2YDAA

Sulfolobus sulfataricus 2-keto-3-deoxygluconate aldolase y103f,y130f, a198f variant
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
292
structure length
292
Chain Sequence
PEIITPIITPFTKDNRIDKEKLKIHAENLIRKGIDKLFVNGTTGLGPSLSPEEKLENLKAVYDVTNKIIFQVGGLNLDDAIRLAKLSKDFDIVGIASYAPYFYPRMSEKHLVKYFKTLCEVSPHPVYLFNYPTATGKDIDAKVAKEIGCFTGVKDTIENIIHTLDYKRLNPNMLVYSGSDMLIATVASTGLDGNVAFGSNYLPEVTVTIKKLAMERKIDEALKLQFLHDEVIEASRIFGSLSSNYVLTKYFQGYDLGYPRPPIFPLDDEEERQLIKKVEGIRAKLVELKILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sulfolobus Sulfataricus 2-Keto-3-Deoxygluconate Aldolase
rcsb
source organism Sulfolobus solfataricus
molecule tags Lyase
molecule keywords 2-KETO-3-DEOXY GLUCONATE ALDOLASE
total genus 114
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 4.1.2.55: 2-dehydro-3-deoxy-phosphogluconate/2-dehydro-3-deoxy-6-phosphogalactonate
pdb deposition date 2011-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2ydaA00
3W6YA 3NGJA 3PR2A 2R94A 3OBKA 1BWKA 1YXCA 1ZJIA 2TSYA 4JN6A 4FIQA 4K36A 3NL2A 4LC6A 1A53A 4IMDA 2CLIA 3QM3A 1SZNA 2WKJA 1U5JA 3DHFA 1B57A 5D30A 1HFBA 2FB3A 3M5VA 3W73A 3GVGA 1JJKA 4GC4A 2YW3A 1KM5A 2DP3A 3FKKA 5AYYA 3ZR4A 1SFLA 3C3NA 3UNDA 2ISVA 3MYPA 3W7OA 4YWIA 2WJZA 3NZ1A 4LT9A 5I3GA 4IMCA 3LHUA 3O15A 3R89A 4FNUA 4O17A 5U7SA 3MI6A 3STGA 3VCRA 3UY8A 4RZ4A 1ME7A 4LVAA 1THFD 2X1UA 1PVNA 4LVBA 4FF7A 3P84A 4FNQA 1KLZA 5FEPA 3GNDA 4IX2A 3N73A 4WXZA 1JQVA 3FA5A 4O0KA 1ICSA 4B5NA 3EKLA 3RMJA 3GXPA 4WX2A 2Y88A 1F73A 5AFDA 3M5YA 1K03A 2CLEA 1K8XA 3RLVA 3G1AA 1QCWA 4MZ1A 4UNKA 3WJYA 5G1TA 2NUWA 2DZTA 3BPWA 3VI2A 3G1DA 3L66A 3CPRA 1Q6LA 2W6RA 3NZRA 2TRSA 4IMGA 2YCEA 2VOMA 3FYOA 2Z6IA 4CNOA 4EVZA 5G4WA 2H3DA 2ZZ5A 4NJGA 3W86A 3DGRA 1B4KA 2LLEA 5CPNA 3W22A 2J9YA 1V5XA 3V1PA 1C9DA 4CCCA 3UPBA 1IXOA 3QSRA 2EPHA 4LS1A 4Q4KA 4TR9A 3O8AA 1R30A 2D73A 1JCLA 5D09A 3PB2A 1EWEA 1E51A 3W1XA 1F5ZA 4IJBA 5HMSA 2NX1A 2P1FA 4YLWA 3E49A 4IWWA 2YXGA 3W2LA 2ZZ4A 1F6KA 3P61A 3QW4B 1RQEA 1DHPA 3LBMA 4LY8A 5K7JA 4WY0B 2QCMA 5E1QA 1VCVA 4IGHA 2CFFA 3USBA 3HPXA 4JTSA 4HPJA 1LTDA 2ZRWA 2VENA 3B06A 4N9CA 5LHFA 4MYAA 2FTPA 4UFMA 1ZENA 4MJMA 5BW6A 2ATSA 4W9TA 4WUIA 3ZFHA 3S1WA 3MP5A 4MVAA 3CEUA 1Z48A 3RNDA 1DKWA 1MEHA 3B03A 1LDCA 4PL2A 1HL2A 3W9ZA 1FCVA 2YFOA 3ZWTA 4AWSA 4LTSA 3C2RA 2Y7GA 1SZEA 4QITA 3IVTA 3W1LA 1P0NA 7TIMA 4JDYA 3BV4A 3LX9A 3TSBA 3OIXA 1GG0A 2GJLA 1J2WA 2TPSA 4JTUA 1M7PA 2WNQA 2ZZ3A 4RZ6A 3LCXA 3EWZA 4HSOA 4DPQA 4N6EA 2QCEA 3PSWA 1LM1A 4PEKA 3UPWA 1BEUA 1I2PA 1TPWA 3QPYA 3G3MA 3MWAA 1HUVA 1QPNA 1OX6A 4N02A 2ZA2A 3W1UA 4AF0B 1VYSX 1PE1A 1XI3A 3CEPA 2ISSA 3L21A 3QPZA 1W37A 4JX4A 4IX0A 4XWUA 1OVDA 2RFGA 3KVJA 2E6AA 4UMAA 5DCDA 2GQ9A 3V75A 1H63A 4JTJA 4Z1DA 4HT3A 4DO6A 5HR7A 2H6RA 4UTIA 3AJXA 4QISA 2DU2A 4A2SA 4ZQNA 5TQLA 3LXAA 4NNAA 3G0SA 2YYUA 1H60A 1SFJA 3CHVA 1TTPA 3GB6A 4PODA 3I7SA 2NLIA 1F74A 5AC6A 2A4AA 2NXGA 4UNLA 2V5LA 1KM1A 1MEIA 1G4PA 1SSDA 3GR7A 1H51A 1X1OA 4I7VA 5CPMA 2CZFA 2VEIA 3N9SA 2QCGA 3QRHA 3A5VA 4CNPA 2YYTA 4DELA 4RJEA 4ADTA 3ANYA 4Y6GA 2GVGA 4MLRA 4DQWA 3GX9A 4RXFA 1TSIA 1XXXA 4UTLA 4BK9A 1XBXA 1WYIA 4CQ8A 3T55A 3W7JA 3QMTA 4HNUA 2B4GA 3KVMA 5D2VA 4FB7A 1SO4A 3N19B 2E5CA 4NNBA 1M6JA 1W5OA 3UWWA 1KTNA 1EP1A 1DQWA 3LHYA 4LVFA 4AF0A 4GE8A 2C0AA 1RR2A 4O13A 4OE7A 3B0UX 1T8XA 4JYEA 2C1HA 5D2XA 2ZYFA 2WNNA 2ZZ7A 3GDMA 4OV9A 1TTIA 2PC4A 2ABBA 4FXRA 3W7CA 3EXSA 4LS2A 2QCHA 4JICA 1TPUA 1PCKA 1UBSA 5AOUA 5I3KA 2J6XA 1A5CA 4QM1A 2HMCA 3M6YA 2NV2A 3O6YX 2WOQA 2OT0A 2FPVA 1D3HA 4BFAA 3IGSA 4YXGA 5CZTA 1IXNA 2A85A 3C8FA 5F2IA 1ZAJA 1ZY9A 5DY3A 3W74A 3HPZA 3KVKA 4RLIA 3FKRA 5EMUA 4ZZ9A 4K7VA 2NXIA 4DO5A 3NAVA 3P8JA 3M7WA 4M7TA 5C5YA 2FDSA 3PBYA 5ABTA 1NEYA 1NVMA 3H53A 4NT0A 4Z08A 5HUPA 5GVJA 1RPXA 3L5MA 3IVUA 4ZVJA 1XL9A 4QIUA 3BW2A 2VFIA 3G24A 1N7KA 4HPXA 3HG4A 3W3OA 4ZQOA 1QWGA 3TXVA 4MFEA 3ABRA 1SU5A 1TYGA 4ML9A 3BARA 4PL1A 1GG1A 4M5PA 3M47A 3L0GA 5BMWA 3PBWA 3S9YA 1TRDA 4KWVA 3TSDA 3CM4A 5AHLA 1LYXA 5DBTA 4TO8A 5HQEA 3NNTA 1WOAA 5H2ZA 2ZZ1A 4RKAA 5K9XA 3ABQA 5KZMA 3W7HA 3MO7A 2E68A 5FF0A 1XUUA 1YPIA 1TTJA 4UR7A 2YDAA 4O18A 5LNUA 5I3IA 3QF0A 3E12A 2QCDB 2Z2UA 5K2ZA 3LCLA 3HGOA 4K39A 2RKXA 5CGQA 5AHFA 5HWNA 3N34A 3LOTA 4AHQA 3G1YA 4MLJA 4O4WA 3G0UA 3N3MA 3KRZA 1DBTA 4NZFA 3CB8A 3HB9A 5IBXA 4IQLA 1W3NA 4JNMA 3M1ZA 3M5ZA 4AWTA 2XN0A 5AHNA 2G5WA 2PRLA 3M41A 4GNJA 3NQEA 3L9CA 1WA3A 1ZFJA 4O54A 4OBTA 2YW4A 2VFHA 3NQVA 4PA8A 1RZMA 3PSVA 5AC7A 5K4XA 1HTIA 4A3UA 2P10A 3TSMA 3GDTA 3MMTA 4DF2A 3DU0A 1JCJA 1IXQA 4U28A 3TH6A 3QMSA 1TJPA 2OT1A 4LC8A 1PIIA 3W7DA 4GWEA 5F1UA 4NJHA 4QAIA 3THQA 1KM3A 3GAYA 5D32A 4QSHA 5CG7A 2VFGA 3EXRA 2YZRA 4GUIA 3NM1A 1X1ZA 4UTWA 2Y7FA 3F03K 4N9BA 3NDOA 3NPUA 5H91A 5LNSA 2X1TA 2OMAA 2CZ5A 1VZWA 3NQ7A 4JS3A 1OFAA 5AHIA 3MI2A 1EA0A 4M7SA 1EX5A 4MY8A 2I9EA 3RU6A 4R34A 3ABSA 1KFJA 1ZALA 4JR5A 1KV8A 2OCZA 3BVJA 4NVTA 1FCUA 3L0NA 4PH6A 2A7PA 4EF8A 1KBJA 1H5YA 1QMLA 5HINA 1VQTA 2WV8A 3LI1A 1A5SA 2QF7A 2ZRVA 4R7JA 3O06A 4UTTA 4AAJA 1OFPA 1FWWA 5HUOA 1OJXA 4WJEA 1G7VA 1QDSA 3W1RA 2V2DA 5BNKA 4ZMGA 3GKAA 2NX3A 1GYNA 3KOFA 3NPWA 3NQAA 3T4CA 1FQ0A 1KFBA 4LS0A 5SWUA 3A21A 3BO9A 3G1HA 3LCGA 2JGQA 3W72A 2R8WA 4TMCA 3B8DA 3BG5A 4RV8A 2Y63A 5LGXA 2GJNA 3IIOA 2QJGA 3OHIA 2JKAA 6ALDA 4TMBA 2CLFA 4XKYA 1O5KA 3TK7A 2JK2A 4AHPA 3S6DA 4O28A 3S5NA 3HIJA 3RF9A 4NX0A 3SSJA 1TPC1 2Q8ZA 4JY8A 3P62A 4ORMA 5EYWA 5KSWA 1ML1A 1KM2A 3W75A 4HSNA 3BLFA 4LV4A 3PWAA 4UTKA 3UZ5A 2Y7EA 1GVQA 3LCIA 1PHWA 4LW7A 3W07A 3O07A 3BK0A 4NJJA 4ONVA 5EPDA 4CQ9A 1XDMA 5HJLA 3W88A 3UWUA 5LGZA 1H7NA 3NQ2A 4PCFA 1DV7A 4MOZA 2W0UA 2RH9A 1T99A 3DXIA 3GXTA 1F6PA 4ALDA 1S5TA 4X2RA 2ZZ2A 2FIQA 3BG3A 1VH7A 5DELA 1ADOA 1K3UA 3R5EA 1J4EA 3I6RA 1QOPA 2BLEA 4KWWA 4DBEA 1YDOA 3RLUA 3GDLA 5FESA 5D2WA 5K3VA 1MSSA 1IXPA 1F7BA 1H7XA 4JTIA 3FEMA 2A6NA 2BXVA 1LBLA 1P4CA 5J5DA 3P74A 2P0OA 1JCYA 1OFEA 3VE7A 2E1DA 1O4UA 3DFOA 3DH7A 3BW3A 4MY1A 2QEZA 3BGJA 3W1TA 4O50A 3C2EA 1KBIA 3FIGA 3STFA 1G4TA 3E96A 2NXHA 4OQVA 4O1BA 4OV4A 1GVRA 5C2XA 4UIOA 3TNOA 1S5VA 2ZRUA 4DF1A 3DI1A 5D02A 5HWJA 1FWRA 3WK3A 2J24A 3QH2A 1K8ZA 3LLDA 3KX6A 4Y9AA 1LCOA 3UD6A 3W2KA 3AO0A 2QDHA 2X2GA 1S3HA 4L4MA 2ZA1A 3R12A 3JR2A 4JYDA 4XTDA 5J5RA 3NEVA 3W1NA 3IEBA 1O94A 3QC3A 4WD0A 3O63A 1KFLA 3W2NA 3KHJA 3FJLA 1YTDA 5G1YA 4AH7A 2JKEA 2OX1A 5K9CA 4UFJA 1JRBA 4WOQA 3W1PA 3HGSA 3W83A 3W7EA 3A23A 4MPQA 4Z0JA 1OK6A 3S1VA 1OF6A 2PRMA 1QPOA 2XFWA 3QYQA 2YFNA 4E38A 1LBFA 4OGZA 4UR8A 1TO3A 2Y6ZA 4FNRA 4Q33A 1K7XA 1IGSA 1AW2A 3TDFA 5CZJA 4DXVA 1W5QA 1S5WA 4UUIA 3KAOA 1SZFA 5FI8A 5D33A 2O7SA 2R91A 3S1XA 2OJPA 1OK4A 2EKCA 1GT8A 2J9ZA 1ONRA 4EWND 3KRSA 2I14A 3STCA 1A5BA 1W3IA 4RX0A 3C61A 1KTCA 1QR7A 1PS9A 4IXHA 5FF3A 1RV8A 3C56A 5KTLA 3W1QA 3NL5A 3LBCA 4D2JA 2DJLA 1KM4A 3LV6A 3L0KA 3TW7A 3C0JA 4IMFA 3A5FA 4N4QA 5CPLA 3STEA 3W70A 2C14A 3WK1A 1QAPA 1SO3A 3FJ6A 4JD4A 5K9DA 2Q3RA 1K8YA 1H7RA 3SGZA 1K7EA 2H90A 4HIBA 4GUFA 2ZFAA 5EY5A 3T44A 3GKFA 3EKZA 3W2UA 3CTLA 3CWOX 3TW6A 3MYOA 3WJWA 3PB0A 2V82A 4QJ1A 3UYCA 3LCWA 2RHGA 3WFAA 1LLZA 2F84A 3P7YA 1DVJA 1OX4B 1GWJA 4NJKA 4FO4A 3QFEA 1JCMP 1JVNA 2DZPA 2G95A 1QO5A 4P61A 1GTEA 3SY5A 1XCFA 4RXGA 4UFIA 3UXDA 3TJXA 1W5PA 1R2RA 1VHCA 2A0NA 1JCXA 2DZSA 5LNWA 1X7FA 2FQIA 1KW1A 2TMDA 1KV5A 4AEOA 5FEWA 3UWZA 3PBVA 4O1DA 2YGYA 1H50A 4RZ5A 2NZLA 1FDJA 1JR1A 4JTKA 1OX5A 2VFDA 4S2BA 5KMYA 1L6WA 3HMJG 1W8SA 3LXCA 1O5XA 3HJZA 2E5BA 4LVDA 5F4WA 1PV8A 4UTHA 2X16A 1NFBA 5AYZA 1SSGA 1D3GA 4O53A 3TROA 3Q94A 4UCGA 3FYPA 4LRTA 1TRIA 4MUZA 2Y61A 3LM7A 2EHHA 1TV7A 4HNVA 4UTMA 1K02A 1F2JA 2PRHA 1DOSA 1Z41A 4JX5A 3KRUA 3LB0A 2BZNA 2Y62A 3VKJA 5CPOA 3CIWA 1WV2A 5LNVA 1TQJA 3JS3A 3VNDA 3BLIA 3GR8A 4NXKA 4XBSA 4FNSA 4XUGA 3HO8A 3O16A 3NM3A 4UFLA 2ATMA 5BRBA 4AMAA 1Q6QA 3S5OA 3UZJA 1K7FA 3QSTA 5TIMA 4JTEA 1QNVA 1L6YA 3TR2A 4L4LA 3PAJA 1KTBA 2JKPA 3L67A 1PL9A 3N2XA 2CU0A 2VKZG 3S5YA 2QCFA 1LROA 3P60A 3IIVA 4JGDA 1FWSA 2Y85A 3SGUA 1P0KA 4O14A 3WK0A 1O95A 3R8RA 3NQGA 1VS1A 2VXNA 2XN2A 1W1ZA 1SQ7A 3TQ0A 4PC8A 4LRSA 4JDBA 1C29A 5E93A 5KITA 2A6LA 1VHNA 2CZDA 2NV1A 4ZQPA 5KZEA 1RQBA 1GQNA 1ZCOA 4LWWA 3W23A 4NUWA 4JTFA 1NF7A 3CWNA 5LNRA 1VLIA 3HBLA 4XTIA 2Z1BA 4O11A 1KM0A 3OEXA 1DJNA 3G8RA 1Q45A 1IF2A 4WOZA 5G2IA 3I7QA 1LP6A 2QJHA 3PF3A 2QUTA 2B7PA 4NU7A 4NJIA 1UASA 3EX1A 1EEPA 2GQAA 3TIMA 1GTHA 1TPEA 1TQXA 4M6QA 1ME8A 1UUMA 3NYZA 1YTEA 1DL3A 3GLCA 2GVJA 3QEZA 4LU0A 3EEGA 3IV3A 4WZHA 3CC1A 4ZL1A 1VR6A 4N4PA 1A5AA 3EWBX 3MBFA 3EWUA 3A24A 3WK2A 1GVFA 2I1OA 3WJSA 1AW1A 2GPTA 1B9BA 1FX6A 3S5ZA 3NXFA 4JTTA 2FFCA 3LHWA 4UXDA 3TJLA 5D04C 2V9DA 5C55A 1XUZA 1LRTA 3IIXA 3LHVA 1QFEA 4JTHA 3ABOA 3EB2A 3W87A 3W7NA 1YDVA 2HS6A 4KFPA 3NG3A 2YPIA 3SI9A 4MZ8A 1LOLA 3W7QA 1FXPA 3G0XA 3Q58A 4S2CA 4A29A 3DHDA 4JTLA 1ALDA 3ATZA 4BWLA 4E2BA 3TFXA 4O57A 2E6FA 4BF9A 2AGKA 4N9EA 4FX6M 4K8EA 5CSSA 4O1CA 1LLWA 4FHAA 4LUJA 1KFCA 3M43A 4LOCA 5KINA 3G1VA 1HG3A 5D38A 1TREA 2A7NA 4Z1AA 1XC4A 3I65A 3TFCA 5EA9A 3S42A 1GPWA 2NWSA 4Y96A 1EP3A 1QO2A 3MBDA 1VPXA 4M6VA 2ZCGA 3T7VA 4FX7A 1JUEA 1OF8A 3UWQA 4MZYA 3LHTA 1LOSA 1IIHA 4IXXA 1SUXA 5IBXC 2GVLA 1EIXA 3HF3A 2ISWA 2CLOA 4O4VA 1HO4A 5G2WA 3GIYA 2QAFA 2C6QA 1OYAA 3LTYA 2FPYA 4Z1BA 2QCLA 3MUXA 4CCDA 1EWDA 2C16A 1XBVA 2O7QA 1SZGA 3N9RA 1KFKA 2HS8A 3WJXA 5FEXA 2DZVA 5CZ0A 1ME9A 1CW2A 1XFBA 3U8GA 3S8HA 1GZGA 3PY2A 4ICNA 5CSRA 2WPBA 3S0CA 5U4NA 1BWLA 3QJAA 1AL7A 5F1VA 1YTKA 5FF2A 3LTPA 2QKFA 3EX4A 3LV5A 4K38A 3TU9A 4MYXA 4UTWC 2QR6A 2GUUA 1DQXA 4C1LA 4MIMA 1R47A 3G1SA 5C54A 1KM6A 2A7RA 4XZ9A 3TAOA 3DBPA 4H4IA 1AG1O 2Y89A 1OABA 3VFLA 3M5XA 1KLYA 1MEWA 4ZQMA 1SW0A 4IPJA 2H3BA 4X22A 2AAMA 1L6SA 1HO1A 1X8FA 2QUVA 1EPXA 4NX5A 4TX9A 4ZQCA 1UUOA 2C3ZA 4QNWA 1I4NA 1M5WA 2BWGA 2YSWA 2ZTKA 3G18A 3I68A 3LXBA 2A5HA 3EX2A 4H3DA 4DEFA 3TE9A 4GUJA 4MFDA 5L6UA 1YDNA 2YR1A 3HGRA 1VLWA 3F4WA 3K30A 3UWVA 4Z1CA 4BR1A 2JBMA 3I7RA 5FEZA 3MHUA 3QMRA 4ADSA 4O15A 1TPFA 4K7YA 4C1KA 1X6UA 4POCA 2AQWA 5HWMA 3B0VC 3M44A 3U6WA 3FS2A 4MJZA 2C13A 3PUEA 4UTUA 4A2RA 3W7GA 4J9JA 1R2TA 2VELA 1SPQA 3D0CA 3KVLA 3JRKA 4NQ1A 5TBOA 4EF9A 1GYLA 1MZHA 3CT7A 4RCXA 3NA8A 1CX9A 2QJIA 3NQCA 5D05A 2V81A 4JEQA 3LERA 3MHGA 3W76A 1TPH1 1UJPA 5A5WA 2C19A 4GBUA 3UWYA 3LRKA 4K8HA 8TIMA 2OZ0A 2E5DA 2Y70A 4LUIA 5F2MA 4HNTA 3B05A 1UB3A 5FF4A 1LRQA 1G67A 5DLCA 3W84A 1L9WA 3F1QA 1RD5A 4UTTC 2C18A 3P8IA 5AHMA 3NQDA 2EF9A 1TCDA 3TQVA 2NUYA 3N2MA 4EIVA 3TV8A 1AW5A 3L2IA 1AMKA 3P5YA 5LHEA 1UCWA 3PVFA 4UFHA 3TMLA 3GYEA 2PCQA 3EX3A 2Q8LA 3UXAA 4YCOA 3LTSA 1YPFA 4IOTA 3THAA 2V8ZA 4G1KA 1VCGA 4IMEA 4Q32A 4JX6A 4CCEA 3SJ3A 1OX4A 1W5NA 3IVSA 4KFOA 4LVGA 1VYRA 1EUAA 4QNEA 3EWXA 3QW3A 4A22A 2ZBTA 3SFKA 1GJPA 1JUKA 4UC5A 1B4EA 4BWLC 3CU2A 3TC7A 1R2SA 1NF0A 1H62A 2QCDA 3TUUA 4WY0F 1T96A 1TPVA 3MI3A 4GUHA 3IRDA 4GRSA 2ABAA 4IPIA 2EAWA 3DENA 3BG9A 2ZQ0A 4N2YA 3HG3A 2Q3OA 1H1ZA 2DORA 3GNNA 3LI0A 3P82A 3P5ZA 5IM51 3W7PA 1QPQA 1WXJA 3OVPA 4JY9A 3YPIA 1GOXA 1U83A 3M0ZA 1NSJA 1PHQA 4O19A 2CZEA 3C6CA 3PBUA 5I3FA 5F2LA 4EOUA 3W7MA 3FLUA 4YCPA 3R2GA 1PCWA 2A21A 5DCEA 3NR0A 5I3HA 1SO6A 4OWGA 3NO5A 2V30A 5G2HA 3NPVA 5DXYA 5C6MA 4Y90A 3IIZA 3PULA 4OU1A 4K37A 4X9SA 1Z42A 1ZNNA 4N6FA 2H8XA 3O1NA 3EXTA 4P2VA 1OFBA 6TIMA 3A22A 3HG5A 4AVFA 1W54A 4O8RA 1JQXA 5BOOA 3OG3A 4OT7A 1EB3A 1OFRA 5AB3A 1QPRA 1LOQA 1LZOA 3LCFA 3M16A 4PFMA 2QDGA 5D2TA 1G7UA 4LNYA 5D37A 3PS7A 3G3DA 3H55A 4BI5A 2NWRA 5HR6A 3SR7A 2DJXA 1JRCA 1G4EA 4DO4A 1F76A 1O60A 5BMXA 1Q6OA 3NQFA 3T40A 1V7YA 3G8EA 3P67A 1ICQA 3W7IA 2J9XA 2V0TA 4AHOA 3NL3A 4NZJA 3C2OA 3C2VA 3FOKA 1M7OA 2JGYA 1DORA 1F05A 1VCFA 2FPTA 4CQAA 4HN4A 1BKSA 4K6AA 3ZWSA 3CLMA 4FNPA 1LORA 3DI0A 2E09A 2X1SA 2Y7DA 2QCNA 1FDYA 1QOQA 3F4NA 4HHPA 1A50A 2G97A 3BW4A 2J88A 3DKLA 3TAKA 3W85A 4DBDA 5CZSA 3QZEA 3CQ0A 3O6CA 1VRDA 4AB4A 2VC6A 2QUUA 2B0MA 4CNNA 3OVRA 4GFSA 1GVOA 4YMZA 2TYSA 4ORIA 3PM6A 1LRNA 4O1AA 1N55A 4O0ZA 2CWNA 3HG2A 3OVQA 1FXQA 3C2FA 2ZRZA 3SZ8A 2ZZ6A 1Z44A 1KA9F 3W2MA 1YXDA 1WQ5A 2RDUA 2ZTJA 3BGGA 1JCNA 4JIPA 3W7KA 3G1XA 3M9YA 3EX6A 3G22A 4HNNA 5EKYA 1WAUA 4O12A 5AC8A 1NAL1 1WX0A 1YXYA 2FB2A 4JTGA 3C4UA 3PG8A 2DZUA 5DCBA 1OFQA 4OHQA 1I2RA 4M19A 5I3JA 5DBUA 5HULA 2HSAA 3PUDA 2H8ZA 4U4MA 4FNTA 3TXZA 1MXSA 4AWUA 1ZAIA 4A21A 2PURA 4UMBA 3DZ1A 1OYCA 2CLMA 3W7RA 1FDZA 2CLHA 2YX0A 1D9EA 1VJIA 1RVGA 1ZHAA 1EP2A 2BX7A 2DZWA 3LRLA 2VFFA 5EBUA 3SW6A 5AHEA 2VEMA 4NNCA 1W3TA 3L5LA 5F2GA 1G4SA 3B0PA 3LLFA 3LCHA 5LKYA 4GUGA 4WQ6A 3SIZA 2XN1A 4TU1A 5AYXA 1B3OA 4XQ6A 3PUOA 2BSLA 3ZS4A 3IIPA 4PTNA 3E9AA 2B7QA 3INPA 2F7FA 4X3ZA 2WSQA 4R53A 3G1FA 1L2UA 3MJYA 3W71A 1I2OA 1EUNA 1I2QA 1XBYA 3NQMA 2ZRXA 1TJRA 1TV8A 3GZ3A 1OYBA 3LHZA 2W79A 3HGJA 2WO5A 1GVSA 4I9AA 4GXMA 1H7OA 3NVTA 1TMHA 1Q3NA 5G4EA 4M6PA 3VE9A 4JXCA 1JULA 1VGAA 3NPXA 2V5BA 4KFNA 5HNRA 1TTQA 3DFPA 4BI7A 2CW6A 4ZQRA 5MHBA 2C15A 1H7PA 1OG0A 1CI1A 5D03A 5EL1A 3W2JA 5T26A 1SR9A 3DFSA 5KZDA 3RFAA 4ADUA 1I45A 1G6CA 2PE4A 3LGEA 2ZDRA 1YADA 3MP4A 4S1FA 2RDTA 2V2CA 3B4UA 1TPDA 3S1UA 4WY0A 2Z0IA 4FX8A 3QQ0A 3TQKA 4E0CA 2NUXA 1G69A 1R46A 5DXXA 3LDVA 2GQ8A 4QQ3A 1YYAA 1FUYA 1I2NA 5LZLA 2FLIA 2CLLA 1ZAHA 3IGUA 1W0MA 2ZA3A 3GK0A 1VYPX 3ATYA 1BTMA 2J27A 2B7NA 2IQTA 2FJKA 4CLMA 2HTMA 3HQ1A 3ELFA 1H1YA 1YLVA 1Y0EA 4I7UA 4O52A 3HOJA 2RDWA 2A1YA 1TV5A 5D2YA 1WBJA 2X1RA 4BI6A 1GEQA 4IUOA 4DPPA 5DN1A 5F4SA 3EWYA 1I8JA 3DFTA 4I7WA 3EWWA 3KFTA 2QCCA 1Q6RA 4XKYB 3UY7A 3FFSA 1FY6A 2E77A 5DY2A 5G5IA 1FBAA 4XBKA 2NX9A 1TB3A 1XBZA 3PC0A 4FXSA 4KKXA 2R14A 4Z0SA 1OFOA 2ZRYA 1KFEA 3T78A 1DJQA 4NXSA 1W5MA 3O05A 3CIXA 3LRMA 1FWNA 4GJ1A 2WSYA 2DZXA 4O16A 1AL8A 3MP3A 2V2HA 4FIRA 1LBMA 5F4XA 2X30A 3TKFA 1JUBA 4AXKA 3U2OA 2WSRA 4TIMA 3NOEA 1W56A 3R13A 4O10A 2G96A 2GOUA 3GDRA 3TX9A 3RK8A 1P1XA 3L5AA 4RR4A 3N14A 3A9IA 3WJZA 1ICPA 1SW7A 3W1AA 1RQHA 1XM3A 3HPSA 1WOBA 5A8GA 5K4ZA 1FCBA 3GDKA 3BLEA 4UMCA 2B7OA 3O6DA 3TA6A 1XDLA 1SO5A 1OFDA 2VFEA 1AK5A 1FWTA 4RK8A 3C52A 3UQNA 2VEPA 3OA3A 1W31A 1VC4A 1FCQA 3P81A 4E2DA 3W7LA 1C8VA 3QQ1A 5L9FA 2KZHA 1WBHA 3E02A 4JYFA 4WXYA 2ALDA 3TC6A 5LSMA 1MO0A 2EGZA 4YL2A 3Q2DA 3H54A 1N8FA 1T0OA 2QAPA 3P80A 3NL6A 4UTJA 1J5TA 2VEKA 4H6KA 4FEZA 3MW7A 1H7WA 2CLKA 3MHFA 3Q37A 1SW3A 1OHLA 4HKPA 2E6YA 3IGXA 1TIMA 5FF7A 1H61A 1IIGA 3NQ8A 4MKNA 3DAQA 3KXQA 4R33A 3TMQA 4N9DA 3PG9A 4UFKA 2WNZA 4LV9A 3DFQA 3SECA 4Y8FA 4MY9A 3DKJA 3TCEA 3L65A 5CKSA 1XKYA 2A2IA 4JIQA 1P5BA 5E0KA 3GXNA 2WQPA 3DFNA 3W1MA 3L68A 2BTMA 3B04A 3GAKA 1TPB1 2Z6JA 3E0IA 1WDWA 2E6DA 2UV8G 5AN7A 4DF0A 3NQ6A
chains in the Genus database with same CATH superfamily
1PZ2A 5A6LA 1V3KA 2AKMA 4QQUA 1Y5XA 3UJEA 1ZJIA 2ACUA 2YZ5A 4WJXA 2FJUB 3NL2A 3LZ5A 4IMDA 1E55A 2CLIA 3KOWA 3M7SA 1N82A 1SZNA 4E2OA 2WKJA 2OU4A 1V3MA 3M5VA 2CKSA 3W73A 3GVGA 4H00A 4F48A 4PEEA 1KM5A 2DP3A 4N42A 1K9DA 3LSCA 3K5XA 1SFLA 3MYPA 2WXDM 2ZX5A 2IKHA 4L9YA 2VL4A 4WDXA 4IMCA 5I3GA 2F2HA 3R89A 4O17A 3QFWA 1BF2A 3KE0A 4NASA 2E28A 4W89A 2VGFA 3AU2A 4HN8A 3AAMA 4U3CA 1THFD 4HGXA 3RJXA 3T0DA 2D2HA 5CBJA 2XSBA 4WDUA 4UQDA 3N73A 3FA5A 3RMJA 4J1OA 2F9RA 3GXPA 4WX2A 1P0DA 4AZ7A 2P5NA 3KUMA 3RLVA 1QXLA 4MZ1A 3WJYA 2HE8A 1IE7C 2DZTA 3BPWA 5IOBA 2ZUMA 3L66A 4GI6A 3NZRA 1MQQA 3CNYA 1LWJA 1NQ6A 3MUCA 4DY1A 3THDA 1E40A 3LK6A 4J3VA 5G4WA 2ZZ5A 2WLZA 2J9YA 3BLPX 1V5XA 2WCGA 3AI0A 1C9DA 1HJQA 3TWAA 3UPBA 3QSRA 4KEZA 2EPHA 4D6CA 1CXKA 3A9BA 3QV6A 4Q4KA 2Z28A 4D71A 1U5VA 4V2XA 1R30A 3TTOA 3HN3A 3W1XA 1MNSA 2QIWA 5FJTA 2P1FA 3GXFA 3E49A 2YXGA 3W2LA 3M0IA 1Q66A 1IV8A 4Q8PA 2GVYA 3ENLA 3UZXA 2W91A 1IZCA 2YDQA 1JD9A 2Q02A 3A4XA 1CGTA 4Z2IA 5CQ1A 2XZ7A 1M41A 5LHFA 4LAOA 3VUSA 4W9TA 4WUIA 4GH3A 3B9NA 3CUGA 1W3KA 3EOUA 4QG8A 1KO0A 3VXGA 1MEHA 2XSXA 1FCVA 5DRIA 2NQLA 1O1HA 4LTSA 3AMCA 1KCXA 1PX4A 3C2RA 1LF1A 2GDQA 3WBXA 4G56A 1D3CA 2Z29A 1UZHA 1KBKA 1P0NA 5I2UA 7TIMA 2GJXA 1NOFA 1GHRA 3OG2A 3QY7A 3VVGA 3EA2A 3OIXA 2GQ3A 1M7PA 3JVAA 4XX6A 4RZ6A 4PCTA 4NAFA 2J7HA 2ZUWA 1UD8A 1BRLA 3AYRA 2A79A 2QXWA 3STPA 3EDJA 1XS2A 2GLKA 2QCEA 4PEKA 4AZCA 4URIA 1AJ0A 1BEUA 1PAMA 3PPFA 3QPYA 3C0QA 1HUVA 1EH9A 1VEOA 3FDGA 1OX6A 5E6YA 4AF0B 3GYCA 1VYSX 1TV3A 3CEPA 4DB7A 3L21A 1MFUA 2QVNA 4LCQA 2CIPA 3GBEA 3N18A 5A8PA 5IHRA 4Q8VA 1TG7A 2PDGA 3MZ2A 3KVJA 4UMAA 3UF9A 3V75A 4DO6A 4C7FA 2H6RA 4QISA 3B8SA 1XIJA 4RE2A 1TIWA 4ZQNA 1QTWA 1UA7A 3O9NA 2JQXA 4NNAA 5I79A 4D6DA 3MCMA 1SFJA 3CHVA 3GB6A 3KS5A 1S1PA 2V5LA 4PMOA 1KM1A 1G4PA 1SSDA 3GR7A 1TZ7A 4ACZA 3RGTA 2CZFA 3VD7A 1ADSA 2VZVA 1F9CA 3IJ9A 2YYTA 4ZXOA 4DQWA 1NDZA 1P1MA 4XZHA 2XG9A 1EIBA 1Q2SA 1XXXA 3PZOA 4CQ8A 3KVMA 1V6YA 5A6SA 4LH8A 3UWWA 1EP1A 5A6BD 2PTXA 4LVFA 1E73M 5D2XA 4DWDA 2WNNA 3S2JA 1H0GA 3GDMA 3R6IA 4JIEA 4UNIA 1R9ZA 3W7CA 4LS2A 1PCKA 3QBUA 2J6XA 5HXMA 4R27A 1P6CA 1BKHA 3MUY1 2OQHA 4P8VA 2NV2A 3W81A 1D3HA 3SURA 2V5DA 1GHSA 5A6AA 1Q6GA 1ZQ5A 2XZ9A 1XH0A 1ZAJA 4LNCA 1B30A 1FFQA 2P76A 3FKRA 3MO4A 4ZZ9A 2NXIA 3FX4A 1PWMA 4DO5A 3NAVA 5C5YA 3M7WA 4M7TA 3PBYA 1XLDA 3H53A 4NT0A 1RHCA 5GVJA 3L5MA 1CDGA 1E0UA 4QIUA 3TJ4A 5CH9A 3FJ4A 1GGOA 3ZJKA 1XRTA 3E6EA 1OGSA 2QMJA 3W00A 3UZWA 3ABRA 1SU5A 1GG1A 3AHXA 5BMWA 4P7LA 2OQYA 1AVAA 1TRDA 3DIPA 4REQB 4HNLA 3TSDA 4EPDC 5HQEA 5E9AA 4J3ZA 1DP0A 3VKKA 5H2ZA 4S3DA 5KZMA 3W7HA 3GD6A 1W9UA 4JHMA 5FAJA 5FF0A 5D8ZA 3EWCA 1IGWA 1TTJA 4A4AA 4O18A 5I3IA 3QV7A 1JF6A 3TC3A 3QY6A 4L65A 1HX0A 2REQA 3EAUA 4HA1A 4QBXA 4C5ZA 1QK0A 2WLYA 5AHFA 3LZ3A 4K1GA 4P7RA 4L4OA 2CYGA 1IHIA 3LOTA 3VA8A 2PLKA 3KL5A 4CCZA 4O4WA 3G0UA 3N3MA 3HB9A 1E72M 3VOFA 2EQDA 2PRLA 4GNJA 1QNPA 3NQEA 1WA3A 5M3WA 4OBTA 2YW4A 3AUJA 4JCLA 5K4XA 4WRHA 2FH8A 5FJPA 1W1B1 3S2MA 4A8NA 2P10A 3MMTA 4DF2A 3O3RA 3TH6A 1TJPA 2OT1A 3OU8A 1A5NC 4PYSA 2YA0A 3W7DA 4AQLA 1UP2A 3GC5A 5F1UA 2XFYA 3GAYA 3ZMRA 2JEQA 4CNSA 1R0MA 5JVLA 4C6EA 2VFGA 1XLCA 2YZRA 2O55A 2DVUA 1X1ZA 4UTWA 2Y7FA 3NPUA 5H91A 2X1TA 3SB0A 8CGTA 3ZSSA 3MCNA 1OFAA 4A35A 1IEIA 4M7SA 3PZIA 1AQFA 1QU4A 1ZALA 5BU6A 2ACQA 4DVOA 4HVXA 5XINA 1FCUA 2G3MA 1TUXA 4PH6A 3UR8A 4DAIA 2A7PA 4EF8A 1J8VA 2DT3A 2WV8A 1A5SA 2QF7A 4ZBCA 4J4KA 4R7JA 2Z2AA 4H41A 4B5TA 2ZXQA 5C9XA 1E6NA 3N6JA 1KRAC 1L6GA 1FWBC 2V2DA 5BNKA 2B31A 2DVTA 3NPWA 3T4CA 3V5FA 2PDMA 4AY1A 2F38A 3MVTA 3IWPA 2OEKA 1IQ8A 5I03A 2Y63A 4UOQA 5B80A 2CLFA 4XKYA 2JK2A 4AHPA 3EMCA 4NX0A 1TPC1 4JY8A 5EYWA 1UR2A 1ML1A 3W75A 4AY8A 4HSNA 4GX9A 2ZUNA 1VBJA 3LCIA 3UZ5A 5A8QA 1PHWA 1PWLA 3ZLFA 7CGTA 3JUGA 1UKOA 5HBFA 1TFVA 3UWUA 1H7NA 3NQ2A 3T05A 1Q65A 4KBXA 4AYGA 2W0UA 4C65A 1T99A 3DXIA 3GXTA 1EA9C 1VRXA 1WDDA 2BOGX 1IEQA 5FJRA 3AHYA 5CLTA 3E0FA 5ECUA 4HYRA 1MSSA 4Y9NA 2V38A 1UD3A 1BQCA 1JFXA 4GY7A 3VTRA 2BXVA 1LBLA 2A3BA 5J5DA 4QRNA 1E0WA 1POJA 5D9NA 3WEZA 2PP3A 4E5TA 5BXRA 3VNKA 3MMDA 3BGJA 3VYLA 2PA6A 4O50A 3ECQA 3STFA 2NXHA 2BGQA 4GZIA 2DSUA 4CN4A 1S2VA 2HBVA 1UKPA 4GQQA 3QTGA 3CWHA 4GVFA 4EP8C 2XIOA 1EJRC 1FWCC 1PTDA 1YE4A 4A6GA 4UQEA 4J5NA 1KGWA 4TTUA 1XIFA 2J24A 2OQLA 4IFKA 1MXDA 3AO0A 5GPRA 2XVKA 2QDHA 1H49A 1XR2A 3R12A 3AMLA 2NLYA 5J5RA 2IW0A 3SCNA 2NQJA 4AWEA 4B3KA 1RAKA 1IEVA 2OX1A 3BJTA 3W83A 1X38A 3GO2A 3A23A 1XDJA 3GVWA 4MPQA 3VMNA 1OK6A 3K13A 3WUBA 4C1NB 4M24A 5A1AA 4MNMA 4E38A 1RBOB 4NF7A 4UR8A 4P8UA 3WMBA 4GVIA 3N9KA 4Q33A 4XIMA 1IGSA 3ARQA 1EYWA 1W5QA 4G1NA 1ODZA 3BSHA 3BZGA 3ZQ9A 4HMNA 3WLNA 4EWND 1ONRA 2VWSA 3UFYA 4RX0A 3PHAA 4GZJA 4E3VA 3XIMA 4C5YA 2FHCA 5EMKA 3W0KA 2HXTA 4H9ZA 3LBCA 4D2JA 1XSKA 3L0KA 2WCAA 3TW7A 3VNYA 5CPLA 3WBAA 3H70A 1DJZA 3U48A 1H7RA 4TVCA 1K7EA 2H90A 3FNDA 4HIBA 4GUFA 4F79A 2PDBA 2GJPA 1XLAA 3ARVA 4GI8A 1BVWA 1GOKA 2V82A 1F07A 4QJ1A 3WFAA 2RHGA 1LLZA 1BF6A 2F84A 1GWJA 4TXEA 1GTEA 1XCFA 3TJXA 1SJDA 1W5PA 2A0NA 3ZO9A 2DZSA 3WH7A 3QLDA 1X7FA 5LXEA 3NSNA 4W5ZA 4AEOA 1KV5A 1H50A 3FYYA 3KLLA 2XM2A 2J62A 1S5MA 2DH3A 4S2BA 4H1ZA 1O5XA 1J10A 1JAKA 1QWKA 1PV8A 3NUKA 3SQMA 3EOLA 3N3TA 3W01A 5IXEA 1MNZA 3JZUA 5CBBA 4UCGA 3EEZA 1TRIA 4XVEA 4GPNA 3K4DA 5GJNA 1R85A 5I02A 1O66A 2GSEA 4GGHA 5A6TC 2EHHA 2WVTA 2ZWZA 4OECA 4HNVA 4UTMA 3UW6A 1K02A 1Z41A 2ZXAA 3AQUA 1AH4A 2BZNA 5LNVA 3LQGA 2G8ZA 4Y9PA 3BLIA 4DI9A 3UVAA 4Q4MA 3SN4A 3CZ8A 1Q6DA 4JPGA 1TJ0A 3WQ5A 3QSTA 4JTEA 4L4LA 3OZPA 4PMQA 1ZZMA 4MMWA 3E0WA 1KTBA 1P48A 4PUUA 3U9IA 5F7UA 3ZR6A 4JGDA 1FWSA 3SGUA 5BOEA 1KBBA 4O14A 1O95A 2Z4GA 4AEEA 4L61A 2XN2A 1W1ZA 1SQ7A 4PC8A 5BRQA 3VC5A 1C29A 3KP1A 2ZICA 3R7MA 2A6LA 1W32A 3V7PA 2CZDA 4GQRA 1LG1A 1ZCOA 4LWWA 3W23A 4JTFA 3ORWA 1VLIA 3HBLA 3WKZA 2NV9A 3OEXA 4IGMA 1DJNA 1Q45A 1IF2A 2DZBA 3B9EA 2OWXA 3KZPA 6REQB 3PF3A 4NU7A 4NJIA 1UASA 3BC9A 3MSYA 1BYAA 4PN2A 3M4HA 1UD6A 3SQLA 4EXBA 2C1IA 3KEHA 3MA8A 4N4PA 2V6AA 3EWUA 3A24A 1ZTVA 1NWSA 4AZCB 3WJSA 1AW1A 2GPTA 3SBFA 1L8PA 4X9YA 2FFCA 4OTKA 4H9XA 3T8QA 1XUZA 1LRTA 3IIXA 4PB3A 3ZLGA 3D47A 3D46A 3FDKA 3LHVA 2O92A 3WY1A 4JTHA 3ABOA 4DRSA 1MI3A 4YJ5A 2HS6A 4WKAA 3URAA 4MZ8A 3LLXA 4A29A 3CB3A 1ZPTA 2F6UA 3TFXA 1B3WA 2QHAA 2VYOA 2BV9A 2AGKA 4OJYA 4FX6M 2OYKA 1MXGA 1PKYA 4K8EA 1UYQA 1LLWA 4FHAA 1UWUA 2FZ8A 4LOCA 2OYMA 3WZ0E 3B8UA 1X7IA 1TREA 2VX7A 4NKCA 3AJ7A 3TFCA 5EA9A 1XLHA 1GPWA 1TMQA 2WB5A 4FLRA 1VPXA 3WQPA 1BVNP 4FX7A 1JUEA 3UWQA 4HOXA 4MZYA 2NVCA 4IQDA 5JMUA 1LOSA 1P7TA 1IIHA 1SUXA 5A69A 4Z2JA 2GVLA 3HF3A 4O4VA 4I90A 1XLKA 1W1TA 2QAFA 3NFUA 3BOXA 2FPYA 4JQ2A 2QCLA 3MUXA 2X1IA 4HD5A 1HJXA 2DIKA 2C16A 2Y8UA 3ZJ7A 3VK5A 1SM9A 3N9RA 1TZZA 3F2DA 5RUBA 1QI4A 2PGFA 1EBHA 2PS2A 3W25A 4Q6XA 1ME9A 1CW2A 3HPAA 2EPLX 3DYMA 4CNTA 2PSNA 3CTTA 1Q7MA 2WW5A 3QJAA 3VGDA 1RH9A 5HMEA 1AL7A 3W6LA 1ODUA 1YTKA 3EOEA 1S3TC 3NSMA 3SEPA 2L5HA 3LV5A 2PDCA 3RHGA 2QR6A 4IHCA 1DWJM 1XD1A 3BAXA 3Q65A 4HJWA 2J7GA 1GK8A 1G1YA 3JW7A 2OOFA 1XH1A 4XZ9A 1HL9A 3GG7A 2ALRA 1OABA 4GY1A 2D2OA 2OVLA 1MEWA 1FFRA 1KCKA 4IPJA 2H3BA 1E6ZA 3C2YA 2FTWA 1UUOA 4PBEA 5HPOA 4GISA 4B4HA 1JXJA 3QZAA 1PJ9A 3TE9A 4GUJA 1BSLA 2NQZA 2PGWA 2XFRA 2YR1A 4XB3A 1KXTA 2DW6A 2JBMA 2XIQA 3QMRA 2A3EA 4O15A 6CGTA 4POCA 2AQWA 4KRUA 1XLBA 5HWMA 3UR7A 5I7GA 3U6WA 3WQWA 3SRHA 3PUEA 1WDSA 3ZM8A 5FD0A 2FZDA 1SPQA 1VF8A 3KVLA 3CYJA 5TBOA 3WENA 1GYLA 4I9JA 2QJIA 3AU6A 5D05A 2V81A 2UY3A 3CQIA 3SY8A 3SFWA 1X97A 1UJPA 2AMXA 2VCAA 5A5WA 1WXYA 4GBUA 3UWYA 3LRKA 3GIPA 4P7NA 2D0FA 5F2MA 4LUIA 5FF4A 4PB4A 4CU8A 1L9WA 4DUWA 4O1FA 3BAJA 3GVVA 3P8IA 2CHNA 5FJIA 2X0YA 1RLDA 3MQTA 1Y5VA 1X6LA 3WF3A 2OOGA 3VCNA 4EIVA 2BVYA 3P5YA 4FOKA 2VC9A 3U7BA 2FFIA 4XO6A 5LHEA 1WZAA 2Y2WA 1XSIA 4HSHA 1AA1B 1UWTA 2PCQA 1G9HA 1D8CA 3EX3A 3WD0A 3LTSA 1IR1A 4IOTA 4G1KA 1VCGA 1UWIA 4IMEA 1OZQA 4Q32A 7A3HA 4CCEA 3T2QA 3L2LA 4A22A 3SFKA 4GCAA 3TC7A 1R2SA 4IQJA 3GW0A 1H62A 3WYZA 4OFCA 3ARYA 2QGYA 4YHGA 1GQIA 2POTA 3UYIA 1KKRA 2BGSA 2Q3OA 4QEEA 3MY9A 2FHFA 3GNNA 4GYFA 4LF1A 1GZJA 4F9DA 1WXJA 1VFHA 2IXVA 1GOXA 4U3AA 1NSJA 1HJUA 1PHQA 2CZEA 2CWXA 2VOTA 2VEGA 4R7WA 3LPGA 3TYEA 3W7MA 1PCWA 2A21A 1FP8A 4HP5A 3NCOA 4OWGA 5BXTA 1QUMA 4PE8A 4Y90A 3IIZA 1NFPA 3PULA 5ECVA 3CQKA 3G6MA 4X9SA 4BF5A 1Z42A 1XX1A 2GVEA 3JZEA 1CYGA 3VIGA 3A13A 1ZB5A 4BHYA 3POCA 4B5UA 4ZFCA 5A3HA 4AVFA 1Q85A 4GD0A 3VIHA 1W1IE 4GI4A 4BY3A 4JTRA 3AZTA 4LNYA 4MADA 2WCSA 1TX0A 3Q67A 2EPNA 1XJBA 1Z6KA 4JNZA 3K1GA 1V7YA 3G8EA 1ICQA 2XWDA 2J7FA 4JFSA 3C2VA 1WPCA 1DE5A 1GVIA 2JGYA 2PGEA 1F05A 3S6TA 4CQAA 4HN4A 1GJUA 3CLMA 4FNPA 3I10A 3DI0A 2PBGA 2E09A 4F4RA 3TEVA 3HJEA 2Y7DA 1FDYA 5IDIA 3REQB 1QOQA 4GX8A 3UG4A 3TAKA 5CZSA 4V1YA 3L7RA 1TA3B 1VRDA 4AB4A 4D8LA 3WMSA 5M1TA 3AHTA 1LRNA 4O1AA 5HQMA 3SZ8A 5EFFA 4FR6A 2BBFA 3PJUA 1YBQA 2ZTJA 4HNNA 4IIEA 3E2RA 3EPOA 1UOZA 2Z7KA 5HK4A 4OHQA 1VIWA 3VOIA 5DBUA 3P0XA 1R38A 1PXGA 3PUDA 3VOHA 2H8ZA 4U4MA 5DMMA 2QJJA 4AWUA 5GNZA 1CPUA 1REQB 3R1ZA 2I56A 1ZUAX 3DZ1A 1OYCA 1FDZA 1D9EA 3TQPA 3TOPA 4IZGA 3CIVA 3LRLA 1V0MA 4PRTA 2PWUA 3PTKA 3L5LA 2WVVB 1XIIA 1E71M 5LKYA 1IWBA 3SIZA 4CN6A 4W8LA 5A6KA 4AFYA 2BSLA 4HPGA 5LIYX 1RY8A 3WF2A 4GH1A 2WSQA 4R53A 3MJYA 1I2OA 4DX3A 1XBYA 5HQLA 4ATDA 2FGLA 1MUWA 4WDTA 4I9AA 1H7OA 3NVTA 1Q5MA 4QG9A 4JXCA 2FVMA 3NZPA 3NPXA 3PZTA 2V5BA 3KOZA 3S47A 4KFNA 5HNRA 1H09A 3NTYA 5BROA 3ME3A 4FI4A 1H3GA 3SGGA 5MHBA 3DX5A 4HTYA 3DFSA 3N4FA 5KZDA 1XPYA 3RFAA 1I45A 2W5FA 1TVLA 2GGJA 2ZDRA 2E3ZA 3UGRA 3N11A 1V3HA 2Z0IA 3GTFA 3RPDA 3QQ0A 3VD5A 1G69A 1R46A 3AIEA 4LALA 3LDVA 4HA3A 4QQ3A 4AD5A 1YYAA 1FUYA 4C6LA 3VMPA 2OZTA 3IGUA 4DN1A 2OZ8A 2ZA3A 3GK0A 3PPCA 3IGHX 3N2CA 1QATA 2PWFA 2YA2A 1H1NA 1X8CA 4I5XA 1H1YA 2KAUC 5CGTA 3FHQA 1Y0EA 4XZIA 4BF7A 4H7ZA 1AD1A 2A1YA 1K8CA 1TV5A 1PIGA 2IKJA 2X1RA 2GZXA 4IUOA 5DN1A 4NI3A 1B3YA 1I8JA 3EOOA 5DY2A 3ES8A 4J3XA 1XKJA 1XBZA 4KKXA 2IKIA 3WNLA 1FH9A 1XYLA 4W5UA 3DCPA 1KFEA 4HZMA 1RK6A 3LYEA 2WSYA 1PEZA 2KX9A 1H4PA 4O16A 1Z8AA 2V2HA 1LBMA 2A3CA 1FWEC 2PDYA 4R9XA 2VURA 2WC4A 3IJ7A 3WLOA 4O10A 2VC5A 2QNEA 3RK8A 3L5AA 4QDPA 2HWGA 3CUFA 4P5UA 1WOBA 2Z1SA 4BEQA 1OB0A 5K4ZA 1FCBA 3GDKA 1GW1A 4PR4A 3MKKA 1DXFA 1EPVA 1W1PA 1OFDA 2YB4A 2FYMA 1VBHA 1W6TA 2NSXA 3NGFA 1FWTA 2C79A 3C52A 5CJNA 4HYVA 3BUVA 1FCQA 1AH3A 5L9FA 2OX4A 2DSZA 3E02A 4DJEC 1IT7A 4IJRA 2OFJA 1CGWA 3P3BA 3QR1A 3VGEA 4UTJA 2VEKA 1M9HA 1TWIA 2BY1A 4FEZA 4F2TA 3CMGA 3SY1A 4XD6A 2VRQA 3GVRA 1OHLA 1KXVA 4MWAA 1EC7A 5AC5A 5FF7A 4R33A 3DAQA 1LG2A 4LV9A 4V1XA 3WQ6A 3TYZA 4Y8FA 3DKJA 3ES7A 2A2IA 3G77A 4JIQA 3POHA 3GDBA 1I1WA 2Q01A 1HNYA 5BXPA 3MKVA 3QN3A 5FA5A 1JYWA 1XIMA 3VDHA 4AZHA 3GAKA 2Z6JA 3QKZA 3N12A 3E0IA 3CMFA 1JDAA 4C6MA 1FA2A 3DG7A 4DZHA 1NELA 2J13A 2XIBA 4NZ1A 3RDKA 3WD4A 3NGJA 3PR2A 2R94A 4R7OA 1QI3A 3TZNA 3ZVHB 4PBFA 4JN6A 3E5BA 4FIQA 1GOMA 4JL1A 5I00A 1Q2RA 5ABHA 4V33A 2ISDA 4NZ5A 2PDUA 3QM3A 4YTRA 4FPSA 4ZO6A 1ESWA 1B57A 1G94A 1W1A1 4GC4A 1LWHA 5AYYA 1GVEA 4MKVA 3EZ4A 3UNDA 2GGIA 5E09A 2ISVA 3LN3A 3W7OA 4YWIA 3NZ1A 3KOXA 4FNUA 3VCRA 5E6ZA 1N8IA 1AD4A 1ME7A 2X7WA 3V5OA 2VGGA 1DEDA 5D9PA 4FNQA 3GNDA 1G5AA 2O9RA 1ICSA 3M5YA 3LEPA 3G1AA 1QCWA 4UNKA 1UR0A 2BNJA 3VI2A 3APGA 3DDMA 1A3WA 1W3HA 1ISVA 3QGKC 2W6RA 4WR3A 5BCAA 3WLTA 3AXMA 2PDQA 3FYOA 3APTA 5FIPA 3W28A 4EVZA 2H3DA 3GFZA 4TVDA 5TF0A 1CTNA 4L4PA 3W22A 3AXXA 3V1PA 2WK2A 1HJWA 2EXOA 4Q8OA 1L2QA 2JIEA 2VD9A 1LT8A 4XO7A 2YCIX 1YQ2A 4TR9A 3GHUA 4LXFA 2OGJA 3AS0A 1BYBA 3PB2A 5D09A 1EWEA 1E51A 1B0IA 4JQ1A 4IJBA 5HMSA 1VEPA 2NX1A 1FH7A 2VVSA 3TNBA 3UZZA 1NDVA 2YL8A 3AIWA 4IWWA 3RM4A 2OEJA 4LBRA 5HNTA 4BQ3A 3RMEA 3Q45A 3VDCA 4X61A 1P7TB 1CXEA 2OZ3A 5E1QA 1VCVA 3USBA 3HPXA 5CC7A 1SZRA 1YE6A 3TTYA 2VENA 3B06A 5A2CA 2EPOA 3SIMA 2FTPA 4NAFB 4UFMA 1E43A 5BW6A 4HTBA 2ATSA 1V7AA 3MP5A 4MVAA 3H7RA 4QE4A 3CEUA 1Z48A 3CV7A 3RNDA 1DKWA 1LDCA 3ONCA 2YFOA 1B90A 4F8XA 4GFIA 3IVTA 3KBJA 2GJXB 4JDYA 3LX9A 4LPCA 4PMYA 2GJLA 1J2WA 3H2AA 4JTUA 1PKNA 1DHKA 1PIFA 2EPMX 1KC7A 3MSDA 4DPQA 4N6EA 1QNSA 4O8AA 3VAVA 3WLKX 3S9IA 1ZP3A 2VR5A 1I2PA 4IPNB 4M1BA 1QPNA 4IMAA 1EFZA 1GCYA 1UR3M 3PN8A 3CL8A 1YRRA 1W9PA 4D1JA 1UW9A 1SJAA 4JX4A 1OVDA 4KWSA 1IZJA 4PB5A 1YMYA 2E6AA 2P50A 4AZGA 2Z26A 3UEQA 1QASA 1FRBA 5HR7A 1OBAA 4WGHA 3CAWA 2C91A 4KCWA 3LXAA 3HFYA 1H60A 4OVXA 4PODA 3I7SA 2NLIA 5AC6A 2GK1B 2A4AA 4PSPA 1JFHA 1OG6A 4ZTYA 1MEIA 4WCJA 1XIEA 4GZEA 1Z32X 3WF0A 4XUYA 3N9SA 2POZA 3F7JA 5CEWA 4RJEA 4ADTA 2WMIB 3GX9A 4C7DA 1TSIA 4M8UA 4BK9A 4YVPA 1SO4A 2YBUA 1W5OA 3FA3A 1ZCCA 1NP0A 1DQWA 1V3LA 2BP1A 3BOFA 4HCLA 4B4FA 2C0AA 3D3AA 1E0TA 1AFSA 4WLCA 3S4TA 4O13A 4OE7A 2ZYFA 1EXPA 3GG1A 4OV9A 3GXDA 4J3UA 2ABBA 1OGGA 3B3DA 1J18A 3CV1A 1TPUA 3CMJA 2PZ0A 1XQKA 3GTNA 1OD0A 1SJBA 2O4QA 2FGBA 2WZIA 2OT0A 1OCQA 3VD3A 3KW3A 3RCMA 1IXNA 1VFTA 4ZE5A 1V0NA 2R9RA 3W74A 1JYVA 1EJXC 1T8QA 3KVKA 1ZLPA 6REQA 7TAAA 3QR0A 2X05A 4R9OA 4K7VA 1JPDX 4LCSA 1ECEA 4GIYA 2QGHA 4TVUA 1NEYA 5HUPA 3P93A 4DJDD 5M5DA 4IL2A 4ZVJA 3BMVA 1UROA 1U1UA 1N7KA 2VT0A 3K4AA 4ZQOA 2AL1A 4KRTA 1RJQA 4MFEA 4WGXA 4PL1A 3M47A 3FCPA 4IGSA 4C6FA 4RZBA 3V36A 3S9YA 4YYCA 2CXEA 1SMAA 3V4BA 4LANA 5DBTA 4TO8A 1WOAA 3GU9A 1K77A 4RKAA 3MO7A 3OQEA 2RUSA 3A3XA 4AG0A 4H6RA 3TN5A 5GNXA 1YPIA 4HOZA 4W8BA 1LUCB 1OIFA 3VZZA 2QCDB 3CHDA 3QF0A 3TYUA 1L8NA 1XICA 3HGOA 2C0HA 1BXCA 1D8WA 1EO5A 5CGQA 3GRIA 5C7VA 3NO1A 3GE7A 4AHQA 4B91A 3L12A 3P0WA 4IQLA 1IEWA 3FK4A 4JNMA 2GUYA 3M1ZA 2EEXA 2D3NA 3M41A 2J7EA 1FTXA 3L9CA 1ZFJA 4O54A 2X2YA 1TVPA 4PA8A 3GXMA 1UQYA 4HZ6A 4F2UA 4UZUA 4DXXA 2CHRA 4S3AA 1IWPA 1ZRQA 4LC8A 1E6QM 3H2OA 1IWAA 2NQ5A 4JTCA 1QT1A 3EPMA 1KM3A 3OO2A 4AUBA 4QSHA 2DDXA 3EXRA 1GYMA 5KZ6A 2CZ5A 4L6HA 5AVNA 4JS3A 1M3UA 3HQOA 2GOKA 5AHIA 2PLMA 1EX5A 4MY8A 2VI0A 4C90A 4QXIA 2OCZA 1AQHA 3VGFA 3ALFA 4CU7A 4E4FA 3KWXA 2HRWA 3BXWA 1S2TA 3MB9A 3RM9A 1QMLA 4NZ4A 5HINA 5HJXA 2WAGA 2X0SA 2NQHA 3LI1A 2F2KA 1D7KA 3B8TA 3O06A 1K6WA 1OFPA 4CD5A 4YTTA 1QNRA 2CCRA 2CHOA 4ZMGA 3GKAA 4GKTA 3NQAA 1KFBA 5SWUA 3C3UA 1BWVA 1M01A 3BO9A 1YEYA 3LCGA 5D4YA 2R8WA 3W72A 5LGXA 1MRAA 1OCBA 1YDYA 4CU6A 4JL2A 1O5KA 3S6DA 3S5NA 2ISFA 3RF9A 3SSJA 1AH0A 1T41A 5KSWA 3IJLA 3L4WA 5AYIA 2XH2A 2XVLA 5BXSA 3W07A 4ONVA 4NZCA 1MQPA 1XDMA 1I0BA 4FXFA 3S1GA 4F66A 3PTMA 4PCFA 4RNFA 3OLEA 4R85A 3U5UA 4ALDA 2FIQA 2TAAA 2HVNA 5I77A 3LQLA 1J4EA 1QOPA 5HNNA 4ACZB 2OTDA 5FESA 5D2WA 1IXPA 1H7XA 3OZOA 2XVPA 2I7GA 2OLSA 2EO7A 3UESA 4JFVA 2P0OA 3N13A 1JCYA 1OFEA 4CQDA 3DH7A 4BKNA 2JFEX 3E96A 2J78A 4OQVA 4O1BA 3VO0A 1QW9A 1UQZA 4OV4A 5C2XA 1T6MA 4UIOA 4GYPC 1S5VA 2OSWA 4N7QA 2ZRUA 3V3WA 4DXKA 3KX6A 4Y9AA 3W2KA 1DXIA 3WLQA 4RE0A 4N0RA 1S3HA 1RPKA 1F4HA 4GIRA 1E5NA 4L4MA 2ZA1A 4HOWA 4ZE4A 1VJSA 4DWSA 4JYDA 3URBA 3W1NA 1O94A 4EX4A 3QC3A 3O63A 1KFLA 3W2NA 3IANA 2XU2A 3H2MA 5K9CA 1GPFA 4WOQA 1B1YA 2D3LA 2QT3A 3W7EA 4QROA 4Z0JA 2WC7A 3S1VA 4EAMA 1E56A 3LM3A 4AD0A 1R6WA 4MWAC 2Y6ZA 1TX2A 1HQTA 5EMMA 3CUJA 4DXVA 3W82A 1X98A 3KAOA 3GU2A 4KF1A 2O7SA 1VFLA 2R91A 2OJPA 1OK4A 1D2KA 2J9ZA 3KRSA 2I14A 1A5BA 4GQ0A 3H7VA 1B5TA 1QR7A 1YNPA 2GUBA 4IXHA 1X39A 3CV2A 4WF7A 4AVNA 3W1QA 3NL5A 2DJLA 2WMHA 1PTGA 3BCDA 2INFA 4DUOA 3NO3A 4ZCWA 1U2YA 1P6WA 1UUQA 1XLLA 3A5FA 1QAPA 3BJSA 2Q3RA 1V3IA 3SGZA 3WQCA 2ZFAA 3WMCA 3EKZA 3CTLA 3TW6A 3MYOA 3WJWA 3DOPA 1K70A 5FAGA 1C3FA 6A3HA 3E1F1 3P7YA 3M0XA 1OX4B 3ZR5A 4NJKA 2DUZA 1JCMP 4QE1A 3GNRA 4H04A 2IXUA 3SY5A 2QJMA 4RXGA 1I60A 2J4GA 1VHCA 3RXZA 1O5RA 3GG0A 4EKJA 2E9LA 3DG3A 2XGBA 1UP0A 3PBVA 2W61A 4RZ5A 2NZLA 4H8UA 4Z17A 1FDJA 4JTKA 1K4GA 1XLFA 1UR8A 1L6WA 3LXCA 1EZWA 3QOKA 3HJZA 2WHLA 1KQYA 4LVDA 3AXHA 2P3EA 4W85A 4K8GA 1BVZA 4W7UA 2WMGA 2Y24A 4DZAA 3WH8A 2REQB 1DPMA 3LM7A 4KCTA 1EDTA 3TN6A 1CXLA 1NM9A 2XGZA 2VWTA 1UWRA 1F2JA 3CL7A 2PRHA 3KRUA 4RNJA 3HPFA 3IAPA 1Q6EA 3EDDA 3MMWA 3VKJA 3UVIA 3CIWA 2XH4A 4X0NA 3VNDA 4NXKA 5FOOA 4NY2A 2VHLA 2DIJA 4FNSA 4XUGA 3HO8A 5A8MA 3MMUA 3NM3A 1NY1A 2J6VA 5T91A 3CHCA 5JIPA 3DERA 3TR2A 2I16A 1O1ZA 1JPHA 3PAJA 2JKPA 3L67A 1M1BA 1HVXA 1HGYA 2QCFA 2Z00A 3P60A 4ZFMA 2Y85A 2OSYA 1P0KA 1I0DA 3R8RA 2Y5JA 4O1EA 5REQA 2ZX7A 2AQOA 2D2JA 5KITA 3ARSA 3I6TA 2OB3A 4PMRA 1RQBA 1GQNA 5C8BB 3V1HA 1RA5A 1NF7A 1E4LA 1E4NA 3P6LA 3O6AA 4XTIA 5AYBA 1US0A 3UT0A 3KS6A 4GYKA 4IH3A 2QJHA 1XG4A 2QUTA 4DWSD 3EX1A 1EEPA 2GQAA 4M6QA 4U2YA 1ME8A 3K8KA 3NYZA 1YTEA 1BYCA 3GLCA 3QEZA 3IV3A 3R8HA 4WZHA 1CGUA 3OGSA 4HMCA 1C8YA 5D9OA 1EHAA 8XIAA 1TMLA 5JU6A 5CLWA 1DJWA 1GVFA 2I1OA 4WVXA 1B9BA 3EBVA 3NXFA 3R10A 5KETA 4JTTA 4GACA 3SCPA 4D9PA 5BZAA 5C55A 1Q8JA 6ENLA 4JIIX 3OQ8A 2CBJA 4EANA 3NOYA 4RW5A 1ISZA 3SCVA 3ANUA 3F4DA 4QG6A 4GK8A 1LOLA 3W7QA 1FXPA 2VQUA 3ZT6A 3BMWA 4K3ZA 4CD8A 3NWRA 5G4HC 3W02A 4O57A 4N9EA 4XD3A 5CSSA 4H19A 4O1CA 3T2PA 4WDWA 3M43A 2HQAA 2V5JA 4BS0A 1EJVC 5JH1A 4M29A 1XC4A 3UP8A 5JXQA 2V69A 1OD8A 3I4EA 3S42A 4Y9MA 5ABFA 1QO2A 1W1YA 3WLMA 2VGBA 4BA0A 4MJ4A 1OF8A 3UWEA 3LHTA 5CC6A 2X42A 2CLOA 3VIIA 5G2WA 4GLEA 3EKGA 4CCDA 2J79A 4Z2HA 1NARA 3TTSA 1PYFA 1XBVA 4F0LA 2YLAA 2O7QA 3DC0A 2JF7A 5FEXA 3NJ3A 1K4HA 1ZBKA 2BVDA 4XBJA 3WDIA 4Q8NA 1XFBA 1HKVA 1P6BA 1GZGA 3S0CA 4FOUA 4L56A 1UG6A 1R9XA 3GXIA 3LTPA 3WQFA 2FZNA 3A47A 4H2HA 4H9YA 1S46A 4K38A 2WNWA 4MYXA 2VC7A 2QDDA 2WBKA 3UBPC 1DQXA 4C1LA 3L2MA 4H8HA 4MIMA 1AODA 4CQCA 1KM6A 1QI2A 1ZJHA 2Y89A 5C2GA 3VFLA 3M5XA 1CNVA 1KLYA 3GH5A 1L6SA 2AAMA 1HO1A 1F3TA 1EPXA 4NX5A 4ZQCA 4TX9A 3E38A 2C3ZA 1TKKA 4QX4A 2PDIA 3G18A 4DI8A 2A5HA 4DEFA 4RL3A 3BH4A 4MFDA 3ITLA 4TV5A 4U10A 3HGRA 4ZEPA 1J12A 3PJXA 4AC7C 2VUYA 4M80A 2WHJA 1Z7AA 5HOSA 2XM1A 4K7YA 4C1KA 1X6UA 3G1RA 4L9ZA 3UJFA 4DO7A 4PMXA 3WLHA 2BGNE 3FS2A 1FWIC 3W7GA 2XINA 2VELA 2EG6A 1HIZA 4KW2A 3JRKA 3AWOA 4IP7A 4RCXA 4S3EA 3AS1A 4HNOA 3EOSA 3SCSA 4ZENA 4OKDA 4C60A 1TPH1 1VBUA 3KCOA 4HK5A 1EOKA 2CXGA 2YBVA 3R8GA 1C93A 5CSYA 1OT1A 9CGTA 1XYFA 3B05A 3RJYA 1UJQA 2D20A 5TNVA 3W84A 1O6IA 4LY4A 3ARTA 3T0BA 2PDNA 3TA9A 2GGGA 2XH7A 3E74A 1GOQA 1QI0A 5C0QA 4OBRA 1AW5A 3L2IA 1X1NA 1XP3A 4P8WA 2XHYA 3PVFA 1MVYA 3GYEA 2VR4A 4BQ2A 3A3HA 3S2LA 2FTYA 3UXAA 4YCOA 4AZIA 4YN5A 1SGJA 1QW8A 2V8ZA 4FK9A 5MKGB 4JX6A 4PMZA 2DIEA 1W5NA 4KFOA 3L4VA 4LVGA 1VYRA 4WSJA 4C6QA 3EWXA 1FHVA 2ZBTA 4B16A 1JUKA 3LNMA 4UC5A 2DZAA 3SAZA 2PBOA 2QCDA 4DJDA 5E5CA 4WY0F 1TPVA 4KEVA 3PZGA 2QMKA 4GRSA 4LUYA 4EPEC 2ZQ0A 4N2YA 5DT5A 5TAOA 3II1A 3VIFA 1XGZA 2DORA 3LU2A 3W7PA 1F4AA 2Y8KA 4F2BA 4ATLA 3YPIA 2VX6A 3U3HA 2E40A 1NH6A 4O19A 2INZA 3AC0A 4GC3A 3T1GA 1PDZA 5F2LA 2Y8VA 1JYXA 3R2GA 2PP0A 3N25A 5I78A 3CZJA 5I3HA 1W1VA 3NO5A 2F6KA 4FSAA 3RPTA 1V93A 4ZA0A 3ONBA 3EYPA 1ZNNA 1O12A 4WHBA 2PB1A 4LYRA 1BHGA 3C5QA 4P2VA 3S2NA 3ZLHA 3GHTA 1W54A 1BQGA 2VQTA 1EZ2A 2PU0A 3OG3A 2OGYA 1EB3A 2CEQA 1A49A 1OFRA 1JI2A 1FVPA 4U2ZA 1E6SM 1GUVA 1LZOA 3M16A 5D2TA 3PS7A 3KDNA 3G3DA 4YPJA 3GNOA 5CJMA 1G4EA 3R58A 4KIRA 5BMXA 1Q6OA 3NQFA 3T40A 3P67A 2EKGA 2J9XA 3B40A 1K1DA 3F4CA 5C2CA 3C2OA 1UKSA 4OOZA 1M7OA 1XGEA 5T9CE 3N6HA 4B3LA 2GGEA 1BKSA 3WN6A 1LORA 4J3WA 1XCWA 2QCNA 2AQVA 2BVTA 2J74A 2G4FA 3IACA 3QZEA 3CQ0A 3O6CA 2D1ZA 2QUUA 4H7CA 4CNNA 3OVRA 3VDBA 1E1EA 3SCWA 2HXUA 4ORIA 3PM6A 4Q4RA 4AW7A 2FDMA 2ZZ6A 5AZ0A 1KA9F 5KEZA 3N04A 1XYMA 2OSXA 3EB4A 4XIAA 4UCFA 4US5A 2E7FA 3M9YA 4X0VA 3EX6A 3G22A 3B97A 2DEPA 4O12A 3VM7A 3S46A 3CAQA 3PG8A 3T81A 2B81A 4M19A 3ZJ8A 4Q4QA 2HSAA 4PUJA 4GQGA 1XWYA 3AZSA 4NRSA 3E5PA 4FNTA 4TTGA 4HA4A 1MWOA 1JZ4A 1ZAIA 4A8RA 4A21A 1EF2A 2G50A 4KPLA 2CLHA 1VJIA 4LYPA 4G5DA 5DO8A 2BX7A 3ANVA 5EBUA 3SW6A 2VEMA 1W3TA 1LQ2A 2DSWA 4FXJA 3B0PA 3LLFA 3LCHA 4GUGA 3H2NA 3NDYA 2HNHA 5BRPA 2XN1A 2I5QA 4IG2B 3PUOA 4LQ1A 4W4QA 3ZS4A 4HCHA 3N4AA 4PMNA 5CBIA 1REQA 1J0ZA 2G0WA 2AAAA 1EUNA 3BL3A 3VIOA 3OIHA 2ZRXA 1TJRA 3GZ3A 2PAJA 1OYBA 3L4ZA 4GIEA 2P8BA 2WO5A 5LIUX 4GXMA 1TMHA 5G4EA 4M6PA 4DJFA 1ZJBA 1XW8A 2ESCA 4HHMA 1VGAA 4PUMA 3D5HA 3GG8A 1EO7A 3DFPA 2VZOA 3WQ4A 2ZKMX 2YXOA 2CW6A 4LYKA 5GQBA 3CO4A 2VX4A 1ADDA 1OG0A 3WLSA 4JKKA 3QVQA 1SR9A 1WKFA 2Y5SA 2Q8XA 3APYA 3WSUA 3LGEA 1YADA 4RW3A 1EOMA 4LF2A 4C6CA 3WEOA 2RDTA 3B4UA 1TPDA 3CAKA 3E2VA 4WY0A 1OC7A 3FW6A 4PTXA 4YTSA 3FSTA 4RPQA 3PP7A 4E0CA 2NUXA 3ITYA 3PZ9A 1JDDA 3WG6A 2X09A 1I2NA 4HHHA 5IRPA 3L23A 1CB7B 3ATYA 1U30A 2YDSA 1BTMA 2XVGA 4HZ8A 1D7FA 3VIJA 4XKMA 2IPWA 1S2AA 2FJKA 3RR4A 3ELFA 4HPHA 4GMEA 2BXZA 4DYKA 3UXIA 1YLVA 2BMBA 4DBUA 4MG4A 3HOJA 5E9XA 4HU4A 3PTQA 5A95A 3HQPA 3EMQA 3K2GA 3AHVA 2PF8A 4R5EA 4DPPA 1EC8A 3M46A 1VAHA 3OHMB 3EWWA 1V02E 3WQ8A 3EA1A 1FY6A 5G5IA 1FBAA 4GQBA 4WJ8A 1A3XA 3L4YA 4Q8TA 2WPGA 4PMVA 2V63A 2XJ7A 4EXQA 2BOEX 1G0CA 1OIMA 1A4MA 1R3QA 3O05A 2ZX6A 5FL1A 3LRMA 3QR3A 4GJ1A 3T08A 2WBGA 3FV9A 3MP3A 1OGBA 3MSRA 4FIRA 4CNUA 3WNMA 2CERA 5HJYA 4ZOEA 3HV8A 1MW0A 3GDRA 3VX1A 1QNQA 1UD4A 1XYBA 1EF3A 2O4MA 3N14A 1KBLA 1YW1A 1RQHA 1XCXA 3B9AA 5CSUA 1XFCA 4JTAA 1DIDA 4H6EA 2BG5A 3GUGA 3O6DA 2B7OA 1CWYA 1P43A 1SO5A 1Q63A 4JBRA 3H8AA 3HZ3A 4U5IA 3ITVA 4RK8A 2G3NA 3E2QA 3OA3A 3EDKA 3S83A 1W31A 4QDWA 1JGIA 3P81A 1JNEA 1CLXA 4E2DA 1C8VA 2SFPA 2KZHA 1WBHA 5DMYA 4JQAA 4JYFA 3TC6A 4MAVA 3FJNA 1C90A 2QAPA 3P80A 3NL6A 4H6KA 1HKJA 2CLKA 3MHFA 1SW3A 2C1GA 4HKPA 4BEUA 1EHNA 1H61A 4QCEA 3TMQA 3VC6A 3G6LA 3SECA 1E3ZA 8XIMA 4K68A 5CKSA 4MF4A 4AX6A 1P5BA 4Z2GA 1R7OA 3RX3A 3GXNA 2XVNA 3W1MA 4NZ3A 5BWFA 3OZMA 1VFUA 2HE5A 1WDWA 2WZEA 2E6DA 3M07A 2UV8G 4DF0A 3PNZA 3NQ6A 2ODOA 1UZ4A 5C9RA 4AIOA 5C70A 3OBKA 1BWKA 4JZ5A 1YXCA 3CHEA 1BD0A 2TSYA 3GZAA 3WLLA 4LFYA 1A53A 1OCJA 4H8VA 2WZMA 3CH9A 1U5JA 4KEUA 1HFBA 5D30A 3COTA 1UH3A 2YW3A 2XYLA 3SCUA 3WBWA 3ZR4A 4NRRA 1S39A 2WJZA 4JKLA 2XIIA 2GGHA 1F3WA 4HU8A 5U7SA 4FR1A 1VPQA 2CC0A 3UY8A 4RZ4A 4F0KA 3F5JA 1J0JA 1PVNA 4LVBA 4GYJA 4PGLA 3P84A 4GXWA 1T7LA 1KLZA 1F3XA 4DZ5A 4IX2A 1JQVA 2IMRA 4XV0A 2AL2B 1WDQA 1F73A 5AFDA 1WB0A 1FKWA 1K03A 3AISA 5REQB 2AGTA 2ICSA 4MSSA 2H9AB 2HNEA 3TW9A 3QGAC 4L1WA 1CT5A 4DJFD 5CC5A 4ZR8A 1Q4WA 3REQA 4A8LA 1Q6LA 3KDOA 4IMGA 4MKSA 2VOMA 2WYSA 2Z6IA 3OODA 4CNOA 1H2JA 3MCOA 3A64A 3OVGA 3DGRA 3AWNA 1B4KA 1JDCA 4ERIA 4DJFC 3S5SA 4CCCA 3QY8A 1MYRA 2JEPA 4LS1A 4F0HA 3CASA 2D73A 4LAMA 3WIJA 2GJRA 2ZX8A 1QVBA 1SMDA 3P61A 3C8NA 3QW4B 1MUCA 1DHPA 2ZXDA 4KIEA 3LBMA 5K7JA 2QCMA 2CFFA 1EC9A 4JTSA 4JCMA 4HPJA 4GNVA 1LTDA 4QS6A 3VKBA 4N9CA 1ZENA 4QE5A 1Q6CA 4Y2WA 5ABFB 1E4IA 3GTIA 3D6NA 3NEHA 2CKRA 3EPNA 1S1RA 1HP4A 4CN1A 4RNHA 3W9ZA 3ARWA 1UC5A 4YTUA 1JZ7A 3LSBA 2CNCA 3NDZA 2VDHA 1SZEA 4QITA 2QYGA 3W1LA 1GKRA 1W9VA 3BV4A 1VFSA 1DTNA 1GG0A 3THCA 2VM8A 4L6OA 1RBAA 2Q6ZA 4V27A 3H4WA 5MF5A 3LCXA 5A6JA 3EWZA 3BLOA 3NVDA 4XAPA 1CXHA 3SUSA 5HMDA 1CIUA 5C9UA 1PX3A 1CLVA 4UQ9A 3QV9A 4LBUA 1GVYA 3W1UA 1EJUC 1ZS2A 2EBNA 1Q6FA 4DYEA 5LA2A 3UERA 1W37A 3SM0A 4I3GA 2BY3A 4XWUA 3GIQA 1S5NA 2RFGA 1AQ0A 3SCTA 1PPIA 1KCLA 4JTJA 5FL0A 4Z1DA 4S3GA 4PZVA 4ZB0A 2D2GA 3AZRA 5LIXX 4IPPA 2DU2A 4A2SA 5TQLA 3V16A 5FCZA 1C7SA 3WDPP 2GDUA 2WMIA 3G0SA 1UZDA 4LEFA 1NWUA 4HK6A 1F74A 4KGJA 2YKKA 1UD2A 2NXGA 4UNLA 4S3BA 1VIZA 1H51A 1X1OA 3AYTA 3IJIA 5H8PA 3KHDA 3DUGA 3IUIA 1UH2A 3QRHA 3T2OA 3A5VA 4FMVA 4CNPA 4DELA 5B7ZA 1RALA 3GSMA 4UTLA 3T55A 2PC8A 3QMTA 1GQJA 5D2VA 3N19B 2R1NA 4NNBA 1M6JA 1KTNA 1BYDA 3LHYA 5T9BG 4AF0A 4A3YA 5XIAA 4KGLA 4NAEB 3B0UX 4JYEA 4ACYA 1FP9A 3SJNA 2ZUVA 1TTIA 4FXRA 4CVUA 4C1NA 2OWCA 2OPJA 2FMNA 3B4YA 4BZYA 1UIOA 5JIWA 2DUAA 5I3KA 3MV11 3U2ZA 1KB3A 4QM1A 1XPGA 3O6YX 2WOQA 1HT6A 1LL7A 2RDXA 1YPXA 1Q13A 4QSFA 3HTWA 3IGSA 3KTXA 4GHRA 2WVUA 1A5UA 2EPKX 3MWCA 4DJEA 3OJGA 3VNZA 1FWAC 5CZTA 2A85A 5F2IA 2ON3A 1E15A 4XZNX 2Y5EA 3BV7A 4RLIA 3BCJA 3LPOA 5EMUA 2UY5A 4HJFA 5IHSA 3NURA 4NILA 1Y8BA 1RLCL 5ABTA 2HJPA 4Z08A 4FZIA 3FXYA 1RPXA 1XL9A 2P0IA 3AIUA 3BW2A 2VFIA 1W9XA 1C8XA 1VFMA 3H4XA 3W3OA 3TXVA 7REQB 3MPGA 4Q8UA 1TYGA 4ML9A 4M5PA 1JL8A 5A94A 1A5KC 2AMGA 3ZOAA 3UU0A 3LPFA 3QOMA 5AHLA 1GJWA 2WHKA 3CUXA 1KFWA 3NNTA 4DZIA 4LSBA 2ZZ1A 3ABQA 3OB8A 3N1AA 1CXFA 4K1WA 1XRSA 4QLKA 1CGXA 1AJ2A 2WMJA 2C7FA 2Z7GA 1XUUA 4UR7A 3E12A 4MWAD 2Z2UA 3E0LA 1CB2A 3FXGA 5K2ZA 3LCLA 4MWAB 1WE5A 2VTFA 1RUSA 3ARRA 4AX7A 3J7HA 5HWNA 2PDWA 3U4AA 2YCLB 3N34A 3RX2A 3G1YA 2HPMA 2JALA 4E6MA 3OGVA 4MLJA 2YL5A 2WM1A 1DBTA 2NT0A 4NZFA 1F3EA 1ISXA 1W3NA 4ZSTA 4M51A 5AHNA 3GQYA 2TODA 1VD6A 1M04A 3WFZA 1RZMA 3HFTA 2O9TA 3N4EA 3PSVA 2VMFA 1OWQA 3F2CA 3ARZA 1HTIA 4A3UA 1EL3A 4J2PA 3TSMA 3GDTA 1JCJA 3QMSA 1UBPC 1PIIA 2C71A 5DT7A 2PMQA 3WD3A 3VABA 4GWEA 4L9XA 4M1RA 3WLJA 3K4WA 1E1CB 3IRSA 5D32A 1KCZA 5CG7A 4GO9A 4KERA 2YA1A 4GUIA 3NM1A 3DEQA 4N9BA 1CEOA 4UOJA 2OMAA 1R3WA 3VDAA 1VZWA 4TX8A 3NQ7A 3RIKA 4QS5A 3OA5A 4OZOA 2PDKA 4DIAA 2J8FA 1EA0A 3LGGA 3RU6A 1CCWB 3ABSA 4JR5A 1TE1A 1Q7QA 3BVJA 1YIXA 2V5CA 1AZ1A 4I6VA 5LA0A 5H8MA 5GJPA 3TOYA 3T09A 1I6NA 4QJ4B 2ZRVA 1CGVA 4D6FA 1UP3A 5HUOA 1OJXA 2CBIA 1B3ZA 5AECA 4LCRA 1GYNA 5BU9A 4LS0A 3WQDA 4TMCA 4Z42C 3B8DA 2W92A 3S2CA 3IIOA 3OHIA 4TMBA 3TK7A 4KRZA 3VNLA 3HIJA 1BAGA 4YU1A 2PWHA 2Q8ZA 2Y1HA 3HA1A 3P62A 4ORMA 4LV4A 3BSGA 2IPJA 3PWAA 1GVQA 4LW7A 1EYEA 5BOFA 4KETA 2W62A 5EPDA 3URNA 1MQRA 5HJLA 3FN9A 5LGZA 2JF6A 4BCEA 4IICA 1Z9AA 2RH9A 1FOBA 1F6PA 3UCQA 1AJZA 1S5TA 4X2RA 2UBPC 1DIOA 2ZZ2A 4JTDA 1A0EA 1J93A 1WZMA 3PBMA 1EDQA 1ADOA 3KBMA 3R5EA 1U1HA 4L5ZA 5JUVA 2D22A 1XH2A 3I6RA 2BLEA 4JTQA 3WQEA 4DBEA 3GDLA 1EGVA 3CHFA 1F7BA 1I1XA 1XC6A 1HZYA 2C8NA 2E1DA 1Q4NX 4E4PA 3BW3A 4MY1A 3UR5A 2QEZA 3W1TA 3I3EA 1KBIA 3BQ5A 1V02A 4X60A 2O9PA 6XIAA 1GVRA 4C6DA 4S38A 3DHPA 3R25A 3CZEA 4DF1A 4P8XA 5HWJA 4CUCA 1FWRA 3QH2A 3E3HA 5H6HA 4KMQA 3FEQA 1LCOA 3UD6A 2VCBA 3LY0A 4W7VA 3UETA 2I5GA 3CV6A 3KOYA 1T5AA 1UZ1A 5EBAA 5EMLA 3R79A 4MB3A 4B2DA 2WWDA 3NEVA 3SUUA 3IEBA 4AD2A 3TN4A 4WD0A 3BAKA 4CD7A 3R0DA 1ONEA 3FJLA 1YTDA 5G1YA 1L6FA 4LBSA 4FALA 4J35A 4E8GA 4FP1A 4UFJA 1IR2A 3W1PA 3HGSA 4GABA 3QTPA 3PUGA 1GOOA 1OF6A 1S2CA 1QPOA 2R1LA 5EFDA 1LBFA 4OGZA 1TO3A 2DH2A 1J6PA 4V15A 4QJ5B 1WZLA 3M0VA 1K7XA 4HU3A 1AW2A 3WCZA 2CITA 1XRFA 1SZFA 1YNQA 4PUWA 1KWGA 3S1XA 7ODCA 1DYSA 2EKCA 1GT8A 3T07A 4B5VA 1W3IA 3B0YA 3C61A 1VB9A 5CPTA 4ICCX 1PS9A 1RV8A 3THUA 3C56A 3P14A 1KM4A 4MB1A 1E9YB 4B15A 3C0JA 3GR4A 1XQLA 3STEA 3ISIX 3W70A 2PWGA 4ZTXA 1ZBCA 4YNGA 1SO3A 3FJ6A 1K8YA 1K9TA 3RAOA 2EG7A 3SN0A 5EY5A 3T44A 2PD9A 1V6VA 4GO8A 1FWGC 1HN1A 2IPGA 3O0FA 3PB0A 3LUTA 1TVNA 3QFEA 2DZPA 1DTUA 5H1WA 1QO5A 1E6RA 3UCDA 1RJPA 3UXDA 2HK0A 5DRCA 3V0UA 4ML4A 5LNWA 2ZIDA 1KW1A 2TMDA 5FEWA 4CEUC 1R8LA 4TX6A 3GNPA 2YGYA 4YHEA 2VCCA 4Y7EA 2GYIA 1G01A 1OX5A 2VFDA 2DT2A 1W8SA 3VIKA 2HV5A 1TWWA 2E5BA 3ZVIA 4UTHA 2X16A 1V6XA 5AYZA 3MZNA 1TR1A 3DHUA 4PMDA 2Z24A 3TROA 2WSPA 2CETA 3FYPA 4CD6A 1JZ3A 4RPPA 1DOSA 5HANA 3LB0A 3KBWA 6PTDA 2Y62A 4L64A 2VD8A 4INFA 4S3CA 3V5CA 1TQJA 2HZGA 1T40A 1B2YA 4EPKA 4S3KA 2VZTA 4JFWA 2E0PA 4C6KA 3O16A 3BLKA 4AU0A 1OT2A 4UFLA 3UZYA 1UR9A 3RRXA 2ATMA 5BRBA 3TR9A 4AMAA 1Q6QA 1LUCA 1RBLA 1DJYA 3A4AA 2QQ6A 1L6YA 3QLLA 3CUZA 1PL9A 4JHOA 3N2XA 2VKZG 1WAWA 3VIMA 2PLJA 1J2BA 2Z1KA 3QYSA 3IIVA 1E5JA 3NQGA 2QPUA