2YC4C

Intraflagellar transport complex 25-27 from chlamydomonas
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
198
structure length
177
Chain Sequence
b'KPIDITATLRCKVAVVGEATVGKSALISMFTSVVAPVTIPDTTVSVELFLLDTAGSDLYKEQISQYWNGVYYAILVFDVSSMESFESCKAWFELLKSARPDRERPLRAVLVANKPPQRHQVRLDMAQDWATTNTLDFFDVSNPPGKDADAPFLSIATTFYRNYEDKVAAFQDACRNY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTRAFLAGELLAR TRANSPORT PROTEIN 25
publication title Crystal Structure of the Intraflagellar Transport Complex 25/27.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Transport protein
total genus 52
structure length 177
sequence length 198
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2yc4C00
2XX3A 3X1YA 2X2EA 1FTNA 2UZ3A 1ZNYA 2YC4C 4A0RA 4D81A 4EJSA 5FPHA 4QL3A 4RKFA 1CRQA 5CM9C 1UBEA 3P1JA 4EJSB 3PUXA 2OAQ1 1W36C 1S96A 1G6HA 1G19A 1XCPA 3OIVA 4PR0A 4ABYA 3HPRA 4A82A 3U44A 1XEXA 2A3RA 2R65A 2DYKA 3U4QB 1QHSA 2QGZA 5CDFA 1ZM4A 2PLFA 3I32A 3NHBA 3BH7A 2JJ1A 1U9IA 2A7QA 1DS6A 4A1FA 2VO1A 2G9NA 3PR1A 3VFDA 5AJVB 5L3SB 2X1VA 2AWNA 5LB2A 5EZ6B 2AKYA 2ZYUX 3SJBA 2BMDA 4PHHA 3IIKA 2C78A 4A0HA 1PUIA 4IHQA 4EFLA 3AKDA 1PLLA 3H84A 2LWIA 2GZAA 4QJ4A 4HAZA 2ODNA 2FJUA 3BB1A 3CWQA 4JZKA 2FFBA 2VP5A 4ZPXA 1UKYA 3GMTA 3CB4A 3U7EB 1YR7A 2J87A 4ASUD 4AG6A 3U6KA 2Z83A 2R62A 1RRCA 4BASA 4A6PA 4QGFA 4TMVA 4PQFA 2OAP1 2KB0A 3WHLA 1I4LD 3K9GA 3T1TA 4QHSA 1S2MA 2NIPA 2HF9A 2OZEA 1ANKA 1R10A 3PITA 1UFQA 4TT3D 1TPZA 4URVR 4E07A 4M1KA 3GJ0A 1XCMA 1Z6TA 4Q7JB 4Q66C 4DDTA 5K8IA 3RYTC 1NLFA 1E2PA 1I2MA 1S1CA 5D3MA 2WWYA 3QVUA 3PJRA 3W3ZB 2WIAA 3KXLA 1AK2A 5BN4A 2O0HA 2A5YB 1YZNA 2EFCB 2CE2X 4ZIRA 1HYQA 2QPAA 1MO6A 1FX0B 1S1MA 4FINA 4KBFA 3NBYC 1D9XA 3ZD6A 4UNSA 1J99A 4PZYA 1YU9A 4AY2A 1N6PA 1ZC4A 2IC5A 2QE7D 2IYTA 1D2MA 1GL6A 3QKTA 4DWJA 1AGRA 2YYZA 1RRGA 3S1AA 4P4TA 4FWIB 1MRNA 2I1VB 3BC1A 2V4ZA 3EA0A 3TGPA 1Z63A 1GRRA 3N2EA 3S1AB 1NY5A 1G7TA 3IQWA 2RGDA 3DDCA 5DN6D 1EK0A 1AZSC 2OE2A 3GEIA 4LC1A 4QHTA 4TL9A 3CBQA 4YMSA 5FOTA 4MA4A 4QJ5A 5LBIA 3KUCA 2NO7A 1R2QA 3BRWD 3SBEA 2VSFA 2AFHE 4IFEA 1HT2E 2ZR9A 3VHXA 2ZJ2A 4L4UA 3KQNA 2FPKA 2Z4RA 2GAAA 4MDFA 3FMIA 2G88A 4URXR 1I2DA 1NMZA 3E70C 4UJ3A 2YINC 4V0OA 2DWOA 1D8TA 4DT1A 4QRHA 3BORA 3GLFE 1KI8A 4HLCA 4PSVA 1XF9A 1D2EA 1QVRA 2GESA 3GLHA 3QPUA 2E9SA 1G5RA 2ERXA 1DAFA 3FKSA 3PENA 2CVFA 4DLYA 4FD2A 3C5HA 4HLQB 2KE5A 4JL6A 5CLQA 2J7PD 5B57C 2QORA 2JLZA 2FN4A 2KJQA 3A36A 3ASYA 1NVVR 2XEXA 1VG1A 3AF3A 2GXQA 1CJTC 2ORVA 5HE9A 2W0MA 1VIAA 4OKSA 1OB2A 3TAUA 1P9NA 2JASA 4XIGS 3GJ3A 2GXAA 3EZ7A 3FHCB 4BRUA 1ZUHA 2WJJA 5CB6A 1GRNA 1P2VA 1RVDA 2H16A 2IYWA 3K53A 4GOKA 4IRUB 5HZHA 1EFUA 3U6BA 4WZBE 5AR1A 1G7SA 4HAUA 1F2UA 1G291 4OQXA 4BLPA 2HXSA 1ZU4A 3I73A 3VNUA 1GKUB 1KZGB 4F4CA 2BV3A 4UXJA 5TXGA 1SQ5A 4RZ3A 1KMHA 5FUYA 1JECA 4OHZA 2JLVA 5IDVA 5JS7A 2XZPA 1XXHE 5EP4A 3CR8A 1F5NA 3LLUA 3KKMA 4EIWA 3PQCA 4P4SA 3ZJYA 1SZPA 2GKSA 4JLOA 1ZCAA 3QKSB 4CT4B 3EZFA 5FI1B 2ZYTX 1GNPA 2QAGA 4N1AA 1W4CA 1J8MF 2D3WA 1SKYE 4EPRA 3PEUA 2QAGB 4E03A 1OYYA 4G5SA 4RFVA 1BMFA 3CNLA 3OE7D 3Q8XB 5EUMA 3VU9B 2NZ8A 2DCUA 3CWZA 4AI6A 2V6IA 1NIJA 1QHIA 2OLKA 1N0VC 3BXZA 1HURA 1ZMXA 4ZDJA 2HJGA 2KI5A 3PG5A 3PUVA 4R2IA 4GNKA 2ZETA 1AM4D 2PX0A 2QP4A 4DSTA 5LD2B 1R8QA 4LRWA 3Q72A 1ZIPA 4TL7A 4JKYA 3TQFA 5BN3A 5FL7D 1DAMA 4JIMA 5FUXA 5IK2D 1CR1A 4MGIR 2JLUA 1PLJA 3SZRA 1OH8A 3A1SA 1OXUA 3DMNA 3J81k 1P73A 2B6HA 1XTIA 2DFLA 6Q21A 4Z8YA 1T6NA 4IOKA 1W36B 2CLDX 1E3MA 4EPYA 2WPDA 4FMDF 1GTVA 3B9QA 2QA5A 4PFSA 2ATXA 3SJCA 2ZE8A 5JWRA 3B1ZA 1E98A 4M8NE 2H92A 1QDEA 4GFDA 2GXUA 3CX7A 1AN0A 4B3DA 4V0ME 5IHPA 5BYKA 1Q3HA 3IUYA 1N6RA 1NJFA 2XTZA 4RD0A 1AS0A 3GJ7A 3CZQA 3SHFA 1LTQA 4V0LA 2JLXA 3C8UA 4TWZA 3R8CA 3CZPA 3KKQA 3QY0A 4QGAA 5E3HA 2FFAA 2IYLD 3K0CA 3EG5A 1SHKA 3I8XA 4LCBA 3K09A 4JSYA 1Z83A 2XOKD 4CDGA 3AP3A 1EX7A 2JATA 1KZ7B 2GRJA 2HV8A 1CEEA 1Q1EA 5C1BA 1Z06A 1XZPA 1OIXA 2H7VA 2PEZA 4QBIA 1A2BA 1RW4A 1P4SA 2ZU0C 3K0SA 5ANRB 4Q5IA 2A2ZA 1YJ5A 1QG4A 5HR5A 5FBWB 5J4YA 1U0HC 4ACBA 4F91B 3QXXA 5K8LA 2X19A 4Q4JA 3CRVA 1KSFX 2P0EA 1G8GA 1BO6A 2W58A 1EGAA 3GCGA 2FEOA 2MMCA 2WIBA 1GITA 1XX6A 3DM9B 4EAQA 2XNDD 3CIOA 4B35A 2QTHA 2ZUCA 3LO5A 1E0JA 2IX3A 2G3YA 4HAYA 4Q03A 4Q9KA 1ZU5A 1FTSA 1IN8A 4RFSA 4B44A 4G1UC 4TYNA 1XFAA 1KGDA 2PT5A 1EX6A 4NU0A 3TW4A 1IY0A 3CW2A 2IK8A 3KKOA 1B0UA 1OHHA 4M1MA 4BFUA 4FCWA 2QMUA 2QM7A 3FGNA 3KJGA 3CKLA 2ZUDA 1TF7A 3K9NA 1W5SA 4A8JC 5L3VA 2P6UA 4V0KA 4C3ZA 3OESA 2ZR0A 1XPRA 4ZCMA 3C15C 1UDWA 4B76A 1OXXK 2ATVA 2GJ8A 3GQBA 4TMKA 1NVVQ 5FPYA 1T8TA 3BE4A 1Q1BA 4M1OA 3I8SA 4TSFD 1ZM3A 4C9BA 4BFYA 2IHYA 4QBGB 3HR7A 2FSGA 1H8HD 3H4MA 3I92A 1OFUX 1G8PA 1YRBA 1GAJA 1M1YE 1TTTA 1E1RD 4YXWA 4CZ2A 2WJVA 2VP4A 1JNYA 3X1WA 4KHZA 2VLIA 4NYIR 1JI0A 2RAPA 2GNOA 3EC2A 2Q21A 1KI1A 5TVKA 1WXQA 2CCGA 4BFWA 2OT3B 1G5TA 3GFPA 2Z4SA 1NNEA 5DI9A 4URUR 1GL7A 5JEEA 3B1VA 1G3MA 3RDPA 3GLIB 1E2QA 2P6RA 1P2UA 5J5CA 1BH2A 5BN5A 1FUUA 4HEJA 2WMNB 3VHLB 4OHWA 4ZKEA 1HUQA 4LUCA 1GP2A 3B13B 4GSYA 1U8AA 2PL3A 4JKIA 1H8ED 3RRNA 1TEVA 5DI3A 1FQJA 1R0WA 4TLBA 4E09A 4JJZA 2ZITA 5KUTA 4OQNA 3IEVA 2X77A 1VECA 1US8A 5JEDA 2O8EA 4H1UA 4ACAA 1US8B 2WJHA 1ZM2A 3UWOA 1XDBA 4TYQA 1JQJC 2ONJA 4DCVA 1XD2B 4DLXA 2YZ2A 2ZRPA 4PPQA 2YC2C 2ERYA 2L0XA 4TMWA 1CJUC 5KSZA 2WKPA 1PJRA 3RABA 2ODEA 1Q44A 4DLTA 3NXSA 4MRVA 4M2LA 3EASA 1M7HA 3THYB 4BFTA 5SZJA 3BH0A 3CRRA 1EFRA 4B2LA 4BFSA 3KXIA 1W44A 4HLDA 2XNSA 1DO0A 1LF5A 2BKEA 2F1IA 5F2EA 3WRXC 3E5HA 2A5FA 1T3SA 1RRFA 3MG9A 4KLZA 2GDJA 1DELA 4OQLA 2O8FB 4XWKA 1AQUA 1W36D 1HTWA 1KMQA 4O2LA 3LFUA 4M1YA 4KU4A 2XXAB 4D25A 4D0LB 1A5TA 2YWFA 2NG1A 1NSTA 1E2FA 3OHMA 4L9WA 3ZIAD 3DM5A 3PEVA 1PV4A 4C2UA 1R5NA 4Q4AB 3ZVNA 5EE0A 4MKGA 1TEXA 1ZJ6A 2A9KA 2HLDD 3GFOA 1W1WA 2XB2A 2ZI9A 3HYTA 5HPYB 2AX4A 1XEWX 2WJGA 3SC3A 1EWQA 3CF0A 3U3RA 1F3OA 1MH1A 5CYPA 4W7SA 5K8UA 3GJ4A 2QPOA 1VYUA 4KVAA 4TMXA 2CHVA 3AGPA 3BFKA 3VR1A 5KYKA 2RHDA 5JCZA 1MO5A 2ORIA 4LHYA 1LF0A 3KJHA 1HH4A 1UBFA 3D8BA 2FH5B 3CUEF 3UATA 3VR6A 3P4XA 4OI2A 4F93B 3KQLA 5EJEA 1GUAA 3AQ4A 4M9ZA 3SYLA 4US2R 2QN6A 1WMSA 3I5XA 2F3TA 1TMKA 1G20E 5C18A 4TZ6A 3CX8A 2QTVB 5FUVA 2AR7A 1DBSA 2J59A 3JZAA 1Z47A 2C8VA 2NPIA 4HUQB 1I4DD 5FL3A 2WTUA 2QMOA 2EWVA 1QRAA 3LAWA 4UNNA 2ZAMA 2OBMA 5H70A 2C9CA 2H57A 2D7CA 3CX6A 5EE5B 1GIAA 4RVCA 3PUZA 1ZD9A 2ZR7A 1IY2A 2AFIE 5K8TA 4V03A 4DSNA 4MRRA 1ODFA 4IDOA 2RGGA 1GDDA 3IO5A 3KX2A 2IUTA 4RZ2A 2NOAA 2PCJA 3B9PA 1C9KA 4MYHA 3W34A 3GLFB 1Z2AA 3N5CA 1CLUA 3LW7A 4IVRA 4M9XA 3U7HB 5HKKA 4HAVA 3ADCA 4UNQA 3AVTA 4WXPA 4KFTA 5AUOB 4HZUA 4AKGA 1Y63A 1AGPA 1L7VC 3RS5A 2O0JA 2K5UA 1XTJA 4LJYA 3MD0A 3BAFA 2JJ2D 4Q1EA 4MUBA 2OCAA 3QF4A 5E7JA 4A92A 2W6IA 4BFVA 4ZDKA 1RZ3A 3IKJA 4BE7B 2PZEA 3QF4B 1G4UR 4NYIQ 4M1TA 4NCIA 1N6OA 4L5BA 3QNUA 4JVNA 5EE9A 5CJ2A 1GSIA 5KNBA 1AKYA 2Q3HA 3MSXA 4KO8A 3RVBA 1FUKA 2ZJYA 1OXTA 3X1ZA 3EAQA 1KJWA 3B60A 4KAXA 4JVLA 3X2SA 1OIVA 1MABB 4M22A 3AM1A 1AS3A 1UJ2A 1G7CA 1SVLA 4A8JB 1YZKA 1TQ2A 2DFTA 1NVXQ 3CPEA 5IRCD 4BEJA 4HLUA 5JECA 3QKRB 2GA8A 2IA5A 2PMDA 5TARA 4DUGD 3CPJB 1TUIA 2DR3A 2GF9A 3EPJA 1Z8FA 3ECCA 3NH9A 4I1UA 1U2RA 1VYTA 4Q4LA 3V4RA 2HJVA 1LV7A 2MMGA 2Q9CA 3VQTA 1QVAA 5CM8B 2QP3A 3KQUA 4Q1CA 2OXRA 4D0NA 4CF7A 2FA9A 1AJEA 5FTLA 3L2OB 4JVSB 2ORWA 1FNMA 1WBBA 4Q01A 1N5LA 3QENA 3W3AA 1SKYB 3TSOA 3KTAA 3L0PA 2GZHA 3L0IB 1U99A 1HY3A 2IXFA 4RY2A 2H17A 1L4UA 1Q3TA 1GFIA 4EUNA 1E79A 5P21A 2J46A 3EZ9A 5DYIA 5GJCA 1YQTA 3NG1A 4B75A 2ODWA 4RSGA 4I4LA 4OBEA 3AUXA 5E95A 5IF9A 2O8DA 4LBWA 1N6NA 4AURA 4UJ5A 5AK0A 3IPYA 1BYIA 3H0KA 2VP0A 1E99A 2WOJA 4QXAA 1K8RA 4EQ6B 4V02A 1L2TA 2BOVA 2KSQA 3AGQA 4FXPA 4DLVA 3U61B 4NMMA 4MGYR 3R20A 2QI9C 2PH1A 1DPFA 1OPXA 1ZC3A 2ZSBA 4JL5A 1OYWA 1R5BA 3CPHA 1TUEA 4P3YA 4TMZA 4PC3A 4AK9A 1KDPA 4P4UA 1JR3D 2JDID 3TLXA 4NL4H 2P5TB 1G3RA 5KDOA 1KI9A 2CEAA 2I1QA 4QC2A 4EPTA 2F7SA 4PO9A 1ESMA 5KO2A 3AVOA 3UIEA 3C4JA 1DAIA 3OFND 3R8FA 4LX0A 5EE1A 2HXYA 1OKKD 1M2OB 4YMVA 4ZKDA 3K70D 1UBGA 3RRMA 3WYGA 2IBMA 4DXAA 2VP2A 1S4QA 2IF2A 2BDTA 2HDNB 4KBGA 2YHSA 3T15A 1CR0A 4B3CA 2OG2A 4G5OA 4B33A 2XZOA 3GLIE 1CKEA 3BS4A 3NWJA 3FFBA 1P7CA 1G8YA 4UKDA 5JS8A 3OEHA 4OHVA 2W2XA 4FMDB 4I1SA 5JRZA 2V7QD 4X8OA 3AP2A 3FHOA 4NCHA 1FPMA 1V5WA 3NDBB 1GKIA 2EFEB 5UKDA 4XSHA 3NKVA 3RC8A 2CDNA 2FEMA 1WDTA 1COWA 3I4LA 2PJZA 3SYKA 5JI2E 2QBYB 2ZI3A 4TZ0A 4KSBA 1KYIA 3GJ5A 2CNWA 4K46A 4PC6A 2LKCA 4C0JA 2EYUA 2EQBA 1GOTA 2WSSA 2I4IA 1KK3A 3QOFA 4LHVA 3ZGXA 3TW8B 3VMFA 3AV0B 3KKPA 4XWOA 5FBRB 4F92B 1LVGA 3U44B 1XEXB 1TU4A 4CRWB 2Q0HA 3THOA 1GM5A 4MDEA 4A0GA 5FOUA 1N5JA 1E0KA 2R6FA 2P2LA 3RANA 3Q3JB 4E5UA 2BCGY 1ONBA 5H68A 1KO1A 4G5RA 4Z8XA 2GCPA 4IEEA 2FPMA 2QTFA 3K1JA 1F6BA 3AB3A 3TRFA 2GBLA 3RAPR 1G4AE 3TIFA 2IYVA 2C77A 2J3EA 3ZQJA 1LB1B 2QSYA 2N42A 3K0CC 4LBZA 4PX9A 4IW3B 3K09C 5FOSA 1P62B 4LOAA 3TUIC 1JR3E 4KFUA 4LSGA 1Q1ZA 4DCUA 4LGMA 4AKIA 3IPXA 2DFNA 4KSCA 3IEUA 4Q7LA 3ZZTA 2RGAA 3TK1A 4BLTA 4U00A 4DLZA 2J41A 5GADl 2Z0MA 3E2IA 1SVWA 3EX7C 1QG2A 2R6DA 4RCYA 5BW8A 1D9ZA 2IEZA 1DAKA 1UPTA 2ZUBA 4IOMA 4D80A 3ADBA 3L82B 3WMEA 2ZRJA 3SJAA 4G3XA 5E4FA 2B7BA 2MSDB 1E96A 2AXNA 4A0FA 4C2TA 1P2SA 3QPWA 1TF2A 1X8LA 1FFHA 2FE4A 1G17A 1RJ9A 2GCNA 1XNJA 4GPTA 1W0JD 3THXA 5FTKA 4JT2A 4LJ6A 5D3MB 4DC9A 4DEXA 2CLSA 4KCGA 1RJ9B 1XB2A 3P26A 4PHGA 3HDTA 3ZVRA 4US0R 4ZIRB 3MRSA 2ZANA 1GVNB 3LX5A 3LVRE 4C0BA 3FE2A 5FOXA 2JIZA 2Y8EA 2XJ4A 4NE2A 1YZGA 3BD9A 4NHOA 1TADA 4CIDA 621PA 2GK6A 4PZZA 5EXSA 1E69A 3LLMA 1G64A 1KI4A 2ZI7A 3Q9LA 3T34A 1ZCBA 2KBFA 4TMTA 1OH7A 3EPLA 4DSUA 4MRNA 1G3UA 2J5XA 2Z43A 121PA 1E2KA 4M1WA 2BHRA 1SXJA 1OH5A 2J0UA 1XBTA 3F8TA 1Z29A 1VG0B 1JB1A 2GK7A 2CE7A 1ZW6A 1ZYUA 1XMIA 2PZFA 3DEFA 4ESHA 2CK3A 3HR8A 3ZYCA 2BC9A 1E1QA 1Q22A 2OHFA 2AN9A 1J90A 4LI0A 3U3MA 3GLGA 1OLOA 1TQDA 2JCSA 2ZRFA 4DT1B 4Q7MB 3SFZA 2BMFA 4HSEA 2IUSA 3GLHB 4XD7D 1GILA 2SHKA 3CF2A 2ZRNA 3GJ6A 1XEFA 2O0KA 3KB1A 3QF7A 2ZRHA 4OJKA 5FI0B 5A5GA 4MH0R 3LW8A 2P6NA 2CHQA 4AKHA 1T5IA 5TMPA 3VKWA 1OT3A 1QHHA 1S3SA 4OL0A 3KKNA 2VP9A 4MYTA 2IYSA 2GJKA 2ZRAA 1EESA 3BERA 2ZE6A 1IJFA 4XVQA 2HT6A 3LBNA 4P31A 4DDWA 4W9MC 3OEEA 3D31A 2VTKA 4HYYA 4Z1MD 2IS6A 3L0OA 3L43A 4HB2A 1F2UB 3ICQB 1LS6A 2EYQA 5GVSA 4O0MA 4OI0A 1KSHA 1LNZA 1PUJA 4BGDA 1YRAA 1Z0KA 2C9YA 4LHXA 5LDDC 1YE8A 1KI2A 1KMHB 3D7MA 3M1IA 2X8AA 3NVAA 2YOGA 4WA7A 1ZUIA 3P4YA 4P4SB 3SJZA 3MCAA 4FCVA 5FPTA 5KSOA 1UKEA 1VIYA 1KK0A 2H5EA 3ZDQA 2R9VA 3C5CA 1AA9A 4C4PA 2GWHA 4GBMA 3O8DA 4JLJA 1IXSB 3GJ8A 4BEBA 1W4BA 3CNOA 4ZI3A 221PA 5TV2A 1ZD8A 4HB4A 4HB3A 4TLAA 3JZMA 1RC8A 2C99A 3RWMB 3TVTA 4M0LA 2GVDC 4QM7A 5FTMA 2XB4A 3RNLA 4A15A 1CR4A 4GI7A 1IM2A 1MKYA 2JJ1D 4DIEA 1R0ZA 4LK2A 4HB0A 4C0AC 3EIHA 3O8RA 2B8WA 2GXSA 2IS2A 2A30A 3K8YA 4Q4HA 2D2EA 3U7GA 3LXXA 4LDJA 2GJSA 4Q4HB 1KO7A 4JLMA 5JRJA 3QSYA 4EFMA 4ILEA 1RE0A 2OESA 2ZTSA 1GL9B 1W2GA 5JFGA 4A6XA 4RZXA 4ZO4A 2VH5R 2ZI5A 2AD5A 2FZ4A 2YVUA 3AH8A 4G5GA 4R71A 4RCZA 4LV5B 4U02A 1EFCA 2VSOA 5G53C 3MJHA 2AL7A 1NG9A 3NC1C 3KFXA 1K6MA 5JJKA 1OFIA 1NN3A 4GT1A 3N70A 4C0LA 2O8BA 5F98A 3DVLA 5J40A 1DG3A 4FIDA 3MJRA 4HUTA 2VRWA 1Z5ZA 2FG5A 5AJWA 1V43A 3EARA 4BUJA 4Y0AA 5FOWA 2FV8A 1KI6A 4KYUA 3NTUA 2ZVPX 1XP8A 3QEJA 1N0UA 1Q21A 5EZ5A 5H1YA 1KI6B 3D6TB 5AUQA 3T1VA 4RJLA 3FMFA 1R0XA 1KDTA 1ZINA 3KXKA 2HEIA 4URYR 3TNFA 1F2TA 2VHTA 1IN4A 1S9DA 2DBYA 1NG1A 2JLRA 3WNBA 3VKGA 2W2TA 4P32A 2IYYA 4PPGA 1HE8B 2CHGA 1UF9A 4UQOA 4DCTA 2FPLA 1W0KA 4DLRA 3K0AA 3VAAA 1MT0A 3DZDA 2REBA 2OBLA 2V55B 1ZM9A 2ZSDA 3CONA 3K0AB 4Q4JB 4X8MA 4D0GA 4EPXA 1YZLA 1UM8A 3CM0A 4R98A 5IT5A 4QBFA 3EIQA 1BS1A 2H1LA 3K9HA 1VCIA 4BFZA 1U8YA 2CJWA 1CIPA 2ZROA 1E2MA 3IILA 3EPKA 4M9SA 3U3JA 3ZS8A 4NCKA 5CDFE 1A1VA 2KWIA 1T5LA 5C46F 3BK7A 1YR8A 4RFSB 1IN5A 4JS0A 3FHTA 1P61B 2REXB 3AVYA 4U7DA 1KTVA 2B21A 3B6EA 1P6XA 4NDZA 3LD9A 1IY1A 2HUPA 2B7CA 5C2JB 1Z08A 3Q5EA 2J7KA 5FTJA 3CRW1 4JJKA 4B3FX 4CT5A 3FB4A 2Q9AA 1E2EA 3FKSD 5DSZA 1E9EA 4M4SA 5EXXA 1EWRA 3UK6A 4S2EA 5FTNA 4HLUC 3A4LA 5B2ZA 5KTYA 4CEJA 2J9RA 1ESNA 1WBDA 1MR3F 2EFGA 4TTPA 4DLWA 1R7RA 5JCPA 1JAIA 4DJTA 1KKMA 1FQKA 3OAAA 4QNRA 3I72A 3AVVA 3FTQA 2OCPA 2ZYWX 3I61A 1XJ0A 2NO0A 4PSKA 2HCBA 1YZUA 4DDVA 1CULC 2G0TA 3FPAA 1NBMA 2XTNA 4BZXA 4NCJA 2ZEJA 2PJRA 2ZS7A 4RD1A 2HF8A 1DARA 1XU4A 4DCSA 1NLYA 1OH6A 4QM6A 2VYFA 1IBRA 4TTQA 3ASZA 1HQYE 2ZRCA 3LH5A 4PHFA 4RD3A 3VX3A 4DB2A 1RKBA 2W6JA 4DVGA 4IVPA 1ELOA 4PC7A 2FDCA 4DHEA 2WWFA 4LJ8A 1T0HB 4BQSA 2CLCX 2FX3A 2G6BA 1EG7A 4AC9A 2CVHA 2EU8A 1KI3A 1KO5A 4D6PA 5DI3B 421PA 1G18A 1TX4B 1YR9A 1QF9A 4C30A 4OK3A 4NH0A 4FW9A 1DVRA 5DO9A 5TY0A 2O8EB 1M7BA 1E2LA 5EP3A 1BMFD 4GOJA 4HDCA 4LJ9A 1D5CA 3F5FA 2J0VA 1MO3A 2W00A 4LJAA 1W46A 3QBTA 2P65A 4LBYA 1E9DA 1SVMA 4LYHA 1NIPA 2CMKA 1VTKA 1P2TA 2P5SA 1K5DA 3I5YA 3B2EA 2EWWA 5E7MA 4TTRA 3H2YA 5FUWA 2MSEB 3UPUA 1II0A 2EFHB 2IS1A 2C96A 3GLHE 5JZVA 3FKQA 1II8A 3P20A 3LWNA 3RS0A 4XOIA 3L8ZA 2ZSFA 3AP1A 4ZV4A 3MAAC 2XZLA 1NLZA 2IHBA 4MGKR 5DH9A 5FR1A 4KFRA 2F3RA 4D2IA 1F48A 1XTRA 2VL7A 3NEYA 4KJZA 4JBWA 1KY2A 4JSTA 3LNCA 3AVQA 4ERNA 2TMKA 1O3YA 2WPDD 3C7KA 1NSFA 3UMRA 1OSNA 5G3YA 1ZAKA 2ZRLA 4LYJA 4O3MA 1P75A 1G9XA 2CL7X 4TQUS 2YOFA 2ZAOA 1TQ4A 2OUKA 2OCBA 3WMFA 1SVKA 2GEVA 5JLJA 3BOSA 4Q19A 1U8ZA 2QROA 4PO8A 3A58B 5HCIA 1S3GA 2O5VA 3L0SA 1J2JA 1D6JA 1VCOA 1IOZA 2ANBA 3G5UA 3NEJA 1OV4A 4CVNA 3P27A 4QG7A 5JMTA 3W90A 3E1SA 1N25A 3ZVLA 1YHNA 3A1UA 2N46A 3IO3A 3QPVA 5KNDA 4QGHA 2PEYA 1XEWY 2ZE7A 4XTCS 2ZXUA 1T0JB 3REGA 3QXSA 1FMLA 1NRJB 2GBLC 1Y3AA 2IYRA 4RZUA 3BGWA 4TQAA 8OHMA 2RCNA 1PLKA 5KDLA 1Z6GA 2LKDA 1RYFA 3B82A 3B5JA 1XTSA 1VHTA 4KXFB 4OK5A 1ZNZA 2BKUA 3PFIA 2ZRMA 5KSYA 4AIIA 1WRBA 3GFTA 4JMPA 4FMCB 2BIFA 4GP6A 5CLLA 4DB4A 1LW7A 5KNCA 4MYCA 1JALA 2GJAA 3AKYA 3TH5A 4P33A 5AWFC 1CJMA 1DTSA 1RFLA 2D7DA 1NN0A 4PZLA 4AYXA 3MMPA 1OHHD 3EZ6A 4KVGA 2ZU6A 3QI2A 2DHRA 3W6NA 1Z07A 4Q02A 1JPNA 3I1FA 1I4TD 4O25A 4MITA 2G0NA 3V4FA 2BWJA 1G21E 1SULA 3DHWC 1XMJA 3O47A 4AG5A 4HZUB 4KITB 2QMHA 3IIMA 5JJIA 5TB5A 2F9LA 3WRYC 1OXVA 3NC0C 4CEIA 4IJMA 3FMOB 1OF1A 2OFOA 1N5IA 4YDSA 3BJIC 2C03A 5DISB 1F60A 2IXGA 2V1UA 4YMTA 2V8OA 3U7FB 4RD4A 4CGZA 5KOYA 4PQRA 1XWIA 2FSIA 3KDSE 3VR5A 2NTYC 4YXWD 2YWGA 1M6NA 3A1VA 3OIUA 2O8CA 1E6CA 4ASUA 1R4AA 1ZD1A 2QAJA 2IS4A 1SXJC 2CXXA 4B32A 3PUWA 2XAUA 3TSWA 2FNAA 4JLKA 2DY1A 2IYQA 1IJEA 1ZNXA 4HAXA 2ONKA 3REFA 2AK3A 3RSOA 1Z2CA 3W9YA 3NBXX 1E94E 1N6IA 2AXPA 4M1SA 2BBWA 4TT3A 1W7AA 4NYMR 5L3QA 1FNNA 5EE3A 1KK2A 1N6HA 2BVNA 2R6AA 1M34E 2OM2A 3Q85A 4KFSA 5E7IA 3O8BA 2ODBA 3AVUA 3QUSA 2JA1A 3CH5A 1ZBDA 4AYWA 1DADA 1VYVA 5LPNA 3MWJA 1O87A 1A7JA 3RS4A 4BFXA 2B8TA 3HU3A 4XWAA 2ZJOA 5G40A 3OZXA 521PA 4ZI2A 2GCOA 4JYBA 1C1YA 3UANA 2WM9B 4XVRA 4GZLA 2GCOB 3ADDA 2IYXA 2JEOA 2QUZA 1JJVA 4V0NA 2BEJA 2QE7A 4GP7A 3KTAB 1M7GA 1X1RA 1JQLB 1XXHA 2ZYVX 3LBIA 4WIAA 4NTZA 4BLRA 2UKDA 2QQ0A 3UG6A 3OF5A 4BZQA 2NGRA 3BFXA 3IIJA 4AYTA 2XSZD 4GRAA 5JHGB 1RIFA 3HU2A 1G5PA 2WICA 2A5GA 5DN6A 2O8DB 3SS8A 4C0SA 5KDDA 2R6CA 4JLPA 5GJVC 5AJYA 1ETUA 2IF0A 1W5TA 2WKQA 4YDHB 1U98A 2X2FA 3TE6A 3UG7A 1UKZA 1A82A 4POAA 2F6RA 2ZRDA 3WP1B 3BB4A 2PLRA 4ZDWA 1W4AA 1EFRD 1PVOA 3H1TA 1ZNWA 2G1KA 2ASEA 1Q1QA 3RC3A 5FPKA 1SHZA 3CNNA 2RKOA 4PTLA 3K0EA 5C4MA 4A2WA 2HCJB 1P60A 1Z0FA 1P3JA 2WKRA 3R7WA 2QGNA 3EC1A 3AF1A 4UXIA 1NF3A 1JXOA 1OJLA 1TL7C 5DHAA 4A2PA 4UNPA 1CP2A 3TMKA 2BCJQ 4F7WA 1DOAA 1TNDA 2Q3FA 4H9GA 3SYNA 3Q7PA 1CR2A 1QBKC 2BM1A 2J7PA 3LA6A 4G0NA 1XMSA 1J8YF 3U5ZB 3NHAA 4LYFA 4HDQB 3W8RA 4Q1BA 2OEPA 4QGGA 4W5HA 1BYUA 4DEYA 4HATA 3RS3A 3TQCA 2RB4A 3T1OA 1P9RA 1XZQA 2ANCA 1ZP6A 3R9XA 2PCLA 3SU8A 1H65A 3VTKA 2WJIA 4DZZA 3DO6A 3KZ1E 3LV8A 3T12A 4OK6A 2FMXA 4QHYA 1T91A 1NVUQ 2FSHA 3ZD7A 2F43A 3W6OA 2C98A 5AJZA 1Q20A 3DPUA 5JHHB 2BBSA 1KKLA 1KAGA 3VR2A 2EVWX 1E0SA 2WWXA 4Q18A 2YWHA 1WF3A 2RHMA 4FMBB 4YLGA 1SKQA 2ZRGA 1Z3IX 4TYWA 1E9SA 3WBKA 2VP6A 5L8VA 2Q3MA 1FW6A 3F3YA 4X8LA 1KDOA 4LJ5A 1KHTA 4OI1A 1AIPA 3UMSA 1FP7A 3M6AA 3T06B 4IDNA 2XGJA 3M4YA 1Q12A 1JBKA 5HCNA 2YJTD 1BIFA 3EWAA 4WAUA 4LJ7A 5FPSA 3OE7A 2FZLA 4CYMA 1YR6A 4M9QA 3ZLJA 3TUZC 2GAOA 2PT7A 3U4QA 3B7GA 4YQFA 2WWWA 3EXAA 1GZSA 3GEEA 3ZS9A 4B3XA 2H18A 3W8NA 1CU1A 5A4JA 3KJIA 3HYRA 5HKKD 4LWZA 4GMDA 3LX8A 2ZM5A 2V6JA 4R9UC 5L3SA 1E4VA 2YV5A 5F9HA 1RPZA 2R44A 5FL7A 4H1VA 4I1OA 4B6EA 1G3IA 5IK2A 2QSZA 3K9LA 4A2QA 1E2GA 4DSOA 3C14C 4HDOB 4F4IA 1IN7A 2W6ID 5HZKA 1Z0DA 4UXHA 3BB3A 1N3BA 4TN1A 2QP9X 2XITA 1S8FA 3BIFA 2ZQ5A 4QBHA 1JEDA 1N5KA 2W2VA 3Q5DA 1E9RA 5F9FA 1X86B 2R6GA 1XMVA 5FR2A 1QHYA 3MFYA 4NBSA 3RRYA 2ZS9A 2DB3A 2CCJA 3DZ8A 2QM8A 4QNMA 4DDUA 3NBFA 4NYMQ 3WMGA 4BLSA 3THXB 4FMCF 1GKYA 3T61A 5CB8A 3I3SR 5AUNB 1E2JA 2J0SA 4MKFA 2CBZA 4Q47A 2UVQA 3P32A 5J47A 2NO1A 4WXRA 4MQBA 3VX4A 2CL0X 3U3OA 1E2DA 2XOKA 1GRQA 1TF5A 4DBLC 3A6PC 4B47A 3THWA 1KIMA 1FX0A 3MLEA 2AD1A 4NYJR 3SR0A 5CIWA 3THWB 2JLWA 2UZIR 4K81B 4L8GA 1SXJB 2J0UB 1YVDA 5HE8A 2WMOB 1YZQA 5C4GB 5JWOA 2C9OA 1NL3A 3AVXA 1TU3A 4URZR 2PX3A 3UWKA 5KPDA 2FU5C 1E79D 4E22A 4NONA 4G5QA 2BMEA 1G41A 4MKIA 4FI3C 3B8HA 1KAOA 3CO5A 1OFTA 4G01B 2XNDA 2IUUA 5FBLB 3GLGB 3AKEA 4CW7A 2QMEA 5AUPB 1NP6A 4XVUA 1FL9A 2F1HA 2WAXA 2YOHA 4RKEA 3DOFA 4TYPA 4EFNA 4OQMA 2JLYA 1X1SA 1XTKA 3CH4B 1IXZA 4B2IA 5M04A 2HYDA 4MRSA 1L8QA 4IXNA 3B78A 5J4KA 3AF0A 2V54A 2RGXA 2A5DA 2WVJA 4Q48A 3TJZA 1VKJA 1VPLA 5KSPA 4JLDA 4WW0A 3ZVMA 3IHLA 3SQWA 3A37A 3LVQE 2WWIA 2OV2A 4AKEA 1QHHB 4IOJA 3NBZC 2VQSA 1EFHA 4US1R 4Q7KA 4KODA 2W83A 1Z6YA 2JLQA 4TSFA 2PBRA 2FOLA 2WBLC 4K8OA 5ELXA 4NPHA 1H8HA 1NMXA 1XD9A 2GJ9A 2PMKA 2QQEA 2ZSAA 1UEJA 1Z6AA 3OIWA 1TQ6A 4NKRA 3DL0A 1E1RA 3BFVA 3LQQA 4UNRA 3NIBA 3F0TA 1BOFA 1ZRHA 3LBHA 3WXMA 3C41J 3ADKA 3TKLA 3IBGA 4QFMA 1ZVQA 2IL1A 2DWQA 1W4RA 3LRPA 3OEHD 4D82A 4YC7A 4QKQA 3SN6A 1UADA 4Q9JA 3DKVA 4FN5A 1KJYA 5DHFA 4B34A 4Z54A 1WB9A 1OE0A 2BBTA 3PEYA 1COWD 3EA5A 2O52A 2B92A 2A5JA 1XCGB 5AJXA 4YMUA 2QRNA 3FYHA 4OI4A 2CNWD 1UKVY 1AZTA 2OFXA 4ZCIA 3ICEA 1W49A 1JAHA 2VHJA 1CF4A 2DPXA 3WBJA 4Q21A 2WSSD 5F3WB 1OB5A 1H8EA 5SZIA 1ZUNB 2NPFA 3QKSA 2NQ2C 2WWHA 4NP6A 4TYYA 1Q57A 2E87A 1KSGA 1G7RA 5DGXA 1N2CE 1E9FA 1UEIA 2RMKA 4C0KA 1E0AA 1U94A 3FMPB 3KJEA 3VU9A 1JR6A 1DEKA 3EWSA 1T8UA 4LY6A 5FH9A 2V1XA 3X1DA 3CR7A 1WA5A 1YZTA 2NO9A 4PC1A 4BZPA 1UDXA 4IKEA 1LY1A 3CF6R 2OFWA 3CLVA 3EPHA 2G77B 3WNDA 2BM0A 2HYIC 2QPTA 3K70C 2ZI6A 5A0FA 1E9CA 1KO8A 4Q1DA 4GL2A 2P3SA 3KFVA 4OQFA 2JLSA 4IFBA 3RLFA 3JVVA 1NKTA 4KLNA 2O8BB 4PHTA 1NN5A 1Z0IA 3BWDD 2WZQA 1LS1A 2GETA 4AWXA 1AKEA 2QENA 5EXTA 3N2IA 1Q0UA 2J0QA 2ZVQX 3QEOA 2NO6A 2Q9BA 3ZIAA 3DKPA 2VPPA 1DE0A 5GVRA 1U90A 3SEAA 2AHOA 5BQ5A 2HLDA 5EUQB 1HA3A 5EP1A 3T5GA 1S9HA 4AD8A 1F2TB 1DAEA 4HI0E 1NY6A 5JBQA 1KJZA 1JPJA 2JIZD 2QNRA 3ZH9B 1YKSA 3HU1A 4NYJQ 4NCNA 4LJ4A 3TSZA 3AKCA 3QXCA 2QY9A 3A4MA 5FBQB 3LY5A 2ZI4A 2WHXA 2ZJAA 1N0WA 4B73A 4BPBA 3U2QA 3B1WA 1MOZA 1P9WA 3HJNA 3VR4A 1K5GA 2BBOA 3SBDA 4PPNA 1GNQA 1SXJD 4RD2A 2WWGA 4WZAE 5CIQA 3ZZUA 2CL6X 1KNQA 5B64A 2CJWB 2QU8A 5FBVB 4OJQA 3WY9A 1T9HA 4EDHA 4Y0VA 3R9IA 4M21A 1G3QA 2OXCA 3MGCA 4FCTA 3UXMA 4GOXA 1NKSA 1GNRA 4B6FA 2GEUA 2CK3D 5J4LA 1E1QD 3A8TA 4JYCA 3QVVA 5B58C 4ESVA 1E4YA 2RGCA 2IXEA 5CITA 4MKHA 1ZIOA 1DO2A 5BYJA 1VCNA 2OO7A 4LV6A 4DCNA 1C4OA 4P0TA 2WOOA 5JJLA 2C2HA 4LV8B 1NVWQ 4A9AA 4B3BA 3W5IA 4DIDA 3QG5A 3SNHA 5DYGA 2QRZA 1TAGA 1XJCA 4DKXA 2FFHA 1R6BX 4CEJB 1WQ1R 1E9AA 1WE2A 2VBCA 1Z28A 2ZJ8A 3B85A 1OIWA 3UMFA 4PSAA 3SDZA 1NN1A 1XTQA 2EFDB 3DMDA 4PQYA 4TL8A 1M74A 3VKHA 4MGZR 2JJ2A 5KU1A 1VMAA 1KOFA 2XJ9A 3T1QA 1GG2A 1A4RA 1R8SA 1T3HA 3QKUA 4MRPA 3G0HA 1D2NA 2FGKA 1IN6A 3OEED 4GDFA 2VHQA 5BXQC 3QBVA 1KO4A 2WAYA 4MYUA 1BKDR 5DIFA 4R7ZA 2Q6TA 1OW3B 5GJWC 4WZ6A 1VG8A 1E2IA 1W48A 2FF7A 1XRJA 1G1MA 3IDQA 5G3ZA 1GWNA 3BH6A 4JLBA 3RHFA 3U3KA 1ZM7A 3TBKA 1MRSA 4EPWA 4II7A 4JVMA 2QT0A 2ZE5A 3RS2A 2OILA 4WBSA 4RD6A 2ZJBA 1PZNA 1RRPA 2ZJZA 3DOEA 3GLIA 1HE1C 3LXRA 4Q9LA 1KY3A 2FSFA 1CTQA 4JLAA 4DUGA 1SXJE 4LC0A 2FFQA 1OFHA 2JJ8A 3KUDA 5KPJA 1EFTA 4A36A 2IYZA 3IBYA 3PVSA 3FVQA 2EW1A 1AS2A 2RGEA 4XTRA 1HT1E 1R0YA 5JSZA 2GEDA 1T4GA 3GPLA 4TLCA 4PPFA 4JBYA 4C7OA 5JSZB 3IHWA 5HTKA 4O2RA 4C7OB 1J7KA 1HV8A 5J4VA 3AUYA 4URWR 3SOPA 4N3NA 2ZJ5A 3GLGE 3BBPA 1L4YA 1VHLA 1X8JA 3RSLA 3C16C 2Z6VA 5SZKB 1HEIA 3WYFA 3WP0A 1KNXA 2LCFA 5JI3E 1SVSA 4LHWA 1Z0JA 2D4HA 1XD2A 1II8B 2F1JA 2QT1A 2XSZA 1UAAA 4B43A 3MUFA 5CYOA 3O8CA 2WJYA 2ZS8A 1FMJA 3SQXA 2ZSEA 3KQKA 2D06A 1XPOA 3TVDA 1XPUA 2GVZC 3GP8A 1VG9B 1WP9A 3THYA 2VHUA 4BLQA 3NDPA 1Z22A 1NJGA 2XTMA 4XSGA 2V9PA 2OSBA 1CJKC 2J1LA 3V9PA 4I99A 3QE0A 2RGNC 2O8FA 1JR3A 2JDIA 5DLQC 2YWEA 3ND8A 3NH6A 2J45A 4MUAA 5JWHA 2WV9A 2IT1A 2XXAA 4WOPA 2BJVA 2OLJA 4JLNA 4W5JA 1N6LA 1DG1G 1Z6XA 2DWPA 4KV9A 4PO1A 4ZDIA 4Q4AA 2IWRA 3PUYA 4Q9HA 4LZZA 2AKAB 2NZJA 3OFNA 4HAWA 2BMJA 3TR5A 1OKKA 3A1WA 1LFDB 3KL4A 4TLEA 3ND9A 5TDHA 4ARZA 4D4LA 3Q7QA 3V00A 1M8PA 2IEYA 4HZIA 3GEHA 3A4NA 2N1BA 1SVOA 3A1TA 4ARZB 3K70B 1QHXA 1CXZA 2OCYC 3TR0A 4EJSC 2ZPTX 3SE0A 3X1XA 1G6OA 1MO4A 1KK1A 4R2HA 1FOEB 2YKGA 3AF2A 1JJ7A 1IQPA 1W0KD 4OHXA 4ZCLA 3SI7A 3ETLA 2V7QA 1IAQA 4PAMA 1E2NA 4Q1AA 2NMVA 1U9IC 4JL8A 4LPSA 3SFVA 2VF8A 2JGNA 1J70A 3SHWA 2BEKA 3W6PA 4DRZA 4LHZA 2F9MA 4JLVA 3VR3A 4BECA 4HUQA 4PAOA 3QXHA 2GTPA 5EQTA 3OIYA 5GJBA 1P5ZB 3ZQ6A 3MWLA 1VCMA 4PANA 2ZREA 4IDHA 4Q00A 1XJQA 2P67A 1E32A 3IGFA 4B71A 2H8KA 4W5WA 3HP1A 1HQCA 2ZRBA 1DAHA 4XJXA 1OXSC 2ZIAA 5EXPA 4ITRC 2A78A 3QIAA 4TL6A 4BLOA 4CEIB 4GMXA 3HWSA 3GLFA 4M53A 4IXMA 4EPVA 2QG6A 2HT1A 2R8RA 3JVUA 3L8YA 5LB4A 2E1RA 4DLUA 5D3QA 1QZXA 2QZ4A 2IYUA 2GF0A 4OYHA 3IQXA 5G41A 3OAAD 5DNYB 4CEHA 3LQRA 1KSJA 1T3LA 5L3RA 2O8CB 1CBUA 3FWYA 5CK4A 3UKDA 2F1RA 4CEHB 1N6KA 2VSXA 1X3SA 1NBMD 3RRZA 4YMWA 5SZHB 4C0HA 2VEDA 3CRQA 3R9WA 1II9A 1NMYA 1X8KA 4ON9A 1QHNA 5BWMA 1B23P 3TUJC 2QEQA 1AQYA 4L16A 2OBNA 3EIEA 1U0JA 5L3QB 3PCRB 4F38A 2V3CC 4WVFA 4TQ9A 2W6JD 2GHIA 5FFMA 2D62A 1MABA 4NZYA 3AF4A 1X6VA 2AK2A 3I62A 3PEWA 5EP2A 1W0JA 4I81A 4A8JA 1R5OA 4S35A 3MWYW 4F4JA 2C95A 1SGWA 3TAHA 1WCV1 3QKRA 4GZMA 2QL6A 5CK5A 3U60B 3B1XA 3KQHA 4LYAA 2GZDA 3EW9A 3G82C 4JT4A 4Z51A 4PC2A 5B30A 3EZ2A 1XXHB 5KHOC 1JEEA 3T35A 3KB2A 1G8FA 4IDPA 2C5LA 821PA 3LDAA 4D4JA 3FFAA 3WYAA 3ZZ0A 4LPKA 1CRPA 3W5JA 2C04A 3QXJA 1EXMA 3WNCA 4B2PA 4D4KA 4KYIB 3GJXC 4N0DA 1VDZA 3GD7A 4DLSA 2JAQA 5H8WA 4PAQA 1KDRA 3HPQA 1FZQA 3K0FA 1W2HA 4B3GA 2GILA 3K0FB 4KI0A 2CCKA 3PXGA 3T5DA 2REOA 3B1YA 4JBXA 1IHUA 5DE3A 1XD8A 2BJWA 4J0QA 1RYHA 2RGBA 1U81A 4YONB 4EQ6A 2G1JA 3M0EA 2RH5A 2YNMA 2IWHA 1A2KC 4A4DA 3R7WB 2D74A 2VF7A 2ZRKA 2WSMA 721PA 4XD7A 4U5XA 4X8HA 1E2HA 2PZGA 2ZRIA 3AEZA 3FOZA 2VIIA 1IXRC 1E9BA 4Q9IA 4L15A 5FOVA 3CRMA 2D2FA 3QG1A 1IONA 5J4HA 1CS4C 1NBME 1S0UA 2ECKA 1NI3A 4IDQA 1FP6A 4B48A 1W47A 3PV0A 4I1VA 5CJPA 4FWTA 2FGJA 2DFKB 1SVIA 1DAGA 2I3BA 4V0MA 4EKDA 1Z0AA 4XH9B 3RWOA 2FWRA 2G83A 4LBVA 3MWKA 4QOSA 2F55A 4D4MA 4Z1MA 3VNVA 4IOLA 2Z5FA 3ONWA 1JXMA 2QAGC 3D3QA 1U0LA 4L9SA 4N0EA 2KBEA 3PIRA 3H86A 4Q1FA 4B74A 1G8HA 2F43B 2R2AA 4BWYA 1KI7A 2RGNA 1G16A 1MV5A 3AVPA 4IVQA 4TLDA 3WHKA 3AVWA 1P72A 2AWOA 2W0SA 3QJYA 1CJVC 1UBCA 2IW3A 2VHCA 4BRWA 5LD2C 4IEIA 4PXAA 1QHGA 4D26A 4QJ3A 3RS7A 4C0QC 3FDIA 2QBYA 3QQ5A 2MSCB 4OHYA 2VA8A
chains in the Genus database with same CATH superfamily
5HF6A 2X2EA 2A92A 2NTNA 2UZ3A 2VDUE 3ISTA 3PDUA 2YC4C 4A0RA 5JI2E 2PUCA 4TPKA 4C7KA 5DCLA 1NYQA 1DIOB 4QL3A 1UMBA 1CRQA 2I78A 3RC9A 2NYRA 2ZFUA 3KC2A 1EUDA 4ITVA 5JJBA 1DWOA 1NLUA 2OAQ1 5CH3A 1G6HA 2WSYB 1G19A 3G5MA 1IUOA 4MWBA 4PR0A 5DLPA 3TW8A 4FC7A 1ODJA 1M8KA 3ER6A 1EFVA 5CDFA 5T5QA 1ZM4A 4MA5A 1W4LA 4RH3A 1U9IA 1GRVA 2QR5A 2A7QA 4A1FA 3BUSA 4K2AA 2WU3A 3ZJ5A 4PFKA 2FKNA 4FYHA 5AJVB 1NLMA 1CUEA 5LB2A 4RFLA 1KR5A 2PM8A 3C3WA 4TS4A 2ZYUX 5EZ6B 3SJBA 1OUMA 1PVDA 3M6MD 4PHHA 2QTMA 4PG6A 3RFXA 1CRZA 2W6NA 2J9FB 5LJIA 2PRYA 4DWWA 2ODNA 3L49A 3FDFA 3ULKA 2BHNA 3V1YA 4UBMA 3DDSA 4KYTA 3GA5A 1C8BA 3GJZA 1UKYA 4XWTA 4G5HA 3L4KA 5BRNA 3OLZA 3U7EB 5P8WA 2R8OA 2XKJE 3HXMA 4PQGA 2Z83A 3U6KA 2R62A 5KJCA 5IXYA 3RASA 2A1IA 3AJ8A 3DNFA 4X45A 2EP7A 3KJFA 3JQQA 4UHEA 2JS7A 2PGJA 2G9RA 1REQB 2C3YA 2KB0A 2BEWB 1Q6YA 2YFYA 4O5OA 1KIAA 3K9GA 1EFAA 3VV3A 1S2MA 3HCCA 3A9SA 3PITA 1SIWA 1QMPA 1OGIA 1TPZA 2YIMA 3D6NB 2CNDA 3EYAA 3THSA 3U37A 3DVAB 3D8UA 2XCSB 4I8DA 4Q66C 1RPTA 1SHJA 3RYTC 1E2PA 1I2MA 1OI4A 4MI6A 1WHTA 3IOMA 3V7FA 3UJ7A 1HKUA 3PJRA 3QVUA 4M36A 3W3ZB 1V8BA 3H3XA 1AK2A 4MQLA 4WH0A 3SIPA 2E6KA 4MYRA 5DB4A 1GEEA 5M2QA 1YH3A 1HYQA 2QPAA 1MO6A 3PB3A 4H15A 1O08A 4ZIRA 1S1MA 5C8ZA 2QTBA 3GIDA 1GNLA 4FINA 1CZLA 2B4KA 1D9XA 4J94A 3FDZA 2VDJA 4AY2A 2ZUVA 3ISJA 2IZZA 1RXSA 1YL7A 2IYAA 2P9HA 1OYVA 3PE3A 1ZC4A 4HPJB 2JGEA 3OO1A 4ZVLA 5K0ZA 1QBGA 3EOBI 3QKTA 4NU6A 2OAGA 1AGRA 1UH5A 1OC2A 4RNCA 4OHPA 4DWJA 1V1MA 3E0QA 4YLYA 1MVLA 4FUTA 4LX8A 5LP1A 3RHTA 1BHO1 2R5NA 3S1AA 4X66B 1MRNA 1GAEO 3TGPA 3F47A 5H7XA 1R6TA 1J2RA 1CY4A 2CXPA 3KQPA 1QPGA 2FRXA 3MWEB 1U9JA 3DDCA 5DN6D 4E5SA 3LT5A 1Y1QA 1KVRA 3GEIA 1SK8A 3OZCA 4NU5A 4DGSA 1W8DA 3AINA 3LDFA 3PCTA 4EG1A 1EMDA 1HDYA 3ID6C 2YJ5A 2NO7A 1R2QA 5TJ9A 4AX8A 2AFHE 2VCHA 3GJQA 3HL4A 3K9QO 3S68A 3S28A 1C9DB 4CQLB 5H9WA 4C1NA 3FIUA 3ZJVA 2FPKA 2YIVX 3EE6A 1ECBA 1O03A 3ONVA 2GAAA 3PDIA 4MA0A 4PGFA 1JKIA 1GU0A 2VCEA 3KD3A 4R68A 4RY0A 3VHXB 4R2KA 4BJ6A 3HRIA 1U8TA 3LXMA 4UJ3A 1ZGJA 2OOSA 4URXR 1YIDA 2YINC 2COUA 1B41A 4K1XA 4R41A 4V0OA 4K5QA 3PQ8A 4WX2B 3W04A 1NXOA 4HWOA 4QRHA 1UPFA 3LF1A 4DT1A 3HJAA 4WI1A 5B5SA 5LXTF 4PSVA 3EB9A 4MGHA 1QFZA 3FNRA 3PEEA 5ALSA 4DVJA 3SZGA 2VDWA 5LUAA 1DAFA 3EXFB 3JYPA 1QJCA 3LP8A 3G9ZA 4UM5A 1O57A 5GZ1A 3C5HA 1Q7EA 1VIMA 4ENVA 1EIZA 2GN8A 2AOWA 5CLQA 4ZV4A 3RTBA 1GLVA 4NWIA 3HJBA 3OMLA 3ZLTA 2FN4A 2IOYA 1D2CA 4MCHA 4U2EA 5JC1A 1N2XA 3D4OA 5H4HA 2ZULA 2OZLA 1JA9A 4U7GA 3LUPA 2ORVA 4O5AA 1UPAA 3WIBA 2C7RA 2KLHA 1IMOA 2YRXA 4NAHA 1ES9A 3FPHA 5IZ4A 3GPDG 3MS4A 1B8UA 1P4RA 3EZ7A 4O0LA 2CC2A 2V7GA 1P2VA 2ODTX 1Z39A 2ASVA 1ADYA 4GPIB 4ZQHA 2H48A 1EFUA 3U6BA 4WUTA 4WZBE 4RZHA 1LDBA 4FGUA 5AR1A 3MJDA 1F2UA 5CA1B 1NFFA 2ZSJA 1YD7A 2HXSA 3NYWA 2RHHA 2UUPA 1VA4A 3I73A 5IT4A 1GKUB 4Z9BA 1CSEE 3EJWA 2BV3A 3OLQA 4G9EA 4O2AA 2HA6A 2QRVB 2R86A 4WSOA 3TSYA 4AUEA 2JIMA 5FB3A 3IVXA 3CSSA 1BCRA 2Y1DA 3O91A 2JBAA 4PY2A 1F5NA 4FFRA 2RHCA 4KPFC 1SUPA 4LXIA 3ILYA 1G20B 3V2GA 3SSAA 1ZCAA 1DIRA 2ZKLA 3MS7A 4CT4B 4U7HA 5FI1B 1GNPA 2PWZA 3ZV6A 2VNAA 3FAZA 4IIUA 3HCOA 1ZD4A 2NP6A 2FB9A 1SKYE 1MAAA 1WXIA 4NHEA 4ZEWA 4CKZA 8ATCA 1RXCA 2ZXEA 3VU9B 2XMZA 1Y6GA 1QS0B 4AJKA 1N7JA 3T94A 4AI6A 3WTBA 1KHHA 2A9JA 5ALLA 5E3JA 2HJGA 4CTOA 3PG5A 2JGDB 1J5XA 1NW3A 3FCOA 4GNKA 1V95A 4Y8VA 5KVCA 2PX0A 2O3JA 2JHCA 4DSTA 4E13A 5CA1A 2J6HA 4TVOA 4U9IS 2BF7A 3HZHA 1SD2A 3PJEA 4DY6A 2BFOA 1AQLA 5ARCA 3UT5B 2OP0A 1DAMA 3IURA 3LUBA 1SA0A 1T34A 2RG7A 3ORRA 4JIMA 5FL7D 4EL5A 5IK2D 1A88A 1BDMA 1Z5OA 4S1OA 4EENA 1OH8A 5ED0A 2YXDA 3DMNA 3J81k 1FFWA 3SC6A 3G2JA 4OQZA 2HA7A 3QEBZ 1QZTA 2VZ0A 3NBAA 5HBGA 3B3JA 4V2IA 1T6NA 1W36B 1KQGA 4OMDA 3UAWA 1E3MA 2WPDA 3QRWA 1NBHA 3B9QA 5KJ6A 5LR6A 1XTZA 2FEAA 2ZE8A 3SJCA 3DL7A 3NHSA 1QDEA 3PU6A 2GXUA 3HS3A 3WLFA 1V11A 3HSYA 2ZTUA 3KO8A 3R2JA 4XYLA 1URPA 1IB6A 2H9IA 1WKVA 2P30A 3LCRA 3M4XA 1Q3HA 3IUYA 4GWLA 1WZNA 5BYKA 5IHPA 3PFBA 3IT3A 3G2NA 1AS0A 2D5BA 3C5WP 5HFJA 4QVIA 2JLXA 2I7CA 3PD7A 3C8UA 3ITNA 1L5YA 3R8CA 3ZBQA 3KKQA 5BUZA 1PR6A 4EOGA 3FOEC 1N5RA 1M6WA 1V2GA 2FFAA 3VDQA 3JAWA 4XDYA 4BKOA 3I8XA 1LFAA 3N75A 4CKXA 2C2ZA 1Z83A 3EGXA 2JA2A 2XOKD 3IAEA 4JSYA 4BMYA 1ONNA 1PSWA 4CDGA 2P62A 1AHNA 1JG2A 3FWZA 3P9ZA 1HMPA 4KWTA 3PR3A 4GO1A 1CEEA 1BQ4A 1Z06A 2FUEA 5F33A 1OIXA 1N9GA 2Q0XA 3QU9A 1Z75A 2WILA 2EJVA 2Q50A 2CD7A 2Z2YA 3FM9A 1B74A 2H2GA 1P4SA 1GUFA 2FQQA 3VYUB 4A73A 4MUYA 2YZMA 3L0CA 4YVFA 4XYBA 2PFSA 3KLMX 2HRBA 1FDTA 1U1IA 1E2BA 1SCJA 2C4MA 3LQ1A 3OKCA 1T29A 5LNK6 5T3UA 2X19A 1JR2A 2P0EA 2SCUA 1YJXA 2W58A 2P6PA 2C29D 4Q3AA 3MT7A 4EGSA 5EJIA 5K3OA 2FEOA 4IR7A 1E5DA 3CIOA 2C9DA 4MS4A 3OQMA 3KPJA 3F90A 4K40A 5AVZA 3R7LA 4C76A 3JD4A 1ZU5A 1FTSA 4L85A 2Y2VA 3EQ9A 4G1UC 3UWPA 1XFAA 3E3LA 5EINA 3A6JA 4NU0A 1IY0A 3O4IA 3CW2A 1I3OA 4ZYWA 4WQMA 3OZTA 1ZN9A 3KFLA 1WM1A 1B0UA 2B0JA 3V1KA 3UTCA 3IQIX 4TV8B 3EVGA 3FYUB 1ORDA 4XRRA 2QM7A 3JALB 1Z2EA 4FX2A 1WOMA 1XRNA 5IBRA 2V7UA 3VSAA 2V74B 1CERA 2W71A 4QRDA 2AN4A 1PL6A 3G2PA 3O6VA 3Q0TA 2I2FA 4R3WA 5L3VA 4YRJA 1AO0A 3E1KA 2ATVA 2IPXA 2GJ8A 1T8WA 2A59A 1YMVA 1DBQA 1NVVQ 3UUGA 4C3UA 1GZHB 3X43A 2QZ9A 2FSGA 3Q40A 3H4MA 1EZZA 4V3CA 2OK8A 3JYOA 4IFTA 3TI9A 5C31A 2MT9A 3N28A 1M1YE 2D4AA 4GI3A 4YXWA 3ZY4A 1R6UA 2GPWA 1JNYA 4MHSA 4DV2B 1FSPA 2H1HA 5JT1A 1JI0A 2D0IA 2GNOA 3CLRD 3L6CA 4RSRA 1J8DA 1WXQA 2CCGA 2R60A 2W90A 4XASA 1RABA 4E31A 1C3LA 3GCWA 2ZTLA 4FWBA 3HM2A 3O84A 1ZA2A 2W9XA 4ND8A 1NNEA 1C9YA 4URUR 2O4CA 1G3MA 1GY8A 4DCJA 5FI3A 2VWQA 1E2QA 1NUTA 3HVJA 4RYLA 1BH2A 1C5KA 2JLYA 2QF7A 2WMNB 3L0DA 3DUFB 2IEAA 3E3MA 4UPDA 5KYWB 1HUQA 1WY5A 4LUCA 2XE4A 3I05A 4YUVA 4GSYA 1BMQA 4KXVA 1E7QA 2H2IA 2VBGA 3TZBA 4A5OA 3RRNA 5KTOA 1EDDA 1E1MA 4EVQA 5LCXA 1TEVA 3BDAA 1F5SA 1R0WA 2VWHA 2IYPA 3IKLA 4MMYB 3RIGA 1HZZC 2QX6A 4K6GA 2ZITA 3O74A 3M4ZA 5I8ZA 5JD4A 3NRCA 3LKDA 3D6MA 3FMGA 4WT7A 5DNCA 2J30A 1CPYA 4DM3A 1BEEA 4DZTA 2OVFA 4X71A 4H1UA 4ACAA 5ITVA 2UUCB 2DH6A 4J0JA 2AQHA 3TO5A 1XDBA 1TLTA 3EHDA 2D0DA 1AN9A 1JTEA 1JQJC 1Y98A 5F4BA 3S2FA 2ONJA 2RB5A 4WDRA 1QPBA 4Z3DA 1U1EA 2TMDA 4KQGA 1N1MA 2VJKA 2YZ2A 4PPQA 1K7FB 1IQUA 2L0XA 1CJUC 4TMWA 3VUEA 2Z9DA 3OLYA 1UDRA 4EHHA 1YBVA 1NNUA 4DLTA 1TJPB 4ES6A 2ZATA 1GTG1 4G9BA 1M7HA 3THYB 4DIFA 4CG1A 4BFTA 3IMFA 2WT8A 4RDHA 1NC3A 4B2LA 1W44A 3IP1A 4HLDA 1X9GA 4BNLA 2XNSA 1A9OA 2F1IA 3FCYA 5F2EA 1B8NA 1T3SA 2A5FA 2QN9A 1LLCA 1DELA 1VPTA 4MQFB 1AQUA 3NM5A 3GCDA 1VGVA 4RM3A 1TAQA 4TMFA 3TXXA 2YYAA 5TS2A 5JCJD 5F35A 2QSJA 5A6VA 4OJYA 4PX2A 5JH7F 5EFZA 1A5TA 2LD4A 3L6UA 3L8HA 3K71B 3OHMA 3ZIAD 1B6SA 5LM3A 1PV4A 2VPXA 3R0IA 4DA7A 3TQSA 1DEHA 3LGAA 4N7RA 3ZVNA 3KRTA 5EE0A 2NU8B 3TCXB 1JPUA 1ZJ6A 3HZOA 1W1WA 2WTMA 1XEWX 5F2KA 5B3JA 1Z4PX 2BM8A 3CF0A 3PGVA 3V7WA 2DHQA 1D4ZA 2HA0A 1F3OA 1MH1A 3FPLA 3KSZO 4W7SA 5K8UA 3GJ4A 4O08A 5LZ4A 4KVAA 4LWQA 3T52A 1W5FA 2RHDA 2YMQA 4NZNA 4XLLA 4D4KA 4DV1B 2OTCA 2J0EA 2YHAA 3GQVA 2GM4A 1HH4A 1PG5A 4DA6A 4NQZA 4RMJA 2HJ9A 3GLUA 3E3OA 4KH0A 4OI2A 1T24A 4WY2A 4F93B 2VJLA 3FYDA 3KYCA 2AV6A 1SOAA 4GGMX 2H54A 4JCCA 1YIOA 2QRMA 1LWNA 3O4JA 3PNVA 3E4DA 4J07A 1G60A 3PCXA 3SYLA 2Q62A 4HH3C 1WMSA 2KLBA 1OA0A 4AMZA 3CX8A 1P0IA 4HS9A 2WNHA 3D3NA 4MS1A 2AR7A 1JG3A 4JJ7A 5E2AA 1ONOA 1T5SA 4BGIA 5EN4A 5BRAA 3PYLA 1Z47A 1VJGA 2C8LA 1FP1D 1Y1TA 3H9QA 3BCHA 4Q39A 1O94D 5FL3A 3GH3A 3T3MB 1JLMA 4AO6A 2EWVA 3GP3A 1XLTC 1PO7A 4IVNA 1KFCB 3DKRA 3TN7A 3IA7A 2O2GA 3CX6A 2ETXA 4MW2A 1YQQA 3MXTA 3PUZA 5F21A 5EHNA 3V55A 1IY2A 2VPWA 5DK6A 5A3JA 1U2DC 4PBRA 4DSNA 4ZC8A 3ROQA 3C1TA 4UUQA 3A06A 3HHPA 3C8ZA 1UBNA 5EI5A 2RGGA 5AT1A 4CCSA 4OLJA 1PIWA 1GPAA 5JYBA 1E1CA 1ACMA 1GDDA 3SXPA 1JAXA 3IUQA 4CF3A 2B6NA 3CEAA 1WCWA 1TLLA 2H63A 3B9PA 5LQJA 4FHDA 5CVVA 5THQA 3I9OA 3OO0A 3N5CA 1CLUA 1XA0A 1PJQA 1QTRA 4JY7A 4MAFA 3UC9A 4YRCA 4QDZA 3IJPA 3OETA 4BMXA 3AVTA 1FFYA 1JEOA 2LXNA 2X0RA 4KFTA 5KTSA 3HBAA 2V6FA 4RW0A 1DRUA 3T4PA 3RS5A 1EVQA 5ECWA 5CLJA 2DH5A 1XTJA 3BWMA 3N8KA 3MD0A 4JNKA 2ATEA 3VTAA 1JZSA 3ECSA 3QF4A 2Q45A 3GY0A 2W6IA 2VKTA 1K4YA 2LDXA 4LMPA 4ML3A 1ARZA 2GZSA 2Z2JA 2CMHA 1KYQA 3PGA1 3V1UA 4M1TA 2FMTA 2R87A 3DT6A 1I0ZA 3BRSA 5LXTA 1CDEA 3RVBA 1FUKA 2ZJYA 1SG9A 1A5SB 1BXGA 3BMNB 1OWPA 3EDOA 2VHYA 1KJWA 4JVLA 2OK7A 3NNSA 1X94A 1MABB 4WZBB 4UW9A 5JAUA 3AM1A 1Z37A 3IMCA 1D1SA 4RHFA 2H29A 1IJKA 3QLVA 5AM3A 3D5QA 4NECA 3GGGA 1BWSA 1Q0RA 4KDEA 3ZEIA 2HHAA 2HWUA 2PX2A 2DFTA 3CPEA 3AQIA 3QKRB 4M1EA 5GV8A 2GA8A 4ZI7F 2PMDA 1QYWA 3BJMA 1TUIA 4HSGA 3VM6A 2QRKA 2GF9A 2Z8YM 1XMXA 1Z8FA 1A5ZA 1B00A 1HOTA 4CLOB 4TV8F 2X5NA 5JARA 2BGLA 1P1RA 3LC1O 2PK3A 2QNBA 5BPHA 2HHLA 4Q1CA 2OXRA 1IG0A 3FX2A 4CF7A 2EHDA 3EIXA 4JVSB 3L8EA 1FXSA 1VKRA 3E5NA 3AFOA 4K3UA 3QENA 1EVKA 4LRYA 5B7PA 1SKYB 2O3RA 1TM2A 3TSOA 1WB6A 2GZHA 1H3NA 4YACA 3DXXA 2H17A 3N8HA 5K9ZA 4OD0A 4FBLA 1J9GA 1KY4A 3E4CA 1PD1A 1HLPA 1AHHA 3LUCA 3CYFA 2VDKB 4FN4A 2FW7A 3FPJA 1D7AA 3NBUA 4GAEA 4W9NA 4AXBA 4ZMSA 1RADA 4LBWA 3UK2A 4AURA 3EF0A 2DG2A 5AK0A 1NJ5A 4R0MA 1UBLS 2I4NA 2VAMA 1VQ1A 1WDLA 4LVNA 4LZAA 1QWOA 4Q0MA 4QXAA 3HNRA 3KD2A 3T4XA 3CJQA 3AGQA 4FXPA 4E3WA 1KPIA 4CODB 3JD3A 1H1TA 4AU1A 4Y0NA 1NQOA 1XZDA 2QI9C 4P35A 1YIAA 3GT3A 4NIMA 1KH1A 2ZSBA 4KE8A 1VA5A 1OYWA 4HQKA 3O1IC 4RXTA 1EFPB 3A10A 2BKLA 3H7AA 4TMZA 3ZWPA 4J90A 4B7XA 4F9TA 4YAIA 4AK9A 4X3PA 1DKNA 3RUPA 4MVJM 6ABPA 1N8TA 2XYHA 2WZCA 5KDOA 1ZHFA 1KI9A 2HIGA 2WFMA 2XZDA 2H4FA 3BTSA 3GRUA 4GQIA 2JFNA 1U8UA 2IDZA 4GLLA 4EPTA 3K1AB 1BW9B 1O77A 4OIMA 3IPLA 3UA4A 1MZPA 1HX7A 3BD7A 4PO9A 5KO2A 1A8PA 3IDOA 7MHTA 1N7GA 3C4JA 1XI2A 3AT1A 3SIXA 3FLEA 1P2BA 2J32A 5EE1A 4KWHA 5FO0A 4XB2A 4ZKDA 1BH6A 3EGOA 3BKXA 4C14A 5JIBA 3WYGA 4YV0A 2IBMA 2X8BA 5E4JA 1MT3A 1S4QA 3IELA 4BWFB 2IF2A 4LA4A 2HDNB 3C4QA 3ZU5A 1QLHA 1CR0A 3T15A 2XHZA 4B3CA 3GWGA 4LZPA 2VSYA 4LF8B 3DV0B 4CCAA 1RWQA 4OA8A 4UZFA 4BNWA 1IOWA 5I4IA 2XZOA 3BS4A 3NWJA 4QWWA 3GLIE 3V6MA 1J6UA 5CFLA 2GN1A 4K3VA 4UKDA 5GV7A 3FUTA 4MIKA 4OHVA 5JS8A 4E1VA 3AR7A 5F23A 2LGJA 1NWHA 2RH9B 3PHHA 2ZUTA 3FHOA 4NCHA 1OZFA 1FPMA 4P22A 4TVKA 3NKVA 2RBKA 3O92A 4TUYF 5IH3A 2CDNA 2ZJ1A 1WDTA 1COWA 3I4LA 3WIUA 4ZHQB 4TZ0A 2FSSA 3LQFA 3QMPA 4IZOA 4KSBA 5CXXA 3UK7A 2ID8A 1AH2A 3EG9B 2CNWA 3GJ5A 2J3LA 4K46A 3QVSA 2RHBA 4KQJA 5FO1A 2AR9A 5E8RA 1UMBB 1GOTA 1EUDB 1XDGA 5IN5A 2P1ZA 1KK3A 4C3VA 3TW8B 1A7KA 3KKPA 3WWEA 4F1KA 3OQBA 4J0KA 1ZH6A 4N48A 1PZEA 1LI7A 2VN8A 5DHPA 4ZVMA 3ETJA 2H1RA 1NUUA 4N82A 3ICWA 2HC9A 3EIWA 2EC5A 1KO1A 1KGSA 1W75A 2WIJA 4G5RA 5EZSA 2R8XA 5G02A 2ONCA 1UIMA 1ZRNA 2GLUA 1E7MA 2QTFA 3K1JA 4IMRA 5KYVA 1F6BA 5K0TA 5JPCA 5YASA 2R8EA 4W1PA 2JAWA 4X6YA 2GBLA 3TRFA 4DANA 3M8KA 1G4AE 2VNHA 5EHXA 3SYRA 1YTLA 2P9GA 2J3EA 2OQIA 4YQZA 1E1LA 1L9XA 2GT1A 4K6KA 2QSYA 2N42A 3CS3A 1FJXA 4BMNA 4I9UA 2QQFA 2C00A 4PX9A 4NOMA 3K09C 4KL8S 1PP4A 1P62B 4B9AA 4RWZA 1WU7A 3LYLA 8ABPA 5CDHA 1IH8A 2L2QA 1QTQA 1A9YA 3MGKA 1MX9A 1J24A 2O05A 4HXGA 1LRLA 4BQNA 4YRTA 4LGMA 1H5QA 1CY6A 1PNQA 3IEUA 3ZZ1A 1T1EA 3HRHA 3Q9NA 5H59A 3A6EA 4QIHA 2NV2B 2G5GX 3FRHA 5ES3A 3CA8A 4DEVA 2VT7A 1SVWA 2X0EA 2B20A 2Z8YA 1QG2A 3LCMA 3PWSA 3EX7C 2R6DA 3TZKA 1PV1A 1UPTA 2Z5LA 1IPEA 4IOMA 4UMFA 1CD5A 1P77A 2FZVA 1G5FA 3L82B 4Z3OA 3RVRA 2MSDB 1XR3A 3CKKA 2FXVA 4C2TA 1SD5A 2HQBA 3WL3A 2HZBA 1P9OA 3F1KA 1M33A 2C94A 2GEBA 3IEIA 4MAAA 1XNJA 4GPTA 1W0JD 3THXA 4DC9A 2YN4A 3KPUA 3FTDA 3I04A 4GI2A 4OQ4A 1XB2A 4RHXA 3P26A 5IKOA 1IN1A 1UMDA 5AXAA 2OHJA 3LLVA 4ZIRB 5CCEA 2ZANA 3WA7A 3LX5A 3R4VA 3LVRE 2BTOA 3ISVA 4JC4A 1YJAA 1YZGA 3BD9A 4CIDA 5D5PA 4PZZA 1N5DA 3LLMA 1AGYA 1P4AA 4LZOA 4N9WA 1WUIS 3P2YA 2IDMA 1GGKA 3LQYA 3Q9LA 4TMTA 2NVUA 3V8EA 3HXLA 4EY7A 1QDUA 2NLOA 3VOSA 5C1PA 4NOJA 3RTGA 4GXRA 2J5XA 4KIJA 1Y48E 5C8XA 1E2KA 3DZIA 4BCDA 1G66A 2X9LA 4D3FA 2BFWA 1XBTA 2J0UA 3QYPA 2GK7A 1JB1A 4NENB 2XWSA 4X62B 1T43A 3EOZA 4IHJF 3LC2O 2NTEA 4OU4A 1RQNA 1XMIA 2RAUA 3IA2A 5EZYA 1Q2UA 5BV2P 3MJFA 2DPMA 1JYSA 4MVJA 2MSLA 4I2NA 1HETA 3ZYCA 1E1QA 2GRUA 3RIMA 4CHGA 3G1UA 1GCOA 3BEOA 4JHXA 5DVZA 1OOEA 4RM2A 4LI0A 1OLOA 3UEOA 5IPFA 3M1LA 1TQDA 4MOWA 3GRAA 3DHYA 4DT1B 2XHEA 4LY3A 3DXZA 3T9DA 3SFZA 4OB6A 4MCAA 3TIVA 4BN4A 4ZZ3A 2CFCA 3FR7A 4HSEA 1C0LA 4PYLA 4AS2A 1PR9A 3CF2A 3M5DA 4C7VA 3GJ6A 1OTXA 1XEFA 5DJ5A 4EW1A 4KPGA 3KB1A 4WESB 4CU5A 4Q6WA 4N0MA 2I4OA 2ZRHA 5CNMA 3VHRA 5FI0B 5C5CA 1SCBA 4HX2A 2UZ4A 2CHQA 1YVUA 4TZKA 4WLNA 1T5IA 5FAXA 1HG0A 2ST1A 3DDHA 1S3SA 4FGLA 3KKNA 1CUWA 2R4UA 3DBLA 3GVXA 1A27A 3W4JA 1W8IA 1QB7A 3WLHA 4WBNF 4TRRA 2ZRAA 3PA8A 3AJEA 1ZL2A 2IP4A 4K7JA 4KQEA 3KSRA 2GN9A 3ROMA 2O2IA 1YUNA 1MFPA 1YASA 3I6YA 2BR4A 3LBNA 4P31A 4EHNA 5JZMA 4D97A 4G4SO 3D31A 2OBYA 3WGOA 2VTKA 4XA8A 4RK7A 4D0SA 1DLJA 3KEGA 3MB5A 2IS6A 3A70A 3PFWO 3UB4A 1JU9A 4HB2A 5D7BA 1F2UB 2OXTA 3VO2A 1LS6A 2OFPA 4NS4A 5JRDS 3VR6H 4OO3A 4KXLA 1S4MA 2YUTA 5DGHA 4BGDA 2XMQA 1YRAA 4MP3A 3DEIA 5I4KA 4IILA 4O2AB 4AJOA 4KUEA 1KI2A 1EBBA 4DPLA 3D7MA 4DW8A 1TXGA 2FCRA 3L8DA 4HYQA 4QTZA 4RKRA 3NVAA 1FFXA 1BCRB 5THKA 1P3Y1 4HFNA 4GM0A 3P4YA 4S1PA 3AG5A 4YWHA 3RAJA 3SJZA 4ARAA 3AESA 4M98A 1RXVA 4RTNA 1IQRA 2I6QA 4LOJA 5HUHA 2QNIA 4ARCA 1VIYA 3FDXA 4NK5A 1U9YA 2H5EA 1W29A 3E15A 5EGSA 3VOBA 6YASA 1DC3A 2GWHA 4JLJA 3O8DA 2JIQA 2Z9BA 3GJ8A 4Z9XA 3RO7A 1GTMA 3N2KB 4DG9A 5BR4A 2Q9UA 2PNFA 1GNSA 3BXEA 3O8OB 3T7SA 5BV1A 2GBIA 3LWBA 1I2BA 1EM6A 3TVTA 4WN3A 3QPAA 1ZD3A 3H8WA 3L6OO 5FTMA 1OZHA 1K7XB 2BGIA 3PL1A 4GI7A 1UOQA 4DIEA 5GP1A 1R0ZA 4HQ6A 3TLGA 3WGYA 4A82A 2JZOA 4HB0A 3EIHA 4CPDA 2IZ7A 2GXSA 2RBGA 3BSSA 2A30A 3DBHA 1XPJA 2PGDA 3K8YA 1N3LA 3FHLA 2QG9A 1GG5A 3Q3GE 1EP2B 2D2EA 3OI7A 2Z3WA 4KTTE 4Q4HA 3TZLA 4H0CA 1FSGA 3LTNC 2C1ZA 3VJRA 4EFMA 2PANA 3PPIA 3L05A 1JDVA 1RLIA 2XUDA 4ZO4A 3DE6X 2IOFA 3WFZA 2I7TA 3OPMA 1P4GA 4PR3A 4BMPB 4HQNA 5U1PA 5LOVA 2NSDA 4NXNB 5BQPA 2CFSA 2CJFA 2AL7A 3QX3A 1UFOA 3NC1C 3FW1A 5K2OA 2PS0A 3AY3A 3ODGA 5LP6F 1U3CA 3ADOA 2UUBB 5JJKA 3E9ZA 2J3KA 2Z6AA 3F6PA 1KBZA 2ACVA 1GQFA 3N70A 1EG2A 2FMKA 3L9XA 4WZZA 5K0NA 4C0LA 4CMEA 5EUBA 4RTOA 3DVLA 5J40A 2P69A 3IULA 4F60A 5KNBH 3MJRA 2VRWA 4IV0A 1WZ2A 1XO1A 3CNHA 4JQSA 4N39A 5FOWA 3NI2A 1KZ6A 2GJ4A 1N0UA 3GT0A 2EWMA 1DC6A 3D6TB 4B6GA 4KR6A 2ZTVA 3ZQ4A 2BP7A 1X80B 3WXBA 2RJNA 4QYXA 3EGXB 3H13A 4LYGA 1IRIA 3C3EA 3D54D 4F12A 1ZINA 4URYR 4FYMA 1SKBA 2HEIA 1EB8A 5HIAA 1IN4A 2AJLI 2DBYA 3DD1A 3QOXA 5L7WA 1WZIA 3WNBA 4OJMX 3LQKA 2W2TA 4P32A 2IYYA 5IDQA 2P11A 2ZBQA 3HO8A 4PN3A 1T9DA 4G26A 3RHSA 1V3UA 4B3RB 5T4BA 4F21A 3KYDA 4TX1A 4AP9A 2JIPA 4G4JA 3SF0A 2HMAA 1MT0A 4KDRA 1IFXA 3DBVO 2ZSDA 1ZM9A 2IJGX 4TROA 1N9KA 5HF9A 4D0GA 3AONB 2NW6A 3N87A 2SCUB 1UM8A 2N47A 3CM0A 5FBZA 1IWBB 2HK7A 4E0BA 4PLFA 3EXEB 4QBFA 5HOEA 3EN0A 3K9HA 1U8YA 3OWHA 5BR8B 1CIPA 4MS4B 1QP0A 1E2MA 2H1SA 4BFCA 3EPKA 3STHA 3HABA 2X86A 4EG5A 3WBBA 3WB2A 4NCKA 3L7IA 1A1VA 5DLEA 1T5LA 3NWPA 1YR8A 2O7NA 2OM6A 5JSYA 1IN5A 4DBVO 4P3PA 5I7UA 2ZB8A 1P61B 1XK7A 3I9NA 1HL7A 3ROZA 2C1EA 1SY7A 2XXJA 2Y76A 3AVYA 3VO9A 6PFKA 1KTVA 1OFVA 5F64A 2GCIA 4DR7B 4UM7A 1JHOA 1XAIA 4X3OA 3I2HA 4I66A 1IY1A 2JAHA 1Q0QA 4QATA 5AK3A 4ZJUA 5C2JB 1ZH4A 2ISCA 2WC1A 4JQCA 1TECE 3TG2A 4UFNA 4DPMA 3K5IA 1NZJA 3ZH2A 2PS1A 4OKIA 3UBTA 4JJKA 4B3FX 2OCGA 3EXIB 2XB8A 4OTZA 1XT6A 2Q9AA 3P45A 1UWVA 1E3TA 1E9EA 5EXXA 3NB0A 3ENNA 4S2EA 2Y9MB 1JFRA 3A1FA 3FGOA 4HLUC 1IPHA 4QOEA 1VGRA 4ZJZA 4C6SA 1MR3F 4GKVA 4I3GA 4LMBA 4OXXA 3B8EA 2ZBRA 1A8QA 1WQ3A 2AW3A 3D5EA 3E05A 3BE6A 1ESCA 3HEBA 5AI8A 2OLEA 1DC7A 2L69A 2OB2A 1I6KA 1N8SA 1HT3A 2HB6A 4MWEA 3DYVA 2GZ1A 3KOMA 4LXHA 3FTQA 3RJMA 3I61A 5MFPA 3ZJTA 2BCEA 1GV0A 2A94A 2NO0A 1LBEA 1M67A 1QH8A 3DT9A 3S2SA 3EISA 2AZMA 2CD9A 2CUTA 3ANNA 2EGHA 4NCJA 3KYIB 4JI7B 1ZRMA 1LRKA 2PQ0A 3A6GA 5TNXA 1NLYA 1OH6A 5F1YA 1D6NA 1XHFA 4CKWA 2WUDA 3TBHA 2M6SA 3AI7A 3Q3VA 1O96A 3U40A 3TOVA 3LH5A 2FG6C 3QELA 3VX3A 4DB2A 1O9GA 5F73A 1CF2O 1TC2A 2C2WA 4IVPA 1ELOA 1LK5A 4GLJA 4NY1A 3BPSA 3E3NA 3NKLA 1EWTA 3DV9A 1IVNA 2HU7A 1LLDA 1RXIA 2EU8A 5DX1A 2O5CA 1XZGA 2HM7A 4FHGA 4L08A 4C30A 4X44A 1VLHA 1VLLA 2B99A 3B3FA 1COZA 2ZAIA 4FDUA 4IXDA 3ZE8A 3QWFA 1DVRA 4B40A 4ZT4A 3W5BA 2VAPA 3MTGA 1P7PA 2BGTA 3NASA 3G5AA 4GWKA 4NZZA 3LOQA 4AMBA 4E14A 3TLEA 1R8XA 2AMFA 3M2PA 1L4KA 1LPOA 4MO9A 3PT9A 2J0VA 2W00A 2BFCA 2BFDA 3H3JA 3JARA 1H2ZA 3QBTA 2A4MA 4MVJE 4P34A 1ST3A 2W8ZA 4WPGA 1SVMA 1I33A 1WXEA 1SD1A 3CLTD 1I3NA 3KNZA 1NIPA 3OU6A 2JCVA 4KLZA 4NCXA 4BVLA 4C43A 1VTKA 1VPVA 2P5SA 1K5DA 2QJRA 3IMGA 4Z6KA 1U3WA 3B2EA 3GV0A 3A6LA 1VL1A 3TTWA 2NVOA 3IYLW 4O02B 1IPFA 1HQKA 3AWDA 4JOCA 4BJ5A 4RV4A 2MSEB 2QTZA 3L4JA 1U6IA 2OD7A 3P20A 4BXOB 2O2JA 3GELA 4XOIA 2ZSFA 1LGYA 3AP1A 2HOQA 3MYRA 2XZLA 4GMKA 4N6GA 1NLZA 1OVGA 2RJOA 4V0SA 5DH9A 4D2IA 5CLFA 5IEJA 1B6RA 2VL7A 4NG5A 3NEYA 4KJZA 2N9UA 4BP8A 4L3VA 1MB4A 5IKPA 1KY2A 2WWTA 3SZ3A 4ARBA 3G5TA 2RGRA 1O3YA 2WPDD 2ZWAA 3C7KA 2VHXA 4ZQIA 4LDNA 5G3YA 5H5JA 2ZRLA 1USVA 4PNHA 2C2KA 1B7GO 5SYAA 4WLUA 1NQ5A 5ALQA 2QPLA 3CB2A 3ZU4A 5LMZA 3MM4A 2J09A 1AUVA 3M6IA 2RGUA 5JLJA 1SVKA 4KX3A 4D7AA 1WXXA 1L5MA 4OP1A 4PO8A 1YFKA 3A58B 4QAJA 1TCBA 2AJCA 1QIHA 1P1IA 2O5VA 3T9BA 2EKQA 2ATCA 1LTKA 2JH8A 2K6GA 2Y0BA 2CKMA 3FETA 3FWNA 3V2IA 3B6IA 5ULLA 4ZV7A 4N49A 1C0PA 3G5UA 3NEJA 1S01A 4Y6LA 1MX5A 5JMTA 2P8SA 4KXNA 1GQ2A 4KBYA 2DT8A 1N7IA 3RU2A 3ZVLA 1N25A 1RQRA 2H1OA 3GLVA 1FU8A 1T10A 4IMPA 1ZPDA 5KNDA 4QGHA 5K5EA 1K0UA 2R5WA 2V96A 1FNSA 5KBYA 3VYTB 1D03A 1WU8A 4PZEA 1P9LA 3CLSD 1FMLA 3QXSA 3KHUA 2RH4A 2XW6A 4BNJA 3UWDA 1K88A 4Z7NB 2JI6A 3MILA 4TQAA 2CN1A 2RCNA 5KOHA 4TWJA 1KEPA 1TCCA 1U5CA 4LOHA 4D43A 4EY4A 1OZAA 1AHIA 3B82A 4HNVA 1VHTA 3GNSA 4MPRA 4BKRA 1QLWA 4AKSA 1MF7A 4DNOA 3AFMA 3O4RA 2ZRMA 3S1LA 3P0RA 1VCHA 4MQ5A 3WK5A 4L1KA 1X7WB 4FMCB 1VI2A 4GR4A 4E11A 2ZSUA 1JFFA 2X22A 5L6MB 1C2TA 4MYCA 4X20A 3AKYA 1CJMA 1DO8A 1RFLA 1NN0A 2WTNA 2H8GA 3MMPA 1I4WA 1E1CB 5CTAA 1A9XB 5AW5A 5CT5A 3QI2A 2V8BA 3LIIA 1XJ5A 2FR8A 1WZCA 1NVKA 3U7QA 5C1DA 1F7VA 3I1FA 4O25A 2Q7DA 5ITZA 1P8JA 2E4VA 3DYIA 1M8JA 3LK6A