QKRB 1P60A 2A30A 2F9MA 2NGRA 3QF7A 2BEKA 2IW3A 1KI4A 1WB9A 3SHWA 2XGJA 4URUR 2PLRA 3FTQA 2P65A 4HLUC 5JFGA 1EWQA 1XJQA 3KL4A 3WYGA 1E9CA 1TF5A 2JLQA 3K09A 1L8QA 1AZSC 4MKIA 4DDWA 4EFMA 5BW8A 2PL3A 3A1VA 5IK2A 3GLFA 1N6PA 1VIYA 4KU4A 4C0AC 4BZPA 2QAGB 1IOZA 3P4XA 3SDZA 5GVRA 2ZITA 1UKVY 3PEWA 2QMEA 3SFVA 1JXMA 3OEEA 1KDTA 5KO2A 4JYBA 4KYIB 2YJTD 1T9HA 4OL0A 1QHNA 4D0NA 4TYYA 4YMUA 4MUBA 4Q7KA 4QGGA 5FOVA 3T5DA 2Q3HA 721PA 3SQWA 4XTCS 1IN4A 2NPIA 2VEDA 3L8ZA 5E7IA 3AVYA 2A5DA 4GFDA 1S2MA 3PV0A 3K0FA 2G0TA 1E2DA 4DLZA 1XPRA 4MGKR 2QPOA 2A5FA 4ZCIA 3KFXA 1NLYA 1G3QA 1HA3A 4P4UA 4NYMQ 3U60B 1WA5A 1E69A 2FH5B 3GLHA 4LYJA 2J1LA 2JIZD 1UPTA 2HEIA 2QTFA 2ZYTX 1B0UA 3WMEA 2G1JA 3A36A 4OQFA 2F3RA 4PXAA 3GEIA 1LNZA 2IYLD 1UFQA 2GNOA 4AURA 4OQLA 4TMKA 1SVMA 2VSOA 1S9DA 1OXVA 4NYIQ 1XXHA 4GZMA 2HT1A 3DO6A 4JLKA 1GOTA 2QA5A 4KI0A 5GADl 2JJ2D 1UM8A 4ABYA 1CP2A 2PZEA 2GHIA 1SKYB 3CONA 1A7JA 1W0KD 4TTPA 4DDVA 4JBXA 5EJEA 1N0UA 5TDHA 2FGJA 1M7GA 3NBZC 5TB5A 1YR6A 4R71A 2XB2A 2ZS7A 1AKYA 4LJ7A 3DM9B 2V9PA 1W5TA 4JKYA 2GBLC 4LBYA 4D0GA 4Q03A 4MRRA 1P72A 1E0AA 5L3QA 2P2LA 3AEZA 4F38A 1G20E 2BVNA 4DCVA 1PUIA 4AK9A 1R0WA 1Z5ZA 2Q21A 4EFNA 3KQLA 4NCIA 1G5TA 1XTIA 3TAUA 4ASUD 3GPLA 2MSDB 1L2TA 5DO9A 3U2QA 4A6PA 4B3XA 1XDBA 4DJTA 1MKYA 2V54A 3EZFA 2ZRKA 4EJSC 3BH0A 3IKJA 5EXTA 5FUWA 1BMFD 4PHTA 2WWYA 1NJFA 3DZDA 1GNQA 1E2PA 3TH5A 2G3YA 2V6IA 4BASA 1ZU5A 4TL7A 3MUFA 2OCBA 2CDNA 3LNCA 2WKRA 4G3XA 3CWZA 4H1VA 2QTHA 2VPPA 5B2ZA 1IJFA 2GZDA 1OKKA 2O8DA 2IWRA 3SBDA 4LY6A 1R5BA 2CL0X 1XD2B 2PLFA 3REGA 2RGXA 3RRMA 4ZO4A 4TTRA 4PZZA 3BB1A 1N6LA 1RZ3A 1TEXA 2W2TA 1BIFA 3BS4A 5HTKA 5FPHA 3EZ9A 1GIAA 3QKRA 3U7HB 3RRZA 3MD0A 4IRUB 1N5IA 2GJSA 3NG1A 2CLDX 3C15C 2DWQA 2HJVA 3RC3A 4EPVA 2CK3A 3IHWA 1RPZA 3DKVA 1MO3A 4JVLA 5BXQC 4QNMA 1EX6A 2WKQA 3PUYA 3AF1A 4FCTA 4FN5A 2F1HA 3W3ZB 4EPXA 1ZYUA 2ZE8A 3K70B 4DUGA 1KO7A 4V0LA 2QSYA 1V43A 3KKNA 5F2EA 2HF8A 2QAGA 5EZ6B 3QBVA 2C96A 4UNQA 4TN1A 3CKLA 3R20A 4HAUA 4XIGS 1AK2A 1UDXA 4GNKA 4W5JA 1UADA 5DHFA 1GKIA 2ZXUA 5GVSA 3CR8A 3AVTA 3VKWA 5CYPA 1JI0A 1IM2A 4FWTA 3BH7A 4M1MA 4MITA 2X2FA 2Z0MA 1OB2A 1W1WA 2O0JA 4U00A 1RYHA 2F1RA 4DWJA 4HZIA 1S0UA 2WPDD 4B33A 3TUJC 1PUJA 1PLKA 1XEXB 3ASYA 4G0NA 5BYJA 3UXMA 2GJKA 2RH5A 2VRWA 2YINC 2A5YB 3EIHA 1JJVA 2DFTA 2DFLA 2B21A 2Q3FA 4MA4A 4CVNA 3SQXA 2BOVA 1IXZA 4RFVA 4G01B 1JAHA 4TMWA 1C4OA 1DE0A 2BM0A 3ZVLA 2ODEA 2I1VB 3UMRA 1M34E 1T6NA 3Q8XB 3QEOA 4X8OA 2ZSBA 1G8GA 3ECCA 3LW8A 1QBKC 4KVAA 4DLVA 5SZJA 5AUNB 5D3MB 2VIIA 4RJLA 5AK0A 4PC2A 5JWRA 1E96A 2CLSA 3DOEA 2WWIA 5CJ2A 1YZTA 3RS7A 1ZUHA 4FXPA 1E1QA 2FZ4A 4L16A 2JLSA 1GNRA 1XMIA 5FPKA 3AKEA 3VHLB 2C98A 4JLVA 5FUYA 3K0SA 1E94E 4A8JC 3I61A 4GOJA 3R9XA 5JWOA 1W0JD 5KSOA 4LC1A 5DIFA 3MJRA 1NP6A 4JLAA 3U3JA 5L8VA 2FX3A 1KI8A 4DB4A 3L2OB 4NTZA 2E1RA 3KZ1E 3EG5A 3SS8A 4XD7A 5K8UA 2DWOA 3AF0A 2IK8A 3V9PA 4Q7LA 5J4HA 2PJRA 1SXJC 1VHLA 1T5LA 5P21A 3RS4A 4PQFA 1G6HA 1X8KA 4KITB 1NSFA 3QOFA 4TLAA 4I1UA 2ASEA 1WXQA 3FPAA 2P0EA 4UKDA 4L9WA 3WP1B 3WNCA 2AKYA 1LF0A 2OXRA 5JHGB 1KY3A 3QNUA 2JASA 3BERA 4WXPA 1GL7A 1II0A 1KZGB 4B32A 2RHMA 3PJRA 1I4LD 4JLNA 3AVXA 2C8VA 1XFAA 1RKBA 1XTSA 4TYWA 2AR7A 4RFSB 2CHQA 3AUYA 4PR0A 4TYQA 1KK1A 1XNJA 2OSBA 2P67A 5EXSA 3SJCA 4BLOA 3CUEF 3NXSA 4B2LA 2DHRA 1Z0DA 1EFRD 1MABB 1GKUB 2GVZC 1MT0A 2F3TA 2QM8A 3KQUA 1HQYE 3BB4A 2AXPA 2J0QA 4ZV4A 5FPTA 4QFMA 3W5IA 1U0JA 1ZCAA 4K46A 1E9DA 4ZDWA 1F6BA 3U4QB 3DDCA 4Z51A 1AIPA 3CNLA 1P9WA 3IUYA 2Q0HA 1R2QA 4KJZA 3DHWC 2QGZA 4XVQA 3TRFA 4MRSA 4TYNA 4MH0R 1W36C 1P2VA 4G5SA 2OV2A 4LJ9A 2LKCA 4XSHA 1SXJE 5DSZA 3THXB 5FBQB 2R6DA 1NSTA 1OPXA 2VA8A
chains in the Genus database with same CATH superfamily
3BOSA 3VO1A 1P4AA 3WMFA 2H2IA 1CU1A 3EHEA 1DXQA 3JARA 3E8MA 4BLRA 3CVJA 1QC5A 2PKQP 3PZBA 4UJ3A 3DAOA 3HDQA 4XUEA 2R7MA 3L6DA 5D86A 3ZGVA 1SG6A 5D5PA 3IVRA 2JHFA 3IVMA 3JQDA 5FBRB 3SEQA 2H17A 1RZRD 1N5MA 4FJ1A 2FK7A 4ZAYA 2ONJA 3QPUA 1NBMA 1XEXA 2IE8A 5A1TA 3V48A 5A4JA 4FFWA 5KYGA 4IKOA 3ZY3A 5H3CA 3PC3A 1WSWA 3DDOA 1DRKA 3M0EA 4L4SA 4N18A 1XKLA 2ZTHA 4CN8A 5KTMA 3H1BA 1PQYA 1U11A 2PGOA 3KVRA 3NHUA 4XIIA 4BRWA 5THQA 3ZWPA 3L4BA 4WZBA 4C20A 3U09A 4L6AA 2FFRA 2WJVA 3HDYA 4IILA 5D8DA 1ZONA 5H7XA 3TD6A 2Q28A 3V4RA 1WABA 1F4VA 1FQWA 2CFTA 3M6FA 1AUOA 2WYOA 3ETDA 1EDBA 2QW8A 4MKGA 4UUNA 3VPHA 3ZDFA 5JYDA 2PGNA 4C78A 1FUKA 4N5MA 3AHHA 1RRPA 2WQZA 1V5GA 2DH5A 4HB3A 1YV9A 3B7GA 4JLSA 3RT1A 2ERXA 4EA6A 5JRJA 2A1UB 3ZHVA 4B4KA 2JGDB 3L7BA 2WIDA 5KEIA 1RHKA 1YI8A 2ZSAA 5CB8A 3PWKA 4R1UA 1GNTA 3V8PA 2RHJA 1GZVA 4MVJA 4FYIA 1KY2A 2W8BA 5FIUA 4DV6B 4WNAA 3LZ6A 4PE5B 3OZFA 3PHGA 2OILA 3IRVA 1FQOA 2IU0A 2P62A 1CDZA 1BXGA 1F8XA 2C31A 4AY3A 1G8AA 1OTHA 3AM3A 1Z6QA 3PPYA 4XUGB 5EWJA 4LDRA 5DP1A 4WZAE 5BOVA 4DPMA 2QYSA 3BFKA 1U0BB 2G88A 2HCFA 3NIWA 3NAMA 4EL5A 5I7RA 3WWOA 1W76A 2YJNA 2JH9A 2VUUA 3T5MA 5A9SB 1JKXA 1WPGA 3B5EA 3G23A 1RWVA 5KYWB 1LBIA 1XZFA 1JSXA 2EFEB 1JHYA 1QIDA 2QZZA 2ZJFA 1UJ4A 3EUAA 4Y1FA 3WYCA 3RG2A 4EZEA 2FSGA 4RGYA 1GD1O 2PJDA 3AIKA 3IOEA 4K6CA 4B3BA 1VJ1A 1X1SA 3WADA 2RI1A 4IMJB 3O26A 5LLTA 4P4GA 5U9CA 4BDTA 1BS9A 2HXYA 2QN1A 1H8HD 2AF3C 1QK3A 4LSWA 5IAKA 1RQXA 4MUYA 2CUTA 2XZPA 3VFDA 1NVMB 2OP0A 1JHZA 3NBXX 3NP9A 1WHTA 3FI0A 2PQ2A 3HJRA 5THXA 4BIIA 4CDNA 2YHAA 3FX2A 3A3PA 3EX7C 1PI3A 5EIWA 1UMBB 2ZIGA 2HUPA 2FWNA 4IIXA 2JVKA 2IF0A 3A4VA 5JWHA 4JMLA 1IBKB 5LSAA 1MJFA 4DIMA 4TXHA 5J5CA 1M6YA 3H9CA 4QYIA 1U9IC 3CR7A 4WOCA 5COQA 1QHGA 2RHTA 2WSBA 3NHSA 3A4TA 4QU9A 1RI4A 2BSAA 1R5JA 3GEEA 3LWBA 4RFSA 4ZQBA 4B6FA 4K0KB 3LGSA 1RVV1 1PDVA 3ZVRA 1DPGA 1LBSA 2ZI4A 2ZJ2A 2VDPB 3S2FA 1G8KA 1MABA 2AOWA 4GMHA 4X00A 4AWAA 2H4WA 2XTAA 5KQRA 1GUDA 3NVDA 4UM9D 1FPMA 2JIMA 1A71A 4BLVA 1SC6A 5BN5A 4M9CA 4OFBA 3RKSA 2XE8A 4FHZA 2GFIA 3U4QA 3Q12A 2RC6A 5BWOA 1WHSA 2CDAA 3OG9A 3NRCA 5IX8A 4D98A 1JEYB 3RUPA 5KSYA 1VE7A 1JJ7A 1E98A 1NMYA 1ZN9A 3CBQA 2G5GX 3C43A 3GFQA 5B3LA 4BX8A 3WKCA 5JOQA 1XZ8A 1YMUA 3T3NA 5IJ0B 1G8SA 2P8SA 1M73E 2HUNA 1NMXA 4UARA 3AVUA 4HC4A 1VPLA 4RKQA 3R76A 4HPJB 4XM0A 4H7IA 2TSYB 1ZI9A 5LU8A 1Z0IA 2VP6A 4I1YA 4K9MA 1UAGA 3HACA 4TSFD 2FUEA 2Q5QA 2H1WA 2OKCA 4DLYA 1NMZA 5AVWA 1FP2A 4D80A 4BN5A 5C2JB 3QFRA 3DDUA 2IS1A 1QVAA 4LBZA 3R09A 1S2GA 3EGWA 3H9QA 3H5VA 1CUVA 2DE0X 2WU1A 1IBSA 4RSGA 5A4KA 4QZVA 4ENQA 3SZOA 4F2WA 3TBHA 2EKZA 4FEAA 1QF7A 4NPAA 5KAMA 4WTOA 3DGEC 4M54A 2HDHA 2COUA 1G0NA 1QX3A 4JP3A 4UUAA 5EYPB 1ES9A 2VHTA 3JRNA 3DWIA 4Z3KA 2OAGA 5C5DA 4CDMA 3NJ4A 4JITA 9ABPA 4ALMA 3AOEA 3MYRA 5CFRA 1SY7A 1YKSA 2MR6A 5FOTA 1NNEA 2I6GA 2JGAA 3J7TA 1SZPA 1ZU4A 2JBHA 4MWDA 3GRKA 4KGDA 2HA5A 3DYVA 4XFDA 5ENVA 4N5LA 3I9OA 1RMYA 3IE2A 4KE6A 3H3JA 2V7QD 4K86A 5B1IA 1U8YA 5JANA 2WTUA 2AF4C 4NU8X 5IVKA 3MTEA 3O1JC 2D3TA 2WHYA 4H0FA 4NBSA 4NZYA 3PYXA 1FSPA 5IT4A 3VGJA 5IUNC 1X7YA 1LS1A 3FRHA 3LWNA 4LDAA 3SI7A 1SCAA 4D79A 5JT1A 2A1UA 4R2HA 4UREA 5A3VA 1CUJA 2ECPA 5CYOA 3ZDRA 1WQ1R 2JGDA 3T7SA 3MMZA 1EMDA 5AVVA 2PSSA 4MRAA 2Y05A 2D06A 3DPUA 3P71T 3R9WA 2V8OA 2AX4A 2H2AA 3UHPA 3SSMA 5BRAA 2C8JA 3EQ7A 2G63A 3QOYA 1J2EA 1GPH1 4HAWA 2VTDA 4DA0A 4Y2XA 4F2GA 3MRXA 3NGXA 4YAWA 2CFCA 2ZB7A 4AMGA 1H4QA 3DPSA 2BM1A 3GZNB 3U4CA 1Y3AA 1VG1A 1ZC3A 4II7A 3HMKA 4UU0A 1MOPA 4BLSA 2F17A 4C01A 4KE7A 2H0QA 1V25A 2RCNA 4GLOA 2HF7A 1FRFS 1JLKA 1THZA 2R6ZA 3GRAA 4HGQA 2HU7A 4EEZA 5A9SA 1IRIA 3V8QA 3CPSA 1A27A 2P6RA 3R6LA 3GLTA 1VZ2A 1YIOA 3CNOA 3T1NA 2NZYA 2ZR0A 1MO4A 1QP8A 1EX1A 2WTAA 2IF2A 3OEHD 3PC8A 5K0FA 1VCOA 4WNCA 4EATA 1G7CA 4G89A 2GTPA 2P4UA 5BY2A 2ERCA 1SKQA 3UJDA 3F8WA 5ED0A 3C3AA 4CKCB 2WMOB 4OUKX 4OFZA 1QRRA 4PXYA 3R8XA 1GP2A 2H85A 1JG4A 1QPGA 1XK6A 5T8KC 3GYBA 1ZVQA 4LBVA 3L3BA 1IMJA 1XVIA 4QBHA 2J6IA 1UMBA 3S0JA 1RWQA 3OFJA 1XRRA 4QG3A 3QVLA 4A2CA 3HR7A 1UWKA 2FHSA 3R40A 3BIFA 3TQOA 1PEDA 2JFOA 4JY7A 4Z2AA 5JFOA 4RKFA 4LHXA 1FXUA 3H1GA 1MVOA 5GM2A 3SHQA 4HEHA 2QTVB 5EP4A 3ANXA 1UBCA 5A5DA 1DTSA 1KYYA 1NQTA 2CHGA 2QMYA 1L1FA 4OXYA 3HL4A 2FLWA 1WVGA 4YCCA 4DAOA 2BTQB 3GMSA 4L28A 2BMWA 5DISB 4RK6A 1R4NB 4PZYA 3HJCA 1IDOA 2QJWA 3BCUA 1ZH2A 5BUCA 2EJTA 4RX1A 1GL9B 1N1DA 1JEYA 4MMXB 4OLJA 5L3RA 2W70A 2XT9A 2XVZA 2OCKA 2QN3A 2XNHA 1HO3A 1WE2A 2QYTA 2SBTA 5KTTA 5CMLA 1T5IA 3WXBA 3RTCA 1OC2A 2P5SA 4F11A 4I36A 3PNMA 1PDOA 2WAAA 4RD6A 2E9SA 1YZKA 4U4AA 1AVTA 2IQIA 5CIQA 3SC2A 4EH1A 3A37A 4JJZA 4WD3A 3U62A 3WWEA 4L6CA 3X1JA 4C0KA 1JXQA 5AT1A 3CXUA 4DIDA 1HDZA 1OXSC 1SZJG 1Y33E 4QYTA 1F06A 2ZZNA 2IYZA 1P1BA 3CVOA 2REQB 1E2QA 2WFLB 4AQ7A 1U1CA 3LDAA 5A06A 4CU2A 1B3BA 3T9DA 3KE9A 1YQ9A 1Z7YA 1H2EA 3T1VA 2CUNA 5ITVA 1SHLA 1G2OA 4GG1A 1HUQA 4I66A 3GARA 4P38A 2VH5R 5IBRA 2HDOA 5JI3E 3UHFA 3VDMA 4REQB 4BTEA 4C4YA 1CULC 1JFFB 2V5UA 4U7PB 5EYPA 5CDTA 4BMZA 4J1NA 4R84A 1Q7RA 1WP4A 3BMOB 1PYGA 2XB8A 3IAHA 5U4QA 2H92A 2JCBA 1N2OA 4G1VA 4EUFA 3F5FA 4Z2YA 2PUFA 1CTQA 1I4WA 3LOQA 1QSGA 4GPIB 1XKXA 4ZXPA 2BZ0A 1VYVA 3NJ8A 4KQEA 3OTOB 2QT0A 4N9QA 1OFIA 3PVZA 4CTJA 1GNPA 3IMFA 3OZAA 4RZ2A 2JDID 1V1MB 2C2XA 4DWVA 1JVSA 2OE2A 4WUVA 3UAWA 2J30A 3A1WA 3I45A 4NS1A 2JBAB 1ZBQA 5C46F 2QMQA 4CLDA 4OXXA 3KOMA 1FZQA 1G20B 4FP9A 1GTL1 3O0TA 4FQ8A 3SZ3A 3TLBA 3DOCA 3DOFA 3WYAA 4CCAA 1JDJA 5HKOA 4NR0A 1KU6A 1QIMA 4CM3A 1WP9A 3FOAA 3GGPA 3TNDA 1HDXA 3S8EA 4L6IA 3U37A 1SVKA 2MIIA 1Z6ZA 2FPKA 1A82A 2CNBA 3HVHA 1AF7A 1JP7A 3SQOA 1QZ3A 3NIBA 3BD6A 1YRAA 5LP6B 2PXHA 3TDMA 2VQDA 1OLXB 3MTDA 5DNAA 3IDSA 1NR5A 3SLKA 4I8DA 4LCEA 1RAAA 4BMDA 3GZNA 3QVXA 2OVBA 2GWHA 2PT6A 1KY5A 2QAGC 5ARBA 4OU4A 3LCUA 5ECWA 3IQIX 4ZQIA 3ZU3A 4R83A 4PCUA 5BMVF 1MVNA 4U02A 4XCXA 5HDQA 4IUYA 1EFHA 1ST3A 1G4AE 3RUIA 3WDSA 2Y1LA 3CH4B 4QGAA 1EA7A 4A26A 5K8JB 1T2VA 2MSNA 4CLEA 4CMGA 3ICCA 1WLSA 2NQ2C 4WESB 1HEYA 3RH0A 3HL0A 1EP2B 4E30A 2WZCA 1XTPA 2XF8A 3LQRA 4KIWA 4RF5A 1NI4B 2VKTA 3EVBA 1U4OA 3LDHA 5ETJA 5IN5A 3TOVA 4D3FA 1W52X 4L7VA 4CKCA 1KDPA 3QTTA 1CNMA 1SXIA 5IHXA 1K7CA 4GOKA 1X8JA 3GV0A 3NX4A 1HDEA 1S4MA 2G9RA 3FCYA 4BFSA 3EXIB 3G8CA 5E8JA 3JTMA 3B51X 2ASVA 2EU8A 3F1LA 3QV2A 4JQZA 4RXUA 4ASUA 3BORA 2XMRA 2ZUDA 4QDZA 4K9NA 3G2IA 5T67A 1NW8A 1U5AA 1UJ6A 3M6IA 1QIIA 2H29A 3KZKA 4HDMB 4U7GA 4YEDA 5FUQA 1KMHB 2C4NA 3F6EX 3IHLA 4G41A 4WRRA 3SHOA 2Z5GA 4XKJA 4KN5A 3TMAA 3THOA 4D92A 5B3KA 2JFYA 4XVHA 2P9FA 2QTVA 4G6ZA 5DHSA 3AXSA 5K8CA 1BMFA 4L74A 4ENUA 1YVDA 2BFBB 1FPQA 1ANKA 5CFZA 4CBVA 5K0BA 1L7DA 2A5JA 2RHOA 5LB4A 3ZKAA 3BHJA 2C9CA 2BTQA 4PO1A 4E2WA 1RPTA 1WCYA 1R4NA 3WGGA 4UD6A 3BPSA 5DULA 3WFIA 4X60A 3BWDD 2ZYIA 1XMPA 3Q3GE 3BEOA 2G04A 4BV9A 4MVXA 3CZCA 1VBKA 5DGIA 4DT1B 1NONA 3WB1A 1M2FA 4WKCA 1U3WA 1RXEA 1U98A 2O3UA 1QHHB 3FCXA 4IJ5A 4KBFA 4R2LA 4TKZA 3EPLA 1YAHA 4BO4A 3NOQA 1OGJA 4AWXA 5B2FA 4ER7A 2N75A 1L4BA 4EPRA 3X1XA 4Y30A 3BH6A 1DBRA 1FJ2A 1UC5B 2GEVA 1PBNA 2B4YA 3KHTA 4BKQA 1LX6A 1OT3A 3NTQA 1ORIA 2MYTA 4A8HA 1AV6A 1P1RA 2V6MA 4HUJA 3NDIA 3U7IA 2WFLA 3QUAA 1IZ9A 1NVXQ 2D4HA 3MEQA 1UEJA 1Y1LA 2NUPB 4ALIA 4YMVA 1JW9B 3L8MA 2CV2A 5KHOC 1Z0FA 3A06A 4JBNA 2RGRA 1XTVA 3AF2A 2QN9A 2VKQA 3Q5GA 5CM9C 1S6YA 4NV3A 3T9FA 3K1JA 2O7QA 4FR0A 3TUZC 4AB1A 2ZDGA 3UKOA 1T8PA 4LJ8A 4JEIA 2RGYA 1THMA 4REQA 4N3CA 1JFFA 2AZDA 1E77A 4JJFA 4RFLA 1ORHA 2Z6QA 4KQHA 4UM5A 3ZDZB 3SKXA 2QUJA 3BMOA 1BX1A 2EFHB 1PL0A 3K1YA 4JC4A 3UWSA 3ZCPA 3CW2A 2EARA 1V8PA 1M2VB 2J08A 3QU2A 4Z49A 4P34A 1SD1A 2J33A 2PR2A 4W5WA 1OFUA 4DKXA 2BJVA 2PQ6A 4S1PA 1KQNA 2YH2A 5DKFA 2YJ5A 3IAM1 3ICEA 4PPFA 3STWA 1V1MA 2YWHA 2ZR8A 3OJLA 1SD5A 3OZRA 3CF6R 4OAQA 1FFDA 1SKYE 2EXXA 2JBAA 2YV5A 1RLTA 3M6LA 4TLMB 1VRCA 4DC1A 5K8LA 1C1YA 1LNSA 1OAOC 4D9IA 4LV8B 1ZINA 3OJOA 1G20A 2OHFA 5HMMA 2OZKA 4RVSA 4G9GA 5CP8A 1Q14A 1FE8A 1YDMA 1COWD 1H6CA 1Y4DE 2Q2NA 1QYIA 2XR1A 3N5CA 4M0LA 4C04A 4UHFA 4HAZA 3PGJA 5T6MA 3V7UA 2AFVA 3OU2A 3VOSA 4CRWB 1YS6A 4K88A 5CFNA 1G3RA 3R5XA 1XWFA 1A8PA 5F2KA 1CUUA 3ZH2A 3TLJA 1SIBE 3HRKA 3UV3A 4BWFB 4E5SA 4TS3A 2E3JA 1TCVA 5KYYA 3I5YA 4N0QA 3GCZA 3IP6A 4D0RA 4UM8B 3UC9A 5CA0F 5LP6A 1U2EA 4MW0A 1OLXA 3BIWA 3BGVA 2IUTA 3BFVA 3FOBA 2BSXA 4DLXA 1HFKA 4BFUA 1MX5A 1MGPA 3NNNA 3SAJA 3PIRA 2C5EA 3MJDA 5ILQA 4AJKA 2C5SA 4UCQA 1CUYA 4DXAA 3GT4A 1D2GA 2WF6A 5CVEA 1EFCA 3G82C 1ZUWA 2CUKA 3KQPA 2AN4A 4ENPA 1BTOA 1DEKA 1XVUA 1EWVA 3RAEC 2X9QA 3GJ5A 4NSNA 3A4YA 4WFIA 1X70A 1Y3FE 5I9IA 2P6PA 2DPXA 3R4CA 1NI4A 2O7NA 1N2EA 1V96A 2YY7A 2YZKA 3N0TA 1TB4A 3ZS8A 3Q8WA 4C4PA 2FF5A 2HA7A 1NATA 4NU0A 1NJGA 7ABPA 3MFYA 1OYYA 2IPOA 2R6HA 3ZCUA 2IYWA 2IVFA 3EBLA 3OE4A 1M7BA 1P7WA 1B6RA 1U8CB 3EXIA 1N6RA 3O7MA 3SX0A 2PXXA 5TS2A 1QFZA 2AMVA 1T91A 5SZIA 5JNWA 4RXTA 1AHIA 2ZBEA 3Q11A 2YL2A 3TSOA 5K3FB 1G19A 1PR2A 3V33A 4FLFA 1H23A 2F64A 4OF4A 3F97A 1YS2X 1C7IA 1RQLA 4IDAA 3RIEA 1KMHA 3TMKA 3IAM6 5FWXA 1DQNA 3NMUF 5K45A 3P20A 2BFBA 4IHAA 2IEAA 3EW7A 1YB7A 1Y1QA 2AUMA 2N9UA 2YVQA 4HQKA 5JAOA 3WGIA 3RRBA 1PQWA 3CCBA 4HDSB 4J16A 3R7WB 5JW6A 1YMQA 4Q66C 3S29A 2WJYA 1S2NA 1E1QD 1WLYA 3AR3A 5FFNA 1ML4A 2OK8A 2ZB4A 4F8EA 1RE1A 2QNRA 4HQLA 4LQCA 4DT1A 4EKNB 4KX3A 1X74A 2QX9A 3K9GA 1PJ4A 1HPLA 1RWNA 3ET5A 1PRYA 1R6BX 1EFRA 2QV0A 4PYOA 3C4VA 3TZHA 4YJ2A 1QHHA 3K92A 5L3SB 1NF3A 2M6RA 5K3EA 4J76A 4ZQHA 4LYHA 4UU7A 3VYRB 3SM3A 4GR9A 5KIAA 2QM3A 2QW0X 1XQXA 2CXQA 2QPTA 2KMLA 4XYMA 1Y3BE 1PFWA 5EINA 4YRKA 1OH6A 2P1DA 3DEAA 3H2KA 2O0KA 1XD2A 2B30A 4BIMA 5BYAA 2WFAA 2NUPA 4F4CA 1JHMA 3GRPA 4AT1A 1H05A 3STHA 4R41A 4V02A 1YBVA 2POQX 2AA3A 2JAOA 3LX5A 3UKDA 1FLAA 2WU3A 1Q0UA 1RXWA 2GYUA 3W6NA 3TM5A 3T3DA 3G9XA 1J97A 3B1ZA 4MWSA 3FVRA 3RS5A 3FN4A 1QGAA 4RYDA 4DMHA 3D3KA 1KJZA 3S44A 3ZEIA 4DQ0A 5CK4A 3VNSA 2I2XB 5DBGA 3V3TA 4K03A 2GPYA 4TLLB 4N49A 4OP1A 1P0CA 4MVJG 4G0QA 1Q12A 5EEHA 4EYSA 4AO7A 1PSDA 4L4RA 5AM4A 1R4MB 4BVGA 2GF9A 1ZGHA 1KK3A 2BC9A 3L7MA 1UBFA 3N0RA 1YL5A 1DBWA 3NT5A 3WP0A 3N3BC 3RC7A 1POXA 1W94A 1XHFA 4NZMA 4GGOA 4YWJA 3QBTA 4MW5A 1EJBA 3IKTA 1FNSA 1YE8A 1MJNA 2OFOA 4IP0A 2HSEA 5GMOA 1TTPB 2MINB 1II9A 1Q1EA 1WV0A 2FSUA 2GJ4A 2OO5A 3L40A 2O8VA 3H2SA 1KAMA 3R0ZA 1NMQA 5AW6A 2C88A 5KYWA 4DR3B 2F55A 1Z4KA 3L8EA 3N2YA 3L1VA 4RULA 4FQ5A 1O9HA 5IJ9A 3KTAB 3CZAA 4LJ4A 1IATA 4NBTA 3QU5A 4UZSA 3BA6A 4ZVTA 2VYQA 2ZWOA 1XHLA 1I7SB 3IO3A 3AFMA 3SQXA 2BE9A 4OH7A 2ZRMA 3KRTA 4IQFA 4M53A 3EPHA 1CY8A 3RFTA 4C4RA 2AMLA 4ZYXA 2PH5A 5LXTA 1JEQB 4GUAA 5FTNA 4DMMA 4G5OA 3H5TA 3UB2A 2VCHA 5ER9A 1JIXA 1RC8A 1KMNA 2Z09A 3NVMB 2QD1A 4JVSB 5TVKA 1U2PA 1LSJA 1HEIA 1P2TA 2EWWA 1KSHA 4D8WA 2Q3CA 1TDJA 5AOBA 4QEDA 4Z9BA 4O33A 4WL0A 2E87A 4E08A 2QEQA 2XQJA 3QE9Y 5K6AC 3GLGB 1EB8A 3LPCA 4BCCA 1T4DA 1Y63A 4EHFA 2X1VA 3VVBA 3G0CA 2A59A 4PVDA 2HMTA 4JASB 4KE8A 4M4SA 3ENWA 3FPLA 4U5XA 1H4VB 1VFNA 3QKTA 5E4JA 3SG0A 4ADSG 3SVLA 2RGWA 2AKAB 1LJLA 4KB5A 1CEEA 4P9NA 2I3AA 3IAS1 1U9YA 1ORDA 3CVXA 4QJIA 1TKRA 2BM8A 2GQ0A 2JI6A 4DDTA 3LYAA 2D8MA 3TUIC 4A16A 4EHAA 3NBQA 2QMOA 4ERXA 1R6TA 1Z38A 2O1EA 3GELA 4M9UA 4HS4A 4IDGA 4C7XA 1PEKE 2NQTA 3D2BA 4N01A 1G38A 1RM0A 1LEHA 2LTAA 2ZSUA 1GVHA 5ALPA 5FTLA 4J29A 4HPWA 1IWPB 1ZX1A 4TTIA 2FMXA 1ZP6A 4Q9LA 5KDDA 3TXYA 1P7YA 2YJGA 5K3FA 1WD5A 3EY4A 3VHXB 1W1IA 2EC5A 2KW5A 2PZAA 4M8LA 4OO3A 3HN2A 5E9AA 4MV6A 1Z33A 1TGVA 1KR5A 1LJ8A 1PW7A 1DTWB 1FX1A 3I05A 1EWKA 4UE3S 1LB1B 2IOHA 3EA5A 3ABOB 1VM6A 3AHJA 4QTXA 4CL2A 3S70A 2QRLA 4W6ZA 3E5RA 4G84A 1XVVA 1FFXB 3L06A 2EP8A 3Q2OA 5BR7A 5J4YA 3PGA1 1SXJD 4HDSA 3R7WA 2I71A 2IYFA 2ZTVA 1LLFA 2Q7XA 3BIJA 4FEGA 4Q1EA 4NCJA 5KYKA 1IEQA 1X80B 4I7EA 4MKHA 4MVJD 1Z25A 4EYKA 3FVQA 4LJ5A 1DBIA 3RVSA 1XCBA 2FEWB 2QRGA 3VTFA 3BGWA 3AUKA 1OX5A 1UR5A 5KNBD 2JZOA 2NX2A 2XOKD 3LDFA 4NDAA 4MHSA 5DP2A 2X6QA 2RGAA 1PTKA 3D02A 3RBZA 5L3SA 4V38A 4JI5B 2RK3A 3COWA 5G53C 3COVA 1BVYF 3I72A 2XSZD 3QXJA 5EJ7A 1E2HA 4XW2A 2OWDA 2UYQA 1NASA 3IAAA 2YWDA 4HWSA 5AHKA 2X2EA 4HZGA 2HK7A 3IDZA 4UDOA 1XMSA 1J06A 4LOJA 1ECJA 3RFFA 1PNVA 3PHBE 3N8KA 1ODJA 1PVVA 3HB7A 3ISTA 3PDCA 5JSFA 1T3ZA 1O57A 2Y67A 4JOBA 2HRCA 3E22B 4XJXA 1TADA 4G97A 4LOIA 3SMVA 1KS9A 3T5AA 1UBLS 3OF5A 3IAS6 1NBEA 4E6PA 3RHSA 4ZGWA 2ODAA 3OC0A 3TTSA 3ZDYB 1SXPA 2IYUA 4RY8A 2DETA 1R4MA 4W5OA 3K1TA 3EPRA 4ALJA 2QOEA 2UZ3A 4PCVA 3K0BA 3KJXA 4QBTA 4EW1A 2NG1A 3DV0B 4HH4A 1SEVA 1W36D 2ZJAA 1VOTA 5JY6A 1ZM2A 5IAGA 1NT2A 1XMQB 2HJSA 2OG1A 5KUTA 1CD5A 2MINA 1GGVA 4QUGA 1OFUX 2HRQA 5CT4A 2UUOA 2NYRA 2GCPA 4PU0A 1ESMA 1AG9A 2WTMA 2Q2VA 1D1QA 3JZDA 3KYDB 4PONA 3PE4A 2QW1A 3KTAA 1QCZA 3D2LA 3ZV6A 4ZYWA 1V7CA 4X93A 5DGDA 4G0VA 4RSHA 4XWWA 4I8XA 1R4ZA 4FFOA 1EM8B 1JR2A 3H2IA 4FI3F 1FS5A 2NZ2A 2JRLA 1MX9A 5EKXA 1YCGA 1JEQA 3STVA 5SYAA 3AM1A 3L8HA 5JBQA 1CF9A 2YUTA 3W5SA 2ZTLA 5FTKA 1S1CA 1ACMA 1QE5A 1JYFA 1XDSA 5KTYA 2OBNA 5HOQA 4QXRA 1E7MA 1FJGB 3U4IA 1XNGA 3NGMA 5EWMB 1GSIA 3KOXA 3DT6A 3V1YA 3SFTA 4OIFA 1BVUA 3B3AA 3GLGA 4KSCA 2NNLD 1YVPA 3INYA 4UQPA 3S99A 2OP1A 4LV6A 5FOSA 1BEEA 3OP1A 3UQYS 3UMCA 2VF8A 4NFHA 4D8YA 3LUPA 1NVVQ 1AKRA 2QLNA 2IKSA 4H1TA 4I1VA 5EQJB 2ZB3A 1LFAA 4YI3A 1FXWA 4CF5A 3PXDA 2IYQA 2R11A 2AK2A 5B53A 2J9RA 4HXFB 1LGYA 2I54A 3LUJA 4MGEA 521PA 3LECA 1TO6A 1QIGA 3W5UA 2QBYA 3VX3A 1B8PA 1ODLA 1U80A 4I9GA 5AI5A 4TQ9A 1NX6A 4MRMB 4OGGA 3LY8A 1H3FA 4FIZA 3QELB 4CV0A 5J43A 1SQGA 2E37A 3PRHA 3I2IA 2ZB2A 3H83A 3HJAA 1YZNA 1JT9A 1O95C 4WX2B 5I9BA 3GN1A 4L0QA 1K8QA 4DC0A 2X9NA 3VHXA 4HNUA 1NOJA 1MGOA 3D0QA 3GIDA 4OYHA 4M6WB 2PFGA 3QOWA 4MICA 1D4AA 1YDFA 4V24A 3PEEA 1DTWA 1W85B 3HJBA 6NULA 5DBOA 1I6LA 3G1WA 5JADA 1UKAA 2RSLA 3U5TA 4LEIA 5EHZA 5LXTB 4M0UA 3A28A 4N7MA 3ANNA 3UTDA 1JL3A 1M83A 1FFXA 5E0OA 5CLFA 3D31A 4AS1A 3E1KA 2YXEA 3RKUA 4G1EB 3OO0A 2E1PA 1X8LA 1POWA 4RU1A 3MCTA 1X80A 4FGUA 3FGOA 3WV4A 4BV3A 4N3NA 1WB6A 3OFND 1COZA 2AG1A 1PFKA 3FCOA 3G8DA 1ACJA 1VKRA 3FDIA 3KXLA 1N3YA 4HG2A 3ECSA 1MJGA 5A6SB 2NZWA 4A0FA 4DABA 3FCUB 2W6NA 5BURA 1HT0A 2XCTB 1P33A 3U48A 1TYCA 3ZGNA 1SC4A 3FGPA 3A1TA 4BYMA 3K94A 1EGAA 1AJEA 3D43A 1TPYA 2NNWB 2C2BA 3FNHA 3MJTA 1H4SA 4DCUA 1ARZA 2BDEA 4EG6A 1RS0A 1DP4A 4HSEA 4DLSA 1F4LA 3C3KA 3E70C 1ND5A 4EKDA 2VPZA 2DWPA 2ZE6A 3FUCA 4OHCA 3DDWA 3C6YA 3NS7A 5ALTA 3E22A 1SB8A 4CDRA 2KSQA 2IHUA 1XNHA 1ZL0A 3SBEA 3BTUA 1GU0A 2QD2A 1XDDA 1JR3A 3M5DA 4P2GA 3SSAA 4BGVA 1AMUA 4NBLA 4EGJA 2VBIA 1TT5B 3S81A 4A6DA 1L4GA 4DLRA 3DGFC 3N5KA 4UUQA 2OZEA 2P77A 1HLGA 3RU7A 1MPXA 1R0BA 2G1UA 1OFVA 3FNIA 5AMXA 4EVRA 2BGGA 1P61B 1KVQA 4JL5A 4MV7A 4KH1A 1GO2A 5ESWA 3AP2A 3QEKA 5CITA 4AUNA 821PA 3DV0A 3KSRA 1WV1A 3DQZA 5FB3A 4FEYA 1H0SA 3HLYA 4YFVA 2FF7A 3LWZA 2WJZB 2ZSDA 3V4FA 3DZBA 1JAZA 4QDTA 1JG2A 2C04A 2PUTA 3KYDA 4YJFB 1ICEA 5FOXA 1ZOOA 1PQUA 4OMCA 2DSTA 3RHTA 4G9EA 2IELA 1KGDA 3ZW7A 4DV5B 4Y1GA 3ETNA 2Q6IA 1EFUA 1AHPA 1EM8A 2C61A 1RYYA 4RZIA 5I8ZA 1JDUA 1ZG3A 1P0IA 2YN0A 2J0EA 1ZVVA 2IA5A 5SZHB 4ODIA 2HU8A 1SNYA 4ETWA 5KSZA 3T94A 3NCTA 1A76A 1TAGA 2E4UA 2G7ZA 3SM9A 4HQNA 1RIIA 1L4EA 1Z2AA 1M9NA 1FBNA 4MTCA 1H9CA 1H65A 3BSYA 2OGUA 4N5IX 2FPWA 3HY6A 5EWMA 1HTTA 1ELOA 1V7QA 5J2UF 1TW3A 5ILOA 1I7NA 1TF2A 3DE4X 4IM7A 3P5SA 3ONWA 1IYZA 3Q98A 3AI7A 2G5CA 3I9KA 4BVHA 3X1DA 3ZD6A 1FDWA 4YK7A 3MAJA 2WVGA 2WABA 5FQOA 1BE8A 3RS3A 4D7AA 1ZIYA 2UXDB 1KC1A 5AJYA 2YWRA 3ZGXA 3CEJA 3GAAA 3L6CA 1SC9A 2JVIA 1YE3A 4OGWA 5DCYA 4XEHA 4BQEA 2C9DA 5DTIA 1DG9A 1FDIA 2QYOA 4URWR 4WBNF 4I50F 2AB0A 4DNOA 2Q2QA 2XA2A 2ZIEA 2OA0A 2X1MA 4PF1A 4OHXA 3ZK9A 5KOIA 3PQ7A 1KJQA 1SELA 1JHOA 5AQ1A 3PNYA 2D13A 3I34X 4MRMA 1ZLXA 5F4BA 1XZQA 2LKDA 2C2WA 3QKIA 1DBPA 3QELA 3CINA 1N2CE 2WIAA 3DTTA 3HCNA 4FHGA 3W6ZA 6LDHA 4LE2A 1TZMA 2AMYA 2GT1A 1LY1A 1IHYA 4B5LA 3M1IA 4IS3A 3PUKA 1T25A 3GJTA 2LD4A 1TVKB 2Q07A 3MCVA 2XTNA 1YI1A 4N0DA 4M6WA 3ISJA 1T3LA 3AGPA 1W85A 4P7BA 3WZLA 5ITSA 3QJYA 3WX0A 4W5TA 2CLOB 2XDWA 3AOGA 2XTJA 3E84A 4M8SA 1VC2A 4E5UA 2FTKE 1KVSA 2JGMA 3KSZO 4P35A 5H82A 1P4HA 4I2VA 5IJXA 2Q3MA 3TLEA 1QRAA 4EECA 5FV7A 1O6FA 2NO9A 4BO2A 1TIPA 5HZKA 4E21A 1NQ5A 1H6AA 3HFSA 2TMYA 3ML1A 8AT1A 4HN4B 2ZRCA 2X6RA 2A84A 4M46A 5TE9A 3RYIB 5DLQC 5K0TA 4C7OB 1TQ8A 4GZ3A 1LPBB 2PUWA 3FSGD 5A6SA 2BEJA 2CEAA 2XT6A 1AQNA 4R3WA 1ZHHA 1HE8B 5FOWA 3BKXA 5BN1A 1GG2A 1SHZA 4W9MC 5I7EA 1OWNA 2QTBA 4Q1FA 1Y5LA 5KTPA 4JI4B 4P32A 3EVTA 1PJ2A 1CNFA 1ZM9A 1HYBA 4U7HA 5AOVA 2QD4A 1E6UA 1FTNA 2JFBA 4BBZA 4O4LF 2AXEA 1JHVA 3LW7A 4AN1A 3EDCA 4ZJYA 2GTHA 4X66B 3FTEA 4AAYA 2AR0A 3R3HA 1VDZA 2H3HA 2W37A 3R9KA 4H7PA 2NP7A 2O52A 4Z1MA 1H4TA 1TNDA 2MTBA 2P3OA 1Q7GA 2P9QA 2ZIWB 2H07A 4OA5A 3RGWS 3IC5A 2BGWA 3AJEA 4KXWA 4GMKA 1TT5A 3U13A 4OQNA 1HLPA 3N2NA 1L7MA 1GTRA 1C9MA 2NSJA 3CQ9A 4BGUA 1P7CA 1QYDA 2EFDB 3B82A 3G9QA 3FPSA 1J0EA 1JJIA 2NZUG 5BSVA 3ZVNA 4G5QA 4MVJM 2VDQB 1YZQA 2WMNB 2N1BA 2XCQA 3ZWKA 4I3GA 4N76A 5G02A 1M0TA 2ZTSA 5JAMA 3GVHA 4HNGA 2IT1A 5ALHA 4RLQA 1M6EX 2P3LA 2R6JA 4LYEA 4PV7A 3WIBA 4WAUA 3D2CA 3ZQJA 3K6JA 4Y2YA 4LFCB 1AGRA 3HB0A 3TIFA 3ZXXA 1X15A 4LF7B 2EEPA 1II8B 2C3UA 4XGRA 4YJFA 2XMBA 4EI2A 4F84A 4GZ5A 4KKVA 4Q48A 1HOXA 3V42A 4DIEA 5B37A 3BL5A 4KRFA 1BMQA 4OK5A 3AP1A 2TMDA 4HLUA 1X6VA 4FNGA 3HA3A 1NVAA 3D7NA 3IT2A 4M1KA 3RVLA 2HMYB 2XYHA 3EFOB 4CCSA 2ZXFA 3DB1A 4M8KA 4UXHA 1FUUA 2HHJA 4JVMA 2W9XA 1Y4SA 2JRCA 1P29A 1DWOA 1ZJ4A 2EBUA 3DE7X 4ZCLA 2VDVE 2QE6A 3PENA 4MMYB 2EJCA 1T9GR 2XRYA 2VHWA 3K0AB 3EG9B 3ZOZA 2OC9A 4BO8A 5CD1A 4O0MA 4GLLA 1M2NA 2XUKA 3JQPA 2Y71A 3MTAA 5DASA 3SD7A 1U0SY 3L1HA 3QVGB 3ZNOA 1RI2A 2NZVG 5JSZB 3JD0A 1JYEA 3K15A 3ASZA 1ADBA 4CIVA 1ZHFA 4ZQCB 4HAOA 4O63O 1UBKS 5EMHA 3INNA 5CDFA 4MAMA 5AHOA 1SUIA 3B2QA 2QVGA 4M7WA 2PMFA 4TRMA 4D8UA 3O3MB 2FPIB 2W6IA 2JGIA 5HRUA 4DUPA 2GEUA 4F46A 3KOWA 1A9ZA 2IQ5A 4WBSA 2G77B 4J90A 2GCNA 3MTIA 1X7XB 3I6MA 5K3BA 4CL8A 3FOFC 2DJ5A 2H9YA 3V6MA 4HAYA 1Y37A 4XE5A 2HREA 5EZQA 5ER6A 4DILA 2VJYA 5KYTA 4IUDS 3IEVA 4FE4A 1OR8A 2O5CA 2GBFA 4BLPA 1F3OA 3NZEA 4C4AA 4KLCA 4WK4B 2FSPA 2CYAA 4WHMA 3DC2A