2YDAA

Sulfolobus sulfataricus 2-keto-3-deoxygluconate aldolase y103f,y130f, a198f variant
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
292
structure length
292
Chain Sequence
b'PEIITPIITPFTKDNRIDKEKLKIHAENLIRKGIDKLFVNGTTGLGPSLSPEEKLENLKAVYDVTNKIIFQVGGLNLDDAIRLAKLSKDFDIVGIASYAPYFYPRMSEKHLVKYFKTLCEVSPHPVYLFNYPTATGKDIDAKVAKEIGCFTGVKDTIENIIHTLDYKRLNPNMLVYSGSDMLIATVASTGLDGNVAFGSNYLPEVTVTIKKLAMERKIDEALKLQFLHDEVIEASRIFGSLSSNYVLTKYFQGYDLGYPRPPIFPLDDEEERQLIKKVEGIRAKLVELKILK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-KETO-3-DEOXY GLUCONATE ALDOLASE
publication title Sulfolobus Sulfataricus 2-Keto-3-Deoxygluconate Aldolase
rcsb
source organism Sulfolobus solfataricus
molecule tags Lyase
total genus 114
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 4.1.2.55: 2-dehydro-3-deoxy-phosphogluconate/2-dehydro-3-deoxy-6-phosphogalactonate
pdb deposition date 2011-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2ydaA00
3VNDA 1GVQA 3QQ1A 5D2TA 3CC1A 2HTMA 3M16A 3N2MA 5G1YA 1N8FA 4RCXA 3W76A 5LKYA 1XBXA 1VH7A 3KVJA 3P82A 3P67A 3RK8A 2QDHA 4NJJA 1W37A 4ZQPA 5GVJA 1SFLA 2XN1A 1OHLA 3MJYA 3LRMA 2BX7A 3N9SA 1OX4B 4UFKA 3TV8A 3NPXA 3T4CA 3O63A 1W3IA 1P1XA 2WV8A 3GXNA 4PA8A 2ZZ4A 1YTKA 1Q6LA 1J4EA 4O1CA 3C2VA 3TU9A 1W5PA 1FWTA 3T40A 3LM7A 2EPHA 3NQFA 3UXDA 3CB8A 1A5CA 3IIPA 3W7NA 3ZWTA 3SSJA 4UTWA 4QSHA 1VS1A 3WFAA 3A5VA 4O15A 3M9YA 1TTIA 1FWRA 3TMLA 4O19A 1RR2A 1EEPA 2Z6JA 2DU2A 3OVPA 1NF0A 1ME7A 3DI1A 1OG0A 1DBTA 3NYZA 1OFEA 4N9CA 1A53A 3E12A 3INPA 1G4SA 5FF7A 2WOQA 2VELA 1C29A 1GYLA 1VYRA 5KINA 4N9DA 4KWVA 4IMCA 1T8XA 1SO3A 4OV4A 3W74A 1TMHA 3L5MA 3G8RA 1B4KA 2V0TA 4ZQCA 4JTKA 4IGHA 4R34A 3N19B 2CLOA 4O14A 1HO4A 1A50A 4MZ1A 3G1XA 2C14A 1JQXA 3PB0A 4U28A 4JY8A 4NX5A 1H7PA 1Q6RA 3SI9A 1GOXA 1WA3A 3OVQA 3P84A 5BMWA 3F1QA 3SECA 2GUUA 2D73A 2Y61A 4IMFA 3NVTA 3NQAA 3ABRA 5AC8A 3R13A 3BPWA 3UQNA 3KXQA 5AHLA 2QJGA 2UV8G 2QAPA 3M43A 3C52A 5SWUA 2NXIA 4A21A 1C8VA 1S5VA 3ABQA 1GVRA 3AJXA 2V8ZA 4N2YA 3ATYA 1EP2A 3LRKA 1EWDA 1QPNA 4UMBA 4TMBA 1ZENA 4M7TA 3LHWA 1KV5A 4Z0SA 5U7SA 5BOOA 1P4CA 3QMTA 3CEUA 3T44A 1VYSX 4BI6A 1B4EA 2ZCGA 1K7FA 1JULA 3TAKA 1EA0A 2QCEA 1KFJA 1W5NA 3MUXA 1TV8A 3STFA 2ZZ5A 3IRDA 1XKYA 3W2LA 2QCCA 5K3VA 5LNUA 3OG3A 3NGJA 2CZ5A 3ABOA 1KFKA 3H55A 4QM1A 3MI2A 4JEQA 3R8RA 3M5YA 3L0NA 3DAQA 3QSRA 3M5VA 4QISA 3MO7A 3SIZA 1FCBA 1V5XA 2A7RA 3K30A 1VLIA 2EKCA 4XKYA 1AMKA 3OHIA 4PODA 1F2JA 3U8GA 1BWKA 3L21A 4CNPA 3NG3A 3SR7A 4D2JA 3L9CA 3LI1A 4O4VA 5F2LA 4HHPA 3E49A 2QF7A 4EF9A 4YL2A 2G96A 3S8HA 1G6CA 3BGGA 3IGUA 3GR8A 5A5WA 3MBDA 4NNCA 4MOZA 5EPDA 2X30A 3NL3A 3LB0A 4IMGA 5G5IA 2E6DA 2GVLA 3MYOA 2X1TA 4AF0A 1KLYA 4UTLA 3C4UA 3P60A 4DBDA 2EGZA 1J2WA 5F4XA 3B04A 3JS3A 1TSIA 4LWWA 2Y85A 3M44A 1MXSA 3T55A 2P10A 4EF8A 3L5LA 4OHQA 1ML1A 1W1ZA 5H91A 2Y70A 3TQKA 3W7CA 5U4NA 1F6KA 5KZMA 3UY7A 3EXTA 3G0UA 2JBMA 4JTEA 2C0AA 1KFBA 3USBA 5AC7A 4ZQRA 2YPIA 5DBTA 1UUOA 1XUUA 4FNUA 3LRLA 4O12A 3S1UA 3UZ5A 3O07A 3QEZA 2ZRWA 2YCEA 2ZRXA 4HN4A 1YTEA 3TC7A 1TPH1 4FF7A 4FXSA 2V2HA 3GKFA 2ZBTA 4JIPA 4PFMA 4TO8A 3FS2A 3KHJA 2C1HA 1YXDA 1X8FA 3GDMA 5CPLA 3TJLA 3YPIA 5FF2A 1H62A 4WOQA 3M41A 1UB3A 1EX5A 1FDJA 4LW7A 3TXVA 3BW4A 4LTSA 2ISWA 1FWSA 1P0NA 4JX6A 3FKKA 4UFHA 3W7QA 3GNNA 4CLMA 3EWBX 3O6YX 1MEIA 3I6RA 4OQVA 3STEA 4CQ9A 1L6YA 1TV7A 4I7WA 1LRQA 1TJRA 3HPXA 1PCWA 3G1SA 5TBOA 4LY8A 1D3HA 5EKYA 4GXMA 1S3HA 4PEKA 3EX1A 3HBLA 1GZGA 2QUUA 1PCKA 4XBSA 3W1TA 1ZNNA 1AW2A 1SR9A 3L67A 2HS6A 2EF9A 3DH7A 2EAWA 3W85A 3LLDA 3P5ZA 1AL8A 1IXQA 4HNTA 4KFPA 5KTLA 4FX7A 5LGZA 4RXFA 1DHPA 1A5AA 2ZA2A 3EX3A 1F05A 3HJZA 5D30A 2E68A 3HOJA 1JCJA 1I4NA 2YX0A 3TW7A 3F03K 1XDMA 1IGSA 1S5TA 1LLZA 4MY9A 4IUOA 4MY8A 1R2RA 2H3BA 4JTFA 4X22A 4XZ9A 2V9DA 4LOCA 4IOTA 3NEVA 3NR0A 1KBIA 5FF0A 3H54A 4JIQA 2YGYA 1CW2A 4UTJA 2NWSA 3W7EA 5L6UA 2BZNA 3KAOA 1ZCOA 1CX9A 3THQA 3NL5A 3CT7A 4ALDA 3LHYA 3NPUA 2V2DA 3GZ3A 3RFAA 1BWLA 3MMTA 2ZRVA 2OCZA 3LHTA 2Y7FA 4MKNA 5CG7A 3DXIA 4AHOA 2FIQA 2ABAA 4MZ8A 2CLMA 4M6VA 1KTCA 3NXFA 5DY3A 3M5XA 4RX0A 1OVDA 2I9EA 7TIMA 1Q45A 4DQWA 3PB2A 3NM3A 3LCXA 1GYNA 3NQVA 2CWNA 4FEZA 2I1OA 3FYPA 1OX6A 4WXZA 1K3UA 3P5YA 4BWLC 4IPJA 3MHGA 5KITA 4GFSA 4LS2A 3UNDA 2VFEA 3ELFA 3KOFA 1JUBA 2ZYFA 3KVLA 3DENA 5F2IA 3P8JA 2ZZ6A 2CFFA 2B4GA 2PURA 3FJLA 2WKJA 1XUZA 1W5MA 4AB4A 1TREA 4Y96A 3G1VA 4UCGA 3O1NA 4NZJA 1I45A 2BXVA 1YTDA 3GYEA 3IV3A 3STCA 2ALDA 1XDLA 4O17A 1PHWA 3HQ1A 1Q6OA 3I68A 1FY6A 4OV9A 2VFDA 1WBJA 2GJLA 1DKWA 4E2BA 2J9YA 4R53A 2CLEA 3M1ZA 1SUXA 4JTLA 1KW1A 4FX6M 4Q33A 2QJIA 3C8FA 3F4WA 1GPWA 4AF0B 5KZDA 2Y63A 3TNOA 1IXPA 3W7MA 4DO6A 5I3FA 4XWUA 1SSGA 4JGDA 2NX9A 1Q6QA 4JN6A 2E6AA 3NPWA 4K38A 3W1NA 2A1YA 2FPYA 1QOQA 4OBTA 1VGAA 4AWTA 2OT0A 1FCUA 1YPFA 3LERA 2O7SA 5TIMA 3W23A 1GJPA 1UJPA 2CU0A 3JRKA 1H7XA 4LVDA 3BGJA 1QR7A 3PC0A 3U6WA 1YXCA 3QZEA 3W72A 2A7NA 1BTMA 5LZLA 2E6FA 1ICPA 4O13A 4WQ6A 3EXRA 3O6CA 1W3TA 3KFTA 1H7WA 1TPVA 2Y7GA 3OVRA 1GT8A 5G2HA 5HQEA 5IM51 2H90A 1PVNA 4LV4A 4O57A 4K7VA 5AHEA 2A6NA 3S1VA 1PIIA 5HR6A 5D2VA 3BW2A 3C2OA 3TFCA 5F4SA 3PWAA 1TTJA 4UIOA 5AFDA 5FEZA 3C0JA 4BK9A 4XTIA 4UFJA 2J27A 1M7PA 3NQDA 2GVJA 4HPXA 3C56A 4JXCA 1GG0A 2C3ZA 2PE4A 3P7YA 4DXVA 3IGXA 3LCFA 3TDFA 1XM3A 4H6KA 4AWUA 2ZRUA 2Z6IA 3BLEA 3GDLA 1PV8A 1QNVA 3W87A 3W84A 4FNTA 3P81A 4JTTA 4MYAA 2A85A 1LORA 3FOKA 1LTDA 5G4EA 3M5ZA 1EWEA 4ZMGA 3IGSA 2E6YA 1EIXA 2TMDA 1OFOA 4PC8A 3KRUA 1W5QA 2V82A 3EKZA 3P61A 1H1ZA 4FXRA 4XUGA 3QYQA 3TSDA 3DKJA 2NV1A 5LHFA 1P5BA 5HUPA 5J5RA 1OYCA 1ALDA 3LCHA 4AH7A 4AVFA 1D3GA 1WOBA 1DL3A 5EYWA 2J9ZA 3PM6A 4UUIA 3HPSA 5AYZA 4BFAA 3I7QA 5E0KA 1LOSA 3NNTA 3HGSA 5DELA 1FUYA 3RLUA 3W83A 3DHDA 1JCXA 2NLIA 1D9EA 5HUOA 1HTIA 4WD0A 3GVGA 4AWSA 1FDYA 4GUGA 2Q3OA 2JGQA 3LXCA 4ML9A 5LHEA 2ZRYA 1QPRA 3JR2A 1FCQA 5CPMA 4UFLA 3B8DA 1GQNA 4K8HA 5CPOA 4FIRA 4GUIA 5DCEA 3BK0A 3WK3A 2ZZ7A 1TRIA 3W2JA 3L2IA 4OWGA 4RLIA 2GJNA 2DZUA 1ONRA 1YDNA 4BR1A 4K8EA 1JQVA 3U2OA 4HSNA 1C9DA 3UD6A 3GAYA 1LCOA 3B06A 5AYYA 3FYOA 5DBUA 4EVZA 1OYBA 3MI6A 3L65A 3DKLA 4NZFA 2NWRA 4TR9A 2DZVA 2DORA 2DZPA 4WY0F 1O94A 3E02A 4BWLA 5CPNA 1AK5A 3TE9A 2TRSA 2J6XA 4N4QA 3EWUA 4YXGA 1THFD 1TPWA 1ZALA 1XBZA 4O1AA 3O6DA 1Z42A 1HO1A 3CQ0A 2XFWA 3CWNA 3TIMA 8TIMA 2H6RA 1QOPA 1K8YA 1UBSA 3PUEA 3HPZA 4RZ4A 3BO9A 3HGOA 5FF3A 2ISSA 1R2SA 3PG8A 1FQ0A 1R30A 3N14A 3DI0A 3MBFA 2VFGA 3ATZA 5G1TA 4CNNA 4W9TA 3IVSA 2QCLA 2C13A 4M19A 3LXBA 2ISVA 4QIUA 3NM1A 1SO4A 1EUAA 4AAJA 1F76A 1IIHA 2OMAA 1EB3A 5CZ0A 1NSJA 4WXYA 3W86A 3L5AA 5F1VA 3WK0A 4UNKA 1K8XA 2Q8LA 1SU5A 1X1ZA 5K4ZA 5AYXA 1R47A 4RR4A 1H50A 2DJLA 4ADTA 3W6YA 3EX2A 1T0OA 1L6WA 2VKZG 3W7IA 4JNMA 1F6PA 3G18A 2AAMA 2KZHA 5C5YA 3Q2DA 2RDUA 3LLFA 5D33A 4X2RA 3OBKA 4UFIA 2QEZA 3CU2A 3TC6A 5EL1A 2F84A 4BI7A 2V5LA 2QCNA 1OK4A 1K02A 3NPVA 2QCDA 1FXQA 2NUYA 5HNRA 4FIQA 2XN2A 3S42A 2H3DA 4UMAA 2JKEA 2NUXA 1JRCA 1AL7A 3RLVA 1GEQA 4XTDA 2X1SA 5F2GA 1X7FA 4FX8A 4DF0A 1EP3A 4QAIA 3OA3A 4O10A 3LBCA 2NX3A 3LCGA 1R2TA 3LTPA 2TPSA 3NL6A 1QO2A 1LOQA 4AXKA 4RZ5A 4DBEA 3W7HA 2DZWA 3VCRA 1VPXA 2AQWA 4GC4A 4R33A 3G24A 3PY2A 2JKAA 1HG3A 3A22A 3THAA 3E9AA 4O4WA 3EWYA 3GNDA 3TROA 2YSWA 2ZRZA 2W6RA 1NEYA 4K37A 4JTSA 2FB2A 2ATMA 3IIZA 1RD5A 2RDWA 1VJIA 3P62A 3LHUA 2CZFA 4YCOA 1AW1A 3BLFA 2A7PA 3TK7A 3RNDA 4IX0A 1K8ZA 4O28A 5KZEA 4I7UA 4JTJA 2X1RA 1B3OA 4BI5A 2Z2UA 2WJZA 3HMJG 5CSSA 4YWIA 1TB3A 3PBYA 1M7OA 5K9CA 3ZWSA 1TIMA 2QDGA 1R46A 5FEWA 1ME9A 1DORA 5TQLA 3QMSA 2R8WA 2LLEA 4Z1CA 3DFTA 4XQ6A 1JCNA 2YW3A 4ADUA 3PULA 4IQLA 3DFNA 4IXXA 2QJHA 3VFLA 2QCMA 2OT1A 5I3GA 2NX1A 5FI8A 3DU0A 1YPIA 4GJ1A 1G7VA 3PBUA 4X3ZA 3W7DA 4IWWA 3IEBA 3HG4A 1HUVA 4IJBA 1UUMA 4JY9A 4LC6A 2YW4A 1SZNA 5FF4A 2E5CA 4TMCA 3TW6A 1WOAA 3OIXA 4A2SA 1K7XA 3DHFA 1UCWA 4M7SA 3CHVA 3HO8A 2VEKA 4P2VA 1LROA 4CQ8A 4RKAA 4MJMA 5DN1A 2R14A 4DEFA 3S1XA 2VFIA 4JYEA 1YDOA 3W1MA 4GE8A 5HJLA 5HULA 1MSSA 2WNQA 1KM5A 4PL1A 5AHFA 4LRSA 3Q94A 2AGKA 3G1AA 4MIMA 5K2ZA 2NUWA 1PE1A 2V30A 3DGRA 3FJ6A 3GAKA 3TJXA 1EPXA 4BF9A 1LRTA 4O11A 1G4PA 1OFDA 3W3OA 4UTKA 3SZ8A 3WK1A 5I3JA 3DBPA 3BG9A 4N6FA 2E1DA 5K9DA 1K03A 4OT7A 3B0UX 5CSRA 1ICQA 1H7NA 1LBLA 1VHCA 2FDSA 1XI3A 3A24A 1GVOA 1OFQA 1SW7A 4I7VA 3W7OA 3UZJA 1T96A 1KTNA 3CEPA 1VR6A 2CLLA 4J9JA 1VYPX 4DPQA 4LS0A 4LVFA 5DXYA 4N9BA 4L4MA 2FB3A 2X2GA 4QITA 1KBJA 2VEPA 3QSTA 1FX6A 6ALDA 1Y0EA 3EWZA 4NT0A 3QQ0A 5CZSA 1QO5A 2Y6ZA 4MFEA 3W7KA 1SPQA 2DZTA 3LCLA 1ZAJA 2Y7DA 4IPIA 1NAL1 1NFBA 1ICSA 3TR2A 4MFDA 2E77A 1WDWA 2Z0IA 5I3KA 2GQ8A 2WNNA 4X9SA 1PL9A 4ADSA 2VFHA 4G1KA 1V7YA 1G69A 2PRMA 3QRHA 1FWWA 3R2GA 3O15A 4XKYB 1TCDA 1AW5A 1JRBA 3G1YA 2CLKA 3MHFA 5AC6A 2W79A 3HG3A 6TIMA 3WJYA 3UWYA 3TH6A 3BW3A 3QW3A 5DY2A 4FB7A 5HWJA 5T26A 3DFSA 3FLUA 3G22A 3M7WA 4FNRA 3MHUA 4NJKA 1JCYA 3EEGA 4YMZA 1LZOA 2CLFA 2P0OA 1H7RA 2B0MA 1M5WA 4K36A 2A6LA 1IXOA 3N9RA 2Y89A 1A5BA 5CZTA 4WZHA 3STGA 5EA9A 2NV2A 2OX1A 3B05A 4MUZA 3CIWA 1O95A 4JICA 5LGXA 4UC5A 3TQ0A 2BLEA 3NDOA 3W1LA 4O1DA 1OFAA 5L9FA 4LC8A 4E0CA 1IF2A 1JUEA 1ZAHA 1IIGA 3O05A 3DFPA 1I2PA 1L2UA 3HGRA 3MW7A 1JR1A 3QF0A 1NVMA 1KM3A 2V5BA 2WQPA 4TU1A 1SZFA 1TYGA 1KM0A 1F74A 3S5NA 2VEMA 2PCQA 1RZMA 3PVFA 3QMRA 4UTUA 1XBVA 1N55A 1ZY9A 5KMYA 1SSDA 3Q37A 1IXNA 2BTMA 4O54A 1DJQA 2FQIA 1OFBA 3ABSA 1SZGA 1TRDA 1N7KA 4WY0A 3UPWA 4RJEA 1TPEA 4Z08A 3W2KA 2YFOA 1YYAA 4Y90A 1K7EA 4UFMA 5F4WA 1H7OA 1WX0A 2BSLA 1SO5A 3EXSA 3S1WA 1VCGA 3G8EA 4UR8A 4FNSA 4ICNA 5D38A 3FA5A 1F5ZA 1I2NA 1SFJA 1W54A 4HPJA 3UXAA 3C3NA 4FNQA 3GKAA 4HT3A 2IQTA 2C6QA 4RXGA 4HKPA 3WJZA 2CZDA 3TA6A 4C1LA 5C2XA 1TPC1 5I3HA 4NNBA 5LNSA 4Z0JA 4O53A 3LCIA 4UTHA 4A2RA 3W7JA 1HFBA 1VZWA 2Z1BA 2HMCA 3IVUA 3KX6A 2VFFA 3LV5A 3NO5A 4YLWA 4WOZA 1VQTA 5ABTA 3LTSA 5F2MA 4JDBA 2FTPA 2PC4A 3LGEA 1QWGA 3PG9A 3UYCA 1EUNA 4UTMA 1KFEA 1Z48A 4TIMA 1I8JA 1OX5A 4O0ZA 5KSWA 1L9WA 5HMSA 2BWGA 2FJKA 3S5ZA 5HWMA 2Q3RA 3BG3A 4NX0A 4OU1A 1LP6A 5H2ZA 4DO5A 1MZHA 1VCFA 3P80A 3GK0A 3MYPA 4LRTA 3N73A 4JX5A 3VKJA 2YDAA 3LTYA 2ZZ2A 5DCBA 1JJKA 3Q58A 1QPQA 4RK8A 5J5DA 4A3UA 3M6YA 1ZJIA 1KFCA 5D03A 1O4UA 3PUOA 2HS8A 3CM4A 4O1BA 4H3DA 4NU7A 1X6UA 3NQEA 1TJPA 2C19A 3FEMA 1FBAA 1W8SA 2QCGA 2Y7EA 3W1AA 1EP1A 2O7QA 2G95A 2WNZA 1GWJA 1JCMP 1XCFA 3L0GA 2A0NA 1H63A 5BW6A 3LHZA 1Q3NA 3W1RA 1E51A 3NAVA 2B7QA 5D05A 2ZFAA 4N02A 1DQXA 1X1OA 1ZFJA 1O5KA 2ZTJA 2DZXA 1DJNA 2C16A 3QJAA 1KTBA 5HWNA 3G0XA 2E09A 1QCWA 3KRZA 4FHAA 4IMEA 4Z1BA 1F7BA 1SZEA 2NXGA 4U4MA 1OF8A 2B7OA 2DZSA 3G1DA 3W1QA 3W1XA 5IBXC 3G3MA 4C1KA 3GLCA 3BV4A 4QQ3A 5D2WA 1G4TA 3HB9A 3A9IA 5K7JA 3TXZA 5G2WA 3NZ1A 5AHNA 4E38A 2B7NA 1H61A 1U83A 1RQHA 1TPFA 1KFLA 4LUJA 4O0KA 2A2IA 1XL9A 3F4NA 2A21A 4A29A 3UWQA 2ZZ1A 5AB3A 3LI0A 1OABA 3G1FA 1I2OA 4LV9A 1BKSA 4UXDA 2Y88A 4Y9AA 4K7YA 1VHNA 3NQGA 3B4UA 5DXXA 2WSRA 1G67A 4N6EA 4DELA 3P8IA 1OF6A 4FO4A 4UMCA 3UWVA 5DLCA 3W1PA 4WUIA 2RKXA 5D04C 4O52A 4YCPA 2J9XA 3R89A 3LOTA 1B9BA 4ORIA 1CI1A 1LRNA 3MP5A 3HG2A 1LYXA 3EKLA 4LNYA 3SGUA 2F7FA 3W07A 1RQBA 4LVGA 5G2IA 3NZRA 3W7PA 2OJPA 3DFOA 3C2EA 1OJXA 1MO0A 3GDRA 1W0MA 3A23A 2JK2A 1S5WA 5BRBA 1TTPA 2DJXA 1TO3A 5CGQA 4MYXA 4WY0B 1O60A 3NL2A 4JR5A 3A5FA 3LXAA 2RDTA 1WV2A 5G4WA 5D32A 3IVTA 2OZ0A 1BEUA 3L0KA 3VI2A 5LNRA 1VLWA 1QFEA 5D2YA 5AOUA 3KRSA 4JX4A 3B0VC 2WSYA 4AHPA 1KM1A 1KLZA 3PAJA 3TMQA 3QC3A 4LT9A 4O16A 4KFNA 4L4LA 1SW3A 4JYDA 5LNWA 3B0PA 3CPRA 4LUIA 4K6AA 2ABBA 4GNJA 3SGZA 2Q8ZA 1QDSA 2EHHA 3EX6A 4N9EA 4HNNA 1G7UA 3C6CA 3QM3A 4IMDA 2JKPA 3NOEA 3PR2A 1LBMA 3WJWA 4DF2A 4XBKA 5C6MA 2RH9A 4Z1DA 4MZYA 4ZQMA 4LS1A 4ZL1A 4NNAA 4CCCA 4WX2A 1P0KA 2Y62A 3L68A 4AMAA 1VC4A 1GVSA 2E5DA 4AHQA 4S2BA 4EOUA 3H53A 3CTLA 2YXGA 4R7JA 3LHVA 5D02A 3S9YA 1M6JA 5K4XA 3PSVA 3NA8A 4PH6A 3ZFHA 4S2CA 5K9XA 2CLHA 4KWWA 1Z44A 2NXHA 1JCLA 1L6SA 3TAOA 2PRLA 3W2NA 2WO5A 2CW6A 2VOMA 1JVNA 4B5NA 1KM6A 3I7RA 1MEWA 2V81A 3UPBA 1YDVA 3HIJA 1A5SA 3QW4B 2R91A 3BG5A 4ONVA 4EWND 5BMXA 3GX9A 4WJEA 2WSQA 4RZ6A 3EB2A 4UR7A 1KV8A 1TPUA 3UWZA 2FPTA 1XBYA 3W9ZA 4HNVA 4JTIA 3WJSA 2YR1A 3V75A 1W31A 1SO6A 4POCA 1YADA 1WQ5A 1ZAIA 2G97A 4GUJA 4GBUA 4NJIA 4CCEA 3SFKA 4NQ1A 2ZA3A 4O8RA 4MVAA 2QUVA 3EX4A 2H8ZA 3R12A 3GB6A 1WBHA 3PSWA 1H5YA 3KVKA 4LVBA 3NQ2A 4DO4A 2P1FA 5CZJA 3W1UA 3S5YA 2VENA 4GUFA 1I2QA 1LM1A 1FDZA 4MY1A 2GOUA 4M6QA 3MI3A 3TFXA 4CNOA 5C54A 4IX2A 3RU6A 1XXXA 4NUWA 3S0CA 1OFPA 4QNEA 5E93A 2W0UA 1RQEA 1FXPA 1ME8A 4UTTC 3AO0A 4DPPA 3FIGA 5EMUA 3N3MA 4I9AA 3N34A 4Q4KA 3TUUA 1G4EA 5IBXA 4TX9A 1FCVA 3BLIA 1GG1A 5BNKA 4DF1A 2HSAA 3IIXA 4MJZA 1OFRA 3NQ7A 1RVGA 1OYAA 3RF9A 3MP3A 5LNVA 4JD4A 3W22A 1RPXA 5D2XA 3S6DA 4OE7A 1TPB1 4CQAA 4Z1AA 4NXKA 3GDKA 1SQ7A 4UTIA 1DOSA 3W75A 3D0CA 1LLWA 3A21A 2QUTA 3SY5A 1VRDA 3LX9A 4QNWA 3UY8A 3W71A 1MEHA 4JYFA 2J88A 3PBVA 5D09A 4ZZ9A 5FEXA 3O8AA 4FNPA 4Y8FA 2QAFA 3T7VA 1ZHAA 2YFNA 3MWAA 3IIOA 3IIVA 1OX4A 3OEXA 4NXSA 4NJHA 5LSMA 1NF7A 2E5BA 3LDVA 1I2RA 2R94A 4Y6GA 4M5PA 3KVMA 4GRSA 1GVFA 5FESA 1PS9A 3LCWA 4GUHA 1Z41A 1HL2A 5EBUA 4UTWC 3C61A 3WK2A 3N2XA 1ADOA 1QPOA 2GQ9A 2GVGA 3UWUA 3EWWA 1DQWA 3FFSA 4O50A 3QH2A 2X16A 3P74A 3CLMA 3QPYA 3VE9A 5F1UA 2ZQ0A 4S1FA 4ORMA 2QCDB 2GQAA 1DV7A 4KKXA 4M6PA 2RHGA 1B57A 5I3IA 5HR7A 2TYSA 3V1PA 3QFEA 4UNLA 3NQ6A 3B03A 1F73A 1GTEA 2G5WA 2ZZ3A 3PBWA 3UWWA 3ANYA 4EIVA 2C15A 2I14A 5CKSA 3ZR4A 2JGYA 2GPTA 2X1UA 5AHIA 5AHMA 3DFQA 1O5XA 3DZ1A 3WJXA 4E2DA 4JDYA 3RMJA 1FWNA 1QAPA 3QPZA 4QJ1A 4JTHA 2C18A 3HG5A 4RV8A 4LVAA 2VC6A 3O16A 3C2FA 2YZRA 3GIYA 3E96A 2FLIA 5FEPA 3E0IA 2PRHA 1TPDA 3W88A 3ZS4A 1LDCA 3M0ZA 4MPQA 4PL2A 4O18A 2YYTA 3W2MA 1LOLA 2ATSA 4NJGA 4NVTA 1U5JA 4ZVJA 1TTQA 2VEIA 4H4IA 1WAUA 5MHBA 3GXTA 2TSYA 4A22A 2QCHA 3W7GA 3W70A 3HGJA 2WPBA 4MLRA 1PHQA 3M47A 4P61A 3NQMA 3I7SA 3PUDA 3NQ8A 3CIXA 3TKFA 5E1QA 3LV6A 3TX9A 5AN7A 1UASA 4GWEA 1YXYA 2QKFA 3G3DA 3G0SA 4IXHA 1LBFA 3BVJA 4K39A 2ZTKA 3PS7A 2CZEA 2FPVA 4JS3A 1TV5A 3FKRA 3HF3A 4KFOA 4OGZA 3W7RA 1JUKA 2V2CA 5DCDA 2B7PA 3SW6A 1T99A 1TQXA 2QR6A 1QMLA 5HINA 3TQVA 1KM4A 1AG1O 4LU0A 1W3NA 1RV8A 3MP4A 2VXNA 3TCEA 1J5TA 1VCVA 3W2UA 1YLVA 3G1HA 5D37A 2J24A 3VE7A 2QCFA 3O06A 1H60A 3CWOX 3TSMA 2ZA1A 2DP3A 1WXJA 4ZQOA 2H8XA 4MLJA 1WYIA 3EWXA 3GR7A 4PTNA 4CCDA 2YYUA 2ZDRA 2RFGA 4N4PA 5A8GA 1H51A 1H1YA 3W73A 3PF3A 3C2RA 1KA9F 3LBMA 4JTGA 4Q32A 4ZQNA 3TSBA 3L66A 3T78A 1KM2A 1W56A 2CLIA 3S5OA 1DVJA 2A5HA 1SW0A 4PCFA 4UTTA 3W7LA 3I65A 2NZLA 3GDTA 3R5EA 2XN0A 1XC4A 4HSOA 1XFBA 1W5OA 3BARA 3NQCA 2FFCA 4AEOA 4JTUA 3GXPA 5EY5A 4HIBA 1TQJA 2A4AA 1GTHA 3SJ3A 4HNUA 5C55A 1OK6A
chains in the Genus database with same CATH superfamily
4ZO8A 3VIKA 3O2LA 2I16A 3M16A 3N2MA 4ATDA 4RCXA 1YPXA 5LKYA 1XBXA 3H4GA 5A2CA 4CNTA 1W37A 2XIBA 1HZYA 1MFUA 1W1PA 1SFLA 1OHLA 3ITOA 3O63A 4HGXA 2WV8A 1P1XA 3GXNA 2WHLA 2FVMA 5LA0A 2E9MA 1O12A 2J7HA 1W5PA 1E4LA 3LM7A 1KB3A 1Q6FA 4Y9PA 4PUKA 1BFNA 3CB8A 1A5CA 4B90A 3S46A 1GPFA 4ICCX 4DJDA 1JZ3A 3H2CA 3M9YA 1TTIA 4O19A 4O8AA 3K4DA 2CEQA 1EEPA 2DU2A 1GKQA 3DI1A 5M3WA 2OOGA 1TZ7A 1C8XA 3B97A 3DHUA 2CKRA 3A3XA 4ZTYA 3GVWA 5KZ6A 4KWVA 4IMCA 4KRUA 4OV4A 1OZQA 1B4KA 7ODCA 4GZJA 1CIUA 2HRWA 3T9PA 3K46A 2CLOA 2NVAA 3BSGA 4O14A 4HA1A 1XLGA 2C14A 5I2UA 1JQXA 3SI9A 1WA3A 1E0UA 3OVQA 4CGTA 2D73A 1ECQA 4WEVX 3ABRA 2Y1HA 3MDUA 2QJGA 4AX7A 6TAAA 3M43A 3C52A 4EANA 3AQUA 1KO0A 4WK9A 2W62A 3AJXA 2V8ZA 1EP2A 1EWDA 2VDGA 3E2RA 3MCMA 2WW5A 4M7TA 4Z0SA 2VCBA 2XG9A 4H7VA 5CG0A 1JPDX 3SAZA 4FOUA 4FLRA 4BI6A 3W01A 1K7FA 4LUSA 1W5NA 1VBGA 2PDCA 1TV8A 2QDDA 3IRDA 5K3VA 2QCCA 3SFWA 5AVNA 3UVIA 4BQ5A 1O68A 1OIFA 2BOGX 3KS6A 4PUDA 4X63A 1CXLA 3H55A 3R8RA 3DAQA 4XAFA 3QSRA 3RPDA 1FCBA 1V5XA 1OINA 1JYVA 2EKCA 1Y5VA 4XKYA 1IR2A 1AMKA 3OGRA 2B81A 3U8GA 1BWKA 2O9TA 3UZXA 3VGDA 3LI1A 3CHFA 2NQHA 2DQXA 4HHPA 3MUIA 2QF7A 3S8HA 4IG2A 2W9MA 3IGUA 1OG6A 1KXVA 4BQ2A 2F2KA 3ME3A 3WNMA 3NL3A 4IMGA 2E6DA 2DV0A 4GBDA 2GVLA 3BWWA 1M41A 1HJVA 1YNQA 4XKMA 4QP0A 3UT0A 3MT1A 3T8QA 4N7QA 4GIAA 2QDEA 4S3CA 1IQ8A 3DDMA 3OQ8A 4EF8A 3L5LA 4OHQA 2W61A 5GQBA 1EEXA 3IAPA 1F6KA 3G0UA 3USBA 3AMDA 3IGHX 1UUOA 5AY7A 2UY2A 3LRLA 1OT1A 3UZ5A 3O07A 2CIPA 2ZRWA 1NOWA 1Q13A 1JZ5A 3GTFA 2A3CA 3TC7A 3WNOA 3GY1A 2V2HA 3FAWA 3GFXA 1HF6A 1QW9A 1ODUA 3IUHA 1DIDA 1TZZA 3GDMA 3PPGA 3ZJ8A 3TJLA 2QVHA 1XFCA 3V4BA 4WOQA 2Q6ZA 3BW4A 3GXDA 5FJRA 7REQB 4LTSA 1FWSA 1P0NA 4DJDD 2POTA 3FKKA 1U2YA 4UFHA 4C6DA 3O6YX 3VDHA 1SFTA 3STEA 4XK2A 2G8ZA 8XIAA 1LRQA 3HPXA 1CWYA 4GXMA 2R1LA 1PDYA 1HX0A 1XIIA 4PB5A 4EAYA 2V3FA 1UH4A 1ZNNA 3W1TA 2WHJA 5FAGA 1IEIA 1VP5A 1E1EA 1PZ1A 1TX0A 4OBRA 1P1MA 5E9XA 3L67A 3IJLA 4NZ1A 5JXQA 1VJSA 3L4XA 1AL8A 4PMVA 5KTLA 1BRLB 3ZJ6A 1W3LA 2ZA2A 4ENLA 3EX3A 3W00A 1F05A 3HOJA 4F0HA 4CQCA 5M1TA 5C7VA 1XDMA 4A3YA 1IGSA 4QJ5B 4WSKA 3PANA 3WBYA 4X22A 1KFWA 4QCFA 3NEVA 3SIMA 3ALFA 1KBIA 2VUYA 5FF0A 3H54A 4JIQA 2V63A 1CW2A 1DJWA 2Z28A 2CETA 2W63A 3W7EA 4PBGA 4I6VA 3THQA 3AAMA 1NTHA 3CT7A 3RU8X 3FVMA 1FH9A 4HYVA 4AD2A 2ZX5A 1PXGA 3NPUA 3AMKA 3BOLA 3GZ3A 3FW6A 1CGYA 4HQVA 2I5IA 1I1WA 3G1RA 2OCZA 3SUUA 4AHOA 3SY1A 4MZ8A 3NXFA 4B3ZA 1DJZA 4UQAA 1OVDA 3AUOA 2I9EA 1Q45A 3FGCA 4RDVA 2ZADA 1BXCA 3UJ2A 2CWNA 4AD1A 3FYPA 3OVGA 3FJ4A 2VUNA 4JKMA 3P5YA 4HOWA 4HZMA 5C71A 3MHGA 3S6TA 4GFSA 4LS2A 2A3AA 3FX4A 2VQUA 2FMNA 2VD8A 3QKEA 2VC5A 4QAWA 4LBRA 5F2IA 3FJLA 5GJPA 4F79A 3M7SA 4XIAA 3GBEA 2Y24A 3G1VA 4UCGA 3CV6A 3O1NA 4LYKA 5C9WA 3AXMA 1EBHA 3OO2A 1PHWA 1T7LA 3IRSA 1QK0A 1HNYA 2ACUA 2P3ZA 4I9MA 3VZZA 2J9YA 3GXIA 4R53A 2CLEA 4JTLA 1KW1A 3RHGA 3BJFA 2PTXA 4FX6M 4LX4A 5E6ZA 3C8FA 1FWCC 4D6JA 4HOXA 4AF0B 1PTDA 1IXPA 4DO6A 3S1GA 1ZLPA 5JVLA 2HXUA 4JN6A 4MWAA 2FPYA 5CC6A 1W9VA 4AWTA 1X6LA 2FFIA 1J01A 3AZTA 1EXBA 3S9IA 1XIJA 2O7SA 5TIMA 5HDRA 1UJPA 3PC0A 4KEVA 3QZEA 4AW7A 2A7NA 3WQ4A 5I03A 3EB4A 1VKFA 4PFHA 4CQDA 1DXIA 3CUZA 4WQ6A 3TWBA 1TPVA 3TYDA 3TYCA 1GT8A 4JZ5A 3RX3A 3T0CA 4LF1A 3CMGA 1NDZA 5HQEA 1EJSC 2H90A 1PVNA 4UOZA 4Q4QA 1UKOA 4GZEA 4US6A 5HATA 2VZUA 5HR6A 4JNZA 3C2OA 4G2DA 4UIOA 3GH7A 5IOBA 3BQ6A 4BK9A 3LNMA 2J7DA 1V0KA 4J2MA 1G5AA 1TE1A 3NQDA 1H2JA 1RXOB 4JXCA 1M03A 3LK6A 3LCFA 3ZR5A 3KHDA 4E6MA 2I57A 1XM3A 5D9NA 2VQTA 4AWUA 3THUA 1PV8A 1Q6DA 3RX4A 3VZYA 3W84A 4XZLX 3P81A 3CV2A 2A85A 3FOKA 1UR3M 1LTDA 2HCVA 3AXHA 4UQCA 5G4EA 3KWSA 1M04A 1EWEA 2OKTA 1EIXA 1CLVA 5FL1A 1TJ0A 1OFOA 3EKZA 4CVWA 4NRRA 4IH3A 3A64A 5HPCA 1W2PA 3ABZA 3URBA 1OC5A 2OKOA 1OYCA 3GUGA 4YWSA 3SY8A 1XIDA 2F6UA 5EYWA 2J9ZA 2WZMA 4C7FA 1KXHA 4C6BA 3I7QA 2WWDA 1LOSA 4PCPA 1A0DA 1AJ2A 1FUYA 3RLUA 1Z32X 4Q8NA 1US0A 1JCXA 2NLIA 2Z1SA 1HTIA 4AWSA 3LPPA 1AJZA 3LXCA 4H04A 4OZOA 4XD6A 4C6PA 2CWXA 3V0SA 1QPRA 3JR2A 1FCQA 4V15A 4UFLA 2XVGA 3NVDA 3B8VA 4K8HA 3UYIA 4FIRA 3DBNA 3H12A 3W2JA 5EMJA 4F4RA 1ONRA 1I75A 4K8EA 1XR2A 3UD6A 3MS8A 1R3VA 6XIAA 5AYYA 3FYOA 1PIGA 1N8IA 5B7ZA 3ABXA 9CGTA 1B3YA 3WZ0E 3RM4A 1TX2A 4B5TA 1JGIA 3PZNA 3E02A 4BWLA 3S2MA 2J6XA 2WZTA 1THFD 3O6DA 3FJNA 3CQ0A 3BLOA 3LY0A 3RO6A 3ZLHA 8TIMA 2H6RA 4P7RA 2Z25A 3HPZA 2GDVA 1R2SA 3PG8A 1R30A 2D69A 2WBKA 3BH4A 2VFGA 4YN5A 4MM1A 3VD9A 3IVSA 4GO8A 1LG2A 4QIUA 3AWOA 2PDUA 1JYXA 3NM1A 4LGXA 1EB3A 1PYFA 2VEFA 1V03A 1NSJA 3L5AA 4ZB5A 1JAKA 1DPMA 1IT8A 2DJLA 4ADTA 5DO8A 2POZA 1J6PA 3AC0A 3W7IA 4JNMA 1F6PA 3GDBA 1A49A 2VTFA 5ABHA 1DTUA 3OBKA 3CU2A 1RBLA 1TWZA 5EL1A 4HSHA 3SCSA 2F84A 3R1ZA 1V02E 2DSKA 2V5LA 1O66A 4M51A 1VBHA 3NPVA 1X1NA 4H9UA 2NUYA 3MV01 3LZ3A 5HNRA 2WAGA 2DIEA 2JKEA 3UU0A 5EU9A 4L6HA 5CGMA 1JRCA 1AL7A 3CHEA 4PR4A 1EP3A 1C3FA 1XYAA 3UG5A 4FS9A 1LOQA 4AXKA 2OSYA 4RZ5A 3TEVA 1MUMA 1Z3NA 3W7HA 2DZWA 3TR9A 2OR2A 1VFOA 2CERA 3PY2A 3SRDA 4O1FA 3E9AA 3EWYA 1FH7A 2YCKX 2YSWA 2AKZA 3MY9A 3CTTA 1L0PA 3RG6A 1V7AA 2BS9A 3EOEA 2CZFA 3QV9A 2I5GA 1GOKA 1S5NA 3Q67A 1UQYA 4M6UA 3TK7A 3ZT5A 2WVVA 5KZEA 4Y8EA 2X1RA 3IJ7A 4BI5A 3N2CA 1QW7A 1FKWA 2XFYA 3PBYA 1M7OA 4RPQA 5J04A 5FEWA 1X7IA 3N12A 1HJWA 4FF5A 1FTXA 1UUQA 1JCNA 4AVOA 4IQLA 3DFNA 1BXBA 4GJ1A 2FZ8A 1GUVA 3DC8A 3GHUA 3PBUA 2ON3A 3NTYA 1BKHA 4JY9A 2E5CA 4TMCA 3B8TA 3N2BA 2BNJA 5BWFA 2PMQA 2UY3A 4PTDA 3CHVA 2VEKA 4P2VA 4CQ8A 4RKAA 3GU2A 3KEHA 2VFIA 4QG8A 1YIXA 5HULA 5LIYX 2W66A 1UZ4A 1UBPC 4LRSA 1U22A 3R43A 3MMWA 4GIYA 3AISA 3BCDA 2NUWA 3FJ6A 4GH1A 3E2SA 1OFDA 5BYWA 4UTKA 4YHEA 1KBLA 3AOFA 2E1DA 2BP1A 4OT7A 3B0UX 3MV11 1ICQA 1JZ6A 1K9DA 3F2BA 1OADA 2VC7A 4K68A 1BYCA 3LPFA 2OSWA 4XZWA 3A24A 5JIPA 4TV5A 5MKGA 3M0HA 3VDAA 2BY0A 3NDYA 3OHMB 4XD4A 1A4MA 2BVDA 1T96A 4NYYA 1WP6A 3KCOA 4ZXOA 3EDJA 3TTEA 4DI9A 4WF7A 1XKJA 4LS0A 4B3LA 4N9BA 2W92A 4L4MA 4IFRA 4XO7A 1Y0EA 4GYFA 5CZSA 3TJIA 3T2OA 1QO5A 1A5LC 1SPQA 1OCNA 3LQLA 3PZQA 1YW1A 2J74A 4MFDA 4I90A 2Z0IA 5IDIA 1FHDA 2EJ1A 4MTVA 1V7YA 5KETA 2AGTA 1HW6A 1G69A 2OQYA 2PRMA 1FWWA 3BQ5A 4DJED 2PI6A 1ZGDA 3TYUA 4XKYB 3KL0A 1TG7A 2OLAA 1JRBA 2CLKA 5AC6A 6TIMA 3TH6A 5HMFA 1E15A 3B40A 4ICMA 3VKDA 4NJKA 4H9YA 4IG2B 4XG1A 2DUZA 3GR4A 1LZOA 2WHKA 4BF5A 3W0KA 3EMZA 1IXOA 3KOXA 1HKMA 4EPBC 2NV2A 1HJSA 3B05A 1VENA 3PJTA 3CIWA 4GINA 1P6BA 1O95A 2OYKA 2BLEA 2XFFA 3PK7A 1W91A 1IF2A 1IIGA 3O05A 1I2PA 1V6YA 3HGRA 4P7OA 1EZ2A 1V6WA 1KM0A 3OJGA 1T5AA 1RZMA 4DI8A 3PVFA 1DIEA 1XBVA 3KTCA 1SSDA 3Q37A 3GD6A 1TIWA 1DJQA 2H9AA 4JKLA 1WKDA 3UPWA 4X0VA 4RJEA 2WVUA 2D1ZA 3W2KA 5DMMA 1K7EA 4UFMA 5F4WA 1H7OA 3EXSA 3EEZA 3REQA 1LF1A 3W25A 4GA8A 1F5ZA 1I2NA 3VOCA 1W54A 4LANA 2VX4A 4E2OA 2G3FA 3C3NA 5T9BG 1NP0A 3WNKA 1RJPA 1V6TA 2Z00A 5FJIA 2CZDA 3TA6A 4C1LA 5JH1A 1TPC1 2XDFA 3CZKA 1Q63A 1CLXA 1JEZA 4Z0JA 1KCLA 1WDDA 5GPRA 1W9PA 3SBFA 2P8CA 2P5NA 2J8TA 3AYTA 1VQTA 1IGWA 3VUPA 1WB0A 2PZNA 2PC4A 1QWGA 3PG9A 1KFEA 4O0ZA 3KUMA 3UGRA 5HMSA 1RA0A 1PAMA 2FJKA 3MU7A 4IM4A 1XYCA 5DANA 1KBBA 4DO5A 3SUTA 2XH7A 1QJWA 3M46A 4LRTA 3N73A 2YDAA 3LTYA 3CUFA 4QE1A 3MUAA 1V79A 7PTDA 3GNRA 2HS8A 1EYWA 2ZXDA 4H3DA 3RJXA 4A8IA 1TJPA 1OCJA 2C19A 2BG5A 3F4VA 3EA3A 4ZOEA 1JCMP 1YX1A 2J75A 2A0NA 4JIIX 4H00A 1U30A 4M1RA 3T09A 3NURA 1E51A 3EDFA 2IPFA 3NAVA 1UD6A 2G3NA 2ZFAA 1ZFJA 1DJNA 1QI0A 2C16A 2PU1A 2DVTA 4ML4A 3ZR6A 1IZJA 1MYRA 3OGSA 4FHAA 1BF2A 2NXGA 5I23A 1ZUAX 3W1QA 3VABA 2VRKA 3W1XA 4C1KA 3GLCA 3BV4A 1G4TA 4R88A 3HB9A 1EJUC 4QHRA 1NWSA 1MQRA 2D0HA 2GWNA 3MB9A 1KFLA 4LUJA 4O0KA 4A4AA 2BDQA 4A29A 3V0TA 3AIVA 1JPHA 4PBEA 3LI0A 1RCQA 3OQEA 3G1FA 1XW8A 1F61A 4Y9AA 3M64A 1CXHA 3G77A 2WSRA 3RO8A 4PCNA 5BRPA 4KBXA 4P8XA 1DWAM 3ITGA 2BV9A 2FTYA 4ZFMA 1QU4A 4AY1A 5I5RA 3LZ5A 2RAGA 2J9XA 3TVAA 3LOTA 4U2YA 4HYWA 1FP8A 1POKA 1SFSA 3A13A 4N42A 3EKLA 2OEJA 4LNYA 2QIIA 3SGUA 3DGBA 2FZDA 4IP4A 3PZOA 4W87A 5CEWA 1CGWA 3W7PA 3P6LA 3URAA 1XG3A 1JG9A 1CXEA 1OJXA 1MO0A 3A23A 2JK2A 2EBNA 1S5WA 4J5NA 1R8LA 2DJXA 1AVAA 1TO3A 3UCCA 3P14A 1M53A 5I06A 4JR5A 3LXAA 1IEWA 5D32A 2OZ0A 3H21A 4EE9A 2ONEA 3VI2A 4ASTA 5LNRA 5AOUA 1UR8A 3B0VC 3HMCA 4GLEA 3VCCA 4AD5A 3QC3A 4US5A 2XM2A 4TVCA 1SW3A 3ERPA 2G50A 3GVQA 1TV3A 4MJ2A 2EHHA 1EA9C 4N9EA 2QT3A 4YTRA 3TN6A 3NOEA 4XBKA 4XIMA 2WJEA 4AZ7A 5HJXA 2Y8KA 4GKTA 4MSSA 3KP1A 2E5DA 4AHQA 4JTDA 3WDIA 2EG7A 2YXGA 1QWKA 1M6JA 5K4XA 3ZLFA 4PH6A 5K9XA 3B4YA 4QE5A 3CWHA 1XCXA 2NXHA 3EGJA 3THDA 3W2NA 1L6FA 2VOMA 3CAVA 3L4TA 1MEWA 4H2HA 2WC7A 1YDVA 3HIJA 1HKKA 3UFYA 1R3QA 1F6YA 3EB2A 3VFCA 3UXIA 3SRFA 3LUTA 3TA9A 3W9ZA 1MRQA 2VJXA 1W31A 3FCPA 2WMGA 4POCA 1YADA 1ZAIA 2G97A 3B9EA 5HPOA 4NQ1A 1XISA 3WD3A 2ZA3A 4MVAA 2CBVA 1P7TB 2H8ZA 4IP7A 3FA3A 3VKBA 3UXKA 5D9PA 3GB6A 3QFWA 1WBHA 1H5YA 1X98A 3KVKA 4LVBA 4DO4A 1SVDA 2D0FA 4ZSTA 1ZU8A 1I2QA 4RW5A 2GOUA 5H8UA 3T8LA 4ERGA 4IX2A 3KTSA 3S0CA 1OFPA 4QNEA 3VMPA 2W0UA 1XC6A 4UTTC 4DPPA 4QX4A 1LUCB 1G4EA 3V35A 2HXTA 3BLIA 5BNKA 1RLCL 4IL2A 4FXJA 3W53A 2CXEA 3N13A 4H7ZA 5A8QA 1F3EA 3LLXA 4DUXA 5HBFA 4H8HA 4CQAA 1CGTA 3WLQA 1WXYA 2PP0A 4LFYA 2J77A 3OIHA 1DOSA 1X97A 3QGAC 9XIAA 3BE7A 8CGTA 1E55A 3WLHA 1PKLA 3SY5A 4QNWA 5AYBA 3W71A 1FWAC 1SGJA 4ZZ9A 1CB2A 4FNPA 3WF3A 3DHPA 1DHKA 3CIVA 2QJMA 4IQJA 2VHLA 4UR9A 3ITCA 3ZT6A 3OEXA 3VK5A 4Z17A 4DM2A 1PDZA 2IQDA 1LLOA 3LCWA 1MQPA 1HL2A 4UTWC 2X7WA 1XD0A 1QPOA 3WMCA 2XJ7A 3ISIX 4O50A 4V2XA 4K1WA 2PZ0A 5E9AA 2Y8VA 3R94A 5BOEA 5TAOA 3QPYA 2OWCA 1H11A 2ZQ0A 1G01A 4ORMA 1MUWA 4S1FA 3B3DA 2BGQA 1HJQA 3OG2A 4XV0A 3IARA 1B57A 1RY8A 5HR7A 1C7TA 2VC9A 4UNLA 3OLGA 3ZQ9A 2G5WA 4FMVA 1W9DM 2ZZ3A 1SJCA 2UWFA 4C6CA 5I02A 3ZR4A 2JGYA 2GPTA 2X1UA 3DFQA 4B5UA 1QATA 1OCQA 5GNYA 4JDYA 3RMJA 3AIQA 1FWNA 1QAPA 1KGWA 1T40A 4AD0A 2C18A 2BXZA 3HG5A 4HNCA 3CZJA 4RV8A 2J7FA 4G9PA 4Q4PA 2PRHA 1UWQA 4MPQA 5E70A 4PL2A 1YQ2A 4UNIA 1LOLA 2ATSA 1K77A 4TX8A 4C7GA 1V3KA 1TTQA 1A5UA 1E0VA 2VEIA 4H4IA 4GX9A 4GOAA 4RE3A 1WPCA 5MHBA 3GXTA 1CPUA 2WZHA 2WPBA 1QTWA 2ZWZA 4W7VA 2GGGA 1DJIA 2XVNA 1UR4A 4P61A 2XSAA 1MRAA 3CIXA 4Q8TA 5FL0A 4UWMA 3LV6A 3SCQA 3TX9A 5F7UA 1UASA 2ALRA 4GWEA 4DXXA 2WXDM 3DUGA 2D20A 3G0SA 3D6NA 4AC7C 3VX1A 1J79A 2YCJA 4MADA 3O6AA 4AYSA 4I5RA 1OGGA 1UHVA 1JZ8A 1AODA 3W7RA 4CD8A 1J9YA 1A0EA 1XF0A 1RK6A 1XLEA 3M0XA 1XPGA 4W7UA 1LWJA 1QMLA 4DJEC 3H2NA 1UH3A 1GEHA 2VGBA 1AG1O 1J5TA 3L23A 1YLVA 3N29A 4QLLA 1C90A 5D37A 3TWAA 1WKYA 2QCFA 1BHGA 4ACYA 6REQA 1X38A 2DP3A 3QN3A 4ZQOA 4M24A 4DM1A 3FA4A 2IW0A 4PTNA 4QTGA 5E09A 4R7OA 2PLCA 1V08A 4DWSB 4Q32A 1S2TA 3SCPA 1W56A 1DVJA 2A5HA 3VMOA 1SW0A 4GI6A 3TTSA 3KRBA 1WO2A 1KRBC 1WZAA 4WLCA 4GQBA 3QXBA 3K1DA 2FFCA 3SJ3A 1GTHA 3UW6A 3CUIA 4DIAA 4HNUA 1OK6A 1F4HA 2WKLA 2QPSA 3QQ1A 1WUFA 1TVPA 1XLFA 1VH7A 3P82A 3P67A 4YPJA 2BXYA 1M7XA 4ZENA 2IXVA 4D6FA 5GVJA 3QY6A 4J28A 3N9SA 1OX4B 5FCZA 1IEXA 3AFBA 4PA8A 1S5MA 3QZAA 3WDJA 1J4EA 1NDYA 1LQ2A 1Z9AA 1GKRA 2EPHA 2OFJA 3NQFA 2Z27A 2EPNA 3ZWTA 1W9BM 1VS1A 4L1XA 4EP8C 2PODA 1VFTA 5HQMA 1FWRA 4L4OA 6XIMA 3U2EA 1S2VA 1NF0A 2QXWA 3T1GA 1OG0A 4KEZA 5TNVA 1F9CA 1TR9A 1OFEA 4L64A 3E12A 4CUCA 4QR6A 3U4FA 1ADSA 5REQA 2WOQA 4AFYA 2GVEA 1VYRA 3EPMA 1T8XA 3W74A 1TMHA 4EWJA 1JI1A 3DCPA 4R34A 4BQ4A 1A50A 3G1XA 1VEPA 2IKIA 1TELA 1HL9A 4U28A 4NX5A 3WUGA 4JIRA 1QHZA 1FVPA 1XRTA 3N17A 3WH6A 5BMWA 3F1QA 3SECA 4ES4A 2Y61A 5CH9A 3KBSA 2XTKA 5IHRA 3H23A 2QUMA 2QW5A 1LL4A 1C8YA 4AISA 4I8DA 1SR0A 4ZO9A 4U2ZA 3EOLA 1C8VA 2V5DA 5HJYA 2WCAA 2V3EA 3FNDA 3ATYA 2PWUA 5EB8A 2XH4A 1ZENA 1B3ZA 4IJRA 2H9AB 2BY1A 5BOOA 4R85A 3CEUA 1VYSX 2YL5A 1W1VA 4YTTA 2PDBA 1E4NA 4G5DA 3TAKA 1EA0A 3L12A 4HBKA 2OZTA 1WZKA 4GY1A 3REQB 3STFA 1MW3A 4B2DA 4LCQA 2RUSA 1CLKA 3ABOA 1KFKA 5CBBA 3SIZA 3K30A 3OZOA 3CZEA 3EDEA 4H9XA 3VVGA 1XIBA 4J35A 3THCA 1UPMB 3HV8A 4DAFA 4MDPA 2O9OA 4UB9A 5F2LA 2ICSA 3GUWA 5AVHA 2G96A 1J5SA 4XSLA 3WH7A 5BZAA 1DJXA 4CU6A 1TWDA 5H6HA 4NNCA 4MOZA 2X30A 1R3SA 3B9NA 2OODA 3R6IA 2VT0A 1FWHC 1LL7A 3P60A 1US3A 4DBDA 2EGZA 2XINA 3SCOA 1LG1A 5F4XA 3OZMA 1TSIA 4LWWA 4HMDA 3AHYA 4PB3A 1MXSA 4IISA 3T55A 5H91A 5A6KA 1RY0A 1JDFA 5KZMA 1A47A 1UWSA 3PPHA 3EXTA 4JTEA 4TQTA 1Y5WA 4ZQRA 5A8PA 3K4AA 4O12A 1P48A 3QEZA 2ZXBA 1PB0A 5JBFA 4S3JA 4P8UA 1YTEA 5JUVA 2WZIA 4FF7A 4HNLA 5CC7A 4PCSA 4RE0A 5FAJA 3WLLA 3BMXA 4YTQA 2ZBTA 3AYRA 3KW3A 4CVUA 1YXDA 1X8FA 1R9ZA 2WMIA 5EGRA 3YPIA 4V1XA 1EX5A 1FDJA 2GLKA 3OLDA 3CJPA 1EJWC 4H9VA 1E9YB 3AIEA 2ANUA 3BSMA 3I6RA 4OQVA 3ITXA 2R1MA 4CQ9A 1L6YA 4WSHA 1TV7A 4B16A 4HU4A 4JBRA 1UROA 2QZRA 3G1SA 5TBOA 5EKYA 3B9AA 3GNXA 1F8MA 1S1PA 1RVKA 3F7JA 5C9XA 4Z42C 4H8NA 3MSYA 1AW2A 4HZ8A 3TN3A 4MAVA 2WWCA 3UPMA 3TYZA 1ZPTA 2ESCA 1Q7ZA 3P5ZA 3ARTA 4M81A 4KFPA 4FX7A 5CJMA 4QCEA 4RXFA 3HJZA 3DFYA 3MUCA 3BXWA 4NZCA 2YX0A 3TW7A 3R0KA 4H9MA 1PEZA 2Y5JA 1S5TA 4R9OA 5CBJA 4ZO6A 4MY8A 1IYXA 1KNWA 3WH8A 3TC3A 4XZ9A 2V9DA 1RK5A 3NR0A 2GGEA 3AUJA 4UTJA 2NWSA 5L6UA 2BZNA 1CX9A 5I78A 3WLMA 4B9ZA 3TJ4A 1NH6A 5EMYA 4AYGA 3BCJA 3N4AA 1BWLA 2JIEA 3MMTA 3R10A 1KWKA 4AY8A 1E1FA 5CG7A 5IXEA 3DXIA 2PDJA 3VNKA 5CJNA 3PTMA 2ABAA 2CLMA 2PWEA 4EK7A 3M5XA 1ZTVA 2YCLA 4DQWA 4YYFA 3PB2A 3NM3A 4IPLA 4U33A 3LCXA 2X2YA 4MNMA 3EPOA 4B2DD 1T41A 4FEZA 1PZ0A 2I1OA 1K3UA 4IPJA 1QNPA 1VFHA 2QULA 3DIPA 4HD5A 5BXRA 4MKSA 5EFDA 4MKVA 4LBUA 5CSYA 3WEMA 1XLCA 2YIHA 3KVLA 4MB3A 3VNLA 5BRQA 3FDGA 4FR1A 4DHGA 4S3BA 5TF0A 3LM3A 4U10A 2OB3A 4Y96A 4C1NA 3RCNA 4NZJA 1JYWA 1YTDA 3NDZA 3GYEA 2ALDA 3GTIA 1XDLA 3M4HA 1UD2A 3BSHA 1Q6OA 1EC7A 2PDPA 3F2CA 2PS2A 4OOUA 1XYZA 1EIBA 4E2BA 2I17A 3SCTA 1AQFA 3SCWA 3M1ZA 1AJ0A 1MDLA 3ICJA 4ECLA 3MSGA 4Q33A 5M03A 1J0IA 1W1IE 3WQCA 4UQEA 1KGUA 3FVDA 1HVQA 1GPWA 3A6OA 2FZNA 1K1DA 5DEZA 1XLLA 1GQJA 3D3FA 1Q6QA 4E4FA 2E6AA 3U5UA 3GS6A 3NPWA 3W1NA 4MB1A 1QOQA 1ITQA 3R79A 4OBTA 3O9NA 3UBPC 2OT0A 3LERA 2WSPA 3EMCA 1H7XA 2XUCA 3KOYA 3SURA 4LVDA 4L6DA 3BGJA 1QR7A 3FAXA 5LZLA 1ICPA 3O6CA 4FK9A 3KFTA 1BVWA 1EC9A 2BHYA 2JF7A 5G2HA 4C6EA 3AXIA 1D2KA 4O57A 2WCSA 1UR0A 4RNFA 3FHQA 3CNYA 4FSAA 5F4SA 1K6AA 1TTJA 3WLKX 5AFDA 3HURA 5FEZA 3C0JA 4UFJA 3I3BA 4DWSD 1OEPA 4HU3A 2PE4A 4HOZA 4DXVA 2DUXA 3TDFA 2TODA 4MHBA 5GNZA 3E3HA 2ZRUA 3BLEA 3GDLA 3CQHA 1AA1B 1YNYA 5BWAA 1DXFA 4J3VA 3V1HA 4NHVA 1OM0A 2YBVA 3WF1A 1IV8A 4BZYA 4GY7A 5T9CE 3M5ZA 3UETA 3ZVHA 2E6YA 1NDVA 2TMDA 3KRUA 2I5QA 1W5QA 1H1ZA 4XX6A 4XUGA 5LIKX 2JFEX 3DKJA 1GGOA 2NV1A 3DYPA 5I77A 5LHFA 1MVYA 4GC3A 5BU9A 5J5RA 4AH7A 1OCBA 4AVFA 1V8EA 1CGXA 1D3GA 5E6YA 3U2ZA 4GGBA 3PM6A 1E6RA 1RCXB 4UUIA 1QPKA 4KCWA 5E0KA 4F0MA 1IWBA 2NVCA 1IR1A 3IPWA 3SUSA 2JE8A 3KL3A 2XM1A 3SJNA 4LY4A 3DHDA 1D9EA 4Q4MA 2ZIDA 4WD0A 1KXQA 4JFVA 3GVGA 1M1BA 2KAUC 1FDYA 1UWAA 3W82A 1A3XA 2JGQA 4Z2LA 4HTBA 1AZ2A 3BAKA 1PX4A 2VNCA 4E2VA 1TVLA 5DCEA 3WK3A 2ZZ7A 4MMWA 4OWGA 4RLIA 4HMCA 1YDNA 1J2BA 4BR1A 4OVXA 3U2OA 3WL0A 7TAAA 2AL1A 4C6JA 1UA7A 1JCTA 3UR2A 2C7FA 1LCOA 3B06A 3TYAA 3O0FA 5DBUA 1OYBA 2FHCA 3MI6A 3DKLA 4NZFA 2NWRA 4TR9A 2DORA 3MSRA 3T0BA 1IZCA 3W38A 1AK5A 2TRSA 4N4QA 3EWUA 4YXGA 3AJ7A 1TPWA 1XBZA 4GHRA 4PBFA 1HO1A 1TWWA 3WUBA 3WLSA 1EDQA 3CWNA 2Q71A 4MF4A 2ZDSA 1UBSA 4RZ4A 5DRCA 4Y2WA 5FF3A 1EGZA 3UGVA 1BQCA 5G1TA 2ZE0A 4PUNA 3RIKA 2ISVA 4AXNA 3SN4A 4GZ7A 4AAJA 2OMAA 4JQAA 2HJPA 3MPGA 3JW7A 2E7FA 3W86A 4XZIA 2ISFA 1OT2A 4UNKA 1E1CA 1UIOA 2Q8LA 1R47A 1H50A 4FP1A 3W6YA 1T0OA 1L6WA 1J0HA 3AHZA 3E0FA 2E0PA 2VKZG 3SO7A 2SFPA 3G18A 3K13A 1CEOA 3VCNA 2KZHA 3Q2DA 4Q3MA 3STPA 2RDUA 3LLFA 4D6IA 4GJJA 2QEZA 4BF7A 3TC6A 3CASA 2PGEA 3CL6A 4JAWA 3VDGA 1OK4A 3LGDA 2J66A 3BLPX 2QCDA 1FXQA 2F6XA 2XN2A 4UMAA 3PP7A 5D8WA 1WCGA 4IIDA 4GZIA 3NEHA 3CO4A 2VRQA 4WJXA 3IV8A 3DC0A 3WF0A 4QAIA 2D24A 2V69A 1RP9A 3W24A 2F9RA 3LTPA 5HANA 2TPSA 6REQB 3H8AA 4GH3A 2X42A 3POHA 3WYZA 2EPOA 3DESA 3R58A 4RUBA 2DT2A 4DBEA 4KCUA 1GOWA 4GC4A 1DWIM 3U9IA 3A22A 4FPSA 3GNDA 2J25A 1UZHA 3OW1A 4CU8A 1CBGA 1NEYA 1F3XA 2ZXQA 4JTSA 1ZBKA 2FB2A 1SM9A 4RZBA 4J7RA 3P62A 4RDZA 3AU2A 5CZKA 1AW1A 4AQLA 1XYLA 3VKKA 3GSMA 4I7UA 4JTJA 3RR4A 2Z2UA 2WJZA 4YWIA 1C8QA 3GG0A 1TB3A 4GVFA 3PWIA 1UD3A 3B8SA 2ACSA 1D7KA 3UG4A 1W1B1 1FWIC 2XH2A 2DSVA 1R46A 3BTNA 1ME9A 3VMNA 2R8WA 4FLOA 2LLEA 1ECEA 1B2YA 5XIAA 2QCMA 3KTXA 5I3GA 2NX1A 1YPIA 3ID7A 3RCYA 1G7VA 1O7AA 4X3ZA 3W7DA 3LSCA 1FOBA 4IWWA 5HMDA 1HUVA 1JDCA 4IJBA 3VOJA 1UUMA 2HNHA 1SZNA 3WD1A 4JHOA 3V5CA 1P6CA 3TW6A 1B3VA 2J8GA 4A2SA 1K7XA 3AU6A 1QXLA 4LYRA 1LROA 5JBEA 3E5BA 3FSTA 4IHCA 1AQ0A 2NVDA 2ZUMA 2EPLX 5IFPA 3LU2A 4G8TA 3UCQA 4JYEA 3IUDA 2UBPC 5REQB 2A3EA 2DZBA 1VD6A 8XIMA 4EX4A 3MMDA 1KM5A 3S9ZA 1E9LA 2CNCA 3UXLA 5K2ZA 1PE1A 2V30A 3GAKA 3TJXA 3VUSA 1G4PA 3W3OA 3WK1A 3UR7A 2RGLA 2NQZA 3KLKA 4N6FA 1UP3A 1WDSA 1LBLA 1XV8A 2FDSA 3SUWA 1B5TA 3JZUA 3MVIA 4XD3A 1GVOA 3APYA 1JXJA 2YL8A 3AI0A 4B9YA 1H49A 2ZX8A 3CMJA 2HVOA 3AYSA 5DXYA 1BGGA 4XVEA 3B9OA 1GCYA 4QITA 1KBJA 2VEPA 4PE8A 2ZWYA 3EWZA 4NT0A 1EGMA 1Q7QA 2Y6ZA 3ITLA 4MFEA 4ZOAA 3QGVA 1QW8A 2DZTA 3LCLA 3PTKA 2Y7DA 3K8KA 4JTQA 3SN1A 1NAL1 4QROA 1NFBA 2GSJA 3TR2A 4JQ4A 3UERA 1W6TA 3CAWA 3KDOA 4MGGA 2WM1A 1PZ3A 2GQ8A 4X9SA 4PUUA 3WKZA 3WLPA 5A6LA 2J7GA 1F07A 2CBUA 4R9XA 3G1YA 3MHFA 3HG3A 3AS0A 4KRTA 3QW3A 5C9ZA 5EBAA 4XBJA 2IKJA 1QNQA 4FB7A 1PTAA 5CPTA 5T26A 2YLAA 1JCYA 3EEGA 3WO8A 4YMZA 1UPPA 2P0OA 3S2NA 4YTSA 1H7RA 4I3GA 3ALGA 2B0MA 1M5WA 1FWDC 4DWDA 2A6LA 1A5BA 5EA9A 4MUZA 2E67A 5A6JA 4UC5A 3TQ0A 1JNEA 3E5PA 1XH0A 5L9FA 4E0CA 5ABFA 1JUEA 1ZAHA 2FTWA 2IXUA 1BGAA 3GO2A 1NVMA 1KM3A 3W6LA 2VR2A 2HE8A 5I79A 4UQ9A 3PFRA 2VGGA 1F74A 4DBWA 2P50A 1N55A 5KMYA 1H41A 1Y7VA 2RJHA 2CCRA 1RJRA 2QGHA 2GZXA 4DJFD 1TRDA 1XWYA 4WIWA 3PZMA 1GVEA 1L8NA 4M29A 3GC5A 2OOFA 5DT7A 2YFOA 4J3ZA 4E3VA 5JU6A 3WBWA 2D0GA 2BSLA 4G6CA 4LH8A 4WDWA 3VIMA 1R5YA 3S1WA 3G8EA 4UR8A 4PEEA 1FHLA 3FA5A 4L7ZA 4ZBCA 3NZPA 4HPJA 5IDZA 4C90A 1GHSA 4HT3A 4J3UA 2X8RA 5C2XA 5A6BD 4WGXA 2OGYA 1EKOA 4O53A 4LSBA 4TXEA 5DMNA 4UTHA 2PBOA 2GFTA 3WQ5A 5IHSA 1EHAA 4DVOA 3Q45A 4GISA 3CQKA 3K4WA 1JGMA 3AZRA 2Z1BA 2EPKX 4HP5A 3LV5A 2AL2A 2WLZA 3WQ8A 3BLLA 2Y4SA 4JDBA 1EUNA 4UTMA 3P2VA 1Z48A 4TIMA 1I8JA 1OX5A 1ZRQA 1RBAA 3S5ZA 5CBIA 4S3FA 3EB3A 4Y9OA 1GONA 1LP6A 1NFGA 3VD5A 5H2ZA 1VCFA 4I5UA 2CKSA 3MYPA 1QT1A 2FHBA 1KXTA 3NWRA 1QPQA 3BMWA 1U5VA 2VR5A 4RK8A 4A3UA 1KFCA 5D03A 3PUOA 2WJFA 3EDDA 4O1BA 4NU7A 1I0BA 1EX1A 2NQJA 3VO0A 1ESWA 1U1UA 1FBAA 1W8SA 2QCGA 3W1AA 2CPUA 1EP1A 4WDUA 2G95A 3AS1A 3M0VA 3UZZA 2WNZA 1H63A 1X8CA 1V6UA 4PCTA 5BW6A 1Q3NA 1R3WA 2PDKA 5DMLA 3N04A 3IAQA 4LCSA 4K2SA 5D05A 4KT2A 2PDHA 1X1OA 2AMXA 2MANA 2QVNA 1MQQA 4U3CA 3TN5A 3W27A 1YHTA 5C9RA 4IPPA 3G0XA 3KM8A 1QCWA 3PFMA 1U5HA 4PMZA 4IMEA 3SCVA 4DWSC 1SZEA 4U4MA 1OF8A 3OODA 2PEVA 2PSNA 1YMYA 5IBXC 3G3MA 3UG8A 4Q8WA 1MFVA 4QJ4B 1KQZA 3A9IA 4XZHA 5G2WA 1K4HA 5AHNA 1H61A 3DECA 2REQA 1RQHA 2ZXAA 2DVXA 4D8AA 1B31A 2OWWA 2A2IA 2A21A 3U3HA 2ZZ1A 1OABA 3PAOA 4C6QA 5BROA 3DX5A 5AC4A 1I2OA 2YCIX 4LV9A 1L8PA 3BICA 4UXDA 5ECVA 4L80A 3ORWA 1VHNA 5FJTA 1XX1A 3NQGA 1G67A 1KKRA 4N6EA 4B4HA 4JFWA 4DELA 4ZB0A 4FO4A 1NARA 4WUIA 2RKXA 3BLDA 4WR3A 4JHZA 1B3WA 5A1AA 4ORIA 1CI1A 1HKVA 1BVNP 3W07A 2ZOXA 3VD7A 3NZRA 3DN5A 1GW1A 1UD4A 1V4YA 1VJZA 2ZUWA 2NQ9A 1CCWB 3GDRA 3WEZA 1V3HA 2GL5A 3USZA 3BC9A 2OVLA 3SQSA 3DOPA 4LJ3A 4WY0B 4I9TA 5A94A 3NL2A 2OO0A 2RDTA 5G4WA 4Q8UA 4JCMA 1R9YA 1VLWA 5D2YA 3QHMA 4JX4A 3E2QA 1UD8A 3V5OA 3ZJ7A 4I8YA 3CL7A 4L4LA 4JYDA 3B0PA 3CPRA 2EG6A 3ITTA 2J62A 1KC7A 3SGZA 2Q8ZA 2V3DA 4S39A 1V3JA 4DZAA 3UJSA 4C6IA 3MKKA 1V93A 1W3HA 1LBMA 3WJWA 3BL3A 5LIUX 4IQDA 2EKGA 4MZYA 3FY1A 4LS1A 4OIFA 4ZL1A 2R82A 4GJIA 3GVVA 4ZE5A 1P0KA 2Y62A 3L68A 5EMKA 4AMAA 4KH2A 4L9XA 4EOUA 3QOMA 3CTLA 5D9OA 3T2QA 3LHVA 5D02A 4DZHA 3S9YA 3ZVHB 3PSVA 3NA8A 1OD0A 1XRSA 3K8LA 4S2CA 5I6SA 2CLHA 1US2A 2PRLA 2CW6A 2GGJA 1E6SM 1ITCA 4JL1A 3I7RA 5BOFA 1TJ1A 3ZJKA 3RPMA 1UR2A 5CAHA 3BG5A 4ONVA 2VURA 3GX9A 4WJEA 1SJAA 1Z89A 3UJRA 2O56A 2V38A 1GW9A 2W5FA 1VBJA 1KV8A 1TPUA 1ZJAA 3SUVA 3UWZA 2OELA 3LPGA 1E4IA 1BTCA 4RW3A 4Y9MA 4PMQA 4PUWA 3WJSA 2YR1A 3V75A 1UC4A 4E8CA 4P7NA 1A4LA 3H2MA 3C8NA 5T8GA 3SEPA 4J2PA 5FJOA 3RYSA 2WK2A 3EX4A 1J10A 2CBIA 4AD4A 3NQ2A 4CU7A 3W1UA 1NDWA 4GUFA 1LM1A 1FDZA 2DQWA 4MY1A 2VD9A 1W32A 3TFXA 1WE5A 4CNOA 1JDAA 4BS0A 4L1WA 1RQEA 1ME8A 2Z26A 4H9TA 3FIGA 3N3MA 3CHDA 1FCVA 3OB8A 1GG1A 4DF1A 4MJZA 3NQ7A 4DNMA 3RF9A 4CNSA 2YDRA 3MP3A 1JD9A 3W22A 4JIEA 5D2XA 3Q65A 1PKMA 3WFLA 2CESA 4HPGA 3GDKA 2PP1A 1FWBC 1SQ7A 2NT1A 4MUPA 9RUBA 3H4WA 4UOJA 3A21A 4IF2A 4A3RA 4QS5A 1OD8A 2J88A 4NZ3A 4PMJA 3WQDA 7ENLA 3AS2A 3T7VA 4QG9A 1E1CB 1NIUA 4TTUA 1XINA 3IIOA 4FLQA 1NF7A 2E5BA 3LDVA 4U31A 4RDWA 3T81A 3MZ2A 3N9KA 4GABA 2R94A 3WQVA 4LEFA 4HU8A 3LNPA 5I09A 1GVFA 2E3ZA 3IWPA 1PS9A 4ROQA 3LSBA 3B8WA 2GVGA 2QV5A 2D2OA 3EWWA 2PTZA 4C60A 2VP8A 4A8NA 4KETA 2TAAA 2X16A 2C1IA 3P74A 3VE9A 3BLKA 5D9MA 4L6OA 1KRCC 2J7BA 2QCDB 3GG1A 4KKXA 4AG0A 2EEXA 1HT6A 2TYSA 3V1PA 4P5UA 1F4AA 3VGHA 4NZ5A 1GTEA 1OWQA 3CBWA 3VGGA 2WC3A 1JPIA 2YZ5A 3ANYA 5DQPA 4EIVA 2C15A 2I14A 2X05A 5AHMA 3QTGA 4INFA 2WVTA 3OBEA 2F61A 4E2DA 2AQVA 4WGHA 1GORA 2OTDA 4MG4A 1S2AA 3RX2A 4EKJA 5I07A 2YZRA 1QBAA 3GIYA 5FEPA 3E0IA 1TKKA 3W88A 1LDCA 5GJNA 3T4WA 1KRAC 4NJGA 3PJUA 3KL5A 1J0KA 4ZVJA 2J7EA 1XGDA 1KCZA 2ADAA 4ILSA 1NWRA 4W8AA 4A22A 1QI4A 2Z29A 3A3HA 1PHQA 2YB1A 4NAFB 3NQMA 3LMYA 3E38A 3WLIA 1JF6A 1J8VA 2HROA 2PPGA 2YL9A 1XSKA 5E1QA 5AN7A 3BZJA 1QI2A 1FFQA 3HPFA 2QKFA 2NQLA 3G3DA 1IWPA 1W9UA 4Q8PA 4FA3A 2CXGA 3S2CA 4HA0A 3WSUA 1S2CA 3NOYA 4YVXA 2CZEA 1K70A 2XZ7A 2WMKA 3FKRA 1RD6A 3KBJA 1GQKA 3APTA 1JUKA 5DCDA 1ITXA 4KEMA 4V27A 1TQXA 2OU4A 2J47A 3TQVA 2OPJA 4AIBA 4LU0A 1W3NA 2DY3A 1RV8A 3DYOA 3R0UA 2VXNA 3TCEA 1AH4A 3G1HA 3CMFA 2PWGA 4P8WA 3S47A 2J24A 3VE7A 3QR0A 4DNHA 3CWOX 1RJQA 3O3RA 1DJGA 3A12A 4F2BA 1WYIA 1JFHA 4Q6XA 1EBGA 2ZDRA 3FHAA 4L56A 3GU1A 4LXFA 4N4PA 5A8GA 1H51A 2PU0A 1W1TA 1H1YA 3W73A 1TZ9A 3PF3A 4G7EA 1KA9F 4JTGA 2I56A 2XFRA 3HQNA 3TSBA 4C5ZA 2CLIA 1CZ1A 4KEUA 1QASA 3TYBA 4UTTA 8RUCA 1XIHA 3VZXA 3T0DA 2XN0A 3BARA 2OX4A 4AEOA 1EJVC 4JTUA 2QNEA 5EY5A 4HIBA 2PDIA 1B0IA 2XISA 2PWDA 1GVQA 5D2TA 1OZMA 2G4JA 2XHYA 3CH0A 2DSUA 4OFCA 4RNIA 3KVJA 3RK8A 2QDHA 4NJJA 4GKLA 4DJFC 2ZUNA 4ZQPA 4CN6A 4TTGA 2XN1A 1V3LA 4H8UA 3RLGA 3LRMA 2BX7A 3N15A 2GQ3A 1UP0A 4GCXA 4UFKA 3NPXA 5FD0A 3L4YA 3T4CA 1W3IA 1CB7B 3V18A 3H7RA 1YTKA 1Q6LA 2CITA 3C2VA 4IUGA 1FWTA 3AMCA 1NOFA 3WD4A 2X0SA 3G5EA 4OKDA 3W7NA 3SSJA 4UTWA 4QSHA 2YXOA 5AECA 3URNA 4O15A 3SSZA 1VAHA 3TMLA 1RR2A 1EO7A 3OVPA 1XG4A 1ME7A 1PWMA 4AZGA 2GUYA 3MKCA 2FHFA 3ARQA 5DFAA 1LQ0A 2EPMX 2D2JA 1JXKA 1G4SA 5FF7A 2YBTA 2VELA 3H2AA 1XLDA 4N9DA 5RUBA 2V0TA 1XH1A 2VZOA 3WENA 4C6FA 1C91A 4IGHA 5CGTA 2C79A 3AICA 3PB0A 4W5ZA 2PLMA 4JN8A 3OLIA 3WMLA 1Q6RA 3ITYA 4QEHA 1UC5A 1GOXA 3P84A 4F0SA 1XRFA 1UR9A 5I7GA 4ZSUA 5FJUA 2GUUA 5EMLA 3D46A 1GQLA 1DJHA 2IMRA 2WPGA 1XS2A 2D3NA 1UIPA 5AC8A 2ZC1A 3R13A 5C2CA 3BPWA 4S3KA 1S1RA 3UQNA 3KXQA 1VPQA 3WFZA 5C8BB 2QAPA 2UV8G 5BXTA 2Z1XA 5SWUA 2PDQA 1WUEA 1VRXA 5I3DA 3RITA 5A2BA 3WQPA 1S5VA 4JTAA 1GVRA 1UJQA 2AOSA 1QPNA 3LRKA 1V0MA 1HJUA 1UW9A 1KV5A 3TLQA 5U7SA 4E3TA 4V28A 4W8BA 1P4CA 1DE6A 3QMTA 3T44A 1JDEA 4MB5A 3QGKC 1B4EA 1JULA 2D23A 2GJPA 1VEMA 3MC5A 5FOOA 3TYEA 1Q65A 1R38A 1XKYA 1UWTA 3W2LA 5LNUA 2ACRA 2CZ5A 1M01A 2XIJA 4QM1A 3MI2A 3JUGA 4XISA 4MDOA 4QISA 3MO7A 3N11A 3FK4A 3FN9A 5I24A 2YA2A 3OU8A 3HFTA 4PODA 1F2JA 1ZCCA 4DJEA 4PMNA 2PTDA 2VMFA 4CNPA 3NG3A 3WQGA 3M0LA 4PMUA 4D2JA 3L9CA 2OEKA 1DWFM 4O4VA 4YL2A 2AL2B 1GOQA 3EA1A 3BGGA 4JFUA 3NCOA 3GR8A 3A47A 4HCDA 4GYJA 2FDMA 5EPDA 4XAZA 1O5RA 4HZ6A 4M1BA 1LJYA 4KWSA 3MYOA 3WH9A 2IPJA 2X1TA 3QLDA 4AF0A 4UTLA 3C4UA 1KQYA 4IMAA 1J2WA 1WAWA 3D5HA 4XVDA 1R7AA 5HAOA 3HM7A 1EHNA 3F4CA 2Y85A 3M44A 3ENLA 4MB4A 2VRJA 1ML1A 1W1ZA 2ASHA 2Y70A 2VI0A 3A4XA 3ZZ1A 5CPSA 3TN4A 2C0AA 1S2WA 5AC7A 2YPIA 3FDKA 5DBTA 1XUUA 4FNUA 2VX5A 2YCEA 4HN4A 1OGBA 2X0YA 3W28A 4Z2KA 3VIGA 1TPH1 2DZAA 4Q4OA 4JIPA 4TO8A 4EPEC 3FS2A 1GKPA 3BANA 3WNLA 3KHJA 2C1HA 3ZT7A 3UCDA 5CPLA 3CB3A 5XIMA 2UY5A 5IRPA 4LW7A 3TXVA 3RAOA 3QC0A 4JX6A 2CYGA 1NQKA 3W7QA 3GNNA 4CLMA 4IT1A 4I7WA 2GJRA 4PEKA 3EX1A 4HA4A 2QUUA 3GFYA 2CHOA 3VC5A 3UNTA 2PB1A 3VDCA 3APGA 2PDNA 4H6QA 2HBXA 2FMOA 4EXQA 3AZSA 2BY2A 2EAWA 2Q02A 4IP5A 2E1WA 3W85A 3LLDA 2BFGA 1IXQA 4HNTA 3GHSA 5C7HA 4YVPA 1HVXA 5LGZA 3AYVA 1DHPA 2ZX9A 4BKNA 1NWUA 2HVNA 2E68A 5D30A 1JCJA 4KF1A 4B91A 4Q8OA 2Y8UA 2J79A 2DEPA 4K8GA 1R2RA 2H3BA 2G41A 1XYMA 2Z1KA 4IOTA 4LOCA 3WBXA 4LALA 1CGUA 3LENA 2ISDA 2G3IA 4QXIA 4AZHA 4MWAE 2YGYA 3KBVA 3QR3A 1VF8A 4O0QA 1ZCOA 3NL5A 4ALDA 2FZBA 2A3BA 3LHYA 3WELA 3TTQA 2V2DA 4YNGA 3RFAA 3OBAA 5G4HC 1JD7A 4W5UA 1UA3A 1ZP3A 2C91A 4Y7EA 5LIWX 3PHAA 4XAGA 4OUEA 2GK1A 4GIRA 3WH5A 3E0LA 4H2CA 5DY3A 3VIJA 1P43A 4RX0A 3MVTA 4LUSB 2G0WA 1GYNA 5LA2A 1HQTA 3W37A 1OX6A 4WXZA 2GDUA 2HE5A 3U57A 2DFAA 5KITA 1E5JA 1ISZA 3ZMRA 3UNDA 3L2MA 2VFEA 4Q4SA 2VCCA 1I9CB 2ZYFA 4LUTA 3P8JA 2ZZ6A 2CFFA 2B4GA 2WKJA 4KIEA 4AB4A 2BXVA 3STCA 3E2VA 4O17A 1ZB5A 3I68A 3VPLA 5FSEC 3L4WA 1R7OA 3VIIA 3HV9A 2PWHA 2GJLA 1DKWA 1EH9A 2E4TA 5HQLA 3EZ4A 4AMCA 1SUXA 2PF8A 2P8BA 4NI8A 2O4QA 4D6EA 3F4WA 3WDPP 4U5KA 5KZDA 2Y63A 3OA5A 3TNOA 3W7MA 4LPCA 2XIOA 2PA6A 4G56A 5DF0A 4JGDA 4X60A 2BMBA 2OEMA 4JFSA 1CXKA 3NZQA 3N3TA 3PPCA 1TJ2A 2HPMA 1L6GA 3NO1A 5FSDC 1FCUA 1R85A 4RDYA 1UWUA 1BG9A 1ZP4A 1FWJC 2WMHA 1HXJA 4AU0A 3CZGA 4PUJA 1YXCA 3W72A 3B8IA 5LXEA 3VXGA 3WX7A 2NV9A 4GNVA 2Y5EA 4WSJA 4KMQA 1TV2A 1J0JA 3KBNA 2WLYA 2Y7GA 3EYPA 1ZQ5A 2AMGA 2DW6A 1S2UA 4LV4A 4R3UA 5AHEA 3S1VA 1PIIA 3CGTA 5D2VA 2ZX6A 4DLMA 2V6AA 1XD1A 2J27A 3GTNA 1VBUA 1GVIA 1M7PA 2GVJA 5I00A 3ZVIA 4FOKA 3UA4A 2OSXA 1LQAA 1R87A 1A0CA 4H6KA 4W86A 3WG6A 3W87A 1ZSXA 2WZEA 5DX7A 4FNTA 4JTTA 4MYAA 1LORA 3WMBA 4X61A 1XIEA 1H0IA 1J0ZA 1W3KA 1ZBCA 4G7FA 1I0DA 2FYMA 3I10A 4V33A 2QYGA 3IGSA 4PC8A 1AD1A 2V82A 1HN1A 4HZ7A 3AHVA 1CT5A 1E5NA 1P5BA 5HUPA 1L2QA 4TX6A 3LCHA 4F0RA 3C0QA 1DL3A 1JZ2A 3GE7A 2PWVA 3N4EA 2O9PA 2PDMA 1VIWA 1EJRC 3S4TA 2PDYA 1Q4NX 3W83A 3JVAA 1UH2A 5HUOA 3BMVA 3CK5A 3WQ6A 2BGNE 1VFUA 2Q3OA 1QOXA 4ML9A 5LHEA 1WDQA 3IJ9A 3BK0A 3NSNA 1HGYA 3S83A 2DZUA 1GYMA 3FGCB 3ZXWA 1ZJBA 4C6LA 4EVZA 4NASA 3J7HA 3H6OA 1RHCA 3OZPA 4WY0F 5CPNA 1Q8AA 4LAZA 3V7PA 1ZALA 4O1AA 1Z42A 2PTYA 4F9DA 1D7FA 5CCZA 4AZ5A 3TIMA 1CXIA 9XIMA 1QOPA 4ZCWA 1K8YA 2G3MA 3PUEA 3WLJA 3HGOA 4PMOA 2Y0FA 1E6XM 3MBFA 3ATZA 4W9TA 2QCLA 4PUMA 3W4RA 1TA3A 3LXBA 3WMSA 2PUZA 4KWOA 4DXKA 1SO4A 4C7DA 3OP2A 1F76A 1IIHA 5CZ0A 1WDRA 4AIOA 4WXYA 3WK0A 1K8XA 3OYZA 3MCOA 1X1ZA 2WMFA 5K4ZA 1SJBA 1SJDA 5AYXA 3BGAA 4RR4A 1HKWA 4M82A 3PZGA 4KERA 2ODOA 4MWAB 1G1YA 4CKQA 3WD2A 3VNYA 1BG4A 5C5YA 3UR8A 3URQA 2QCNA 4BY3A 1K02A 1V6VA 2DSZA 2PFHA 3VGFA 4Q8QA 2YDQA 1OQFA 2H3DA 5M2FX 2PDXA 3WDRA 4HCLA 2OYMA 4L4PA 4GACA 3RLVA 4XTDA 1IEVA 4ERIA 3WUEA 3R4IA 5F2GA 1X7FA 4DF0A 5ECUA 1GJUA 4O10A 3W81A 1R2TA 5AZ1A 1QO2A 3NQBA 1B1YA 4V1YA 1O5QA 4GVHA 5FKYA 2VDHA 4ZOCA 2NW0A 1DP0A 4R33A 3RCMA 1Q6GA