2YDAA

Sulfolobus sulfataricus 2-keto-3-deoxygluconate aldolase y103f,y130f, a198f variant
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
292
structure length
292
Chain Sequence
PEIITPIITPFTKDNRIDKEKLKIHAENLIRKGIDKLFVNGTTGLGPSLSPEEKLENLKAVYDVTNKIIFQVGGLNLDDAIRLAKLSKDFDIVGIASYAPYFYPRMSEKHLVKYFKTLCEVSPHPVYLFNYPTATGKDIDAKVAKEIGCFTGVKDTIENIIHTLDYKRLNPNMLVYSGSDMLIATVASTGLDGNVAFGSNYLPEVTVTIKKLAMERKIDEALKLQFLHDEVIEASRIFGSLSSNYVLTKYFQGYDLGYPRPPIFPLDDEEERQLIKKVEGIRAKLVELKILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-KETO-3-DEOXY GLUCONATE ALDOLASE
publication title Sulfolobus Sulfataricus 2-Keto-3-Deoxygluconate Aldolase
rcsb
source organism Sulfolobus solfataricus
molecule tags Lyase
total genus 114
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 4.1.2.55: 2-dehydro-3-deoxy-phosphogluconate/2-dehydro-3-deoxy-6-phosphogalactonate
pdb deposition date 2011-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2ydaA00
1O4UA 2FPVA 3T40A 4R34A 2ZCGA 5D37A 4HSNA 1TPFA 3JR2A 3IV3A 3L66A 3LXCA 4S2CA 2RDTA 3R8RA 3W1RA 2QJIA 5BNKA 5AYYA 2QAPA 3GB6A 5D2VA 1OK6A 2ZZ4A 3L68A 5D2YA 3C0JA 3KFTA 1P0KA 4IGHA 1K8ZA 1EP1A 2J9ZA 3L21A 1SZGA 3IGXA 3PBYA 3MI3A 3NL2A 4UFJA 1CI1A 3H55A 5AFDA 4N4PA 4UR8A 2O7SA 1GPWA 2X1TA 4A22A 3HMJG 3LLDA 2X16A 2A2IA 4JGDA 3W7IA 1EEPA 2VEIA 5AB3A 2NLIA 2RDWA 1Q6QA 4MZ1A 4GUIA 3ABRA 3H53A 4X3ZA 3C61A 3N73A 1IXPA 4QITA 4JTHA 3P61A 2X1UA 4HIBA 3QFEA 1BWKA 1JULA 1VPXA 1OG0A 3TC7A 1WOBA 4O52A 4K36A 1MSSA 3W71A 3ABSA 2DZPA 1AMKA 4NNCA 2FJKA 1G4PA 3LTPA 1JQXA 4ZQPA 1EB3A 3BLEA 2RDUA 3MP3A 5C6MA 1DKWA 1EWEA 2G5WA 2PRMA 2VFDA 3BLIA 4RX0A 5BMXA 1OFEA 4B5NA 4ZZ9A 3KOFA 1TJPA 3VNDA 1YTEA 3CT7A 4MKNA 1XKYA 4JIPA 4JXCA 4Y8FA 4JNMA 4XWUA 4Z1CA 4BWLC 3CHVA 1LRQA 5FESA 3SZ8A 2PRLA 1TIMA 3PR2A 4NJKA 3LCFA 3LCXA 1B9BA 4E0CA 1H7WA 1H7NA 3ELFA 1ZFJA 2GJNA 1I8JA 5CPNA 1LBLA 1XM3A 1EP2A 3CIWA 5KMYA 4FIQA 1SW3A 1OYCA 1ZENA 2RH9A 1Q45A 1FWSA 4EF9A 3TSBA 5IM51 1VCVA 4UTTC 4UCGA 4AHPA 1X1OA 4UMCA 3CTLA 4RZ4A 5F4XA 3W75A 1BWLA 5FEWA 2B7QA 4RZ5A 3EXTA 2QCEA 3S9YA 3STEA 2R91A 3BK0A 3R13A 4O28A 3VE9A 2J27A 1TB3A 3BW3A 1JCMP 5EPDA 5G2WA 1EUNA 1VCGA 4JY9A 3GDLA 3GXPA 2CFFA 4FX7A 2Y89A 3ZWSA 4FNUA 5K3VA 5F1UA 1TMHA 4MUZA 4N6EA 1H60A 1FCVA 3QSTA 3CLMA 2IQTA 1UJPA 1F5ZA 2QUVA 3TW7A 1MO0A 1IXOA 1NF7A 3QPYA 4UMBA 4UXDA 3I7SA 1S5VA 1GEQA 2GQ8A 5C54A 4O1BA 3MWAA 1R30A 2Y7FA 4CQAA 3B05A 1KFJA 3GXTA 1FDYA 1GTEA 3S5NA 3SIZA 5F2IA 2TMDA 2BWGA 1V5XA 1Z41A 1XBVA 2Z2UA 2QCDA 4XQ6A 1XC4A 3TR2A 1FCQA 1AW1A 3HG4A 5FF7A 5TIMA 2H90A 5D32A 1HG3A 1RQBA 2QAFA 2NWSA 3G8EA 3LB0A 3W1NA 4K38A 1ZAHA 3N9SA 4OT7A 3MMTA 1X7FA 1AW2A 1XBYA 1KM6A 2JGYA 4WY0A 2FB2A 2CLMA 3L65A 4XTDA 4Y90A 1F05A 2G95A 2G97A 5F2LA 1G4EA 4JTKA 3W1QA 3W2LA 3E02A 3PSVA 3NXFA 3M41A 5ABTA 3Q37A 3ABQA 3M5YA 4NJGA 4WY0F 5T26A 4LS0A 4HHPA 5LHEA 4WOQA 3QM3A 4IPJA 4JICA 4DF0A 3E9AA 1H62A 5FF2A 4LC6A 2QR6A 1W3NA 4MIMA 4UTJA 1LOLA 6TIMA 4K8EA 4U4MA 3G1YA 1DV7A 5KZDA 3W73A 2V2HA 1E51A 3NPUA 3PBUA 4U28A 2V2DA 5I3FA 4IXXA 2B7PA 3N3MA 1TV7A 4P2VA 4MYAA 2A4AA 1W54A 2VEKA 1VLIA 1FWTA 2ZTJA 5HWMA 2E09A 2HSAA 4XZ9A 3KXQA 1XFBA 4UTLA 3TA6A 2P1FA 3PUEA 4KWWA 4ZQCA 4AVFA 5D03A 3FJLA 4NNBA 1A5AA 4FF7A 2FLIA 1K03A 3CU2A 4LS2A 4YLWA 2GVGA 3CB8A 5H2ZA 3C2RA 2Z0IA 1C29A 3W1LA 3HPSA 2NUWA 4GBUA 1OX4B 3TXZA 5DXXA 1VR6A 2OJPA 2CLIA 5AC6A 3M1ZA 4X2RA 2C14A 1TPWA 2BXVA 1FQ0A 4JTUA 4AAJA 4P61A 5HNRA 3E0IA 5TQLA 1GJPA 1C8VA 2DZXA 3BPWA 4FNSA 3DBPA 3A5FA 4GFSA 3O15A 1R46A 4GUHA 1LBMA 4ONVA 2J6XA 1O60A 3NGJA 2WV8A 3NL3A 1OJXA 4M6VA 2V5LA 3SECA 4EF8A 1ML1A 4MZYA 4FNTA 3O6DA 4IUOA 1THFD 3LI1A 3G24A 3N34A 3MI2A 5CZSA 2QCNA 1YDVA 3GNNA 4FB7A 1FXPA 1XI3A 3UWVA 5EBUA 2Q8LA 1TCDA 3IIZA 5K4ZA 3C4UA 3IGSA 1KTNA 2A21A 3NM3A 3WJYA 2PC4A 2CZDA 3MP5A 2FFCA 3HG2A 1TRIA 3KVLA 1F73A 3LCLA 3DXIA 3O6YX 3NA8A 4JEQA 2B7OA 4HNVA 4RKAA 3LI0A 3D0CA 4GUJA 3W76A 4WXYA 1F2JA 5E93A 1HL2A 2YW4A 1JCJA 5A5WA 3NEVA 3NPWA 4C1LA 5EL1A 1VYSX 1BKSA 5LNUA 3W23A 1SZFA 4ZMGA 3OVPA 2CW6A 1BEUA 4NJHA 3LCGA 4UUIA 2Y7DA 1XL9A 2WSRA 3N14A 1M5WA 3IIXA 4KFPA 4AWSA 3PB0A 4ZL1A 2LLEA 3TIMA 1G4TA 1YPIA 1B57A 1ICQA 1X1ZA 1VGAA 1QR7A 4ZQRA 1LCOA 1T0OA 2GOUA 3CM4A 1W5OA 2E6DA 4NU7A 5KZEA 3G1AA 3QPZA 1GTHA 1JR1A 2V5BA 3LRKA 3W3OA 3TH6A 2BX7A 4AEOA 2OX1A 3LERA 1ALDA 4AXKA 1JRBA 3INPA 3DKLA 5G1TA 4LY8A 1SFLA 2I1OA 4RZ6A 3MP4A 4MY1A 4MOZA 3M5ZA 3W2KA 5LKYA 4E38A 2V82A 1SZEA 5AC7A 3KX6A 4ADSA 1WXJA 3W1XA 1GVSA 1LOSA 4XBSA 4DBDA 4PH6A 4MLRA 4BI6A 3W7NA 4UTIA 3GDTA 1ZALA 4IMEA 4CQ8A 1KTBA 3L0KA 1OFDA 5LGZA 1SR9A 5I3HA 4BF9A 2ABAA 2VC6A 3LV5A 3OIXA 3UY7A 3MJYA 4RLIA 2ZA3A 3NQ8A 4PL1A 2XFWA 3NQ6A 4CLMA 3EXSA 2Y6ZA 4M5PA 2ZTKA 1LORA 3TFXA 3W7JA 1Z48A 1ICPA 1ZAJA 3P82A 3N9RA 5AC8A 3DFTA 3LHUA 1MZHA 4O8RA 1VZWA 5BOOA 2ZRZA 4Z1DA 3RNDA 4A2RA 1RD5A 2CLFA 3TE9A 3QF0A 4Z1BA 2BLEA 1XUZA 4OQVA 4GC4A 4NQ1A 3TAOA 1TO3A 3HOJA 3W2NA 5LNVA 3EKLA 3CWNA 5K2ZA 1LTDA 1KV5A 5DBTA 3L5MA 2EAWA 3GDKA 3JRKA 3B8DA 2VFFA 1C9DA 2FTPA 1HUVA 5EY5A 1G6CA 1KFBA 1I2PA 4LV4A 1F6PA 5LNRA 5FEZA 4NX0A 4S2BA 3B03A 4WXZA 1H1ZA 3BW2A 3EX4A 3O6CA 4Y96A 3SJ3A 3OA3A 3M16A 4CNOA 3S0CA 5HR7A 3EWZA 1R47A 1DORA 2Y7EA 4N6FA 3BVJA 1M6JA 3U8GA 4XTIA 2Y63A 3W85A 1LROA 3UYCA 1A5BA 4N9CA 2DP3A 1MEHA 1PL9A 3HGJA 2WNZA 1JUKA 3PS7A 3FLUA 3MHUA 2H8XA 4GRSA 2QCLA 4O1CA 3TU9A 3HPXA 2Q3RA 4ADTA 3TXVA 3MHFA 1XUUA 2E1DA 4NJJA 4IX2A 1GVFA 3A21A 2ISVA 3LRLA 1LP6A 1D3HA 1K8YA 1TRDA 2A7PA 4HKPA 1OF6A 1B4KA 4UTKA 4CNNA 5GVJA 1W1ZA 3BLFA 1W5PA 1H1YA 2Z6IA 2GJLA 2C13A 1KM2A 4EIVA 3B4UA 3FIGA 2WSYA 1FX6A 3JS3A 4K7VA 4AWUA 5AHMA 1AK5A 1TYGA 4HNTA 5D04C 2WSQA 3TJXA 1F74A 2ZZ3A 1K7XA 3W1AA 1M7PA 3W7LA 3FOKA 4XKYB 1I2OA 2C6QA 3G3DA 3M5VA 1YXYA 4TIMA 2ABBA 4JTJA 1WOAA 5K9DA 3W83A 3TMQA 3NZRA 4JDYA 1LM1A 4LVGA 1T8XA 4AWTA 5LSMA 4JY8A 2C15A 3HJZA 1B3OA 1ZCOA 1QPRA 3W7KA 5EKYA 4O12A 4JYEA 3O63A 2X1SA 2B4GA 4YXGA 2GQAA 4LU0A 3BW4A 1NF0A 4LRSA 3GKAA 1JCLA 1WDWA 2ZZ7A 1H7PA 3B0PA 5K9XA 1ZNNA 1OHLA 3A22A 4RV8A 3DFNA 5KZMA 4CQ9A 5DCEA 4IX0A 5EMUA 1QCWA 4O53A 5AHLA 3MHGA 4EWND 3W2UA 4I7VA 4HPJA 3S6DA 3C2OA 3LBCA 1XBZA 3L0GA 1W5QA 3MO7A 1N7KA 4JTFA 4N9EA 3M43A 3MUXA 3FEMA 3WK3A 1A5CA 3NL6A 3QQ0A 1VQTA 4UIOA 1Q6LA 2ZQ0A 4ZQNA 4FXSA 1KFCA 1K8XA 3NZ1A 3M44A 4JDBA 5DN1A 4IXHA 1W3IA 1HO1A 1SSGA 5FF4A 1OFRA 1QMLA 3W88A 4QSHA 1KLZA 2EPHA 3EWWA 1U83A 2ZA2A 3QMRA 5D38A 4FEZA 4AMAA 4LNYA 3LHVA 1I4NA 2DZWA 3CWOX 2J24A 1D9EA 4JX4A 3THQA 3N2MA 1GG1A 1TQXA 5U4NA 4WX2A 1J4EA 5E0KA 1FY6A 3C8FA 3I7RA 4O13A 4WD0A 4N4QA 1TSIA 3L67A 3MBFA 3LCWA 4FNPA 1KBIA 1H7OA 5CPLA 3PY2A 4AHQA 2R94A 2EF9A 2FPTA 4Z1AA 3G1FA 1NVMA 3UZ5A 3T44A 3LTSA 1KM4A 4CCCA 1IIHA 1AL8A 5I3JA 3MYPA 3M0ZA 3R2GA 4NT0A 3W72A 4L4LA 2VKZG 4LT9A 4D2JA 5G4EA 5CZTA 3PULA 1PHWA 3GAKA 1I2RA 1G69A 2GVJA 3TNOA 3L2IA 2CU0A 5HUOA 2YZRA 2VFEA 3P8IA 2JBMA 3EX3A 1YYAA 4Q32A 4O16A 2HS6A 4FIRA 1RZMA 4TO8A 3PWAA 3TCEA 1GVQA 3E96A 2UV8G 3W7MA 1BTMA 2WJZA 3STFA 3S1WA 3UXDA 1DQXA 3F4WA 3K30A 4YMZA 3QH2A 2QCCA 4NXSA 3W7RA 3OHIA 2I14A 2Y62A 2W0UA 3HGRA 3PF3A 1OX4A 2F84A 5HWJA 3TQKA 1QFEA 3LCHA 1QOQA 4YL2A 4RJEA 1RVGA 2YGYA 1WQ5A 5D33A 1VS1A 1TPUA 3HBLA 4PEKA 3OEXA 3S5ZA 1QAPA 1H7RA 4TX9A 4NZJA 3EWYA 1V7YA 4K39A 4GUGA 3LHWA 1GQNA 4FNRA 4BR1A 3W7DA 1M7OA 1W5NA 2QCFA 1GYNA 1R2RA 2C1HA 1G4SA 2VFIA 3W7CA 1SPQA 1Z42A 1KV8A 3WK1A 4DF2A 1L6YA 3LHTA 1EPXA 3LXAA 2BTMA 4ZQOA 1SSDA 4QNWA 2C19A 5D30A 4LW7A 2VXNA 2J88A 5CZJA 4DPQA 2GVLA 3SR7A 3NG3A 4UNLA 2A85A 1KA9F 1LLZA 3HGSA 1OFPA 1H5YA 4A29A 3RMJA 3IVUA 1KLYA 1SO5A 3FS2A 1RPXA 1B4EA 1SW7A 1X8FA 1IXNA 3O05A 1XCFA 5DY2A 5L9FA 3NAVA 2Y85A 4JX5A 3W1PA 3G18A 2WOQA 4HPXA 3L5AA 4LUIA 1LDCA 2QUTA 3EXRA 5D2XA 1NFBA 3BO9A 1I45A 5AOUA 3C52A 3BV4A 3SFKA 2TRSA 4AHOA 2NXIA 2P10A 5J5DA 2C16A 3G0XA 3TQ0A 4Y9AA 1H61A 5D2WA 4WY0B 3UXAA 4GXMA 1PV8A 2E5DA 2BZNA 2YFOA 3FFSA 2A7RA 3G3MA 4IMGA 1ME8A 3B06A 2QCMA 4H3DA 1TTJA 4OU1A 1EX5A 4KKXA 2FIQA 4R7JA 4BFAA 3UD6A 1TTPA 2VEPA 3THAA 3UPBA 1TPB1 2JKAA 5L6UA 4AF0B 4HSOA 3LGEA 2DJLA 4OGZA 5C2XA 4I9AA 3W70A 2YYUA 4O4WA 1GWJA 3M5XA 3LHZA 1OFOA 2V81A 4OE7A 4NX5A 1CW2A 4O50A 3QW3A 1OABA 3BGGA 5C5YA 3LV6A 2H3DA 3W7HA 3FYOA 1FBAA 5FF0A 5G2HA 5KSWA 1TPEA 5HR6A 1ME7A 3RLVA 2ZZ1A 3M47A 3QC3A 3NQ2A 3PUDA 2PCQA 2W6RA 2JK2A 2R14A 5KITA 4O19A 1MXSA 2YFNA 3FYPA 3V75A 1DHPA 3O8AA 3HG3A 1QPQA 4JTSA 1ZHAA 1IXQA 1K3UA 4O0KA 3VFLA 1O94A 3KAOA 4IMDA 4NXKA 1GZGA 4IWWA 4ZVJA 1IIGA 3USBA 3G1SA 4JYDA 1SO4A 3F4NA 3OVQA 3QYQA 1A50A 3P74A 4NZFA 1T99A 1LZOA 3BG3A 4BI5A 2ATMA 3U6WA 3N19B 3A24A 1PCKA 2E5CA 3G8RA 2ZRVA 3ZS4A 1I2QA 4MY9A 5BMWA 3TAKA 1VRDA 4GUFA 2YCEA 3PG9A 3PC0A 4PA8A 2Q8ZA 1SUXA 5CZ0A 2AQWA 3KRSA 3MW7A 1CX9A 1JUBA 3WJZA 4PFMA 1FUYA 4DBEA 2ZZ5A 4X9SA 1QDSA 1OX5A 3W86A 4H6KA 3GAYA 1YDNA 1NSJA 2A6NA 5EA9A 5AHIA 1YTKA 1KM3A 3SW6A 2VENA 5DY3A 4QAIA 3FJ6A 5K4XA 2B7NA 2CLEA 3DGRA 2XN1A 2O7QA 5D2TA 2CZEA 4A3UA 3O16A 3W9ZA 5MHBA 2CLHA 3EKZA 1RQEA 4UC5A 1ZY9A 4A21A 3R5EA 2YDAA 1FCUA 3M9YA 4O18A 2B0MA 1LRTA 1QPNA 4UTHA 2E5BA 4JD4A 3NQDA 4Q4KA 5HINA 3O1NA 2C0AA 2QJHA 1WX0A 4YCPA 2GQ9A 3ZWTA 4ORIA 3RU6A 3P62A 1LYXA 3IIVA 1PHQA 2CLKA 1WBHA 5SWUA 2WNQA 3EX1A 4QNEA 3DFPA 2V2CA 1OYAA 3C3NA 3AO0A 3CC1A 2ZZ2A 1FXQA 4Q33A 3NDOA 2QEZA 2FB3A 3GNDA 4O14A 3VCRA 5FF3A 4XKYA 2VELA 3W2MA 5G5IA 3P5ZA 1LOQA 4ADUA 2DZUA 1SZNA 3DFOA 4DQWA 4EOUA 3P81A 1DQWA 4FNQA 5LZLA 4BK9A 1KM5A 3LHYA 1TREA 3CEPA 3IGUA 4R33A 2NZLA 1MEIA 3GDRA 3PG8A 7TIMA 3I65A 4QIUA 1S5WA 2DORA 3NQEA 1S5TA 4FHAA 4XUGA 4DF1A 4RK8A 4UFHA 2NX9A 1Q6OA 3NOEA 1N8FA 2EKCA 2VEMA 3OVRA 3DFSA 3UPWA 4XBKA 4N2YA 3EX2A 2QDHA 5HWNA 3HGOA 4RCXA 3ANYA 4QJ1A 1NEYA 2OT0A 2WO5A 4IMFA 2AGKA 1OFBA 4JTGA 5CSSA 3W6YA 2DZTA 3GKFA 5KTLA 5HQEA 3PSWA 1PE1A 2ZYFA 4OV9A 1H7XA 4K8HA 3DHFA 4O0ZA 1EIXA 3TSDA 2Y88A 1VYPX 3BGJA 4C1KA 1JJKA 1G7VA 5CG7A 1KTCA 4WOZA 1GT8A 5K7JA 3LRMA 3LBMA 4PL2A 1EA0A 4GNJA 2P0OA 2HMCA 3DI1A 3NQCA 4HN4A 4TR9A 5G1YA 3EX6A 2ZRUA 3W1MA 8TIMA 3T4CA 2JGQA 4UFIA 2FQIA 4O11A 4Z08A 2ZZ6A 4MVAA 3TKFA 4ALDA 3CEUA 1R2SA 3TUUA 1UUMA 1Q3NA 5CKSA 4WJEA 4OWGA 1YLVA 3LCIA 3PBWA 4IMCA 4O15A 3VI2A 3WJSA 3B0VC 5CPMA 3S5OA 1S3HA 3DENA 3NQAA 3ATZA 1TTIA 4LVBA 2XN0A 5HULA 2DZVA 1SO6A 5D02A 1UASA 4DXVA 2A0NA 3NYZA 5AYXA 3GX9A 2XN2A 1IF2A 3OG3A 3GR7A 4AB4A 1EUAA 2YSWA 3OBKA 1P4CA 1SW0A 3TW6A 2QUUA 5D05A 1D3GA 2OT1A 3SGUA 4MFDA 2RHGA 1DJQA 2V9DA 2NUYA 3NPXA 1XDMA 1VCFA 4S1FA 1K7EA 3DI0A 4I7WA 5BRBA 1OF8A 3QMTA 4QM1A 1WYIA 5LNWA 2TPSA 1HO4A 4DELA 2NWRA 1W3TA 4LRTA 3E12A 3EEGA 1ICSA 4JIQA 3C2EA 5AN7A 5FI8A 1YDOA 1SQ7A 1DVJA 3E49A 3T78A 1XXXA 1WBJA 1JVNA 3FKRA 1LBFA 4N9DA 4M6QA 2ZDRA 3MBDA 4YCOA 1OK4A 2YXGA 5CGQA 1W37A 4UFMA 3M7WA 4MYXA 4FXRA 3IVTA 1J5TA 1LLWA 3MYOA 4PCFA 4IPIA 3TSMA 2FPYA 4LC8A 1FDJA 3RFAA 5A8GA 1TPH1 5D09A 2VFHA 3LX9A 1DL3A 5AHFA 3NNTA 1TPC1 1P0NA 3UWUA 1JCYA 1OX6A 5I3GA 5LGXA 1F76A 3S42A 2CZFA 1GVRA 1FWWA 3DFQA 3TK7A 1PIIA 3DU0A 2Y70A 3S1UA 4JN6A 3NQGA 1NAL1 4EVZA 2C3ZA 3GVGA 3HPZA 3DZ1A 3PAJA 2V8ZA 4CCEA 2NXHA 4LVDA 1VJIA 3ATYA 2EGZA 2Q3OA 4MLJA 4QISA 5F4SA 4G1KA 4WZHA 1GYLA 1K02A 2NV1A 2V0TA 1YXCA 4WQ6A 3R12A 2RFGA 1F6KA 3C56A 1XBXA 3L5LA 1W56A 4O54A 2YYTA 1H50A 3G1XA 1UB3A 3NQFA 3GR8A 1Z44A 4OBTA 2FDSA 3NPVA 1EP3A 3TV8A 1UUOA 4JX6A 2CLOA 4R53A 3TDFA 3PM6A 3NM1A 1MEWA 2E77A 3I7QA 3MI6A 1GVOA 1XDLA 3O06A 3VKJA 3A9IA 3HG5A 4GE8A 2R8WA 1ME9A 4DPPA 3VE7A 5F1VA 5BW6A 4L4MA 4Z0SA 1HTIA 1L2UA 4ML9A 2NUXA 4PODA 3DKJA 1PVNA 5AHNA 2PURA 3UWZA 1FCBA 1Y0EA 2E68A 3P5YA 4M6PA 1O5XA 5LHFA 1JRCA 3CPRA 4BI7A 3GIYA 3EB2A 1FWRA 1QO2A 4W9TA 3W07A 3I6RA 1VC4A 4J9JA 2VFGA 4LVFA 3F1QA 3DH7A 2ZBTA 2JKEA 4KFNA 2ATSA 1DOSA 1VHNA 2Y7GA 1TPDA 1TQJA 3KRZA 1RR2A 2Y61A 4UFLA 3ZFHA 1H63A 1OYBA 2E6AA 3UY8A 3G1DA 4DO4A 1WAUA 3SSJA 3GK0A 5U7SA 5IBXA 3ZR4A 3SI9A 2HTMA 1VHCA 4MJZA 2GPTA 3GLCA 4MY8A 3UQNA 3RK8A 5FEXA 3RLUA 3C6CA 2QDGA 3V1PA 3UWYA 4YWIA 3P7YA 4AF0A 2CWNA 3GXNA 3W22A 3FA5A 4UR7A 2ZFAA 3C2VA 3QW4B 3LTYA 4NVTA 3DAQA 3Q94A 3G0UA 1QWGA 3G1VA 3NQMA 2NX1A 4FO4A 3RF9A 2YR1A 5KINA 4O57A 5G2IA 2QKFA 2X30A 3KRUA 5EYWA 3IVSA 3NR0A 3F03K 4LS1A 3UWQA 1QNVA 3TC6A 2Z6JA 1TTQA 1UCWA 3KVMA 1R2TA 3G1HA 3IIPA 1Q6RA 2ZA1A 4UTWA 2OCZA 2QCDB 3SGZA 3M6YA 4E2DA 4MFEA 1QOPA 3PVFA 3QJAA 4ICNA 3L9CA 2H6RA 2QCGA 5HMSA 4DEFA 1ZJIA 3QEZA 5CSRA 3W87A 5F4WA 5DELA 3W7EA 1P5BA 4FX8A 1TV5A 1TV8A 5AYZA 3WK2A 4PC8A 3G0SA 3N2XA 4H4IA 1UBSA 2WKJA 1W8SA 2RKXA 3W1TA 5DCBA 3QSRA 2D73A 2A1YA 3NO5A 5CPOA 2QF7A 2YPIA 1LRNA 4X22A 2Z1BA 1WV2A 3WK0A 3Q2DA 1H51A 3EWXA 3AJXA 2VOMA 3WFAA 5H91A 4MZ8A 4PTNA 4POCA 3QRHA 1SU5A 1O95A 3LM7A 5LNSA 4FX6M 2NX3A 2TSYA 6ALDA 2ISWA 2WQPA 4O4VA 3S1XA 3SY5A 2AAMA 4CNPA 2E6FA 3S1VA 4UTMA 4ORMA 1TJRA 5DCDA 1PCWA 1QPOA 3B0UX 1JUEA 1RQHA 3KVJA 3Q58A 3W1UA 1W0MA 1YPFA 4JS3A 4OHQA 2DZSA 2YW3A 4JTEA 4I7UA 3GZ3A 1ZAIA 3TJLA 1KBJA 1KFLA 4M19A 5F2GA 2H3BA 3EWUA 3B04A 1EWDA 3TROA 1OFAA 1O5KA 3T7VA 2PRHA 4O1AA 3WJWA 1FWNA 1JCXA 4KWVA 2X2GA 2G96A 3HF3A 5HJLA 2E6YA 3BARA 3QQ1A 2C18A 3LOTA 3IEBA 2DU2A 3PUOA 3QZEA 3CQ0A 3EWBX 4JTLA 1YTDA 4O10A 1VYRA 2ZRYA 4K7YA 3TFCA 2YX0A 2WPBA 1QO5A 4Y6GA 4O17A 3DHDA 1VLWA 3W2JA 2H8ZA 4IOTA 3LLFA 1DJNA 5TBOA 1L6SA 4A2SA 3LXBA 2NXGA 3U2OA 4OV4A 5C55A 2A5HA 4IJBA 2BSLA 1A53A 1HFBA 5J5RA 5IBXC 3KHJA 5K9CA 1ONRA 1T96A 3UZJA 1W5MA 2ISSA 3W7OA 3PB2A 3UWWA 1W31A 1G7UA 1WA3A 2A7NA 1JQVA 1X6UA 3NVTA 3H54A 3IIOA 3NL5A 1PS9A 1YADA 1ADOA 3S5YA 3HIJA 2ALDA 2WNNA 4LWWA 3W7QA 3S8HA 1FDZA 1KM0A 3P67A 5AHEA 3GYEA 1SFJA 4MJMA 3W84A 4IQLA 3ABOA 2EHHA 4NNAA 3NQVA 4MPQA 4DO6A 3NQ7A 5G4WA 3C2FA 4N02A 4UTWC 1OVDA 1GG0A 4LOCA 3O07A 4O1DA 3FKKA 1KFEA 5FEPA 1F7BA 4UNKA 4RXFA 4M7SA 3UNDA 3A23A 1KW1A 2OMAA 3I68A 3W7PA 3T55A 4LVAA 4HNNA 4TMBA 1KFKA 4RXGA 3YPIA 3IRDA 1K7FA 1OFQA 3STCA 1YXDA 1AW5A 3HB9A 2NV2A 3WJXA 1GOXA 3W74A 3BG9A 4N9BA 2QJGA 4RR4A 4TU1A 1VH7A 4HNUA 4GWEA 4M7TA 3R89A 1IGSA 1DBTA 3HO8A 2JKPA 3TQVA 2QCHA 1TPVA 2V30A 1JCNA 2CZ5A 3P80A 4K6AA 4BWLA 2ZRXA 1L9WA 3TMLA 2OZ0A 4QQ3A 3L0NA 4KFOA 4GJ1A 5F2MA 1I2NA 3A5VA 4UTUA 3P84A 1AL7A 3LDVA 4ZQMA 1J2WA 2KZHA 2X1RA 4AH7A 4LV9A 1KM1A 4CCDA 1RV8A 4NJIA 2DJXA 3G22A 5DXYA 4JYFA 5DBUA 4UTTA 3BG5A 4UMAA 3PBVA 3CIXA 4JTTA 2ZRWA 1L6WA 2J9XA 2PE4A 4HT3A 4UFKA 1A5SA 2I9EA 4WUIA 3TX9A 3GDMA 2A6LA 4E2BA 3HQ1A 1G67A 3P60A 2HS8A 2TYSA 4LUJA 4LTSA 3W7GA 5I3IA 3KVKA 4Z0JA 3STGA 2GUUA 5DLCA 1N55A 5E1QA 1SO3A 1P1XA 2W79A 4TMCA 2F7FA 2CLLA 4K37A 5HUPA 3P8JA 4JTIA 1U5JA 4NUWA 1AG1O 5I3KA 4DO5A 4JR5A 2J9YA 3QMSA
chains in the Genus database with same CATH superfamily
1O4UA 4DI9A 2FPVA 1M04A 2VZOA 4CVWA 2ZUTA 2IMRA 3WQ8A 4HSNA 2QS8A 3IV3A 2I16A 4GQ0A 3LXCA 2QJIA 5I78A 1WKYA 1JDFA 1Q6GA 5D2VA 5D2YA 3KFTA 1P0KA 4C6OA 4YYFA 1EP1A 4RL3A 4ZE4A 1SZGA 5A8MA 3PBYA 3EOSA 5AKQA 2HVNA 4HA4A 2XGZA 1DIOA 2WCGA 2WC3A 1MW1A 2QUMA 4UR8A 2O7SA 1GPWA 2JALA 3LQGA 3KLKA 4A22A 3K4DA 4MWAC 1V6UA 4GH1A 3W7IA 1EEPA 1SJCA 5A2BA 2VEIA 1NP0A 2V3FA 4GUIA 3H53A 3VD7A 4GVHA 3ONBA 4QITA 4WEVX 4HIBA 4AZ6A 4B9ZA 2OYKA 4MGGA 1AMKA 1ZTVA 3ARTA 3SCWA 1O1HA 3GVVA 5IXEA 1REQB 1EB3A 2RDUA 3ARUA 1DKWA 1EWEA 3AHYA 2BDQA 1H41A 1OFEA 4OUIA 2WSPA 3RHGA 1TJPA 1XKYA 3PZTA 2QF8A 4JXCA 1XD1A 1Q65A 3MVTA 1LRQA 4W7UA 3GTFA 4NJKA 2GVYA 3LCFA 3RX2A 1OT2A 2Y0FA 4GINA 4E0CA 2GJNA 2P8BA 1TWIA 1XM3A 2Z2AA 1EP2A 1Z32X 3XINA 3CIWA 4XZMX 3MDUA 1OYCA 1KXHA 4NAFB 2JF7A 1QI2A 5IM51 1XLLA 2ZC8A 1UC5A 4HYWA 2DSVA 2OPJA 3VGDA 2GFTA 4M82A 4UMCA 4RZ4A 3VD3A 3GUGA 4JQ4A 5FEWA 2B7QA 4ZOAA 4HK5A 3EXTA 1F9CA 2QCEA 3STEA 3VDBA 2R91A 3UT0A 2XYLA 4XZBA 5RUBA 1VAHA 4O28A 2XM1A 1TB3A 3PFMA 1NFGA 2R1KA 3MUIA 5G2WA 5LIXX 1EUNA 4JY9A 5HJXA 3WH5A 3GXPA 2CFFA 2J7EA 4IJRA 2OSYA 5F1UA 4MUZA 2WMJA 3QSTA 1RY0A 1F5ZA 1IXOA 2GJXA 3QPYA 5CBBA 1S5VA 1US2A 1LL7A 4LBUA 1PTGA 4IP4A 4CQAA 2VX5A 3QC0A 1GORA 1XIHA 1UP3A 1KFJA 3OZYA 3GXTA 5M1TA 1RBAA 2PZNA 4JZ5A 3W01A 1JPIA 3HV9A 4XQ6A 1XC4A 3TR2A 4IJCA 5TIMA 2H90A 3QHOA 3PN8A 2C7FA 4ATWA 1RQBA 1M7JA 5CLWA 3WQDA 4OT7A 4B5XA 1FWGC 3WQOA 3MMTA 4GD0A 1UR3M 3W4RA 3EDDA 2H9AB 2G97A 4GZEA 4JTKA 2ZUUA 3GXDA 1XH0A 2HXUA 3M4HA 2A3CA 3ABQA 1TWWA 1XR2A 4PMQA 4LBSA 3ZVHB 4IPJA 3WUGA 3E9AA 4LC6A 5EGRA 3H26A 4MIMA 1UC4A 2RDXA 2GWNA 1LOLA 4K8EA 4JKKA 3G1YA 5BCAA 3PZQA 4S3GA 3KCOA 3PBUA 4U28A 2V2DA 1RBOB 3CZKA 3STPA 1TR1A 1DHKA 2HWGA 4P2VA 2X42A 2DQWA 1FWTA 3EEZA 5HWMA 2HSAA 4UTLA 4R9XA 3TA6A 3PUEA 1RHCA 5D03A 3QFWA 4D6EA 3E38A 4FF7A 1ADSA 5I7GA 4QE5A 2J7CA 4GY1A 2PDJA 4IGSA 1BXNA 3KOXA 4PGLA 4LALA 5H2ZA 1U33A 3U4FA 2BY2A 3HPSA 3N6HA 4Q22A 1MW0A 3A4XA 3TXZA 5DXXA 4CEUC 2CLIA 2OQYA 5AC6A 1PZ0A 3NYDA 3EWDA 1JD9A 4X2RA 3COTA 2C14A 1TPWA 1HQTA 2QMKA 1GONA 4P61A 4WJXA 1GJPA 3TYZA 1C8VA 2PZ0A 3T8LA 4K68A 2NQJA 2CC0A 4GUHA 4E8CA 1J9YA 3NL3A 2OOGA 1OJXA 3ITGA 1E4MM 2DQXA 5GPRA 3VD5A 4DO7A 3G24A 3MI2A 2ZICA 1YDVA 3GNNA 2Q8LA 1TCDA 2VUNA 1G5AA 3CMFA 1KTNA 2VGFA 3KOYA 3A4WA 3HG2A 4DJEC 1F73A 3LCLA 2XVPA 4MWAD 3O6YX 1WUEA 4AVNA 2B7OA 4RKAA 3T2OA 4GUJA 4HNCA 4WXYA 1HL2A 1JCJA 5A5WA 3NEVA 5A69A 2XSBA 3KHDA 3NPWA 5LNUA 1BKSA 3A9BA 4W4QA 3OGVA 5B7YA 2CW6A 1FTXA 4AZCB 3E5PA 5BRQA 2WHJA 2GWGA 1MZRA 4I9TA 1UH2A 4PTWA 2WSRA 1M5WA 5C9XA 1MWOA 1TJ0A 4AWSA 3CYJA 4ZL1A 3RRXA 3DYMA 1Q2SA 3TIMA 4ZB0A 2ZXBA 2GSHA 1B57A 2IKIA 3S2NA 4GABA 1VGAA 5XINA 5KZEA 2QJJA 1AZ1A 1EEXA 1GTHA 1JR1A 3LRKA 4EPKA 2EO7A 3INPA 3MC5A 1E40A 4HNOA 3MP4A 4BKNA 4GVGA 1XKJA 2W61A 3OZMA 4XAYA 4DM2A 5EB8A 5AC7A 3KX6A 4DI8A 1WXJA 2E7FA 1GVSA 5T9CE 4XBSA 5E6ZA 1GW9A 4MLRA 4BI6A 4IMEA 5T9BG 4D6HA 1WKDA 3DOPA 7ENLA 5I3HA 4BF9A 3L4ZA 2VC6A 3GS6A 4GYKA 5A6JA 2EBNA 1R86A 3UY7A 2MNRA 1E3ZA 2ZA3A 4UZSA 4F48A 3JW7A 2XINA 3LA4A 3BJSA 4CLMA 3EXSA 3TLLA 2ZTKA 3F2CA 1FHVA 2X41A 2D0GA 3QY6A 1ICPA 4PCTA 1XRFA 3DFTA 3GH4A 3WQCA 1MZHA 4AZ7A 2GDQA 2J47A 4O8RA 2ISDA 1VZWA 5BOOA 3W02A 3RNDA 4A2RA 1YNQA 3TP4A 4GYFA 1E9YB 1IQ8A 4GC4A 1E1EA 4JQAA 3BOLA 5EMJA 5LNVA 1DJIA 5FJPA 3SADA 2PTZA 3DHPA 3AIRA 3L5MA 2J6VA 2EAWA 3GDKA 4I6KA 2JQXA 3AIUA 2G3NA 3B9OA 3RO8A 2OTDA 1C9DA 3PJXA 2FTPA 4RE0A 4IFOA 1HUVA 2G3MA 1TZZA 4LV4A 3UZYA 4KGJA 1DWFM 5LNRA 2RUSA 1R7AA 4NX0A 3EYPA 5HPCA 4WXZA 1H1ZA 3EX4A 4Y96A 1IR1A 3R6IA 3SJ3A 5C2GA 4EPEC 3ARPA 3C8NA 5HR7A 3S0CA 1XLBA 1CLXA 1DORA 1W3HA 1X1NA 4M8UA 1JNDA 4XTIA 2DDXA 2Y63A 3UYCA 2DP3A 2WNZA 2PTYA 4KCWA 1OQFA 3PS7A 3FLUA 1O5RA 3MMDA 3TU9A 3VM7A 1B30A 3BV7A 3TXVA 3WMSA 1XUUA 2Z00A 1EIBA 3A21A 2ISVA 1XG4A 3LGGA 1K8YA 1XX1A 2NQ5A 1B4KA 3M6DA 4LAMA 1W1ZA 4KRUA 1REQA 1H1YA 3URQA 1KM2A 3OLDA 4A8IA 4EIVA 2XPKA 4K7VA 2V3GA 3SUTA 4AWUA 1D8WA 1VRXA 1KC7A 5D04C 3L4UA 2ZZ3A 4LYKA 2XTKA 5FJIA 5FL1A 4KRTA 1TA3B 2R1LA 2WVSA 4NSBA 1UD3A 4I90A 4V2XA 1HXJA 1TZ9A 3W83A 3TMQA 1PKMA 4JDYA 3WMCA 1E4IA 1LM1A 4LVGA 4AWTA 2I56A 4NAFA 1QPRA 2O9OA 3O63A 4JYEA 1DXEA 2GQAA 3NGFA 3BW4A 3CK5A 3EAUA 3T0TA 3GKAA 3VKCA 4H6EA 2FFIA 1XGZA 1OHLA 2YLLA 3DFNA 5KZMA 4LSBA 3TYCA 5GJMA 1PIGA 1EJVC 3GTHA 3VX1A 5AHLA 3MHGA 4EWND 4H7VA 3C2OA 1BVZA 3LBCA 4JTDA 1XBZA 2DSZA 1N7KA 4JTFA 5FJJA 3Q65A 3RIKA 2Q6ZA 2X7VA 5M3WA 3GRIA 1VQTA 4UIOA 1Q6LA 4X9YA 1V0NA 1KFCA 1W9PA 3M44A 1M65A 3ABZA 4B3ZA 5DN1A 3E2VA 2ZXQA 4LFYA 2X2YA 1W3IA 1SSGA 3UBPC 1OFRA 4QSHA 3G1RA 2ZA2A 2CITA 2X7WA 2XM2A 5D38A 4FEZA 1VP5A 2Q02A 1R3QA 3VA8A 4YS1A 1P6BA 3V5CA 4HQVA 2X05A 1LT8A 2YCJA 1GG1A 1YNPA 4IM4A 1HX0A 4WX2A 4F0SA 3UNTA 3C8FA 3UCDA 1ZJBA 4BY3A 5MF5A 4JKLA 3L67A 2O56A 3S2LA 3LCWA 3ZVHA 2R94A 2QIIA 4AUBA 3R94A 1F4HA 1XF0A 3GHUA 1LF1A 2XDFA 4NY2A 4Z1AA 1FWDC 4PRRA 3UZ5A 3LTSA 1M53A 3SUVA 1AL8A 3MYPA 3LPFA 4LT9A 4D2JA 2PDXA 4CN1A 4DBUA 4XBJA 2GVJA 4I5UA 3TNOA 1NWTA 4X63A 1XYLA 2CU0A 1TIWA 3GDBA 5A6AA 3NQBA 5E9AA 3WNLA 1GJUA 2XIJA 4TO8A 2REQB 2I17A 4A35A 3BOFA 4EX4A 1E71M 3U5UA 1DQXA 3BZGA 1ISYA 2PDBA 1I1WA 1Q66A 2QCCA 2I14A 4NXSA 2Y62A 3HGRA 2WZIA 4CCZA 2PDIA 5HWJA 4LB4A 3LCHA 4YL2A 3I10A 1SFTA 3ZSSA 1RVGA 3T2PA 1ELSA 3EMCA 3URBA 1HL9A 2Z7GA 3G6LA 3HBLA 3OEXA 3EDJA 4QLJA 1V7YA 4K39A 4GUGA 1H1NA 4PCSA 2Z27A 3W7DA 1BGGA 2XIIA 1A5UA 1Q7QA 1QW7A 3LG3A 4F40A 1G4SA 3WMBA 4L9YA 3RITA 1LLOA 4XKMA 3IV8A 1J6PA 1L6YA 3LHTA 4J3WA 4ZQOA 1SSDA 3ITXA 2VXNA 1JZ4A 5DFAA 5BXRA 1GVIA 4FA3A 2GVLA 3SR7A 4UNLA 5LA2A 1LLZA 4GYJA 2HBXA 1SO5A 2PMQA 2PS2A 2G4FA 1B4EA 1XCFA 4KRZA 3BOXA 5L9FA 3CNYA 3G18A 3Q45A 2WBKA 3L5AA 3O7UA 2QUTA 3EXRA 3RU8X 1VFTA 2F6KA 3HPFA 3KDOA 3SFKA 2TRSA 4AZBA 2FZDA 2EG7A 4XO6A 4DWSC 3WL0A 2J25A 4ROPA 2XZ9A 3BSHA 4WY0B 3CHEA 3UG4A 3FFSA 1UQYA 1QU4A 1BD0A 3MSRA 3B06A 4H3DA 3EDFA 2ZWZA 4QRNA 4KKXA 4XD6A 2FIQA 3WLQA 1TTPA 1CCWB 3N15A 3UPBA 4DZIA 3LGEA 3VDHA 2DJLA 4OGZA 5C2XA 4I9AA 3VFCA 1GWJA 4F66A 3KS5A 4D1JA 4OOUA 5M5DA 2PGFA 2WPGA 3WKZA 1E43A 1BSIA 1XD0A 1MVYA 2VNCA 4ECLA 1OABA 3BGGA 5JMUA 1E4NA 2H3DA 3W7HA 3FYOA 1FBAA 4AD2A 2CETA 4KW2A 3M47A 1UA3A 3QC3A 3NQ2A 1UZDA 2JK2A 3VKDA 1DJHA 5FCZA 4NKCA 1MXSA 4HK6A 5HDRA 3HG3A 1QPQA 1E15A 3LPGA 3WN6A 7TAAA 1ODUA 1O94A 1V3IA 2QGYA 3BMXA 4ZVJA 3AIEA 4ZOBA 3USBA 5C8BB 3TN3A 2J7HA 3AMCA 1DWHM 1A50A 3N25A 4JFSA 2HV5A 4BI5A 3BG3A 2ATMA 3PUGA 1FOBA 3RR4A 4UQEA 2E5CA 3AMKA 1ZQ5A 3G8RA 4IIDA 4NRSA 1PZ2A 1NTHA 4MY9A 4D6CA 3G2GA 1XCXA 2PP3A 3USZA 3A3HA 3PG9A 1SUXA 3K1GA 5DT5A 4RDWA 4EXBA 3H6OA 1FUYA 3IJ7A 1Z89A 3T4WA 1QDSA 4Z2KA 4P7OA 7REQB 3W86A 4AY7A 5EA9A 5AHIA 1UR8A 3WCZA 3MCOA 5DY3A 1QHZA 4W7VA 5D2TA 3OIHA 4AIUA 3O16A 4PFHA 4L7ZA 4IIFA 1O5QA 3M9YA 3UG3A 4RUBA 1QPNA 1FA2A 3HJEA 4DB7A 2E5BA 4JD4A 3GG7A 3LLXA 3VOHA 2C0AA 3PZGA 2GQ9A 3KBJA 3E6EA 1PHQA 1WBHA 1MNZA 1W9XA 1M7XA 4GISA 3KBMA 3EX1A 1BVNP 2V2CA 1XPGA 1IHIA 2PDGA 1FXQA 3DDMA 3OOQA 5CAKA 3NDOA 3R1ZA 3UJEA 2FB3A 3P3BA 1US3A 1SJDA 2PEVA 1DQUA 4FALA 5FF3A 4M1RA 4U31A 2VELA 3WYZA 5G5IA 1LOQA 4IPNB 4ADUA 3DFOA 2XH0A 3RYSA 1JD7A 4FNQA 1ZZMA 4ERIA 1KM5A 3LHYA 3BURA 1XICA 4R33A 1IWPA 4MWAB 4J40A 3IJ6A 2ZWYA 2DORA 3CYVA 3PTDA 4FHAA 3ZYZA 4DUWA 4YHEA 1ZUAX 4EANA 3BJTA 1R3WA 5CGMA 4KT2A 4J27A 3GSMA 3DFSA 4RNHA 3EX2A 2QDHA 3GVRA 3HGOA 5HWNA 4X61A 3ANYA 2WWCA 4NASA 4Q8MA 2VHLA 4KWOA 2OT0A 4IMFA 2AGKA 3UW6A 1OFBA 4W84A 3LMZA 4IP5A 3T81A 3WD3A 1ZJAA 3BAJA 4O0ZA 1ADDA 4PSRA 2QZRA 3BGJA 3VC6A 1GT8A 3H7RA 1OY0A 4AMCA 2VJXA 3WF3A 3EX6A 2ZRUA 2J7FA 1B3ZA 4O11A 4Z08A 2ZZ6A 3MCMA 3TKFA 1FWHC 3POHA 1UUMA 1Q3NA 5CKSA 4OBRA 2PWGA 2J8TA 4OWGA 4V15A 3PBWA 4L65A 4XO7A 4Z2GA 5LIYX 1ESWA 1LT7A 5IDIA 5JBEA 5CPMA 4KIRA 3NQAA 5E09A 3ATZA 1QWKA 1SO6A 5TD4A 4QQUA 1DP0A 3LPOA 2VUYA 4HBKA 1IYXA 1JDAA 3OG3A 3B8IA 4QE1A 1P4CA 1SW0A 5FOOA 3UETA 5D05A 1D3GA 5HJYA 3PNZA 3VYLA 3SGUA 4MFDA 3VZZA 1FWAC 1J01A 5BRBA 2J4GA 3KM8A 3TOPA 3IUDA 4I9MA 3FV9A 2Y5JA 3VCNA 3CL7A 3WDJA 2ZE0A 4TV6A 5AN7A 1FRBA 1W3LA 1SQ7A 3I4KA 1F8MA 1WBJA 1LBFA 2OQLA 5GNZA 4N9DA 1BPLB 3MBDA 1JFXA 2REQA 3F7JA 1K77A 4GO8A 4GY0A 1XIBA 2CXEA 4ZOCA 5A8PA 1FDJA 1TMLA 1XYFA 1V7AA 5D09A 4PMJA 2VFHA 3NZQA 2QNEA 1DJXA 2HVMA 1DJGA 5I3GA 5LGXA 4C7DA 1GVRA 5D9OA 3M0MA 4AIEA 3TK7A 1S2UA 1NIUA 1S5NA 5C70A 4YTUA 2YLAA 1EA9C 2BBFA 4Y8EA 3HPZA 2XFFA 3K13A 4AEFA 3OODA 1J5SA 2BHYA 2J8GA 4UOQA 2Q3OA 3NSXA 2EEXA 5F4SA 5BRPA 3QHMA 1K02A 1S2CA 3GNPA 3L5LA 1AD4A 1V6TA 3POCA 2QHAA 1H50A 1UB3A 3H22A 3NPVA 1XSIA 1B9ZA 4JX6A 4R53A 1E73M 2OO0A 4GH3A 1M1BA 1XCWA 2R9RA 2YA0A 3MI6A 4I9JA 1GVOA 4V27A 3ES7A 3HG5A 1Q63A 3M0VA 1XPYA 1D2KA 4L4MA 1ZRQA 4E5TA 2NUXA 4UOJA 4HTBA 3DKJA 3VZYA 2VMFA 1W3KA 4IQDA 3LN3A 1FCBA 1Y0EA 3UWZA 1OZQA 1JI2A 3P5YA 1O5XA 1WPCA 5I03A 2TAAA 3GIYA 4ZCWA 1QI3A 4W9TA 3I6RA 9CGTA 3V5FA 4AQLA 1VFLA 3VOCA 3KRZA 4XZWA 3P0WA 3C2YA 3IWPA 1OYBA 4ILSA 1GOQA 1EC8A 4MJ4A 4UQ9A 1LL4A 1QI4A 3GK0A 3NDZA 5U7SA 3SY8A 4MJZA 2WKGA 4MY8A 3RK8A 3VABA 4PB5A 3RLUA 3V1PA 2CWNA 3GXNA 3L7RA 3C2VA 4NVTA 1P0BA 3IAQA 4MJ2A 1NELA 2DT2A 1EF2A 3G0UA 1QWGA 3S83A 2NX1A 1QOXA 3SCOA 1U5VA 3RF9A 2YR1A 4O57A 3SCSA 2GJPA 3EOUA 3NR0A 4LS1A 1QNVA 3TC6A 1UCWA 1VD6A 5EMLA 1KRBC 1XIIA 4BZYA 3FYYA 2DH3A 4V33A 3GH7A 1R38A 2OCZA 3SGZA 4MFEA 2I57A 2V68A 1QOPA 2WVTA 3PVFA 2H6RA 5HMSA 1YX1A 1J0KA 1BLIA 4FOUA 3ZT5A 4DZAA 1UBSA 4F2UA 3ZO9A 1E72M 3NO5A 1KRMA 3B9EA 1LRNA 4AWEA 5FJRA 3WK0A 1H51A 3PPFA 4QJ3B 3SCNA 1LWHA 3EWXA 4JHMA 2DGAA 3WFAA 1PX8A 5H91A 4KERA 3QRHA 1HP4A 4E8GA 1O95A 4PBGA 6ALDA 3MUY1 1OIMA 3SY5A 2AAMA 5HOSA 2E6FA 1OGGA 1O12A 2EPOA 1TJRA 2FH6A 1QPOA 2PLMA 4U33A 3F4DA 3IRSA 1HNYA 3R7MA 1W0MA 1YPFA 1EX1A 4WLCA 2DZSA 4H19A 3I3BA 3DFHA 3EB3A 4KETA 1ZAIA 3MJMA 7REQA 1NDWA 3EWUA 2HXTA 4MM1A 2PGWA 1XYCA 4XK2A 4W85A 4NF7A 3AIQA 2X2GA 2E6YA 4WSJA 3OTRA 4NYYA 2DU2A 2VTFA 5I6SA 1TE6A 3S2JA 2O4MA 1VYRA 4ES4A 2Y8KA 3J7HA 5IOBA 4GXPA 4J35A 3EOLA 3H2EA 1AQ0A 5EMMA 4P8VA 2JEPA 4ZTXA 3PZ9A 1MRAA 1TMQA 1VBRA 3BLKA 4CD6A 4AZIA 1WZKA 3ITTA 2XUCA 4LYQA 2NXGA 3ZLGA 3M0HA 3AWOA 2PWHA 1S39A 4TOQA 2BSLA 2FHFA 5IBXC 3RCYA 1ONRA 2WB5A 1T96A 3UZJA 3M0XA 3UWWA 1G7UA 1EO7A 2WZMA 1J18A 1XP3A 3FVDA 5FSEC 1X6UA 2AGTA 3H54A 4G56A 3IIOA 1YADA 1ISWA 2PD5A 3W53A 3TYBA 5I07A 2FZBA 4LWWA 1KCZA 2G0WA 2VRJA 3GU1A 1FDZA 4WF7A 3P67A 2XVKA 1W1PA 3SCQA 4MWAA 2FHBA 4NNAA 4DLFA 3NQVA 4G2DA 3ITVA 2XH2A 1R3RA 2IXUA 3FKKA 1KFEA 4CD7A 4UTFA 1F7BA 1ZSXA 2WWDA 2FVLA 2AL2A 4UNKA 2IXVA 2E8YA 3TJIA 1KW1A 3V36A 4TMBA 3U4AA 4GG9A 3OGSA 4DM1A 3HFYA 4JHOA 1D3CA 3VD4A 2NV2A 3WJXA 1R7OA 1S1PA 3ABXA 3ARQA 3FA4A 1XLDA 1V79A 3TQVA 3CMGA 2PDPA 4D1IA 2ZRXA 1ONXA 2OZ0A 4XSLA 3TWBA 1I2NA 4CVUA 4DJDC 5IRPA 4MNLA 1TV4A 1KM1A 4P8UA 4OKDA 1RV8A 4F3HA 3E74A 1QT1A 3AIWA 3XIMA 3PWGA 2CIPA 3SDOA 1KBBA 2J9XA 2E4TA 1NH6A 4HT3A 4UFKA 4DNMA 4TVUA 2VGGA 4H83A 3ARRA 3OBAA 3GG1A 3V7PA 4HA3A 4D6DA 3STGA 2GUUA 5E1QA 3SRHA 2W79A 4KCTA 2Y5SA 1AQMA 4GQGA 4K37A 5HUPA 5H8MA 1E3XA 4JTIA 2TODA 3AJ7A 3QMSA 3SRDA 4QHRA 1HGYA 1E70M 1JGMA 4ASTA 3GXFA 3UJRA 1PZ3A 3EMZA 3MUZ1 2QAPA 4KEUA 3GB6A 1OK6A 3SCTA 4IIEA 1CGUA 1DIDA 4IGHA 1K8ZA 2J9ZA 3CHCA 3IGXA 1F3EA 3UZWA 3BLDA 3MI3A 3MKCA 4UFJA 1CI1A 3AAMA 1OB0A 2PP1A 2D0HA 3V4BA 3VM5A 1V3JA 4JGDA 2B81A 3O0KA 5AB3A 4J3SA 4MZ1A 1CLVA 3ABRA 3GIPA 5C7HA 3N73A 2BOFX 3P61A 1BWKA 1JULA 3TC7A 4BCEA 4O52A 2PU1A 2ZUVA 4XD4A 1MSSA 4A8LA 3ABSA 4NNCA 2FZ8A 4LBRA 3LTPA 2PDCA 5ECVA 1TVLA 3N2OA 2NQ9A 1T6MA 2PSNA 1XYAA 3IJ8A 1TVNA 3BLIA 4WHBA 3GNRA 3MCNA 4B5NA 4ZZ9A 4ICCX 1YTEA 1L6GA 5A6SA 1UD8A 1E0XA 3WDRA 5A8QA 2ICSA 3SZ8A 4GMEA 4QG6A 3LCXA 2RGMA 1B9BA 1H7WA 1H7NA 1W1A1 1LBLA 4LAKA 2QPSA 5E5CA 5KMYA 4FIQA 1FWSA 4EF9A 4IF2A 3AHXA 1HZYA 4UTTC 3AYSA 4UCGA 4HU8A 2UZ9A 3CTLA 5F4XA 3W75A 2WLYA 3L12A 3VNZA 3H8AA 2FKPA 4RZ5A 1K8CA 3U0HA 3S9YA 4P8WA 3BK0A 1U1UA 4PBFA 3VE9A 3PAOA 2PWEA 1VCGA 1PO9A 5BWFA 1LL6A 1AH4A 4FX7A 3ZWSA 1FCVA 4UQCA 2DSKA 2IQTA 4NZ3A 2ZC1A 1UR2A 3RM4A 3WLPA 2GQ3A 2EG8A 4UXDA 4DYJA 3MWAA 4H2HA 4D9PA 2Y7FA 3UZZA 1KD0A 4DJEA 3BDKA 3B05A 4I8YA 3AS1A 3SIZA 2PU0A 3NUKA 1RUSA 5F2IA 2TMDA 4AX7A 2RJGA 3U2EA 1QNPA 2Z2UA 1FCQA 1AW1A 5BXPA 2F2HA 1HG3A 3WBEA 4QS5A 3G8EA 3EA2A 3F4VA 1UKQA 3W1NA 2WQDA 3G5EA 3MS8A 1X7FA 4DWSB 1XBYA 3GHRA 3QLLA 1KM6A 2JGYA 4LUYA 2FB2A 2G95A 2YKKA 1UG6A 3K2GA 3WLNA 3ZSTA 2BV9A 2R1PA 4QDPA 4B4HA 4UNIA 1JCTA 3T0DA 3NSNA 3WH7A 2POZA 1SYTA 3TEVA 3M41A 2ZOXA 2J62A 2HE8A 3M5YA 3OW1A 5T26A 4LS0A 5CPQA 5LHEA 3QM3A 4FOJA 2ZXDA 1H62A 3T1GA 5FF2A 2QR6A 1U2YA 1W3NA 3CS2A 1JL8A 6TIMA 2PUZA 2OYMA 4CKQA 3URNA 3KBVA 4KBXA 1IT7A 3GVQA 2B7PA 4WDXA 4MYAA 2A4AA 2BY0A 1ZL1A 2VEKA 2Z2BA 3WNNA 2ZTJA 2A3BA 2VL4A 4AVFA 2GGGA 1ZGDA 4NNBA 1K03A 3CU2A 3U7BA 3WD4A 4YLWA 3O0FA 2Z0IA 1C29A 3W1LA 2OSXA 2NUWA 4GBUA 3REQB 1VR6A 3S47A 4K2SA 3THUA 3M1ZA 4ZB5A 3F2DA 4OJYA 4J7RA 2DZXA 3BPWA 3A64A 4XZNX 4IGNA 3DBPA 3G6MA 3A5FA 4GFSA 3O15A 1R46A 1LBMA 3MSDA 4RW5A 4ONVA 5E70A 1IWBA 4EF8A 4U2ZA 2F2KA 1ZPTA 4KEVA 4MZYA 3O6DA 4QJ4B 1THFD 1CXHA 3WZ0E 5TNVA 4FB7A 3S46A 2HVOA 1HKIA 3IIZA 2WC4A 1PDZA 4FS9A 1BG9A 1SMDA 2PC4A 2CZDA 1ITUA 2FFCA 1TRIA 3DXIA 3MZNA 4JEQA 4R27A 2W91A 1F07A 2WHMA 3LI0A 3O3RA 5E93A 3WQPA 2XH7A 5CQ1A 4IICA 3AS3A 3ICJA 2RJHA 4MDOA 3ZJKA 3GTXA 2V6AA 3W23A 4ZMGA 3CASA 1ZLPA 1BTCA 2V5DA 4R9OA 5BROA 1XL9A 3N14A 3IIXA 1W9DM 5JU6A 3PB0A 2LLEA 4L61A 1R87A 2FGLA 1G4TA 2XH4A 3W28A 3V0TA 3ZLFA 1MFVA 1ICQA 4ZQRA 1W5OA 2E6DA 4NU7A 3G1AA 3SRFA 2AKMA 1POJA 3W3OA 4B3LA 3TZFA 2BX7A 2OX1A 4QLLA 4ACYA 5CC6A 3JZUA 1K70A 2ZXAA 4LEFA 1E6PA 3L4YA 1J12A 3MSYA 4QBXA 2XIMA 2QPUA 4ZBCA 2VVNA 1SZEA 3DESA 3MVIA 4M56A 3VAVA 4CQ8A 3GDTA 1ZALA 3WY1A 3VZXA 3ALFA 4IP7A 2WM1A 2ANUA 2D3NA 4B16A 1VF8A 1IT0A 1AUSL 4F0LA 4ZR8A 4B9YA 4W7WA 3B8VA 4PUMA 3NQ6A 1GUVA 3APGA 3VOGA 1E9IA 1HVXA 1B3VA 2FMOA 4OIFA 3LHUA 2OWWA 3IGHX 1E56A 3LK6A 4LJ3A 4Z1DA 1MNSA 3TTQA 2CLFA 3TE9A 4H1ZA 1MI3A 3HFTA 1VPQA 1EPVA 1XUZA 2GYIA 3K8KA 4AYGA 4A3YA 1TO3A 3HOJA 3W2NA 5IHSA 2ACUA 2XWEA 3NWRA 5E0FA 4LPCA 4DX3A 5DF0A 1A49A 2QIWA 3RLGA 3O6AA 5DMNA 1X8CA 3JRKA 1KXVA 1Q7ZA 3APTA 3VIGA 3SGGA 4GQRA 1G6CA 2ESCA 1KFBA 3QXBA 5FEZA 2D2JA 4S2BA 3AUOA 1JFHA 5ECUA 5HNTA 3M16A 4WKHA 4S3DA 1QK2A 2D2GA 3BCDA 3V18A 3BVJA 1I0BA 1M6JA 3VNJA 4OBSA 3U8GA 3W85A 1DJZA 4N9CA 3HGJA 1E5NA 1M68A 4D6FA 2WZEA 3SIMA 3WD0A 4ADTA 1XIJA 3MHFA 2XG9A 2E1DA 3VKBA 1CBGA 3KLLA 4Q8OA 2V3DA 3FDGA 3P93A 3LRLA 1LP6A 1E6QM 5CJMA 4XSMA 3BLFA 2P0IA 1W5PA 4Q8VA 2Z6IA 1JYNA 4I5RA 2GJLA 2C13A 3GNOA 1A4LA 4R85A 4RPQA 4HMCA 2R1MA 1WUFA 1AK5A 3GE7A 5BU9A 2WM0A 1OD8A 5DRCA 1F74A 4XVDA 3TTSA 2WZTA 1OINA 1V02E 3FOKA 3M5VA 2WK2A 1YXYA 4JTJA 5K9DA 4AFYA 2V63A 1OD0A 1XW8A 4HCHA 1T8XA 2OXNA 3CV1A 1RP9A 4H9UA 4H6QA 1ZCOA 3W7KA 1PYMA 4IPLA 1GZ1A 2EPKX 2B4GA 4YXGA 2Z1KA 2GGEA 4EXQA 4GYPA 1WDWA 1H7PA 1K1DA 5IFPA 1ZNNA 3ZT7A 4RV8A 1Z6KA 1JI1A 1E9ZB 2QGHA 3IPWA 4NI8A 4O53A 3BAXA 1XHGA 5CLTA 1RVKA 4I7VA 1I75A 2ACRA 2VGBA 2WHKA 3ISIX 3L0GA 1W5QA 3MO7A 3KWSA 5DRIA 3MUXA 5FAGA 3FEMA 2BODX 8XIMA 3WK3A 1A5CA 3MB9A 4FXSA 4D72A 1XH2A 4LGXA 4JDBA 5I79A 1UWRA 1IV8A 5A95A 4IXHA 4GJIA 1HO1A 2W66A 1QMLA 1KLZA 3FW6A 3WEOA 3N2CA 4BQ5A 3SJNA 1UJQA 1XWYA 4YYCA 1OC6A 3HPAA 3GQYA 4KCUA 3WUBA 4JX4A 2OQHA 3SBFA 3FDKA 3RM9A 4DWSA 3W6MA 1J4EA 2PWVA 5E0KA 1FY6A 3H24A 3KW3A 3I7RA 3WQWA 1D7FA 1UH3A 1ZB5A 4LAOA 4O13A 3L23A 4WD0A 1TSIA 2RAGA 4CN4A 4FNPA 3VNIA 4CGTA 3WBWA 3C86A 5CPLA 3BL3A 2EF9A 1BHGA 1LQ0A 3B97A 4NZ1A 3MPGA 4GXWA 3WX7A 2JIWA 1NVMA 1EZWA 2CZVA 1KM4A 1R3SA 4CCCA 1V93A 3R2GA 4XD3A 2VKZG 4Y9MA 1EGZA 5CZTA 1O66A 1PHWA 5I09A 3OZPA 4JN8A 4A3HA 2BVWA 2VURA 1G69A 3AQUA 4AIBA 4YU1A 3WBAA 3L2IA 4KWSA 5HUOA 3VINA 2YZRA 2VFEA 1DWJM 3B0XA 3TCEA 4U10A 4F8XA 3STFA 2DT3A 1UWTA 3CUIA 3UXDA 3S9ZA 1XLEA 4GCXA 4MAZA 4YMZA 1QNSA 1TZ7A 3W7RA 2W0UA 4UR9A 3REQA 5I0DA 1OCNA 3TQKA 4RJEA 4GQQA 2IS7A 2J66A 2PDQA 1VEPA 4PEKA 1JPDX 1UKTA 1H7RA 2HPMA 4XAPA 3EWYA 4H6RA 3S6OA 1GQNA 1RBLA 4ZENA 1VB9A 1W5NA 2NLYA 1GYNA 2C1HA 1XS2A 3W7CA 1EJTC 3WF0A 1P6WA 1SPQA 1KV8A 1F8IA 5HATA 1BXBA 4DF2A 3LXAA 3CH0A 1KB3A 4QNWA 2PTXA 3H23A 1MUWA 4J2PA 4IZGA 4JL2A 5CBIA 4DPQA 1SGJA 3GTNA 1E0TA 1TR9A 2DUZA 2QV5A 1XISA 3CO8A 3WELA 4A29A 3KL0A 4D8AA 2NVDA 4JTQA 1RPXA 1X8FA 4W8AA 1JF6A 2Y85A 3W1PA 4UQAA 5HXMA 2WOQA 4PUNA 4Z2IA 4L9XA 1RXOB 1V6YA 1NFBA 3BO9A 4CNTA 1XSKA 1I0DA 3C52A 3BV4A 4XUYA 5CJ5A 5J5DA 3IS4A 3VIHA 5CEWA 4XB3A 4AD3A 4REQB 4G9PA 1MQQA 3UXAA 4GXMA 2Y24A 3C0LA 3G3MA 1ME8A 4H8HA 2CBJA 4AEEA 3QBUA 2X8RA 3MV01 3OYZA 1B5TA 3UD6A 2VEPA 3THAA 3E0VA 4FXFA 2JKAA 1DWIM 1JZ7A 4JCMA 3GU9A 3CZ8A 3UGVA 1UOKA 4O4WA 3PZOA 1HP5A 4PUUA 4OE7A 1QASA 2IKHA 3RN6A 1IEVA 2CHNA 1IZCA 1EOKA 1XIEA 1P48A 5MKGB 4B5UA 5FF0A 1VFSA 5G2HA 3WEZA 1ME7A 4IPPA 3RILA 3RLVA 1OC7A 2ZZ1A 4FSAA 1TVPA 2R14A 3GG8A 5D9PA 5KITA 2PLJA 4YTRA 3GNXA 3CUHA 2YFNA 3KDNA 1UPMB 3O8AA 2VX6A 1IXQA 1FHDA 2Y8UA 3VFLA 1K9FA 2JE8A 3KWXA 4UB9A 1HKMA 3VGFA 3VIFA 3G1SA 5T91A 2C79A 3P74A 4AX6A 1T99A 2EJAA 4TUFA 2W4XA 3FSTA 1PCKA 5AVNA 1XLFA 4NHVA 3SN1A 3H2MA 1Q6EA 2FZ9A 1Z7AA 5BMWA 2YDQA 1VRDA 3PC0A 2J8FA 5CZ0A 4H9XA 2Q09A 3WJZA 4RE2A 4PFMA 1V3LA 3OVGA 3AISA 4DBEA 1UIPA 2ONEA 2XVGA 4NIRA 1OX5A 3P14A 4GZ7A 1TV3A 4H6KA 2YCKX 4FLQA 1YQ2A 1DXIA 1NSJA 4Q8PA 2A6NA 4ZXLA 2ZDSA 4US5A 2VENA 3GY1A 4GZIA 4QJ5B 2PAJA 5K4XA 1Q2RA 2FYMA 2CZEA 4Q6JA 4RV3A 4A3UA 3L2MA 4XX6A 1ZY9A 1DWAM 1FCUA 2GOKA 1LRTA 1EJWC 4HA0A 3S6TA 1UKSA 2VWSA 1TKKA 5HINA 1ISVA 4YCPA 4S23A 3OJGA 4XZHA 4AW7A 2O0TA 4ORIA 3RU6A 1LYXA 3IIVA 2CLKA 2HRWA 5SWUA 2E9BA 1RJQA 1IEXA 3H2NA 3QR1A 2V5JA 4JFWA 3DFPA 1Y65A 1XLKA 2OGYA 2DY3A 4IGMA 3CC1A 4MG4A 2ZZ2A 1KBLA 1KCLA 4GHRA 2OZTA 4GI8A 3WUEA 3P5ZA 2DV0A 2DZUA 4YHGA 4EOUA 2OG9A 1UD6A 3SFWA 1DIEA 1VPYA 2V69A 1VIZA 3EKGA 4QAWA 3I65A 3VIPA 1S5WA 4PUEA 4DF1A 4RK8A 1OM0A 1Q6OA 2D22A 2EKCA 1E9LA 2FJUB 3OVRA 3RGTA 4XBKA 2RGLA 4N2YA 1GOKA 4RCXA 4ICMA 3BLPX 4QJ1A 3QKZA 1IE7C 1HL8A 4G6CA 2DZTA 1GKPA 1MW2A 1E6XM 1H5VA 5KTLA 5HQEA 3B8TA 3BE7A 4OV9A 2Z28A 3AS2A 1EIXA 3TSDA 1I60A 1JJKA 1G7VA 1V3MA 3U2CA 4H8NA 2J13A 3LBMA 3T9PA 1ONWA 4YTSA 1C8XA 2HMCA 3DI1A 3W1MA 2V38A 2EPLX 4UFIA 1IWAA 4ALDA 1R2SA 4MNKA 1YLVA 1QK0A 1S1RA 3V0SA 3DX5A 4IMCA 4FPSA 1S3HA 4LVBA 3QN3A 4MB5A 4G7FA 2DZVA 4DXVA 4S3FA 2PGEA 2XN2A 3MANA 1UKPA 1E6ZA 1LG2A 4AB4A 1EUAA 4PZVA 9XIMA 1KR1A 1SJAA 3RCMA 3TW6A 3WSUA 2QUUA 3V3WA 5EMYA 2OT1A 3HURA 3VVGA 2RHGA 3UA3A 4QCEA 3NPXA 5HNNA 3VIMA 1HJUA 4KEMA 1K7EA 1PZ1A 4INFA 3ZXWA 3DI0A 1CB7B 3PJWA 1OF8A 3QMTA 1CB2A 1P0DA 3N2TA 3A13A 2NSXA 5LNWA 2Z25A 4N0RA 4WR3A 1HO4A 4DELA 4PMZA 1W3TA 4AD0A 4LRTA 4MHBA 5FI8A 1UZ4A 3WUFA 5HANA 3E49A 3T78A 3AHTA 4M6QA 2ZDRA 2WW5A 3PZUA 3C0QA 2YXGA 4UFMA 3VIOA 3M7WA 4FXRA 3IVTA 7ODCA 2NT1A 4IPIA 2F6XA 3RFAA 3EBVA 3PJTA 3NNTA 5AHFA 1P0NA 2FZMA 1F76A 3O9NA 2CZFA 4PMYA 3TC3A 1HN1A 3DFQA 1EJRC 1VFFA 4HZ6A 4JN6A 3BUVA 2ON3A 1NAL1 2Z29A 3IJQA 3KP0A 4ZO8A 2V8ZA 4CCEA 2W5FA 2NXHA 4LVDA 3ATYA 5A6BA 4F0KA 4QISA 5GJPA 1GYLA 1YXCA 1XBXA 2FVKA 1IZKA 1WDSA 2YYTA 1Z44A 4MB3A 4Q4OA 4Z17A 3WLOA 3E2SA 3MSGA 4B92A 3TDFA 1C93A 3NM1A 3HM7A 3UZXA 1C8YA 1F61A 1XDLA 1GEHA 3H2AA 1DTNA 4GE8A 1MW3A 2R8WA 4DPPA 3QR0A 2VM8A 4Z0SA 1GVYA 1QUMA 4ML9A 3KZPA 3N04A 2CERA 4NAEA 2PDYA 1XLGA 2PURA 3D3AA 4Q8QA 1PX3A 2QDEA 3UXIA 1CNVA 5LHFA 3PFRA 3EB2A 1QO2A 3W07A 1Q6FA 4LVFA 2PTWA 1R3VA 4GIYA 2ZBTA 4QROA 1PSCA 2ATSA 3L2LA 1VHNA 2Y7GA 3L4TA 1TPDA 1JXKA 5CZKA 4REQA 5FA5A 3ZFHA 5REQB 4KESA 1F3XA 2E6AA 4JFTA 2E40A 3K1DA 3G1DA 3QOMA 3SSJA 2OKTA 5IBXA 4GVFA 2WCAA 2HTMA 2GPTA 4PMOA 3M0YA 3UR5A 4S3KA 4JN7A 4QTGA 2QDGA 1NDYA 1KWKA 3UWYA 4YWIA 3P7YA 3V5OA 3WDQA 7CGTA 5CSYA 1FH7A 2J77A 3TNBA 3WLKX 1DE5A 3QV7A 3G1VA 3NQMA 5AZ0A 3FA3A 5EFFA 4B5WA 2QKFA 1TUFA 2X30A 1U5HA 3KRUA 5EYWA 4DBWA 1JYXA 3G77A 3F03K 1L0PA 3G1HA 5MKGA 4P7LA 2QVNA 2QCDB 3FCPA 3ZT6A 3L9CA 1PXGA 5CSRA 3W87A 3UA4A 4J3XA 2ZUSA 4WDWA 5FKYA 1AJZA 3W7EA 4QGCA 1LUCB 3G0SA 2O4QA 3M46A 3N2XA 3FVMA 2WKJA 1W8SA 2RKXA 2WMGA 3W1TA 5DCBA 1C90A 5CC5A 3WD1A 3Q2DA 3AJXA 3UCCA 4ZSTA 4MZ8A 4H7ZA 5LNSA 4FX6M 2TSYA 1W1YA 1AD1A 2WQPA 4O4VA 3HU7A 4UTMA 1OG6A 4ORMA 3BWWA 4DJDA 2IPJA 1ZCCA 1JUEA 3KVJA 3Q58A 1C92A 1QTWA 5BU6A 2E3ZA 4KQNA 2QJMA 2YW3A 4I7UA 3VDAA 3GZ3A 4O1FA 3TYDA 3W81A 3T0CA 5F2GA 1NOUA 2H3BA 3B04A 3QOKA 1P0EA 3PHAA 4ZO9A 1OFAA 3TROA 1O5KA 3T7VA 4ATDA 1MYRA 3SCUA 5CSUA 1FWNA 4CUCA 1JCXA 2GZXA 3HQOA 3BARA 1TE1A 3IEBA 1CT5A 1WKEA 1QXLA 3SSZA 4ZB2A 3SQLA 3PUOA 3QZEA 1XQLA 3EWBX 1J0ZA 4O10A 5FJTA 2Z24A 5AYIA 2GLKA 4OTKA 1NFPA 1QO5A 1KGUA 4Y6GA 4O17A 4QR6A 2E25A 2H8ZA 4DJFC 3CO4A 3RCNA 1L6SA 3DECA 5C55A 3WLIA 4J28A 2AKZA 3UFYA 4IJBA 3BMWA 1Y8BA 3KHJA 2PDFA 5HMEA 2ISSA 4J3VA 2CYGA 4RE3A 1B0IA 2NVAA 3D46A 3OA5A 4Q3MA 1W31A 3QYSA 3TJ4A 1CTNA 3CAQA 1FP9A 3WQEA 4BQ2A 1VFUA 2OELA 3S5YA 3DHUA 3HIJA 2WNNA 1KM0A 1IEQA 4MJMA 3GW0A 3MU7A 4IQLA 3AHVA 3ABOA 3THDA 4DO6A 3NQ7A 5G4WA 4UTWC 3QV9A 2P3EA 3ZMRA 1VBJA 3WLRA 1HGWA 4M7SA 1V0MA 2DZAA 2PB1A 1RALA 3PP7A 4JNZA 3W7PA 3ARSA 3ZIZA 3T55A 4LVAA 4MB1A 3CAVA 2JFEX 1EGMA 4RXGA 2ZIDA 3YPIA 1OFQA 1BF2A 4HZMA 2WLZA 2D2HA 3BG9A 4PR4A 5G1MA 1U1JA 7XIMA 4HNUA 4GWEA 3R89A 4KF1A 5FSDC 4MNMA 4W86A 2JKPA 1BQGA 1CLKA 1O6IA 3ZQ9A 1TPVA 2GGJA 4MF4A 1L9WA 4KFOA 5JH1A 1KKRA 2G50A 2UBPC 4NP7A 2OU4A 4TX6A 3P84A 1AL7A 3LDVA 5CPSA 3BSGA 4W88A 5GNYA 2KZHA 4IIBA 2X1RA 4WCJA 4PMDA 4CCDA 1VJSA 1UHVA 4JYFA 4UTTA 4UMAA 3S2MA 3CIXA 4JTTA 1A5NC 5E0CA 4B15A 4M81A 4AXNA 1MQPA 4FR6A 2CBVA 2G3FA 1EJXC 1XIFA 2GK1B 1A5SA 3U3HA 4WUIA 1HKVA 4LUSB 5LIUX 3S3GA 2DT0A 1G67A 4IQEA 2YL8A 4LUJA 5ABFB 2ZX5A 3W29A 2CHRA 1Z9AA 5DLCA 1SO3A 4TMCA 2NQHA 3QKEA 2CLLA 3VOFA 1KXTA 3SB0A 4JR5A 5FACA 5C9RA 3T40A 3LGDA 3VUPA 4R34A 3APYA 3BZJA 4PTVA 3JR2A 3NO1A 3L66A 1J11A 4GZJA 3WO8A 4S2CA 3W1RA 3E2QA 5A8NA 5BNKA 3BCJA 2PI6A 2YOCA 1MMFA 1E0VA 1XV8A 3C0JA 3DN5A 3OPSA 3QGAC 4GACA 3K8LA 4IMAA 3E2RA 3NOYA 3H55A 5AFDA 3NJ3A 1HIZA 2OB3A 2WNWA 4LYRA 3LLDA 4R7OA 2A2IA 1FKWA 4MPKA 3GXIA 3A4JA 3ARZA 2NLIA 2RDWA 1Q6QA 3VKKA 1U1HA 2C0HA 1KGWA 2X1UA 4K36A 1ISXA 3VU2A 2NQLA 3W71A 4DUVA 2DZPA 3F5KA 5A94A 2FJKA 4JQ2A 4H9MA 1G4PA 2XU2A 2QPXA 4UWMA 4ZQPA 2GGHA 3BLEA 4W87A 5DMYA 1RJRA 3MP3A 3T05A 4KPLA 2G5WA 3ARWA 4RX0A 5BMXA 3PZNA 3FNDA 3KOFA 3VNDA 4MKNA 4JIPA 3ANUA 4LCQA 4Y8FA 3GIQA 2PDNA 4BWLC 3AXIA 3NSMA 1XINA 2PRLA 4DJED 1HT6A 3BLLA 5JBFA 3ELFA 4GBDA 1ZFJA 2WJDA 1I8JA 3M0LA 4EAYA 1SW3A 3HN3A 1C91A 4QE4A 1Q45A 5KEZA 1DEDA 3H12A 1C8QA 3TSBA 1HKKA 4ACZB 1VCVA 3BQ5A 4PUWA 2CHOA 4MB4A 3GHSA 4AHPA 4FLSA 1Y5WA 1BWLA 1JPMA 3WNPA 4M1BA 4O8AA 1SFSA 3LEPA 4BEUA 5REQA 1C7TA 2J27A 3BW3A 4HD5A 1U30A 1JCMP 1E0WA 5EPDA 4E6MA 1EDGA 4A6GA 4Z2JA 5TAOA 5K3VA 2Y89A 4FNUA 1WXYA 1PEZA 1TMHA 1H60A 5DO8A 2WC7A 3WLJA 2QUVA 3TW7A 1MO0A 1NF7A 1UR0A 2DVTA 1AA1B 5FL0A 1U22A 2NV9A 3I7SA 1DE6A 2GQ8A 4O1BA 1R30A 3VUSA 3GXMA 1JAKA 2Y4SA 3W0KA 1GTEA 3T6CA 3S5NA 2BWGA 3VGEA 1Z41A 4PRTA 2QCDA 1XLAA 3UJFA 5FF7A 4P7QA 4TTUA 5D32A 3GH5A 2JEQA 2NWSA 4H8VA 3KCLA 3LB0A 3GC2A 1LUCA 4C7GA 2WVUA 3WF1A 3LQLA 1ZAHA 1W9VA 5C9UA 3W38A 1GGOA 2G3IA 1AW2A 3EPMA 4MDPA 1XLJA 3GM8A 2CLMA 4Y90A 4WJ8A 1F05A 3PZIA 4RW3A 5F2LA 3W1QA 3E02A 5PTDA 4E4PA 5ABTA 3Q37A 1VENA 4NJGA 4HHPA 4WOQA 4DF0A 2I5GA 2QVHA 1J6OA 4XAZA 3LZ5A 4UTJA 1QVBA 1IZJA 3PPHA 1VFOA 2I7GA 1DV7A 3W73A 5DX7A 4DHGA 4C6NA 1DTUA 2YXXA 4IXXA 4JQ1A 3TTEA 1HF6A 1W54A 3GVWA 3WLLA 4C60A 5J04A 2PTDA 3VKAA 4ZFCA 2E09A 1FHUA 1A0EA 3KXQA 4ZXOA 1GQLA 2P1FA 4KWWA 4ZQCA 4QG8A 2OR2A 4C6EA 2VOTA 2FLIA 3FHAA 1WXZA 1XYBA 4HN8A 3N6JA 3W37A 4FP1A 5LIKX 1W91A 2P8CA 2EG6A 3JVAA 1RK6A 2YA1A 4Y9PA 3KBNA 1JYVA 2HZGA 2C1IA 3AXMA 3FJ4A 4R88A 4DIAA 1FQ0A 3U57A 1W2PA 3E0IA 5TQLA 3CBWA 4FNSA 1JZ2A 4ERAA 2J6XA 3NGJA 1GOMA 2J79A 1AZ2A 2R1NA 3KEHA 4WKFA 3TN5A 3MMWA 4IUOA 3M0KA 3VK5A 3GW3A 2CESA 3N34A 1XI3A 1JPKA 5K4ZA 4P7RA 3C4UA 4B91A 3IGSA 1JGIA 3HTWA 4GIAA 1Q85A 9XIAA 3WJYA 3KVLA 3M7SA 1H09A 1Y7VA 4E3VA 3MWCA 4HNVA 3W76A 4HU4A 4S3JA 1GHRA 2YW4A 4B5SA 1QPKA 2X0YA 4IFRA 4PMVA 4C1LA 5EL1A 1ZBKA 4JIIX 1UWQA 3WQ5A 3TCSA 2GGIA 1BEUA 4NJHA 1EF3A 2WYSA 3LCGA 3UGRA 1FFQA 2DVUA 4CD4A 3UEQA 1UH4A 1NY1A 2O9PA 3FAXA 1X1ZA 3TTYA 2BASA 1QR7A 4AZGA 1LCOA 3CM4A 3U7VA 3QPZA 3IJIA 6XIMA 1R9ZA 1RD6A 2BOGX 2V5BA 2F61A 3TH6A 4AEOA 3LERA 4AXKA 3PWIA 1EHAA 1FKXA 5C71A 3DKLA 3B8SA 5G1TA 2V3EA 3DG7A 4RZ6A 3N3TA 3C0SA 4MY1A 4E38A 2V82A 1WKFA 1OBAA 4ZOEA 3W1XA 1LOSA 3OU8A 4DBDA 4PH6A 2YCIX 3W7NA 4UTIA 1A4MA 1KTBA 3L0KA 5D4YA 4L5ZA 1BF6A 1SR9A 4YNGA 4YIWA 2ABAA 3LV5A 5DMLA 3IK4A 3B40A 3ZVIA 4RLIA 2UY5A 4GFIA 5IDZA 4C6FA 2DIEA 1BYCA 2YB4A 3KBWA 3NQ8A 4PL1A 4S3AA 1XSJA 2GK1A 3OP2A 4LUSA 2Y6ZA 5ABFA 3TFXA 5DQPA 1Z48A 4UQDA 3W7JA 3P82A 2XZ7A 3N9RA 2BXZA 5GJNA 4HYRA 3UG5A 2C1GA 2O92A 2NQZA 2BLEA 1KGXA 4OQVA 2DUXA 2XVLA 1US0A 2CCRA 1LTDA 3P6LA 1KV5A 4P5UA 4C6PA 3SN0A 1F6YA 3B8DA 2VFFA 3N2BA 4F0HA 1UZHA 3CQHA 3R4IA 1JZ8A 3K4AA 1TELA 1F6PA 3VMOA 2J75A 3HZ3A 4GKLA 3O6CA 3M0IA 4JQ3A 3OA3A 4CNOA 4KGLA 1R47A 2Y7EA 2E8ZA 1PJ9A 5TF0A 2WSKA 3TN4A 4L1XA 3GFXA 1LROA 3WBXA 3VIIA 1MEHA 1LQAA 1RLDA 3MHUA 1T41A 2Q3RA 2AL2B 3K46A 4NJJA 3TR9A 3C5QA 4IX2A 3N4AA 1X7IA 3LS9A 1JF5A 3T2QA 2DFAA 1R9YA 1OF6A 3B0YA 3SCRA 2HQAA 2XSXA 4CNNA 1V08A 4GX9A 1XRSA 3ZOAA 5A6LA 2WSYA 1FX6A 1EXPA 3JS3A 3N13A 3SUWA 4DNHA 4PMRA 1V8EA 3TJXA 1EBHA 1K7XA 3W1AA 1M7PA 3W7LA 4XKYB 1I2OA 2C6QA 3G3DA 2OSWA 3CL6A 1WOAA 5A6TC 5CCZA 5A6KA 4G5DA 2YXOA 4PMNA 1KFWA 3LYEA 2R82A 3NZRA 3GBEA 2VO5A 3WQ6A 5FD0A 4JY8A 5AECA 2C15A 2QYGA 3D5HA 1VFMA 5EKYA 3IAPA 1Q4NX 4ACZA 5I06A 2X1SA 3A12A 1QW9A 4AZ5A 4LU0A 5DANA 1NF0A 4LRSA 3RMEA 4A4AA 3B0PA 3VGGA 3ALGA 4JTRA 5K9XA 4DWSD 3WF2A 4IQJA 4PUKA 4HP5A 4CQ9A 1V51A 4HB7A 1CGYA 5EMUA 3PTQA 1QCWA 1EO5A 1SZRA 4HOXA 4HPGA 4H7CA 4Q8WA 4HU3A 4JKMA 3GHTA 3AIVA 4DN1A 2EJ1A 4N9EA 5I3DA 4GY7A 3ORWA 3PZVA 3S5SA 2IW0A 3QQ0A 4D8ZA 5EBAA 4PULA 2XSAA 1HJQA 1J96A 1K8XA 4GCAA 3E0FA 3DFYA 3R10A 3VNKA 2ZUWA 4I8DA 1EYEA 4L6OA 2EPHA 4HCDA 1UR4A 1RLCL 4BQ3A 2BHZA 4AMAA 3LHVA 1I4NA 1KNWA 3SAZA 3QHNA 2J24A 2VX7A 3N2MA 1ZP3A 2WMKA 1Q7MA 2W27A 4HHHA 1Z69A 3CV2A 3BXWA 3WNKA 3SY1A 3GZAA 1H4PA 1W1VA 3I6EA 2W9MA 4DBSA 3BH4A 2F38A 5ABGA 1KBIA 3UVAA 3BAYA 2FPTA 3BGAA 1ENUA 1TCMA 1POKA 2OZ8A 2P53A 4Y7EA 4DY1A 1IIHA 1OGBA 5I3JA 5I5RA 3BCFA 3KE0A 4FR1A 1I2RA 3CZLA 4FLRA 5HK4A 1DYSA 3P8IA 4QG9A 4Q32A 4O16A 3OG2A 4M3PA 2HS6A 4FIRA 1KO0A 1GVQA 2UV8G 4HCLA 1JAEA 4PEEA 4NILA 1TJ2A 2BMBA 1PUDA 3K30A 2QXWA 2OYLA 2B31A 2W67A 3PF3A 1MFUA 4GA8A 1A0CA 1QFEA 3ANVA 4HJFA 1QOQA 2YGYA 4D8LA 1WQ5A 5D33A 1CGTA 4C6QA 1RH9A 2DW7A 3S5ZA 3PNUA 2OGJA 2GUYA 4Y2WA 3IJ9A 3LHWA 4FNRA 1TUXA 1X39A 1M7OA 1QBAA 1X6LA 1AJ0A 1R2RA 4V1YA 3LM3A 3DIPA 1UD4A 2I5IA 2X1IA 3AALA 3A6OA 3WQVA 3VMNA 2J88A 2VQUA 1UWUA 2PLCA 4MWAE 4ZTYA 5A1AA 4L1WA 3NG3A 5GNXA 1H5YA 3IVUA 1KLYA 3EPOA 3FS2A 3VGBA 5KETA 1SW7A 1KQZA 1OWQA 4L6DA 2C91A 3FHQA 3QGVA 4C6LA 3FSUA 1Q4WA 3ECQA 4LUIA 1LDCA 4CNSA 5D2XA 2ZVIA 4AG0A <