2YDAA

Sulfolobus sulfataricus 2-keto-3-deoxygluconate aldolase y103f,y130f, a198f variant
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
292
structure length
292
Chain Sequence
PEIITPIITPFTKDNRIDKEKLKIHAENLIRKGIDKLFVNGTTGLGPSLSPEEKLENLKAVYDVTNKIIFQVGGLNLDDAIRLAKLSKDFDIVGIASYAPYFYPRMSEKHLVKYFKTLCEVSPHPVYLFNYPTATGKDIDAKVAKEIGCFTGVKDTIENIIHTLDYKRLNPNMLVYSGSDMLIATVASTGLDGNVAFGSNYLPEVTVTIKKLAMERKIDEALKLQFLHDEVIEASRIFGSLSSNYVLTKYFQGYDLGYPRPPIFPLDDEEERQLIKKVEGIRAKLVELKILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sulfolobus Sulfataricus 2-Keto-3-Deoxygluconate Aldolase
rcsb
source organism Sulfolobus solfataricus
molecule tags Lyase
molecule keywords 2-KETO-3-DEOXY GLUCONATE ALDOLASE
total genus 114
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 4.1.2.55: 2-dehydro-3-deoxy-phosphogluconate/2-dehydro-3-deoxy-6-phosphogalactonate
pdb deposition date 2011-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2ydaA00
1OYAA 4MJMA 2QF7A 4JTSA 3OIXA 2DU2A 3MI2A 3NNTA 2YYUA 4ZQRA 2ZRZA 1K8ZA 1PV8A 3S5ZA 3KFTA 2IQTA 3KOFA 2ZRYA 1H7RA 4O4VA 1O5KA 4A2SA 2ZYFA 3P62A 3STCA 1LZOA 5SWUA 3WK0A 3UZ5A 1ZNNA 4AAJA 4ORIA 4IX0A 5D32A 1OFEA 3GX9A 1FDJA 3UZJA 3G1SA 1FCQA 5LHFA 3DKLA 3L68A 1TQJA 1EB3A 4TU1A 3RLVA 3MP5A 3LI1A 4OBTA 4UR7A 1I2OA 1M7OA 3BK0A 1Q6QA 1LLWA 1VHCA 1PHWA 4JEQA 1KM6A 4TO8A 4UNKA 1HO1A 3LHTA 3G8RA 1W5QA 1ICSA 1OHLA 2CLKA 3I7RA 2YPIA 1FCVA 2X1TA 2FQIA 1QOPA 3B04A 1W1ZA 3TSBA 3GVGA 4LT9A 4MY9A 4EIVA 4N6FA 1GTHA 3LCFA 1FWNA 4IJBA 3TXVA 2VFHA 4EWND 2WJZA 5LZLA 1R47A 4Z1AA 4OT7A 3SSJA 1H60A 4DELA 3W7DA 4LC8A 3PBUA 5FF4A 1VCGA 1RD5A 1FX6A 3BLIA 3NZRA 1HL2A 5K4XA 4O13A 4GUHA 4QSHA 3P5ZA 4WJEA 2ALDA 3PUEA 3S5YA 1SO3A 2HSAA 1W31A 1JUBA 4NXSA 3N9SA 4JTGA 1CI1A 3D0CA 4ZQPA 4W9TA 4ADUA 4PODA 1AW5A 2ZZ7A 2F7FA 3TMLA 5HJLA 3G1YA 3TW6A 1W3NA 3JRKA 5DBTA 4JY9A 1TPC1 2V82A 4JIPA 4DF0A 3THAA 4WY0F 3W1UA 2FTPA 5BMXA 4GUFA 3QW3A 4POCA 4GUGA 4TMBA 3I65A 1OX4A 2YW4A 5EYWA 2P0OA 3W7KA 3TJLA 3EWZA 4UMCA 4UTHA 5I3IA 2CLEA 3NQMA 1N55A 1O5XA 3NR0A 3FOKA 3FLUA 2RH9A 1OJXA 3SFKA 3IIZA 2CWNA 1G4TA 3QW4B 1EA0A 1SUXA 3M41A 1HTIA 3TDFA 2AQWA 1G7UA 3N3MA 4XWUA 2CLMA 2CZDA 4LUJA 1KFKA 1DJNA 4MFEA 5KZEA 2A2IA 3GDTA 4DO5A 1K7EA 4LUIA 2C13A 2YSWA 3W74A 2VKZG 1GVSA 4AF0A 4PCFA 2Q8ZA 1GQNA 3S9YA 3AO0A 4O54A 1VYSX 4N9BA 3GKFA 3NOEA 3PBWA 3KVMA 3QRHA 5U4NA 4XZ9A 4NX0A 5I3KA 2GJNA 1NEYA 1GOXA 5F4SA 5G4WA 3W7MA 2DZXA 3NZ1A 3F1QA 4IPJA 5HQEA 1F6KA 2CLHA 4BK9A 3KVJA 1OF6A 4LNYA 4DPPA 2QCLA 4DF2A 4E2DA 1TPH1 3QEZA 2J24A 4NJHA 4QITA 1JUEA 2QCDB 1FWTA 5D2VA 3LBCA 3WJWA 3RU6A 3OVPA 1SPQA 3LX9A 1A53A 4RR4A 5EY5A 4HIBA 3EWUA 2VFFA 4N02A 3B0PA 3E02A 2H3BA 1WOBA 1LBLA 4GUIA 3ANYA 5CZTA 5CZ0A 3M5YA 3CT7A 1G4EA 5G5IA 3FKRA 1O95A 3VE9A 4GUJA 5F1VA 1EUNA 3R13A 1GPWA 4UNLA 1L6SA 4P2VA 5D03A 1O4UA 3LCWA 3MO7A 2OZ0A 5LGXA 1YPIA 2Y85A 1LORA 1FWWA 4N4PA 3NQFA 1XM3A 2Z0IA 5CGQA 3B03A 1R2RA 1H62A 4UIOA 1FY6A 1IXNA 2NX3A 1IXPA 3G0UA 4WX2A 3NQ6A 2QCCA 4RZ5A 3FEMA 5FI8A 1LOSA 4UTMA 2AAMA 4NZJA 1H7NA 2EHHA 3A5FA 3IVUA 5CSRA 2C1HA 3LTYA 1TPEA 4WOZA 1M6JA 2B4GA 1YDNA 3YPIA 3HG5A 1H63A 5KZDA 3OBKA 1BKSA 4J9JA 4R33A 4BFAA 5HWMA 1QNVA 2OT0A 1K02A 3CLMA 4O28A 1JRBA 2PURA 3LB0A 3QSRA 3HMJG 3GB6A 2E5BA 2BLEA 1G67A 3DI1A 5DY2A 2X1SA 3CWOX 1KW1A 4LOCA 2NXGA 1OX4B 3G24A 3A9IA 3GDRA 5D38A 2FDSA 1OABA 2YGYA 3HBLA 4JIQA 2G96A 1ME7A 4UTLA 3W3OA 2QCNA 3GDKA 2ZZ2A 3CEPA 1TPUA 2NXIA 5FEXA 4A3UA 4BWLA 5F1UA 4JYFA 3DAQA 4UMBA 3R8RA 4OWGA 3W70A 2GPTA 3ZWSA 2HS6A 3GYEA 3HQ1A 4I9AA 1XBVA 3G1DA 4UC5A 2WKJA 1NAL1 1SSGA 5TQLA 3WJYA 3ZR4A 1KTCA 3TFXA 1ADOA 3GXPA 1RZMA 4Z1DA 5HUPA 3R5EA 1U5JA 3S0CA 2EPHA 4UFHA 2ZDRA 1R2TA 2ABAA 2EKCA 3CIXA 3W1PA 4MVAA 1KM1A 3QH2A 2YX0A 4WUIA 3PUOA 2QDHA 3E0IA 3T4CA 5HNRA 2VEKA 4FB7A 1OFRA 2R14A 1TRDA 5F2GA 3GDLA 1N7KA 2GQ8A 2J9XA 3UWQA 1JQVA 1JVNA 4UFKA 4O4WA 4DXVA 5LNSA 3DHFA 4NT0A 2YXGA 1R30A 4JTJA 5D30A 4NJJA 1JQXA 1U83A 1KFLA 1H50A 4UTJA 1WDWA 3PULA 4UFIA 3W7NA 3KXQA 1QDSA 2EGZA 5FEPA 2QCFA 3GKAA 4XTDA 4I7VA 3W07A 1VHNA 1KTBA 3DU0A 4FHAA 2BTMA 3HPZA 3NL3A 1TTPA 3W75A 2TSYA 4AB4A 4HPXA 3EXSA 3PC0A 2Q8LA 2A0NA 4JD4A 3V75A 3UYCA 4JS3A 4AWTA 5HR6A 2ZZ3A 4TMCA 2QJHA 1E51A 1YTEA 4JYDA 3W9ZA 1VCFA 1ZY9A 4XKYA 3UWWA 3BV4A 3A21A 4YWIA 4K6AA 4JDBA 5J5RA 3HOJA 5D2XA 2NWSA 3NPVA 3LCLA 4X9SA 2DZPA 1OFPA 5L9FA 4DEFA 3L0NA 4FO4A 2C14A 2QKFA 1T99A 3NQEA 2A7NA 4LVAA 1JUKA 1JCYA 4OGZA 3SR7A 3TSMA 2QDGA 3B06A 4CQ9A 2E09A 2E5DA 1TPB1 1XUZA 1QO2A 3UWYA 4DBEA 5L6UA 4JX4A 3S8HA 5BW6A 3DXIA 1F73A 4JICA 5FF3A 3F03K 1A50A 4K7VA 2NV2A 4MKNA 2CLOA 1LCOA 3FFSA 4C1LA 2E1DA 3M1ZA 3LDVA 1LRQA 4RXFA 1R46A 2NUYA 3LCXA 3DFSA 5KSWA 1FWRA 1DVJA 1H1ZA 3G1FA 3LHWA 3VI2A 5AHNA 1TJPA 2Z6IA 1ZENA 3USBA 1EIXA 5BNKA 3MMTA 5KMYA 3OHIA 2A6NA 3FJ6A 2Y7DA 1PHQA 4GFSA 1YPFA 1JJKA 1OK4A 5F4XA 3M47A 3UXDA 2D73A 4Z0JA 1VRDA 1T8XA 4CQ8A 4N9CA 1GJPA 2OCZA 2VOMA 1T0OA 3STFA 4FNSA 3B4UA 1W3TA 3TFCA 3TU9A 3PUDA 5CZSA 1L6WA 3STGA 3F4WA 3FIGA 1KFJA 4K38A 3WK2A 1JCJA 1EP3A 3NQVA 2QAFA 3P8JA 5K3VA 1IXOA 3OG3A 4R53A 1QO5A 2GQ9A 2BZNA 4LS0A 3P74A 3BW3A 3TCEA 3TR2A 3GNDA 4RZ4A 2B7PA 1DBTA 2Q3RA 2CLFA 3TMQA 4E38A 1G4SA 4U4MA 3W22A 3C6CA 3M5VA 3DZ1A 5IBXA 1ONRA 3P82A 3O16A 4E2BA 3PSVA 5EA9A 2CFFA 1FDYA 3QF0A 4K39A 2Y62A 1PCWA 4BI7A 3TV8A 3N14A 2C15A 2Y6ZA 1QOQA 2YFOA 1T96A 3HG2A 2ZZ4A 5U7SA 4TR9A 2DZWA 4BF9A 4IMEA 1UUMA 4FEZA 1TJRA 2C19A 3MHUA 4B5NA 1A5BA 1CW2A 1VQTA 2O7SA 3WJXA 5EPDA 3T40A 3T78A 3PSWA 6TIMA 4MLJA 3LHYA 2CLLA 1H7WA 4EF8A 2ISWA 3IEBA 2FLIA 4Z1CA 4H3DA 3LCGA 2GOUA 2WSQA 3K30A 3G0XA 3TJXA 3L5AA 4S1FA 3TC7A 4BR1A 3IRDA 4OU1A 2E5CA 1TCDA 3IVTA 5TIMA 2A5HA 2C0AA 3EWWA 1ZAJA 1GTEA 1R2SA 4EF9A 4MLRA 3HPSA 1F76A 1VJIA 2OJPA 3CEUA 4IGHA 1H1YA 1JRCA 1H61A 2CZ5A 1TTIA 4FX8A 5D33A 4FNUA 1YYAA 2NX9A 4PTNA 2V2CA 5HINA 3BGGA 5D37A 1Z44A 3PB2A 2JK2A 5G2WA 4AWSA 2ZRVA 5J5DA 1GVQA 1I2QA 4NJGA 3NVTA 1FXPA 4JGDA 5D05A 3NG3A 1OFOA 4UUIA 3W7CA 3PWAA 2CLIA 2J27A 3OA3A 3I7SA 3KRZA 4JYEA 1ICQA 4QAIA 2XN1A 3IGSA 2TMDA 4IMDA 3W85A 3NQ8A 5EMUA 1SW0A 4MFDA 1EX5A 1ZHAA 1TV5A 2JKPA 4UFLA 4QM1A 4GE8A 1C9DA 1W5PA 4HSNA 5E0KA 1IIHA 3CIWA 1F5ZA 4WQ6A 2LLEA 1J4EA 2PRHA 1J2WA 4HHPA 4GXMA 3PY2A 2DZSA 1D3HA 1VGAA 3N9RA 2GJLA 4GNJA 3P80A 2OT1A 4QNEA 3W1XA 3N73A 1I4NA 4JTKA 4MOZA 1Z42A 4JTFA 4O14A 1K7XA 4PH6A 3MYPA 3W76A 1UBSA 3I68A 2ZZ6A 1VC4A 5DCDA 1A5CA 1ZALA 4LRTA 2E6DA 1LTDA 3UY8A 1XFBA 2QCEA 3U2OA 4ADTA 4FNQA 4KFNA 1YLVA 1F05A 2JKEA 3QZEA 3O05A 4RV8A 3SZ8A 5F2LA 1KM5A 4ONVA 4UR8A 2B7OA 3C2OA 4LS2A 4LVBA 4WZHA 3LHVA 1AK5A 2ZZ1A 3BO9A 2ZQ0A 4R7JA 3W71A 1TV7A 1AMKA 3W1MA 5AHMA 4CNNA 2HS8A 3P61A 1OX5A 5FESA 2V0TA 5HULA 4JTEA 3W86A 5KZMA 1TSIA 2J9ZA 2QAPA 2WNNA 3GAKA 1W37A 3UD6A 3WJZA 4JTIA 3TNOA 3W7GA 5KINA 3C2VA 2V8ZA 4P61A 2QCGA 4AWUA 1I2RA 7TIMA 1ME8A 5AC8A 3PG9A 1WA3A 2B0MA 3W6YA 2FB2A 5AB3A 3UY7A 3SY5A 2XN0A 2A85A 5CPNA 4YMZA 5E1QA 1OFBA 2NUWA 3VCRA 1W5OA 3LV5A 1IF2A 2X16A 3NQDA 4JTHA 3LXBA 1IGSA 8TIMA 2Y70A 1SO5A 1D9EA 1OYCA 3JS3A 1G4PA 5C6MA 3B0UX 2C16A 2ZRUA 2JGQA 2RDUA 5HR7A 4K8EA 3LCIA 2NUXA 3NL2A 3U6WA 3FKKA 5CKSA 1XDLA 1RR2A 5HWNA 1ML1A 3G3DA 4M6QA 4ADSA 1FCBA 5LNWA 2X1RA 2VEPA 4FIQA 3ELFA 1WBJA 1ZCOA 2Y7EA 5BOOA 5G1TA 3ABSA 3LOTA 3TW7A 3E96A 1LM1A 4EOUA 2C3ZA 2ATMA 5GVJA 3MW7A 5ABTA 4X22A 4UTTA 4CCEA 3MYOA 1YTKA 1W5MA 3A23A 1OF8A 4ZVJA 1RPXA 4M19A 4M5PA 3A22A 1DOSA 1FBAA 1K8XA 2QUTA 2ZRWA 5F4WA 2DP3A 1NVMA 4WD0A 3CB8A 4MY8A 4UTIA 3QYQA 1F6PA 4L4MA 3W1NA 3Q2DA 1UCWA 1LYXA 4HNTA 3M5ZA 1EP2A 1PS9A 1I45A 2R8WA 4A21A 3GR8A 4A22A 3DI0A 4UTKA 1PIIA 3DFNA 4UXDA 4ZQCA 4L4LA 2W79A 3DHDA 3S1UA 2OMAA 2EF9A 4Y9AA 3NM1A 2WV8A 5K9DA 2I9EA 1NF7A 2A21A 3EX1A 3HG3A 3G0SA 3LHUA 3TH6A 4YXGA 1MEHA 1FXQA 4O19A 2E68A 1F7BA 3HGOA 5D04C 5AHEA 3TQVA 1RQHA 3W1QA 1OYBA 4IMCA 3C3NA 3RF9A 1VZWA 4WXZA 5DCBA 3HF3A 3PBVA 4JNMA 1O60A 1Z41A 3BVJA 1RQBA 1HUVA 1JCMP 5I3HA 4WXYA 5K9XA 2TYSA 5BRBA 3TQKA 4CNPA 3BG5A 1RQEA 1IIGA 3SI9A 1SQ7A 3E9AA 4BI5A 3EEGA 2Y7GA 2DJLA 2Y88A 4OV9A 3UWUA 1YDVA 2A6LA 3TAKA 1B3OA 4HPJA 5G2HA 3RMJA 5FF7A 5FEZA 2PRLA 4O17A 2J9YA 1LLZA 1H7OA 3N19B 5DBUA 4O18A 3LGEA 1NF0A 4IMGA 3M16A 4FX7A 4MZYA 1IXQA 2V5LA 4LVDA 1AL8A 3W7IA 3NAVA 3GZ3A 4FXSA 3L5MA 3EX4A 1TTQA 2V9DA 1ZJIA 3QSTA 2DZTA 1TTJA 4XUGA 4MPQA 3HB9A 4DO6A 4O16A 1DORA 4FNRA 1W0MA 1I8JA 5AOUA 3MWAA 5CPLA 4OV4A 2ZTKA 2C18A 2BXVA 5CPOA 3Q94A 1DV7A 4OHQA 4QJ1A 3GR7A 3M43A 3HO8A 2ABBA 3W2KA 1FCUA 3TROA 1BWLA 1THFD 2VFEA 2NWRA 2Z1BA 1FDZA 2J88A 4FIRA 3EWYA 4PL2A 4KKXA 3CQ0A 2C6QA 4PA8A 5LGZA 2FB3A 3BGJA 1SZGA 3IV3A 2DZUA 3W1TA 4ICNA 3TQ0A 1G6CA 2NV1A 2ZA3A 3EWXA 3NGJA 3CTLA 3MI6A 4N9EA 1SR9A 4KFOA 4QISA 3EWBX 3MBDA 1WOAA 1WYIA 3G22A 1KM4A 2DJXA 1X1OA 5G4EA 2FFCA 2A7RA 1OK6A 3O6DA 1Q6OA 1TPFA 4A2RA 2J6XA 1X1ZA 2ZA2A 1AW2A 4Q33A 3LRMA 4RLIA 3EXRA 1XBYA 1GZGA 1KFEA 3DGRA 3LLDA 3M0ZA 3VKJA 4MY1A 2R94A 2CZEA 2WSYA 4O53A 1V5XA 3LBMA 1I2PA 3H54A 3GK0A 4IXHA 4O11A 3O15A 4O1AA 1FQ0A 4O10A 1XL9A 5IBXC 4AHOA 3W2MA 1KBJA 2XN2A 4UMAA 3CWNA 5LNRA 5FF0A 4KWWA 3W2NA 1G7VA 3OVRA 1JCLA 3CU2A 1TQXA 2HMCA 3S5OA 1H7PA 3PM6A 1J5TA 3PBYA 3IIVA 3BW4A 1JULA 1ICPA 3LM7A 4MZ8A 1SFJA 3W72A 5G1YA 1LBMA 3G1AA 3S5NA 1TREA 4FF7A 3TE9A 1PVNA 3NQ7A 4JX5A 3C52A 3SGUA 4Z1BA 1BWKA 1TPWA 2B7QA 2DORA 4LC6A 4K7YA 3MHGA 1V7YA 4XBSA 1EEPA 1QFEA 1JCXA 1LRTA 1AW1A 1L2UA 3SGZA 3RFAA 2WNZA 1N8FA 1HG3A 1BEUA 1KLZA 2Q3OA 1GVFA 4HSOA 4LVFA 4O15A 3NQGA 3DENA 4LS1A 1QPRA 1S3HA 4RJEA 3IIPA 3TUUA 2ZBTA 3O6CA 4QIUA 1QPQA 4OE7A 4X2RA 2Z2UA 2H8XA 1VYRA 1K7FA 3UQNA 4S2BA 1LROA 3FYPA 3KHJA 4HKPA 4IXXA 2PE4A 4D2JA 1VPXA 3KVLA 4K37A 5AHFA 4GWEA 4MJZA 1KM3A 1LOLA 1JCNA 5F2MA 3R12A 4IMFA 2I14A 4YCPA 1XDMA 3GAYA 5I3FA 3TAOA 3LTSA 3NDOA 3TC6A 3GNNA 5T26A 3RK8A 2RDTA 4A29A 1QCWA 4NQ1A 3SECA 3CPRA 5D2YA 4ZQNA 3E12A 3DFTA 2ATSA 3LI0A 4UCGA 3BLEA 3P67A 3LERA 4YCOA 2QUUA 3W7RA 3PAJA 3IGXA 2VFDA 2VXNA 1GT8A 1B4KA 3HPXA 1MZHA 2ISVA 2YZRA 2YYTA 4AF0B 3MUXA 3SJ3A 5C54A 3NYZA 5D2TA 2V5BA 1VS1A 3BLFA 4JN6A 2YDAA 3INPA 3T55A 4CQAA 2PC4A 3C61A 1DQXA 4O1BA 2OX1A 4AVFA 3NQ2A 4WY0A 1K03A 5I3JA 3A5VA 4RXGA 3F4NA 1VR6A 3H55A 3NL5A 5K2ZA 2EAWA 3DFPA 5DXYA 1SW3A 4K8HA 3STEA 4O57A 4O52A 4I7WA 3C8FA 5BMWA 1DHPA 1G69A 2H6RA 3G18A 1XC4A 1KV8A 4HT3A 2A7PA 1ALDA 4M7TA 4NZFA 4QQ3A 2E6YA 2YR1A 1GYLA 1XCFA 4H6KA 1NSJA 2GVGA 3TSDA 5CG7A 1XXXA 4X3ZA 3W83A 3CC1A 4Z08A 5LNVA 4AH7A 4LV9A 1QR7A 2NX1A 4FXRA 3T44A 2GVJA 2PCQA 1PE1A 3U8GA 1JR1A 3M7WA 1TV8A 4JR5A 3P60A 2G95A 3GLCA 4LRSA 3ZWTA 3ATZA 1GVOA 3GIYA 4FNPA 3GXNA 3L9CA 3EXTA 4Q32A 3LTPA 1VYPX 2F84A 1FWSA 1MEIA 3C2FA 3LRKA 3W1RA 1S5WA 3G1XA 1DKWA 4PL1A 4WY0B 1XUUA 1P1XA 2NXHA 2VC6A 3W2UA 3QMSA 3TA6A 3TXZA 1KLYA 2E77A 1WXJA 2BX7A 4FX6M 1GYNA 3NL6A 1RV8A 1XBZA 2WO5A 4MIMA 2ZA1A 2HTMA 3OEXA 4Y96A 2R91A 1B9BA 3QFEA 3HIJA 2H90A 2DZVA 1I2NA 2RKXA 1K8YA 1OFDA 1W54A 3GDMA 3LLFA 2G5WA 1KBIA 3Q37A 2ZCGA 1VLIA 3TK7A 3W7JA 5EKYA 3NPWA 5A8GA 4O50A 3P5YA 3LRLA 3WK1A 2JKAA 1UASA 3P81A 1OFQA 5D09A 5I3GA 1OFAA 3ATYA 4ZQMA 5HWJA 3V1PA 1NFBA 2ZFAA 5HMSA 3B0VC 4LVGA 2WNQA 3LHZA 5DN1A 4O8RA 2GVLA 3FS2A 3QMRA 3MJYA 3O1NA 1YXYA 4ZQOA 2A4AA 4PEKA 2Y61A 3P8IA 3TIMA 5K4ZA 1TRIA 2H8ZA 3IIOA 1TYGA 1GVRA 4GBUA 1DJQA 2V81A 4UTTC 2V2HA 3B05A 2QCDA 3G8EA 4U28A 3M9YA 3O6YX 2P1FA 4RX0A 5D02A 4IPIA 1K3UA 5FEWA 1LDCA 5AHIA 3W23A 2X2GA 4CNOA 3SIZA 4ORMA 2CW6A 3WK3A 5AYZA 1B4EA 3BARA 3EX2A 5HUOA 1AL7A 4GJ1A 1A5SA 5LSMA 5IM51 4JXCA 1Y0EA 4CCCA 4N6EA 3CM4A 1MEWA 3S1WA 4AHQA 4RCXA 3S6DA 1EPXA 1L9WA 3R2GA 3W7HA 3L2IA 1AG1O 3I7QA 5AC6A 5A5WA 1QPNA 3ABOA 3QPYA 4HNVA 3W2JA 3O06A 1MXSA 1SW7A 3HG4A 2JGYA 2H3DA 4N2YA 5K7JA 4TIMA 2NZLA 1O94A 3P84A 2QR6A 4I7UA 3LCHA 4N4QA 4JX6A 3RNDA 2E6FA 1GG0A 3FJLA 1ME9A 2E6AA 3UNDA 4AXKA 3MI3A 2PRMA 5FF2A 1QWGA 3W7PA 1WV2A 2B7NA 2QJGA 3PF3A 3W1LA 1W5NA 3W7QA 1D3GA 2ZZ5A 1W3IA 4NX5A 1PCKA 3W73A 3NPXA 3MHFA 3M44A 1DQWA 1F2JA 3S1XA 1A5AA 4IOTA 4NNCA 3BG9A 4PFMA 4C1KA 5AFDA 1QAPA 5C2XA 4ZL1A 3Q58A 1LBFA 5DY3A 1MSSA 4Y6GA 3QJAA 3M6YA 2FPVA 1F74A 4AEOA 3BW2A 4IQLA 3C2EA 3PR2A 4YLWA 4DQWA 1BTMA 4O1CA 3KAOA 2FPYA 3UWZA 1YDOA 1QMLA 1DL3A 3IGUA 4RKAA 3QM3A 1Q45A 3PVFA 3O8AA 3FA5A 1YXDA 4UTUA 3ZS4A 3SW6A 1GWJA 3DBPA 4NUWA 3N2MA 3I6RA 5DELA 1X8FA 4ML9A 3W2LA 5E93A 1UUOA 2RFGA 4O12A 1SFLA 3C56A 3LV6A 3W84A 2WSRA 4JDYA 3WFAA 4NNBA 4GRSA 4RZ6A 3W1AA 3QPZA 4O0ZA 1M7PA 4WOQA 4NJKA 3O07A 4IWWA 2V2DA 4CLMA 5CZJA 5LNUA 2I1OA 4NU7A 5AYYA 3MBFA 2TPSA 3MP4A 5D2WA 1HO4A 3E49A 3NQAA 4LU0A 2A1YA 3PG8A 5AN7A 1ZAIA 5LHEA 3ABQA 4HNUA 1KFCA 2WPBA 1S5VA 2W0UA 4OQVA 1C29A 3KRUA 3VNDA 1H51A 4JTTA 3RLUA 2VELA 4UTWC 3EB2A 3L65A 3HGJA 4H4IA 2Y7FA 2YW3A 1WQ5A 4ZZ9A 4UFJA 4DF1A 1P0KA 2QJIA 2NLIA 2FPTA 4JTLA 4LW7A 2VENA 5KITA 4UFMA 3WJSA 1W8SA 1Z48A 1KV5A 3N2XA 1P0NA 3L0KA 3VE7A 2UV8G 1WAUA 3AJXA 3C0JA 1TB3A 3UPBA 1H7XA 1KFBA 4LWWA 5DXXA 3GXTA 1HFBA 4MYAA 1EP1A 4YL2A 3UWVA 1EWEA 1ZAHA 3UPWA 2YFNA 3HGSA 2KZHA 3W7LA 3G1HA 3O63A 4N9DA 5LKYA 4NVTA 5DLCA 5MHBA 5TBOA 1SU5A 1WX0A 3G1VA 4MZ1A 5C5YA 1GG1A 3MP3A 5AHLA 4E0CA 5AC7A 3EX3A 3L67A 1UJPA 1YADA 1LP6A 3G3MA 1KM0A 2QUVA 4G1KA 4R34A 4Q4KA 3VFLA 2V30A 1P5BA 1Q3NA 1VCVA 3S1VA 4BWLC 3JR2A 2VEMA 5C55A 3QMTA 2ZTJA 5EL1A 4BI6A 3L21A 3NM3A 5K9CA 1Q6LA 3NA8A 4XBKA 2X30A 4XQ6A 3P7YA 2GQAA 4K36A 3NXFA 2CU0A 3B8DA 3THQA 4DBDA 2Y89A 3C2RA 3TX9A 1LRNA 3DFOA 4RK8A 4FNTA 3QC3A 4AMAA 2G97A 3CHVA 2QCHA 1L6YA 2BWGA 3DFQA 5H91A 2P10A 1OX6A 2FJKA 1SO4A 1TPVA 2Y63A 4JTUA 5CSSA 1VLWA 2ISSA 4O1DA 1SSDA 4LTSA 2RDWA 1QPOA 2WQPA 3PS7A 5AYXA 3W7OA 2JBMA 3L0GA 4GC4A 4DO4A 1B57A 2YCEA 3NO5A 1TO3A 4CCDA 4Z0SA 3EKZA 3HJZA 4M7SA 1KTNA 1TMHA 2VFGA 1TPDA 4MYXA 1RVGA 4QNWA 2W6RA 3PB0A 6ALDA 2WOQA 2XFWA 3DKJA 5KTLA 4M6VA 5F2IA 3W7EA 4AHPA 1MO0A 2VEIA 1H5YA 3ZFHA 1S5TA 4PC8A 2GUUA 4M6PA 5EBUA 4NNAA 1PL9A 1CX9A 3M5XA 2QCMA 2X1UA 1XKYA 1YTDA 4IUOA 2O7QA 1OG0A 1OVDA 1XBXA 3NPUA 4KFPA 4XTIA 5H2ZA 1SZFA 3KX6A 3NEVA 1GEQA 3IVSA 4NXKA 1YXCA 2QEZA 3R89A 5CPMA 1SZEA 1EUAA 4Y8FA 1X7FA 4UTWA 4MUZA 3EX6A 1SO6A 3NQCA 1KA9F 4XKYB 3IIXA 3LXCA 1XI3A 4Y90A 3DH7A 1VH7A 4LY8A 1EWDA 1Q6RA 2ZRXA 4NJIA 4EVZA 1FUYA 3BG3A 3HGRA 4IX2A 3W87A 3W88A 3H53A 1LOQA 3EKLA 1WBHA 4ZMGA 1UB3A 1TIMA 2Z6JA 2BSLA 3OVQA 1C8VA 3T7VA 3FYOA 1M5WA 5DCEA 3TKFA 3S42A 3QQ0A 3A24A 3N34A 1SZNA 3ABRA 1ZFJA 3L66A 4DPQA 4HN4A 3QQ1A 2CZFA 1W56A 4HNNA 3KRSA 3KVKA 3UXAA 2TRSA 4ALDA 4O0KA 1X6UA 4S2CA 1P4CA 2VFIA 2AGKA 5G2IA 4TX9A 3L5LA 4KWVA 2FIQA 2RHGA 4LV4A 1KM2A 3BPWA 3C4UA 4JY8A 3LXAA
chains in the Genus database with same CATH superfamily
4ZB5A 1FWBC 3SCVA 3NNTA 3PTMA 3ITLA 2YYUA 5G4HC 2R1PA 3A4AA 4S23A 2E25A 1XWYA 1K8ZA 4PCNA 3S5ZA 1KRAC 3KOFA 1D8WA 3QQWA 1YIXA 3NDZA 4CKQA 1H7RA 3AMGA 2ZYFA 3P62A 3UZ5A 4AAJA 2J74A 4G1NA 4NG3A 5D32A 1FDJA 1KGWA 3UZJA 3G1SA 1H4PA 1FCQA 5LHFA 1TA3A 1TQJA 3KP1A 4TU1A 4IISA 3RLVA 4C6CA 4OBTA 1M7OA 2INFA 1PHWA 1ISXA 3LHTA 4UZSA 1NDVA 1OHLA 2YPIA 2X1TA 1JFXA 3B04A 1E1CA 3ZJ8A 3M0KA 4CVUA 2O9PA 4ZO6A 1FWNA 6PTDA 4CN1A 4ECLA 1DIOA 1R47A 1XYMA 4F3HA 4OT7A 4Z1AA 4DELA 5FF4A 1RD5A 1BXBA 3NZRA 1A4LA 1WKEA 3KS6A 4V15A 4WJEA 2R1NA 1NTHA 1ZJAA 7ENLA 3OU8A 3SUTA 4NXSA 1CI1A 3T81A 4LQ1A 1FP9A 4LB3A 4W9TA 4PODA 1XJBA 1MMFA 3QVQA 1YRRA 4AZ7A 3U5YA 3JRKA 4DF0A 1NARA 1PZ1A 1UWIA 2INEA 2PPGA 1H2JA 5BMXA 1E4IA 3V4BA 4CEUC 4POCA 4OFCA 2WXDM 3GIPA 2PTWA 2YW4A 5E0FA 2P0OA 3BAYA 3I3DA 2PD5A 3ITTA 5I3IA 3NQMA 1O5XA 1ONWA 3FLUA 2WPGA 4W86A 1G4TA 1VBGA 1O7AA 3QW4B 3KWXA 5A6TC 2DH3A 3M41A 1HTIA 3TDFA 3OLEA 1G7UA 4PMUA 4XWUA 1J79A 4ACZA 3CZEA 5H8UA 2XGIA 1K7EA 2ALRA 1VFFA 1X97A 1EXPA 1B3ZA 1GVSA 5HJXA 2JIEA 2XVPA 2UY4A 3N12A 3S9YA 3AO0A 4O54A 1X38A 3WNKA 2BFGA 4BA0A 1W1B1 4QR6A 4AMCA 3N15A 3KVMA 3SN0A 1IGWA 1M7XA 1LQ2A 3QRHA 4G8TA 1Z89A 3VIOA 2HZGA 4C6NA 4NX0A 3FK4A 3DDMA 4M56A 4KCTA 5F4SA 4DWSA 3NZ1A 3F1QA 1F6KA 3KVJA 4I5RA 4DPPA 1MUCA 1K9FA 1TPH1 3A3WA 2P0IA 4NJHA 1JUEA 1B30A 5AYIA 3E2RA 3RU6A 3OVPA 3CGTA 4J3VA 4HIBA 3EWUA 2VFFA 3BMVA 3B0PA 1WOBA 3WLTA 4L6DA 1LBLA 1MUMA 1G94A 4BJHA 1G4EA 3FKRA 4GUJA 5F1VA 1EUNA 1GPWA 4PMNA 3TEVA 3U57A 3WY1A 4I90A 5LGXA 3GM8A 5CCZA 3ALFA 3DERA 1XLCA 4CUCA 1XS2A 3THCA 2ZX9A 1B9ZA 4NAEA 1R2RA 1IXNA 2PA6A 3ZOAA 1ISWA 4BQ5A 2Q6ZA 4B5VA 1WZMA 4WX2A 2QCCA 4RZ5A 2GDUA 4UTMA 4EXAA 1EHNA 3U48A 4NZJA 2EHHA 3A5FA 4MGGA 3IVUA 2BHYA 2C1HA 2W4XA 3VNLA 4H9XA 4Q8VA 4JQ2A 1TPEA 2GGJA 4IIDA 5A2AA 4BFAA 1WB0A 1TZZA 2GWNA 4O28A 2PURA 3LB0A 3QSRA 1CENA 3HMJG 3I3EA 4E6MA 2FGLA 3W81A 5GNYA 3NOYA 4IPLA 4MPKA 2NXGA 1BSLA 5HPCA 3RGTA 1H09A 1S2UA 5D38A 4C6IA 2FDSA 2D69A 3GDKA 3CEPA 2NXIA 4A3UA 4JYFA 2EPKX 3GVWA 1GQLA 4OWGA 4S3EA 2HS6A 1POKA 4JAWA 4I9AA 4K1WA 4UC5A 1XP3A 2DW6A 3ZR4A 3CAVA 3GXPA 4EAMA 3RIKA 4QE4A 4Q8UA 5DT5A 1U5JA 3CIXA 4MVAA 3H2OA 4LBRA 4I6VA 3EZ4A 3AYSA 1BYDA 3PUOA 3WSUA 3E0IA 2C71A 3T4CA 7CGTA 1EBGA 3R0KA 2OU4A 2FFIA 3CZGA 5F2GA 1N7KA 3UWQA 2J9XA 4JIEA 4WLCA 1JQVA 2E1WA 3LNMA 2NQLA 1BD0A 5D30A 2VDHA 3PJWA 1U83A 2DUAA 2XINA 4C6PA 4UFIA 3LMYA 5I09A 3TYBA 4XTDA 3RDKA 4I7VA 1GZJA 2GSHA 3S5SA 1TTPA 1YQ2A 4WGXA 1XR2A 2TSYA 4AB4A 1BRLB 3PC0A 5HBFA 3QY7A 4TUFA 3UYCA 4Y7EA 1Q63A 4KBXA 3P93A 4TMCA 1CGVA 4FF5A 3CYJA 1VCFA 3UWWA 3BV4A 1UPMB 3VOIA 2OQHA 1HQTA 2DT0A 3A4XA 5J5RA 3HOJA 5AKQA 5A8NA 3TLQA 3MQTA 2P3ZA 3B97A 1JUKA 6REQA 1OCJA 3S6OA 4ZR8A 3N6HA 3PZNA 1D8CA 3B3DA 2E5DA 4FMVA 4PEEA 3N25A 1M7JA 1PYFA 1XG4A 5IHSA 2DZBA 3UWYA 4DBEA 6A3HA 3S8HA 3WNOA 2PWVA 4UQBA 5BW6A 2IMRA 1EF2A 4J4KA 1QXLA 3F03K 1A50A 4K7VA 2WYSA 1QU4A 3AHVA 5PTDA 3M1ZA 1XIEA 1Q6GA 3EDDA 3VGDA 4AQLA 3LYEA 4ZENA 2QJMA 3G1FA 4ZSUA 3LHWA 4J3ZA 1Q85A 3MMTA 2IQDA 4OBSA 2Y7DA 3PZIA 3OJGA 1Q5MA 4WKHA 5A6LA 4GFSA 3GNOA 1AA1B 2C8NA 3AZTA 3F2CA 2J78A 2YIHA 1VF8A 2GGIA 4Z0JA 1IZJA 1T8XA 1ODUA 4CQ8A 2HEJA 3CBWA 4N9CA 5CLTA 3H4XA 4FNSA 4KT2A 2FTYA 4F0MA 3CUXA 1L6WA 1WUFA 4K38A 3P8JA 1EP3A 1ZBCA 4GIAA 3VA8A 4C6BA 4ZO7A 5E0CA 1SZRA 4GOAA 4D6HA 1V3MA 3UPMA 3FHAA 5M1TA 3W28A 5IBXA 3P82A 2P5NA 4W7VA 5EA9A 3ITGA 3QF0A 4K39A 4K3ZA 3N14A 2BVYA 4AW7A 3HG2A 3NUKA 2X1IA 2D2JA 5U7SA 1EJVC 4I6KA 3CS2A 4IMEA 2D2GA 4KRZA 2HVNA 2OODA 4GZJA 1VQTA 1CW2A 3WJXA 2O7SA 4IQEA 3GVRA 4M1BA 1KCXA 1G5AA 4WIWA 2FLIA 4Z1CA 4H3DA 2GOUA 4KRUA 2V67A 3TJXA 3TC7A 1SGJA 1EF3A 1HT6A 3WQ5A 1GTEA 4DXKA 5I03A 2OJPA 1Q6FA 4Q7IA 4QEEA 1H61A 2CZ5A 1TTIA 4FX8A 3T09A 2V2CA 5HINA 2VVNA 5D37A 2YXOA 3MC5A 2V69A 2HQAA 4KCWA 1XSKA 3F7JA 3EDKA 4R27A 1FXPA 4JGDA 4F66A 3WLOA 2EG8A 1B0IA 1EH9A 1CCWB 1RJRA 3OA3A 1CXIA 2QV4A 1UW9A 1ICQA 2FZBA 1F4AA 4Q8MA 2WNWA 2C1GA 4RE3A 2YBTA 2AQOA 4MFDA 2JALA 1ZHAA 4DHGA 1IEXA 4RDZA 2VM8A 4GE8A 4NZ3A 4TXEA 1S1RA 4HSNA 3WH5A 4LBSA 3ARSA 1RVKA 1J2WA 2O55A 1PWMA 4GXMA 3PY2A 3WEMA 2DZSA 3F5LA 2OT1A 1FRBA 4QNEA 3W1XA 4JHMA 2W91A 4O14A 2FVKA 2BHZA 3W76A 3DC8A 4L4OA 3I68A 2ZZ6A 3MTWA 4LRTA 2PSNA 4XAZA 2VX6A 1LTDA 1IEIA 1J2BA 4NL1A 2QCEA 4HZ8A 1GK8A 3QBUA 1YLVA 1IHIA 3B8TA 4FP1A 1E3XA 1FWAC 3KBMA 2PDHA 2PU0A 3NSNA 1KM5A 3UW6A 1RY0A 3SQLA 4UR8A 5A6SA 2B7OA 5BU6A 1AK5A 4LF2A 2TAAA 4P8WA 4D6FA 4R7JA 1DIKA 4JTDA 2IQ0A 1TV7A 3AU6A 4XAYA 1KBLA 4HOXA 4ZCWA 4RZBA 1TSIA 4PBFA 3ZZ1A 3GAKA 4JTIA 3BLOA 3PG9A 1WA3A 5AB3A 3PNUA 3BMXA 3MMDA 4L1GA 1QW7A 5CPNA 1IF2A 5BZAA 3SBFA 3AIVA 3LXBA 1IGSA 2Y70A 3N4EA 3USZA 1SO5A 3KOYA 3S9IA 2NUXA 4E8CA 3U6WA 3FKKA 2HDJA 2PBGA 1UQYA 2IXVA 2J79A 4ICCX 2I17A 3VGFA 1XLJA 2DSUA 3C0LA 4H01A 3ELFA 5G1TA 3ABSA 3TW7A 4LAUA 3SFWA 2C3ZA 2FHBA 2PDUA 5GVJA 3L4YA 1E71M 4X22A 1UPPA 4UTTA 1AH4A 1OZQA 1ZP4A 1PTDA 5CBIA 1DOSA 3VKAA 2XWDA 2AAAA 3CHEA 1FWIC 2DP3A 4AU0A 1WZKA 5T9CE 2WJDA 2VTFA 1LF1A 4HYRA 1F6PA 3GFXA 4L4MA 3BC9A 3KTSA 3W1NA 3Q2DA 4HNOA 1EP2A 1T40A 1E0WA 3UCQA 1TKKA 1I45A 3VILA 1WUEA 3BH4A 3MKCA 1A5LC 2Z4GA 4OZOA 4ZFCA 3HA1A 5A8QA 1C90A 5AYBA 4C6EA 3EAUA 4ZQCA 3B9DA 3S1UA 2EF9A 4Y9AA 3NM1A 2WV8A 1JDFA 5K9DA 2ISDA 1VFLA 1ZPTA 1NF7A 2A21A 1JDCA 2OVLA 3LPOA 3G0SA 2FH8A 3TH6A 4YXGA 5FJUA 4O19A 3M0JA 4V28A 5D04C 1RQHA 5H6HA 3W1QA 4L64A 3C3NA 3RF9A 2PTDA 2BNJA 2BGNE 5DCBA 1YDYA 4JNMA 1HZYA 5K9XA 3T9PA 3BG5A 3IANA 1O5QA 3SI9A 4F79A 3E9AA 3FSTA 1GOMA 2HBVA 4G2DA 4QE1A 2DJLA 2BGQA 1GOQA 2A6LA 5G2HA 3ABZA 2PGFA 4O17A 1LLZA 1H7OA 4BCEA 3GNRA 4O18A 1J9YA 3FXYA 4HMEA 1QK0A 1J0KA 4B2DA 2PCEA 1BGGA 4Q7BA 2D3LA 4F2BA 4B5TA 3EA3A 3W7IA 3GZ3A 4H2HA 1TTQA 3HB9A 1KXHA 1UR0A 1GCYA 4UQ9A 5JUVA 1CPUA 1F8MA 2JEQA 1UWSA 2PDPA 1RP8A 3GR7A 5I00A 1PTAA 4XX6A 4QX4A 3L4TA 1TUFA 5AVNA 1JDEA 4U2ZA 1V6YA 3LEPA 3WMCA 2VFEA 3S2JA 2PDCA 1ADSA 4LUSB 3WQEA 2Q71A 1XYBA 4REQB 2YBUA 3CQ0A 5LGZA 2FB3A 1ZBWA 1W1A1 1EZ2A 3BANA 1CB2A 2CHRA 2DZUA 4HZMA 4ICNA 1MI3A 1JCTA 4IFKA 1SR9A 2XM2A 3EWBX 3MBDA 3H2EA 3G22A 3N6QA 1J8VA 4AD2A 5G4EA 3N18A 2FFCA 1OK6A 4A2RA 3UZXA 1OSEA 3AS3A 3A4WA 3V1HA 2DUXA 3MUIA 1AW2A 3LRMA 1GZGA 3LLDA 3SUSA 4MY1A 3WD2A 4O53A 2WSYA 1M9HA 3EDFA 2G37A 1UP0A 2PTYA 2J8TA 1VBUA 3LBMA 1I2PA 1TE1A 4IXHA 3W27A 4O1AA 5IBXC 4O10A 2XN2A 4UMAA 1G7VA 3H2MA 3OVRA 1JCLA 4RDVA 4MB4A 4DBWA 1UIOA 2C7FA 3OTRA 2ZDSA 1LWHA 3ARXA 3UETA 2HMCA 5M03A 1EJTC 3S5OA 1E73M 4GVIA 3VKDA 5A6AA 3S3GA 1JULA 3POHA 1SFJA 3TYUA 4DYJA 5C0QA 1F4HA 4E4FA 1JD9A 1WAWA 1QW9A 1NWUA 2VEGA 1UP2A 4GH3A 2ZXQA 3SGUA 2D3NA 3P0WA 1UWUA 3PBMA 1TPWA 2B7QA 2DORA 4K7YA 4QEHA 1V7YA 4XBSA 1KNWA 2O0TA 4W8AA 3N1AA 4D8ZA 3FSUA 1XGEA 3SAZA 3H22A 3SY8A 2O92A 1XCXA 1CGYA 1BEUA 2Q3OA 3SURA 4C60A 4XZWA 5BYWA 1RD6A 3XIMA 4GQQA 4DNHA 4RJEA 1YPXA 1J01A 4QIUA 3S6TA 3ES7A 2H8XA 4MB5A 1K7FA 3UQNA 3OW1A 2DSKA 4IXXA 4ZFMA 1VPXA 3KVLA 1JCNA 4IMFA 2I14A 3UNTA 1XDMA 3TAOA 3LTSA 3NJ3A 3MCNA 5T26A 5CXPA 3VNYA 2VWTA 1VFUA 4B5XA 2CEQA 4Y9OA 5I24A 3NZGA 1SMAA 1A3HA 2D2OA 3RR1A 2FGZA 2UY2A 3LI0A 2VP8A 1TA3B 5H1WA 4D6DA 3PAJA 2INZA 2H9AB 4IIFA 1XKJA 2VC5A 4PZVA 5EMMA 1NWRA 3HPXA 3QY8A 4HYWA 4DI8A 4Q6JA 2WJEA 4HMCA 4AF0B 4MNJA 3SJ3A 2PF0A 4IIBA 1HJUA 3INPA 3OIHA 2PC4A 4WR3A 2IPGA 4AD0A 2OX1A 4L1WA 4AVFA 2YL9A 4J3UA 4WY0A 4JHZA 3A5VA 1PKNA 4RXGA 4ML4A 1VR6A 3F4DA 3H55A 2V5CA 3DFPA 3ZQ9A 3ZR5A 1W9UA 4D9PA 3CO8A 3CV6A 3ZIZA 5CJ5A 3B8SA 1WZAA 5FSDC 1DHPA 4UCFA 4F9JA 4M7TA 5EMLA 3ZLHA 3GFYA 2PGEA 2F6XA 3LZ3A 1XCFA 1NSJA 2GVGA 3EMQA 4KW2A 3TSDA 4C6QA 5LA1A 3VIPA 4U31A 4LV9A 3TN5A 4FXRA 4Q8TA 4IIHA 3WEOA 2GVJA 2WMHA 4EX4A 4GLEA 5D8WA 3U8GA 3MJMA 4LRSA 2G95A 3ZWTA 1U30A 4IUGA 3GIYA 3EXTA 2D0HA 1CLVA 2I7GA 1VYPX 1FWSA 4ATWA 3W1RA 1DKWA 1XUUA 3H24A 1P1XA 3W2UA 4YIWA 1KRBC 5I0DA 2BXZA 1A5NC 4PSRA 4KCUA 4IT1A 4S3GA 4FX6M 3NL6A 4ZTYA 1UD2A 4J35A 1U22A 2WO5A 2ZVIA 3OEXA 1W1IE 3ZSTA 3GNXA 3QFEA 1UHVA 1V0LA 2H90A 2YJQA 1W54A 4ZOBA 1XIBA 2ACRA 3TK7A 3IV8A 4KEMA 4O50A 3P5YA 3WK1A 6XIMA 2JKAA 2C0HA 2NQ9A 1VIZA 1TX0A 4PTVA 2EJ1A 4WDWA 5D09A 1RUSA 4MWAA 3M46A 4LVGA 2WNQA 3LD5A 4O8RA 2GVLA 3SEPA 1O1ZA 1G01A 2PD9A 3BXWA 4HYVA 2A4AA 1PKMA 2PP0A 2H8ZA 3IIOA 1TYGA 1GVRA 2Z2AA 2NVCA 4GBUA 2V2HA 4J2PA 3B05A 3RLHA 2J62A 3ISIX 3ZT7A 4QXIA 5JIWA 2X2GA 1UD3A 2PDJA 1ONEA 1KBKA 3EX2A 3PZTA 5EGRA 2RJHA 3KBSA 5E5CA 4JOMA 4JXCA 2HV5A 1DWFM 3GG8A 1F3XA 5ECUA 3EPOA 4RCXA 2HXUA 1EPXA 3AJ7A 3PK7A 3WLIA 3P2VA 4AD5A 3VC6A 5A5WA 1QPNA 1IV8A 5TAOA 3WUGA 3RX4A 1DIDA 1MXSA 1ZJHA 3CYVA 2JGYA 4C65A 2G0WA 3JVAA 8CGTA 2ICSA 1HGWA 3HQNA 4H00A 5M5DA 2X0HA 3N11A 3LBOA 1UC4A 4FI4A 4C6JA 4LXFA 2WC4A 1NFPA 4KS0A 1EOKA 4PR4A 3W7PA 4K2SA 1WV2A 4L61A 4YPJA 2R6OA 1XC6A 1VRXA 5EMYA 1A49A 3BLPX 4GY7A 2ODOA 3VCNA 4N0RA 3R8HA 5CAKA 3M44A 2ZICA 5AZ1A 1IR1A 4DUXA 3S1XA 3KLKA 3PJTA 2P50A 1QAPA 4DX3A 3Q58A 1F74A 3I4KA 3ZT6A 2OG9A 3TYAA 3BW2A 3DIPA 4A8RA 1MW0A 3WQ8A 2RGLA 4FALA 4MDOA 4IQLA 2ZXDA 3C2EA 4DQWA 1HVQA 1PUDA 1L8PA 3UYIA 2FPYA 1YDOA 3WN6A 1W32A 3O8AA 3FA5A 3UU0A 1KR0A 3OODA 3FJNA 1X8FA 4ML9A 5E93A 3GC5A 3IJIA 3S2NA 3W84A 4RZ6A 3W1AA 1J18A 4NJKA 3O07A 4IWWA 1V6TA 3UJ2A 5CZJA 4JN8A 2I1OA 3MP4A 3GQYA 1B31A 5D2WA 5J8LA 3OQEA 4MM1A 2EQDA 3E49A 3ITYA 2QYGA 1KFCA 3IJLA 3CH0A 2WPBA 3IARA 2HE5A 3KRUA 1QT1A 3VNDA 1H51A 1NDWA 3B8WA 5DMYA 3ECQA 2OLSA 1EJXC 4QLLA 3KS5A 1P0KA 4XISA 1OZMA 1AQ0A 3MVTA 2PWUA 1EDTA 2I5GA 2FPTA 4D6GA 2FZ8A 1KV5A 3N2XA 1P0NA 2YCLB 3TR9A 5CH9A 3VE7A 3A9BA 3IS4A 1KCKA 3BJFA 3J7HA 4DJDC 4LWWA 4PULA 1RCOB 1V93A 5HNNA 3L4ZA 4GKLA 5KZ6A 1KQZA 3UPWA 1H49A 3W7LA 3BMWA 3GZAA 3O63A 4Q4SA 5DLCA 1SJDA 4PRTA 5C5YA 1GG1A 5AHLA 2O4MA 4LPCA 1S1PA 1LP6A 1JXKA 4L4PA 4LB4A 4AWEA 4IIEA 4R34A 3DG3A 1ZS2A 5A6BA 1X8CA 3S1VA 4HCDA 3JR2A 4JKLA 1GGOA 3L21A 3M07A 1R85A 3NA8A 4XBKA 4K36A 2CLPA 3THQA 1CXLA 4OECA 1W9VA 1TV3A 3DFOA 4QG9A 4AD3A 2DEPA 4QLKA 2G97A 5JH1A 1C8XA 1L6YA 2BWGA 4Q4OA 2VZOA 3ARRA 2CZVA 4CU8A 1E56A 1OX6A 3QLLA 3IWPA 3WLKX 1EGZA 1PDZA 3MV01 2Y63A 4JTUA 1QK2A 5CSSA 1C91A 4JTCA 1SSDA 2WQPA 4KMQA 3JUGA 3VOCA 5AYXA 3W7OA 2G50A 5HOSA 1EJRC 4CD5A 4C1NA 4TQTA 1KTNA 4YTRA 1TPDA 1RVGA 1PZ2A 1QOXA 3DKJA 3M0LA 2WSKA 4NRSA 4A8NA 4AHPA 3ZFHA 4Z2KA 4HOWA 3I6EA 5EBUA 4NNAA 1PL9A 3KL0A 2AL2B 4OKDA 4IFOA 1JF5A 1R9YA 1OG0A 1OVDA 1E55A 2XTKA 3NPUA 4XTIA 3NEVA 4NXKA 3IK2A 4RUBA 3R89A 1Z6KA 1SZEA 5BOEA 3QTPA 4GIEA 1F3WA 3EX6A 4GNKB 3WBEA 4HZ6A 4LY8A 2I16A 1Q6RA 2ZRXA 1DIEA 4EVZA 3BG3A 4Y8EA 4W5UA 5JQ9A 4P7RA 3NO1A 2CCRA 4GJIA 1K1DA 1EO7A 1R3WA 1W1TA 3SGGA 3QQ0A 2A3HA 3N34A 4J3WA 1PTGA 5LXXA 1OBAA 1PPIA 5TNVA 4WRHA 4H04A 4DZAA 5CC6A 4EXQA 4HNNA 3UXAA 4D1JA 5DO8A 5I07A 1X6UA 3GU1A 1P4CA 1OC6A 2AGKA 1YKWA 4TX9A 4HA4A 4W8LA 3L5LA 4KWVA 3B8VA 1HNYA 8XIMA 3LXAA 3ZVHB 4JFTA 3G6MA 3K4AA 5KETA 4JIIX 3OIXA 3MI2A 1JNDA 1S46A 3APGA 1C7SA 1LL7A 3UGVA 3UXIA 3ZJ7A 3BAXA 2HNEA 2O9TA 2IQTA 4LEQA 3PZ9A 2ZRYA 1XLDA 1O5KA 3WLRA 4TVUA 1LZOA 1ZNNA 4MUPA 4ORIA 1JD7A 4IX0A 1GVYA 1OFEA 1O68A 2J25A 2V3FA 3LMZA 4GQGA 3MP5A 1SR0A 4U33A 3RUBL 3N9KA 1Q6QA 1MDRA 1LLWA 1KXQA 1W1PA 4QCFA 2E28A 4B16A 5BWFA 1M1BA 1FH8A 1HO1A 2OXNA 1JI1A 1RH9A 2VZTA 3G8RA 3GXMA 3LPPA 3TYEA 2KX9A 1ICSA 2CLKA 3CNYA 3K8KA 3IACA 3WQVA 3I7RA 1QOPA 4R9XA 4U3CA 3B9NA 3GVGA 4LT9A 1KD0A 2Y5SA 1AZ2A 4PSPA 3K4DA 2JFEX 3TXVA 3FV9A 1ELSA 4EWND 2WJZA 5LZLA 1UQZA 5D4YA 3URBA 1XHGA 1F07A 3WCZA 4AC1X 3ZYZA 5K4XA 4W89A 4GUHA 2WJFA 4QSHA 3P6LA 2ALDA 3PUEA 4M51A 3VMPA 4AD4A 4NZ4A 2WVUA 4X9YA 4ACZB 3TYCA 2ZE0A 3W37A 3D0CA 3A3HA 1FH7A 5B7ZA 3VFCA 4ZQPA 3S2MA 4ADUA 1KCZA 4TV5A 1AW5A 4NZ5A 2F7FA 1WPCA 3NDYA 3TMLA 3TW6A 2QVHA 2WLYA 1FHLA 5DBTA 2QPUA 3THAA 4AD1A 3BOFA 3T6CA 2PP1A 4ROQA 1PZ3A 3AMKA 5T9BG 3I65A 5EYWA 3K8LA 4AX7A 3EWZA 4UMCA 4DLMA 1FA2A 2V38A 1W91A 4ZA0A 4P8XA 1HJVA 2HRWA 2DT2A 3VDGA 1CGXA 4LEFA 3BZJA 2CZDA 1ITXA 2W61A 1KFKA 4MFEA 4DO5A 2OEMA 5C2GA 3RRAA 1VBJA 1R6WA 3WIJA 4PCFA 1GQNA 3FYYA 2V68A 1VKFA 2CPUA 3BLKA 3ME3A 1E6SM 2WCSA 1QVBA 2WSPA 3RJYA 4QP0A 4GGHA 3CL7A 2G4JA 2OYLA 3UF9A 2RGMA 5U4NA 1ZQ5A 4XZ9A 4B9ZA 1Z69A 1IZCA 1W8GA 1Y7VA 1PWLA 5G4WA 3W7MA 3GD6A 2DZXA 4QS5A 2CLHA 2A3LA 2D23A 1OF6A 2G41A 1O12A 4LNYA 3LGGA 1NH6A 4LYKA 4DF2A 2VD8A 4E2DA 2J24A 1JIBA 1V3IA 1Y5WA 1FWTA 5D2VA 3OA5A 3DX5A 1A53A 3QTGA 1TZ9A 5IHRA 2H3BA 2DIKA 4GUIA 3ANYA 3CMFA 3WBWA 2HE8A 4DN1A 8RUCA 3CL8A 2CKSA 4ZSTA 5G5IA 3VE9A 1L6SA 4GY0A 4XKMA 4M29A 2TODA 4J27A 1NP0A 2GGGA 1XRVA 1YNYA 1BF2A 1LORA 1E6XM 1GHRA 4AXNA 1XM3A 4C7FA 1PIFA 5CGQA 3H12A 1HL9A 5XIMA 3RX3A 1BAGA 2NX3A 2Z1WA 3JW7A 3G0UA 1LOSA 3CUGA 2YL5A 3L2LA 3WL0A 3LENA 2GOKA 1K77A 4GBDA 3LTYA 1M6JA 3CUIA 3ARZA 2A3AA 3ARUA 3BL3A 1X6LA 3OBKA 3S2CA 5HWMA 1QNVA 1K02A 1IR2A 3DHPA 3GB6A 2BLEA 3DI1A 4C90A 3GUGA 2V5JA 1OX4B 3H7VA 3A9IA 3IUHA 1OABA 1E4LA 4JIQA 2G96A 3NCOA 3BOXA 3VNMA 3W3OA 2QCNA 3S47A 3WQPA 3IAQA 1CECA 1TPUA 5FEXA 4G56A 2REQA 1EYEA 2F38A 3MU7A 3EA2A 3R8RA 1PDYA 4KEUA 2QF8A 3G1DA 4AY1A 2WKJA 5TQLA 2J7BA 1BLIA 3WJYA 1EA9C 4NHVA 1ADOA 5HUPA 3R5EA 3S0CA 3EOSA 4UFHA 1R2TA 2YB4A 2ABAA 2EKCA 1DJYA 2X7WA 5A8OA 5AC4A 2ON3A 4KETA 2YX0A 1EL3A 1V51A 3W0KA 3VNIA 5AY7A 5HNRA 2VEKA 4FB7A 1VB9A 3G6LA 4UOJA 5HDRA 2DVTA 2ZC8A 1JVNA 1QASA 4ENLA 1YBQA 4O4WA 1EC9A 4DXVA 5CC3A 2OQLA 2NLYA 3DHFA 2YXGA 3RO6A 1JQXA 3TOYA 3GXFA 5DQPA 1YE4A 2OZTA 3VIHA 1KFLA 2PWFA 3MCOA 4UTJA 1WDWA 4XD6A 4DWSB 4HMDA 2EGZA 5FEPA 1LT8A 3OZPA 1DXFA 4FHAA 1PSCA 3HPZA 4ZE4A 5LA0A 1TWSA 2QMJA 1TWDA 2Y5EA 3CV7A 3MZ2A 1OGGA 3AS0A 3ITOA 4FR6A 2OZ8A 3D3AA 4DWSD 1V0NA 1UD8A 4XKYA 2V3GA 2XGZA 5D2XA 4AISA 1HX0A 2NWSA 1HKJA 3NPVA 3NFUA 3T0TA 3LCLA 4GXWA 3F5JA 4X9SA 2DZPA 1ZSXA 1OFPA 1AODA 5L9FA 4MADA 2QKFA 2A7NA 1GJWA 4OGZA 3LS9A 3SR7A 2VJXA 3TSMA 2ZUWA 5HQMA 2QDGA 1TWZA 4J3SA 2PZNA 3SIMA 1VBHA 3VZXA 4JZ5A 1QO2A 4NILA 4RE2A 5L6UA 4FXJA 2OWCA 5FF3A 3R8GA 2CESA 1XLIA 2NV2A 3GWQA 3WDQA 2CLOA 3FFSA 1AUSL 4C1LA 2E1DA 4MNMA 1PB0A 4QBXA 2BY0A 1S2TA 3DFSA 2PGWA 5KSWA 1CNVA 1DVJA 1H1ZA 1TJPA 1TJ0A 1EIXA 5A69A 2W27A 4GI4A 3WUEA 1DJWA 3OHIA 2A6NA 3FJ6A 2E8ZA 1R3SA 1DE6A 3GU2A 1YPFA 4PUEA 1JJKA 3RMEA 2XVKA 1OK4A 4JNZA 5F4XA 3UEQA 3M47A 3UXDA 3W6LA 4DJDD 1Q7MA 4Q8WA 1VRDA 1KBBA 2OCZA 2JF7A 1T0OA 3EDJA 1W3TA 4XO7A 3TU9A 1A3XA 3R4IA 1EX1A 3FIGA 1KFJA 4HK5A 1JCJA 3AMDA 2QAFA 3EMZA 5K3VA 1IXOA 4OIFA 4R53A 4FR1A 3TTOA 3VOHA 4HTYA 4F2TA 3TR2A 1CYGA 4RZ4A 2Q3RA 1TUXA 2DQWA 3BSMA 2XVNA 3CAQA 5CPTA 3RCYA 4E38A 4U4MA 4X0NA 3QR1A 3M5VA 1V77A 3O16A 3PSVA 1MFVA 4CGTA 3W02A 3AIBA 3VAVA 3AXMA 4F4RA 2GUBA 1FWFC 1LJYA 1WKFA 3I6TA 4AIEA 2POTA 3ZVHA 2L5HA 2YFOA 1D7FA 2W92A 2ZZ4A 3T42A 2DZWA 5LIWX 1Q2RA 2VL4A 3M4HA 1R7OA 3MHUA 3BWWA 2BVTA 4PUUA 1A5BA 4C5ZA 3WBYA 1WXYA 6TIMA 2RJGA 2CLLA 9RUBA 1H7WA 4EF8A 5A95A 1IEQA 5IDIA 3CHDA 5CBBA 1FWEC 4S1FA 2HXTA 2SFPA 4OU1A 2E5CA 3DG7A 1EEXA 3EWWA 1DP0A 1ZAJA 4W8BA 7TAAA 3N2BA 1RPKA 3HPSA 3PZVA 2FJUB 3BCDA 2BY2A 5D33A 4FNUA 3CL6A 2IKIA 4PTNA 3APYA 4LAOA 3BGGA 4F8XA 1I2QA 3SCNA 3NVTA 4C6KA 5D05A 3NG3A 1OFOA 3W7CA 2CLIA 2VZSA 1VBRA 1GKRA 4QAIA 3FAWA 1V3JA 4PRWA 3IGSA 4IMDA 1A5KC 2GVYA 2OEJA 2GJPA 1Q4WA 1PX4A 4BKNA 1QBBA 4M82A 3URQA 4J1OA 3TP4A 3JZEA 1GEHA 3VGBA 2R1LA 2BOGX 1W5PA 5CPQA 2YKKA 3CK5A 3VM7A 4LFYA 1D3HA 2IKGA 1Q8JA 3E38A 3L12A 3RITA 4E2OA 2ZX5A 1UD6A 1I4NA 3EEZA 3N73A 4PTWA 4MOZA 4CCZA 4JTFA 2J7CA 2OGYA 1K7XA 4PH6A 3MYPA 2HROA 4FZIA 4HPHA 2OSWA 1VC4A 1ZALA 4A05A 2E6DA 3M0YA 1XLFA 1ZLPA 1G9HA 5H8MA 2P3EA 4QCEA 1RK5A 4IGMA 3U2OA 1JYXA 3TYZA 4UQCA 4W87A 1M01A 1CGTA 1FFQA 1W2VA 5F2LA 1FWCC 3TN6A 1UR8A 5EMKA 1MVYA 4DYKA 2XIBA 4LS2A 4LVBA 4PMDA 2ZZ1A 3PZQA 2ZQ0A 3W71A 1AMKA 1P0EA 3UJSA 2DFAA 3M0MA 2ZXAA 4DUVA 3OP2A 2V0TA 1LLOA 4GHRA 2WNNA 3WJZA 1W37A 3W7GA 4AYGA 3V36A 2QCGA 3L4XA 5C9ZA 1I2RA 2X2YA 5B80A 1H11A 3EWDA 2Z1KA 4GZEA 4G5DA 3UY7A 3SY5A 1ECEA 2XN0A 2XGBA 2A85A 3GH5A 4YMZA 1OFBA 4Q4PA 1W5OA 3LV5A 4F2UA 1V6WA 4NI8A 1AH3A 3NQDA 3PANA 4JTHA 1AQFA 3NWRA 4C6OA 4CD6A 1C9WA 1D9EA 3JS3A 4LAMA 2ZRUA 4GNVA 5HR7A 2V63A 3LCIA 3WLNA 4YTQA 3A13A 1XDLA 4LANA 1UR4A 1ML1A 4QE5A 4NI3A 5LNWA 1NWSA 2QS8A 4FIQA 2Y7EA 1HKKA 3LOTA 1DWHM 4P8VA 4WDXA 3VABA 4PMJA 4IP5A 1LM1A 4I5UA 3BQ5A 3MW7A 1UIPA 4HA1A 3MYOA 3CUZA 3A23A 1FHVA 3TJIA 1RLCL 3HQOA 3G77A 4ZVJA 3MB9A 1XLLA 4IICA 1R87A 4U10A 4R88A 3BICA 4CD4A 4MY8A 1CB7B 1TVNA 4F40A 1OIMA 2C79A 1UWQA 1XV8A 4A3QA 2PDGA 1LYXA 1JZ7A 4A35A 2QIIA 1PS9A 2DZAA 3UERA 4C1NB 4F0RA 2J8FA 3DFNA 3RXZA 4PUKA 2ZOXA 1YNPA 2OO0A 1FXQA 4FA3A 2AL2A 1F7BA 5AHEA 2HK1A 2W66A 1E1CB 2EKGA 1QNPA 3HF3A 3VOGA 1RQBA 3SO7A 4WXYA 4X60A 3TQKA 4CNPA 1GORA 1UC5A 4S3DA 3REQA 4GKTA 5J04A 4LAKA 2Y88A 5CPSA 2XSBA 3HTWA 2YA0A 1BQGA 4H19A 1YMYA 4MB3A 5FF7A 4HA0A 3I4EA 2J9YA 3HV8A 1GVIA 2G3NA 4PB3A 3B9OA 2ONEA 1IXQA 3U4FA 2BHUA 3GUWA 5LIYX 4LVDA 1AL8A 5FA5A 4Z1YA 1XFCA 3NAVA 3ARPA 1JZ4A 4FXSA 3AHTA 4J3TA 2XU2A 3FNDA 2V9DA 1BQCA 4XUGA 1BXCA 1XYZA 1WP6A 4MPQA 1DORA 1I8JA 5AOUA 2ZTKA 2C18A 2BXVA 4QJ1A 2KAUC 3M7SA 2H9AA 4IL2A 3HO8A 1EQPA 2IS7A 4ZB0A 2ABBA 3PTDA 1THFD 4Y9MA 1HKVA 3MZNA 3T0AA 3VD4A 1B3XA 3EWYA 4KKXA 4PA8A 4I9JA 2YL6A 2J7EA 2F2HA 4LYPA 1SZGA 3QOMA 1GW1A 3W1TA 3R43A 1G6CA 2ZA3A 3QXBA 3NGJA 3CTLA 1TJ2A 3EOEA 3PPHA 3VD3A 3O9NA 4WGHA 1FWDC 5IFTA 2EPMX 1Q6OA 1FH9A 4ATLA 1MFUA 2BY1A 1BRLA 1RAKA 2DW7A 4B9YA 4Q33A 4RLIA 2OLAA 2E9LA 4ERIA 5FJJA 2R94A 4CN4A 1H5VA 3D5HA 1TZ7A 3UP8A 1V5XA 3H54A 2D2HA 3GK0A 4O11A 1XL9A 3DG6A 1VEPA 1CXHA 5FAJA 4NZ1A 4W7UA 4B91A 5FF0A 4BY3A 3PZUA 4EANA 3WLSA 5ABHA 3U3HA 3OGVA 3K13A 1JPIA 1XH1A 1H7PA 3PBYA 3GW0A 3UCDA 1LBMA 2D24A 4DI9A 4DNMA 3T0CA 4AIUA 1JGIA 4DIAA 1UA3A 4FF7A 4GQ0A 2DT1A 1PVNA 5HXMA 3PFMA 1HIZA 2ZUVA 3NQ7A 1LG1A 1FHDA 4XSLA 4D8AA 3MVIA 3SCQA 5C9XA 3MHGA 5FL0A 3GVVA 3BCFA 3SGZA 1PKYA 1ZU8A 2WNZA 1BTCA 1HG3A 2CBVA 3N04A 3NQGA 3MUZ1 4FOUA 1QPRA 3V5OA 3WDHA 1S3HA 3REQB 3IIPA 4GX9A 3EMCA 3GTFA 1NOFA 1V79A 4M81A 4DJED 1VYRA 4WSKA 3EOLA 4MTVA 1LROA 2DV0A 2PP3A 2CBJA 4D2JA 2W9MA 4K37A 5AHFA 1KO0A 2IPWA 3EPNA 4MJZA 4PCSA 1LOLA 4YNGA 3R12A 3U7BA 2BBFA 4GZ7A 6ENLA 4YCPA 2WANA 3AXHA 3AZSA 5D2YA 1WCGA 3DFTA 2QUMA 3W4RA 2NQJA 1LUCA 4AEEA 1S5NA 3LERA 4YCOA 3W7RA 3UXKA 3ZMRA 3U0HA 1MZHA 2ISVA 4H6EA 3RR4A 2Y8VA 2YYTA 5C54A 5D2TA 1MW1A 4M6UA 4JN6A 3EYPA 4HJWA 4CQAA 4US5A 1EIBA 3C61A 4O1BA 1M53A 2C1IA 3VO0A 3ANUA 3GDBA 4LX4A 1BYCA 4B5WA 2EAWA 2WQDA 4K8HA 1S2AA 1GQKA 1V3HA 5JH2A 4O57A 3AHZA 3C8FA 5HMFA 3A12A 1XC4A 4NZFA 2YR1A 2F2KA 1XLKA 1JPMA 4G7EA 4R7WA 4X3ZA 3M64A 3W83A 4WDTA 5LNVA 4GGBA 4H6RA 1V7AA 3NO3A 1PE1A 1DJHA 3CV2A 1JR1A 3HFYA 1TV8A 1B54A 3ATZA 3OGSA 4FNPA 3GXNA 2WBKA 5IDZA 1KQYA 3IUIA 3RO8A 1ENUA 1MEIA 3C2FA 3WQWA 3WMSA 3LRKA 3AI0A 4J5NA 5FCZA 1Y5VA 4WY0B 2FVLA 3QMSA 5C7HA 3R7MA 1WXJA 3H2NA 4KGLA 1RV8A 4IQJA 2ZA1A 4PMRA 2PGRA 1WDRA 4QDPA 2DZVA 1I2NA 2WM1A 2RKXA 4YS1A 3GDMA 3LLFA 3CAWA 4WSHA 2WAGA 4KQNA 3QHMA 4LUTB 4HHMA 1UASA 2PF8A 3H8AA 3PBGA 1OFQA 2DUZA 3ATYA 1TMLA 1FVPA 4YVVA 5HWJA 3V1PA 1U1UA 3FS2A 3QMRA 2WC7A 3MJYA 4OOUA 3N17A 1HKWA 2Y61A 2EBNA 5K4ZA 1EGVA 4JEJA 2V81A 1A0EA 2QCDA 1ZBKA 1F3TA 3SQMA 3G8EA 3HMCA 3O6YX 5AZ0A 4J3XA 4RX0A 1T7LA 1K3UA 1LDCA 4WDUA 5LYRA 4IFRA 4LYRA 3WELA 4O1EA 3SIZA 4ORMA 1R9ZA 3BARA 1TMQA 4GJ1A 5IM51 3EOOA 4EPKA 2V5KA 3CM4A 1MEWA 4N6EA 5GJMA 4H9TA 3FVDA 4NZCA 3A47A 2EJAA 3VVGA 3ABOA 3ORWA 4GINA 1SW7A 3GU9A 2H3DA 4LY4A 4Z17A 3KE0A 5K7JA 3D3FA 1O94A 3U9IA 4GFIA 3RPTA 3SRKA 3RNDA 2PWDA 3FJLA 3UNDA 1QWGA 2VR2A 1NP2A 4GX8A 4GVFA 3WBXA 2QJGA 4QLJA 3C3UA 3GXDA 1V6VA 3O0KA 4JTRA 1XYLA 3M0IA 1JYWA 4DUOA 3UR5A 5M2FX 4IOTA 4D6IA 4DWSC 3NYDA 4G7EB 5AFDA 3DYMA 3V0UA 1WZLA 5DY3A 1MSSA 1UUQA 2FPVA 1V6XA 2E4TA 1J6OA 4NAFA 4JKKA 1ZJBA 7XIMA 3QYSA 4AEFA 4PUDA 1BTMA 4DM2A 3H2AA 5JU6A 2A79A 4C7DA 4RKAA 3QM3A 3PVFA 3AS1A 4Q4QA 3K2GA 2B31A 4ZODA 3SW6A 1GOWA 3KOZA 5HK4A 3VTRA 2Z7KA 3DBPA 2XHYA 4NUWA 1YX1A 3I6RA 1UOZA 3W2LA 5DMLA 1XF0A 1SVDA 4AFYA 2VRKA 1UUOA 2HWGA 3KRBA 3WLMA 3LV6A 3GO2A 3WFAA 4NNBA 3CQIA 2PUZA 3SRHA 3QPZA 4WOQA 1EJSC 2V2DA 4CLMA 5LNUA 5AYYA 2TPSA 1E70M 1HO4A 3NQAA 4LU0A 3AWNA 2R1KA 3VINA 1ZAIA 5LHEA 9CGTA 4HNUA 3JU2A 2W0UA 2FZ9A 4H8UA 1V08A 1JG9A 2VQUA 2Q01A 4Q4MA 1C29A 3C5QA 2WZTA 2PDMA 5CZKA 4JTTA 4YJ5A 4EPBC 2VELA 4UTWC 1LWJA 1V8EA 4M80A 3L65A 1A80A 4TVCA 3H70A 4ZZ9A 2WHJA 1ITCA 4A3HA 1YBQB 2NLIA 3SB0A 2BOEX 3THDA 3QR3A 1Z48A 3E6EA 1A4MA 2VUNA 1WAUA 1UR2A 3AJXA 3E0VA 5JBDA 2FHFA 2DDXA 3N4AA 2GYIA 1KRMA 4MYAA 5MKGB 1EP1A 4YL2A 4XG1A 4X2PA 4HU4A 1GYMA 3UWVA 1EWEA 4PMZA 3HGSA 3RU8X 3LM3A 3G1HA 1SU5A 4QG8A 4MZ1A 2BY3A 3KOXA 3MP3A 3ES8A 1F8IA 4AZIA 3RN6A 1QNRA 5AC7A 3G3MA 3MUAA 1NOWA 2VURA 1KM0A 2GUYA 2VOTA 4Q4KA 2O9OA 3H4GA 1VCVA 4WHBA 5C55A 1UWAA 2ZTJA 5EL1A 5GPRA 4PGLA 1EQCA 2Y8UA 3CPGA 4C5YA 2X30A 3VGEA 3P7YA 3QR0A 3NXFA 2CU0A 4M1RA 4GC3A 2OSXA 3C2RA 4RK8A 4REQA 3GW3A 1DEDA 3CHVA 2IPJA 4LGXA 1E5NA 5A2BA 2P10A 1SO4A 3WDPP 4AC7C 3WYZA 5AC5A 1REQB 2QXWA 1VLWA 4O1DA 4LTSA 3POCA 4UWMA 2XH0A 3L0GA 3GHRA 4YYFA 1EOMA 2NQHA 3E1F1 1R3RA 3EPMA 3HJZA 1ODZA 4M7SA 2VFGA 4QNWA 3PTQA 2YOCA 1ZBVA 3PB0A 6ALDA 1W9DM 1UKTA 5KTLA 4XZLX 1YE6A 5I79A 4M6VA 4XZHA 3W7EA 1MO0A 2VEIA 3EWCA 2I57A 2GUUA 1YEYA 2D22A 1W3JA 3KZSA 4XB3A 1JZ6A 3B8UA 1N82A 4Q4RA 3OPSA 1R0MA 1EXBA 1MNZA 2DSZA 4IUOA 3PPFA 4KFPA 4GI6A 1SZFA 6TAAA 3IVSA 2QT3A 5FD0A 3I10A 4F0KA 2XYLA 3TN4A 1X7FA 4MUZA 1KA9F 4AYSA 3ARYA 3DH7A 1TR1A 1IWPA 1US0A 4ERAA 4NJIA 4IL0A 2WWDA 3HGRA 3W87A 5BXTA 3H53A 3SCSA 1WBHA 1UB3A 3OVQA 1C8VA 1H0GA 4WK9A 1R3TA 3FYOA 5DCEA 4H9VA 5EFFA 3S42A 3E0WA 1SZNA 1HP4A 3L66A 2CNCA 5C2CA 4JKMA 2QV5A 1W56A 1S5MA 4O0KA 3SN1A 3NGFA 1XH0A 1WDSA 2VFIA 3VM5A 1OGSA 3WD1A 3BPWA 4JQ4A 3QPEA 3C4UA 3O3RA 1OYAA 4JTSA 3VD9A 2OELA 4EPEC 4KESA 4ZQRA 1IYXA 1PV8A 1F6YA 4YWSA 2OYMA 5ECVA 1C92A 1E0XA 4O4VA 3GG0A 4ICMA 4B5UA 3STCA 5SWUA 5BXRA 1YW1A 2QW5A 2BASA 3V0TA 1O66A 5GJNA 1MZRA 1H1NA 3GX9A 5MKGA 3KCLA 1EB3A 4RE4A 4I8DA 3TTYA 3LI1A 3UZYA 3FA4A 3BK0A 1IT7A 1VHCA 1J0HA 4RNIA 2P8BA 2DPEA 5XIAA 4JEQA 1KM6A 4TO8A 1TELA 2VX5A 4AIOA 1DTNA 4BS0A 3KM8A 1W5QA 1FCVA 4B3ZA 4D8LA 1W1ZA 3TSBA 1QRQA 2CXGA 2OGJA 1GTHA 4N6FA 1KKRA 2IPFA 4OBRA 2VFHA 2WM0A 3SSJA 1H60A 4LC8A 3BLIA 4GCXA 3DC0A 4O13A 5JBFA 4RNFA 2FTWA 3S5YA 3DOPA 1DJGA 3UGRA 1SFSA 1W31A 1JUBA 4DYEA 1OCBA 2FMOA 2OWWA 4TOQA 2CITA 2Q02A 1V0MA 2QDDA 3DFHA 3OQ8A 3QFWA 5ABFB 3MSYA 5HJLA 1L6FA 4ZBCA 1W3NA 4B4FA 3BLDA 4JY9A 3SY1A 4JIPA 1ECQA 2V82A 4LF1A 3GHSA 4XD5A 3B9AA 2OWXA 1LG2A 4GUFA 3QW3A 4PUJA 4GUGA 1E6ZA 1OX4A 2IKJA 4JCLA 3TJLA 5FJIA 4UTHA 4YN5A 2I5QA 2J75A 3ZJKA 4IH3A 3NR0A 3H4WA 3FOKA 4XAFA 4PCTA 2RH9A 3SFKA 2CWNA 3PPGA 4IM4A 4IIGA 3UESA 1SUXA 2PDQA 4TTUA 4WJXA 4J7RA 1KKOA 3GH7A 2AQWA 1LL6A 1WDPA 3GIQA 4US5D 4LUJA 2UWFA 7ODCA 1DJNA 2VC9A 2A2IA 5HATA 4Q8OA 2CHOA 2YSWA 8XIAA 5E09A 2GVEA 3ONBA 1VFHA 1I1XA 2VKZG 3VX0A 3EGJA 4AF0A 3VDAA 2UZ9A 1EJ7L 4J2MA 1VYSX 3PZMA 3VNKA 3GKFA 4Z2LA 3WDRA 1Q7QA 2GK1B 4RW5A 3WF0A 2GDVA 3PAOA 4B3LA 2GZXA 4C6MA 3SDOA 2GJNA 1NEYA 1GOXA 3GC4A 2YLAA 4JFUA 5C9UA 3OOQA 4IPJA 1A5OC 3NTYA 4JCMA 3WF4A 2Y4SA 1R5YA 2XDFA 2QJJA 3QEZA 4QITA 1JF6A 1HKMA 1GJUA 3LBCA 4A8IA 3LX9A 4RR4A 1W3HA 1RP9A 4N02A 2FDMA 4ZXOA 3E02A 4Y9PA 1DJIA 1F61A 5CZTA 5CZ0A 1QNOA 2BDQA 4E3VA 1XLEA 1MW2A 3LU2A 2E40A 3R13A 3FVMA 3E0FA 4UNLA 4P2VA 2BG5A 2VGIA 3LCWA 3VIMA 2OZ0A 3V0SA 4GA8A 1YPIA 3KUMA 1XGZA 4N4PA 3OVGA 1J12A 4U5IA 2G4FA 1BGAA 3GTNA 2ZKMX 5FOOA 3UWEA 1Q66A 3BAIA 1H62A 4UIOA 1KXVA 3SN4A 1NOUA 5REQA 1OADA 3L7RA 5EB8A 4AZCB 5FACA 3COTA 4CQDA 5GQBA 1E9YB 1AD4A 1XRSA 2ZE3A 1A3WA 4EWJA 3D6NA 2GFTA 2QPXA 2VDIA 3FHQA 3DYPA 4WOZA 1XQLA 2JF6A 3TVAA 3M0XA 1YDNA 1H63A 1BKSA 4BEQA 3B0YA 3VIIA 1UWTA 4XZIA 1JRBA 3UG3A 3CASA 3B4YA 4QJ3B 4ES4A 4S3JA 2E5BA 4P7OA 1G67A 1HL8A 2X1SA 3H21A 4LOCA 5I5RA 3G24A 3MWCA 3GDRA 2JIWA 3HBLA 2PEVA 2RUSA 1E1EA 4UTLA 1E43A 3VPLA 3BTNA 3TCSA 4BWLA 5F1UA 2W62A 3DAQA 4UMBA 3W70A 2GPTA 3ZWSA 3RM4A 3UCCA 2VGBA 1NAL1 2WVVB 3TFXA 4Z1DA 1I0BA 1HW6A 4AY7A 2VD9A 1BG9A 4QG6A 2OTDA 3GSMA 3W1PA 1KM1A 2XIQA 2WZHA 5CGMA 4WUIA 3N6JA 4NYYA 3FJ4A 3R10A 2DIEA 3W29A 1JAEA 3AYRA 1TRDA 4PTMA 3GDLA 4FOJA 2GQ8A 3V7PA 4UFKA 4HU0A 1XYAA 5LNSA 1R30A 4GACA 4JTJA 4NJJA 2FGBA 2HPIA 2PWGA 4IZGA 2GK1A 3WNPA 5A3HA 2BXYA 1QDSA 1PYMA 4EKJA 4W93A 3GKAA 3LSCA 3W07A 3KL5A 3DU0A 3RM8A 4XO6A 2VMFA 3NL3A 4XIMA 3VK5A 3H26A 2Q8LA 4JD4A 4L9ZA 4AWTA 2AKMA 1J96A 5HR6A 3RRXA 1WDDA 3UBPC 1XLMA 1UWRA 1XPGA 2ZZ3A 2QJHA 1E51A 1YTEA 4JYDA 3RCMA 1JDAA 1ZY9A 3KTCA 1MQQA 4YWIA 1MQPA 4UOZA 3HFTA 3ANVA 4HCHA 3AFBA 4U5KA 2EPOA 4LAZA 1T99A 1JCYA 3V5FA 3MO4A 1I1WA 4CQ9A 1SMDA 2O9RA 2Q8XA 2PB1A 4X61A 1TPB1 1GKQA 2NW0A 4ZOCA 5I78A 2P88A 1WO2A 4JX4A 4JL1A 3VUSA 4RPPA 1VENA 4FS9A 4JICA 2XIMA 1NQ6A 4HQVA 4A4AA 4GISA 1RHCA 4W4QA 4I8YA 3LDVA 3BCJA 4RXFA 3NVDA 4DJFD 2WW5A 1BYBA 3E2VA 3O6AA 4IP7A 1FWRA 4INFA 5B7YA 4YHEA 1L6GA 4JIHA 3VI2A 5AHNA 2Z6IA 3USBA 1ZENA 5BNKA 1XG3A 1WNOA 5KMYA 3EDEA 1W1VA 1BF6A 1ZB5A 4RPQA 3I3BA 3SUVA 3CHCA 3CHFA 4GY1A 4H8VA 2D73A 3C0SA 4AIBA 4H41A 2CETA 1GJPA 2BB0A 1Y8BA 2VOMA 3B4UA 3APTA 4MJ2A 4H9YA 3TFCA 4LUSA 5HANA 2XVLA 3STGA 1RY8A 2WHKA 2YCLA 2WMFA 4CNSA 3NQVA 2VRQA 2VUYA 3OG3A 1US3A 4RNHA 3P74A 2PFHA 3BW3A 3TCEA 3TTQA 3URNA 3GNDA 3PJXA 1BHGA 1WKYA 3TMQA 4Z2IA 3LUTA 3W22A 3C6CA 1CLXA 2AQVA 2CFFA 1FDYA 2YB1A 5DT7A 2Y62A 3FXGA 1PCWA 3VIJA 1OT1A 1NWTA 1C8YA 1TG7A 2C15A 2Y6ZA 3AS2A 1UKQA 4MHBA 4AUBA 4B3KA 4OJYA 1QOQA 2UY3A 4HU8A 1P0BA 1NDYA 1NM9A 4BF9A 1TJRA 4LNCA 1XW8A 1UH2A 4XBJA 1VD6A 4GYJA 5EPDA 3T78A 4EAYA 3LHYA 1EPVA 2ISWA 2FYMA 2WMGA 2WHLA 4HPNA 3QHNA 4IP4A 3L5AA 3CXOA 3CPUA 2OR2A 2AOSA 3IRDA 5TIMA 1TCDA 2OOFA 3PWIA 4AZCA 1R2SA 4H9MA 2G8ZA 1NELA 1F76A 1VJIA 3H2FA 4K1GA 3CEUA 4M8UA 4IGHA 1H1YA 2VGGA 5BRPA 4J28A 2XIOA 1QPKA 3KBJA 1YYAA 1U1HA 4NYUA 1W3KA 3GHTA 4LBUA 2AMGA 4XZNX 3PB2A 2JK2A 5G2WA 1GVQA 2QHAA 3F4CA 4U3AA 6REQB 3TTSA 3BAJA 1EO5A 4EXBA 3KRZA 4JYEA 4ROPA 4ATDA 3WH6A 3VKCA 2XN1A 5DF0A 2CKRA 2TMDA 3W85A 1A0DA 2E9BA 1SW0A 4JPGA 3IUDA 1OD0A 1TV5A 4CEXC 2JKPA 4QM1A 3F2BA 5ABFA 5BOFA 2HBXA 1C9DA 1E6PA 1R38A 2Q09A 3H23A 3DEQA 1O6IA 4WQ6A 2LLEA 1J4EA 2PRHA 2WMJA 3CO4A 3N9RA 2GJLA 4GNJA 3ONCA 1TVPA 2O56A 3S83A 5CSYA 1Z42A 3BSHA 3BQ6A 1AZ1A 1UBSA 3B0XA 1GOKA 3OZYA 4PRRA 4P7QA 2GDQA 1XFBA 4FXFA 2XH2A 2QULA 4ADTA 4L6OA 3IJ7A 1HXJA 1F05A 3QZEA 3O05A 4RV8A 4TVDA 3W01A 4UTFA 3C2OA 3BO9A 5A6KA 3K1GA 2J13A 3STPA 1Q6CA 1W1YA 2HS8A 3QY6A 3VZZA 3P61A 4H9UA 5FESA 1Z3NA 3KDOA 4B4HA 3W86A 4U2YA 2Y24A 4PUMA 3TNOA 3C2VA 2V8ZA 3E3HA 4WF7A 1ME8A 3E0LA 1GPFA 2B0MA 2FB2A 2OSYA 3ZT5A 2X42A 4AG0A 1K4GA 1QI0A 2UBPC 1PX3A 2X16A 1UBPC 2D1ZA 1HKIA 3CZJA 1OYCA 1G4PA 5C6MA 3B0UX 3E5BA 4K8EA 4W5ZA 1SM9A 1B1YA 1Y5XA 1Q6EA 2OPJA 3MKKA 1RR2A 4S3KA 1T5AA 4M6QA 4ADSA 1FCBA 1EC8A 2VEPA 1DE5A 1ZCOA 1UOKA 5BOOA 1RCXB 5BCAA 4QQUA 1IT8A 2DY3A 4EOUA 2EO7A 1CXKA 2ATMA 1P48A 5ABTA 1W5MA 1CLKA 1AVAA 1OF8A 3SRDA 1RPXA 4R7OA 2J7GA 4NAEB 4F9DA 2FH6A 2ZRWA 3LLXA 2BOFX 3CB8A 4UTIA 5C7VA 3VNJA 2YCJA 1R3QA 1MUWA