2YDLA

Crystal structure of sh3c from cin85
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
67
structure length
67
Chain Sequence
b'ASDYCKVIFPYEAQNDDELTIKEGDIVTLINKDCIDVGWWEGELNGRRGVFPDNFVKLLPPLEHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SH3 DOMAIN-CONTAINING KINASE-BINDING PROTEIN 1
publication title Distinct Ubiquitin Binding Modes Exhibited by SH3 Domains: Molecular Determinants and Functional Implications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 10
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2011-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ydlA00
2KRMA 1RLQC 1Y0MA 4QT7A 2EQIA 1PRMC 4HVVA 2DBMA 4IIMA 4RTWA 4CC3A 1SRMA 2H8HA 1SEMA 1YWOA 4FSSA 2CUBA 1T0JA 2JTEA 1N5ZA 1UHCA 2DL5A 3KFVA 1LCKA 4J9CA 3M0SA 1W6XA 2F2XA 4JPBW 1KIKA 5IXFA 2OJ2A 2MIOA 1KFZA 2JT4A 2GNCA 2JW4A 1M30A 2KT8A 3VS0A 1OPLA 1SPKA 1K1ZA 5GJVB 3CQTA 3PE0A 4OMNA 3GBQA 1TUDA 2RNAA 4Z89A 1CSKA 2KXCA 4OMLA 2C0IA 3EG1A 2J06A 3EHQA 4J9GA 2XMFA 1X6BA 3NHNA 2KROA 2LCSA 4F16A 2RQWA 1WA7A 4J9EA 1MV0B 4R0KA 3ULRB 1CKBA 1JXMA 2BZYA 1AWWA 2W10A 2LQNA 2VKNA 4IIOA 3M0QA 1NEBA 4J9BA 2D0NA 2DJQA 2QDLA 2FRWA 2O9VA 2PNIA 1OPKA 1GCQA 3EG2A 1WLPB 2L2PA 4K11A 1GFCA 2EGCA 4HVWA 1FYNA 4LN2A 5HCKA 1PKSA 1M3BA 2ED1A 2LZ6B 4DEYA 4E6RA 1QKXA 2DL7A 2DA9A 1I07A 1IO6A 3M0UA 1K9AA 3R6NA 1UTIA 2X3XD 2DYBA 1X2KA 2A36A 4AG1C 1YWPA 2V1RA 2LJ0A 1PHTA 2JMCA 3VS6A 1WFWA 1JXOA 1G2BA 2J6KA 2EYZA 2DVJA 2LJ1A 2L0AA 2K6DA 1PRLC 4RTYA 3I5SA 1NYFA 2P4RA 1ZSGA 4LE9A 2LNHB 1AD5A 2CH4A 1EFNA 2JS2A 3I9QA 2RN8A 1MV3A 3H0FA 1TUCA 1YN8A 5IH2A 2FG0A 1GCQC 2BTTA 2VWFA 5IHNA 2JM9A 4GBQA 1NG2A 4D8KA 5I11A 4OMPA 1UHFA 2HDAA 2B86A 3TVTA 4D8DA 3M0PA 1PWTA 4OMMA 1FMKA 2C0TA 2J6FA 1UDLA 1OEBA 3H0IA 2W0ZA 5GJWB 3SHWA 1BU1A 1RLPC 1YNZA 2DX1A 2AKLA 2PTKA 2F2VA 2CT4A 4AFUC 5FWBA 3U23A 2RQUA 1PNJA 2LX7A 1W70A 4LNPA 1WDXA 1GBQA 2YT6A 3JV3A 1WX6A 2EBPA 2GQIA 2EGAA 4CC7A 2AZVA 2FPEA 1ZLMA 4LUDA 2NWMA 2ABLA 2GTOA 2J05A 2KEAA 2ECZA 2DL8A 1SHGA 3I5RA 2O88A 1E6GA 2JXBA 2VVKA 1S1NA 2BZ8A 2ENMA 2DMOA 2E5KA 1H92A 2EYYA 1B07A 3QWXX 3REAB 2DILA 2GGRA 1U06A 3H0HA 1UJYA 1UFFA 1Z9QA 1WI7A 4EIKA 1MUZA 1K0XA 2EGEA 2KXDA 2DL3A 1AZGB 1T0HA 1UECA 2ROTA 2V1QA 2KT1A 3M0RA 3A98A 5FWCA 1VYTA 1UG1A 2KR3A 1AOJA 2O31A 3VS1A 2NUZA 1PKTA 3UF4A 4DEXA 1X27A 2ED0A 3PVLA 1K76A 3THKA 4RTUA 2DBKA 4A63B 1BK2A 1JQQA 1T3SA 2A08A 2CH4W 4JJBA 2CREA 3VRYA 2MCNA 1BB9A 1U5SA 2EYWA 1RI9A 1ZBJA 2ESWA 2O2OA 1AVZC 4JJCA 1JO8A 2K79A 3H41A 4RTXA 4F17A 1M27C 1CKAA 3I35A 2FO0A 3UA7A 5ECAA 2M51A 1JEGA 1HD3A 3VS3A 3C0CA 1OOTA 1KJWA 1I1JA 3VS2A 2I0NA 2KBTA 1QCFA 2DM1A 2D8HA 2LJ3A 1SSHA 1WYXA 4CC2A 1B3QA 1QKWA 2SEMA 3NGPA 1BBZA 3EG0A 1SRLA 4J9HA 2RMOA 4JZ4A 2EPDA 2KRSA 4ZNXA 2L3SA 2F2WA 1ABOA 2YUNA 2FRYA 4CC4B 2GTJA 4F14A 1UE9A 1WIEA 1UUEA 4OMOA 3RBBB 2EYXA 2RQTA 3VS7A 3O5ZA 1AWXA 2CSQA 3RNJA 4AFSC 2DRKA 1VYUA 3ZL7C 4Z8AA 2OAWA 4HCKA 1AZEA 3EGUA 1U3OA 4OMQA 2AZSA 1YP5A 1YCSB 4HVUA 4HXJA 1AEYA 1ZUKA 2JS0A 1NLOC 3VS4A 3TSZA 1ZUUA 1AWJA 3PVQA 2KRNA 2FPFA 2RPNA 1X6GA 4RUGA 2OI3A 2SRCA 2M0YA 1TG0A 4Z88A 1M3CA 2HBWA 2DL4A 2DRMA 1GBRA 3REBB 1HSQA 1JU5C 1WXUA 1AWOA 4ORZA 5EC7A 2LQWA 2ROLA 3EHRA 1K0SA 3QWYA 1K4US 1E7OA 2A37A 4J9DA 2IIMA 4JJDA 3LH5A 2FEIA 1GCPA 4KRTA 2C0OA 2K9GA 2D1XA 1A0NB 1NLPC 1J3TA 1NYGA 2CSIA 3UA6A 4GLMA 2JM8A 2RQVA 2HCKA 1NM7A 2PZ1A 2JMAA 5IHKA 1X69A 2AK5A 2K3BA 3EG3A 4X1VA 1M8MA 3TSWA 2L3QA 1UJ0A 2BZXA 1XOVA 5I22A 1W1FA 2CDTA 1X2QA 1ZX6A 2RQRA 1E6HA 2CT3A 1H3HA 1HJDA 1KSWA 2K2MA 2YDLA 1Y57A 3FJ5A 1QLYA 2D8JA 2EW3A 1VA7A 1V1CA 2HEQA 1UGVA 2DNUA 4LUEA 2KYMA 1GL5A 1GRIA 1I0CA 1M3AA 1H8KA 5L23A 2RF0A 4ESRA 2GBQA 2YUQA 2DE0X 5IXBA 4JZ3A 2YSQA 2K7AA 2J7IA 4AFQC 1ARKA 3NPFA 2L3PA 5IHIA 3SEMA 3IQLA 4J9FA 2YUOA 1VYVA 2G6FX 1QWEA 2KNBB 5FW9A 1X43A 3VS5A 2AKKA 1SHFA 3M0TA 1Z9ZA 2MOXA 2KYBA 4J9IA 2YUPA 2A28A 2FPDA 1WXBA 4WCIA 2KGTA 4RTTA 2J6OA 2DF6A 2O9SA 1G83A 1ZUYA 2X3WD 2KE9A 4Y92A 1QWFA 2LP5A 3VRZA 2DLPA 1ABQA 2EVRA 2EKHA 1GFDA 4AFZC 4AG2C 3NMZC 1OV3A 1NEGA 1WXTA 4M4ZA 2LMJA 4RTVA 3UATA 2HSPA 2CUDA 4RTZA 1T3LA 1RUWA
chains in the Genus database with same CATH superfamily
2KRMA 2FL7A 2R5MA 4HVVA 2MK5A 4CC3A 1SEMA 4M77F 3OYAA 4FSSA 2C06A 1WHMA 2EFIA 1VQNT 2DXCA 1JJ2A 4JRQA 3FDRA 5FROA 4IURA 1LCKA 3QXEB 3M0SA 3OYEA 2FZCB 5IXFA 1PD0A 2OJ2A 1QVFA 3ZEHA 1KFZA 2CP7A 2DVEA 4XTUA 1YJWQ 3CBMA 5GAN5 2RJFA 1OPLA 2X4JA 4BI8B 3CQTA 3PE0A 4OMNA 3S3OA 1W2BA 3GBQA 3MEWA 1VQ5Q 6AT1B 4OMFB 4ZN3A 3CMET 3QYHB 1MV0B 1JXMA 2BZYA 2LQNA 4XU2A 1NEBA 2QDLA 4JJNK 1UGQB 2O9VA 5A2QE 1GCQA 4XQ3A 1JB0E 3CCJA 4K11A 3C4SA 4LN2A 1PKSA 3OW2S 2RHXA 4HT9A 1QKXA 5LJ3f 5IAYA 3CCVA 1IO6A 1D1BA 3PIOA 4EPCA 3QJ6A 1ZSZA 3CCJT 1SG5A 3L2ZA 4EDUA 3NFCA 3S6WA 3PIPA 1YHQQ 2KDSA 5CKDA 2LJ0A 1PHTA 4OB3B 2J6KA 1B7TA 2EYZA 2OTJQ 1OU8A 2OTLA 2QA4Q 4L5GA 1PRLC 3I5SA 3TU4K 4Z02A 5GAN6 3M5AA 4JLIA 1YITQ 3VU3C 1FX7A 3JCMV 5EG2A 1VIEA 2CH4A 1QMCA 1SKUB 2RHIA 3OYFA 1M1KC 4RG8A 3GOXA 3H8ZA 3JCMW 4A4EA 4VUBA 3C12A 2RHZA 2EJ9A 2VWFA 2JM9A 1VQMA 1QP2A 1NG2A 4D8KA 4E7ZA 2YHTA 1UHFA 4PLLA 3TVTA 3GIBA 3OBWA 3M0PA 4OMMA 1FMKA 2C0TA 2J6FA 3T9NA 4PJOG 1OEBA 2KQWA 1BU1A 1YNZA 1B34B 5J26A 2PTKA 3CCSQ 1N8RU 4IUQA 4AFUC 4JRPA 5FWBA 3ZFJA 3L2VA 5GAOl 2RQUA 3WVEB 2JNGA 3DLLA 2O01E 2FVUA 1Q82U 1WDXA 5GAOp 2P4TA 3TREA 2QGFB 1WX6A 5I21A 1K73C 5CCAA 3PFSA 4CC7A 2AZVA 2CZ1B 2VGNA 3MEVA 1ZLMA 4LUDA 2ABLA 2DEUA 3I5RA 1S1NA 2BZ8A 2RJDA 2X51A 1VQOQ 3QWXX 5GMKj 1OI1A 4PJOB 2GGRA 4N4HA 3L2RA 1X75C 1PG5B 3FJPA 2KY9A 1Z9QA 1K0XA 4EIKA 1MGQA 2VXFA 2ROTA 4HT8A 2XDDA 3M0RA 4XTVA 5LJ5f 3HFNA 3EG9B 3A98A 5FWCA 1UG1A 2D9TA 1JJ2P 3UF4A 4UC4A 4RTUA 2XDPA 2P0QA 1VQPT 3JB9G 2M02A 1JQQA 3OQ5A 3S3MA 4JJBA 4M77C 2M0OA 1BB9A 5I2MA 1ZBJA 2ESWA 2O2OA 1KD1C 2JJ9A 3P8HA 1M2OA 1W2BP 4JJCA 3JCMJ 3CCRQ 1H3ZA 1M27C 2FO0A 5L8RE 5ECAA 5CK9A 1YJNQ 3C0CA 4C92A 1OOTA 1LOJA 1Y07A 3CCEQ 3I56A 2E5QA 2LJ3A 3BDUA 3E9GA 3EFSA 2XG8D 2DKGA 3NGPA 1VQ8A 2NLUA 4DBFA 4J9HA 3OYGA 4PNOA 4L6V5 2KRSA 1KC8C 2K5LA 3EGDB 2L3SA 5A0LA 2YUNA 2EQKA 4CC4B 3I56T 3CCUA 4F14A 4DBRA 4BY6B 4ELZC 1VQ8T 5GANg 5CQYA 3O5ZA 1M2VB 4Z8AA 1AZEA 4OF1A 1U3OA 4M7DD 1YCSB 4HXJA 1AEYA 1TH7A 2JS0A 1QVFS 4EMHA 3G71A 3VS4A 5GANj 4C8QC 2DETA 1AWJA 4M75G 2FPFA 4BI3A 1VQNQ 2ZPHB 1R0BG 5GMKe 4C8QG 2HD0A 2EAYA 2D6FA 1YJ9A 2DL4A 2E3HA 1GBRA 3NTKA 4M7AE 3L1AA 1RABB 3G71T 1AWOA 2NYSA 1BCMA 2R57A 5D7UA 4RCCA 5EC7A 3OYCA 2M16A 3EFOB 2DTHA 2ZAEA 1GXIE 4FSXA 3OMGA 1XTDA 4J9DA 2IIMA 2EQJA 2AHJB 3LH5A 2LT4A 2JUFA 2BIVA 3FC3A 1IREB 4KRTA 1YJ9T 3DLMA 2X35A 1NLPC 5FRNA 4LDUA 1J3TA 1NYGA 4KBMB 4OB0B 1VQ4A 2RH2A 2P84A 2YRVA 2PZ1A 5IHKA 1VIFA 4J6WA 2NUPB 1D0XA 1KC8R 1PC0A 3AHUA 3TSWA 4ZN1A 5I22A 4BI4A 1N9SA 2JTFA 1ZX6A 4M75B 1H3HA 1KSWA 1N8RR 2K2MA 1FWZA 3QZ9B 2QQAA 4F04B 3QYGB 2QA4T 3OS5A 3JCMf 1UGPB 1UGVA 2RHYA 4FYVB 3OS1A 3CCJQ 4LUEA 2R5AA 4C0FA 5DLQE 1GL5A 1M1FA 3M55A 1I0CA 1H8KA 1PSEA 1YITT 2YUQA 1I81A 2J7IA 1C6VX 3SEMA 3CCVQ 3IQLA 4A4KA 4RKUE 3E2UA 1NJIU 3L2QA 2K3XA 3E19A 1TOVA 4M7AD 2NUTA 5CKEA 1MMNA 1Z9ZA 1O9SA 2MOXA 2FPDA 1WXBA 4RTTA 2J6OA 1G83A 1K8AU 2E12A 1Q86C 1LPLA 4R56A 2LP5A 2OTLQ 3X25B 4C5EA 3A8OB 1OZ3A 1GFDA 4AFZC 5LJ3h 5GANe 4M78B 4DBQA 1VQ7A 3M4GA 2LMJA 2YRDA 3UATA 2HSPA 3L2WA 4ATOA 2DAQA 1RLQC 2QG9B 3M59A 1BI1A 2EQIA 2QTVA 4HCBA 4IIMA 2CYZB 5LJ3g 1ZSZC 1VQ7T 1UHCA 2ATCB 2CS7A 1VQMQ 4J9CA 4JPBW 1Q81C 2HL5C 5GAN4 3ZBDA 2X9HA 5AT1B 2MIOA 1Q95G 4XU0A 2JT4A 4XTYA 3GP8A 4EMKC 2JW4A 2KT8A 5DM7R 5CO7A 4Q5WA 1K1ZA 1VUBA 5GJVB 1VQ6A 3V7CA 4ME7A 4XTZA 1I5LA 4J9GA 3EFOA 3VUBA 3CCLA 2QK0A 2LCSA 4F16A 4J9EA 4R0KA 4PJOF 1AWWA 3INZA 3PT9A 2DJQA 3PMIA 1QQJA 3CC2A 1M90U 3CCLT 2XIDA 4MZTA 4HVWA 2KSSA 5HK3A 3NTHA 3I55A 2LZ6B 4E6RA 3QHSA 2FZKB 3VYGA 1I07A 2DK3A 1K9AA 2CZ6B 2XDBA 2DYIA 2JTMA 4HCZA 4AMCA 1UTIA 1FMWA 3HRTA 1X2KA 2A36A 2F5KA 1DJ7B 2DTOA 3FB9A 3I55T 1YWPA 2HQXA 5IT9E 1BKBA 4BUGA 3RERA 3Q1JA 3VS6A 3C95A 2DVJA 5M9OA 1MNEA 2Y4XA 3EGXA 3OA6A 1Q81R 1MMAA 4J5YA 4NL2A 2JZ2A 1ZSGA 5DY9A 2LNHB 2JS2A 2MAMA 3GLXA 1MV3A 1YN8A 2KK4A 2QYZA 3UDCA 2RA2A 2DFUA 1R8OB 3KBGA 3JB9F 3OYJA 2RI3A 2R58A 4M78A 3I56Q 4A4GA 2DO3A 4D8DA 1Y96A 3A8LB 2COYA 1VQ8Q 3H0IA 2I2LA 2XHCA 5LJ5g 4M7DA 4DQ2A 2VXEA 3E1SA 5LJ3e 4A4HA 4FW2A 3RMQA 3CCUQ 1LVKA 4NL3A 1N27A 4A4FA 3O8VA 5LJ5j 1TU0B 2GQIA 1WQWA 2EGAA 4ANJA 2E1HA 2NWMA 1IXDA 4GY5A 2J05A 1E6GA 2JXBA 5GAOn 4RG2A 3G71Q 1I5OB 1G3YA 1X01A 4C92G 2EYYA 4FYWB 2DILA 1IZ6A 1U06A 3RKWA 1UJYA 2KVQG 4CRIA 2PQWA 1YJ9Q 2KXDA 1TS9A 3CPWA 3M4YA 1T0HA 1UECA 2PVDB 3NTIA 1QP3A 5FU7C 2V1QA 3MEAA 2KT1A 2K5IA 2O4XA 4M75F 3JCMP 3BFMA 5FLXE 4FL6A 2QXFA 3M56A 4C8QF 2ED0A 4JS4A 4F7UB 5KCHA 2PUKB 1BCOA 1BK2A 1VQ4Q 3CCVT 2A08A 3VRYA 9ATCB 3RUXA 2EYWA 1W4SA 2OAUA 4M77E 1RI0A 1AVZC 1R0CB 4C92B 3WXMB 3MHXA 4RTXA 4F17A 2LC4A 4N4IA 3E9FA 1CKAA 3UA7A 2M51A 1JEGA 2H3JA 4M7AA 3QKJA 2E6NA 1KJWA 1I1JA 1WNLA 2KBTA 2OTLT 1QCFA 2DM1A 2D8HA 1SSHA 4PFOA 1B3QA 1M8VA 1F1BB 4E7LA 1BBZA 3EG0A 1SRLA 3RKYA 2RMOA 1QVGA 5LJ5d 5FU7B 4ZNXA 1V76A 2F2WA 1TXQA 1KD1U 4PJOC 1G3SA 2GTJA 1UUEA 1UGSB 3LW5E 1AWXA 3RNJA 5GMKh 2EQUA 1VQMT 1VYUA 2DJZA 3ZL7C 2K2VA 4P5NA 2COZA 3JCMh 2RD1A 2OAWA 5LJ5e 3HFOA 1BIAA 4FT2A 1VQKA 1YP5A 4ELYC 2HL3A 5HY6A 1VQLA 5KH6A 2CZ0B 1EX4A 2PVOB 3GF5A 3BY7A 1ZUUA 2JVVA 4C8QE 4M77D 2KRNA 3JCMg 1VQ7Q 4RUGA 2SRCA 4AT1B 5C0MA 2M0YA 1VQKT 4Z88A 4JRIA 2QEXA 2F5TX 1VQLT 3UT1A 2HMAA 1UGRB 4XK8E 4ORZA 3M54A 4B9WA 2ROLA 3EHRA 3JCMQ 3QWYA 2A37A 4E47A 4NS5A 1GCPA 2QEXT 1YBYA 5HKCA 4KH0B 1Q7YU 2CSIA 3UA6A 4GLMA 2JM8A 1VQ9Q 5CR2A 2AK5A 1VQ6Q 1M8MA 2GCXA 2L3QA 1UJ0A 4DOWA 4ZGJB 1KQSA 2GFAA 3V8LA 1IGUA 4QQDA 1W1FA 4BY6C 1X2QA 1BIBA 1E6HA 2CT3A 3CCLQ 2BE7D 2EJFA 2XD0A 1ZA2B 1Y57A 4ZGEB 2M1HA 3LLRA 2RO0A 4F7UA 2HEQA 3CC2Q 2XICA 4J7IA 2M9UA 4ZGDB 3EAEA 3JB9J 2YWWA 3V7SA 4C8QD 3M58A 3I55Q 2DE0X 3V8KA 1RAAB 4LXCA 4JZ3A 2YSQA 2P0PA 1PCXA 1M9SA 4AFQC 1IHWA 2NUTB 2X4XA 2G6FX 3H9NA 5FW9A 5GANh 4JS5A 4MDXA 1X43A 3HP9A 2AKKA 1SHFA 2YUPA 1AT1B 3CPWP 2O9SA 4Y92A 1K9MU 3EFRA 1N8RC 2GFUA 3EH1A 2WSCE 2VC8A 2EVRA 1Q82C 1OV3A 1WHGA 4PL6A 3RR6A 2CP6A 3CC4A 1JJ2S 1WJRA 1TTHB 4RTVA 3CCMA 2CUDA 2K3YA 4RTZA 3CCUT 3QO3A 2E10A 1Y0MA 1NBEB 1PRMC 1D0ZA 4M75C 4DA4A 4RTWA 2RB6A 1YWOA 2E41A 1RADB 2CUBA 2EKOA 2K4YA 2L89A 2JTEA 3KXTA 2L5QA 4WTOB 2WACA 2DL5A 3KFVA 1W2BS 1OQKA 3CCMT 2EJGA 2F2XA 2HKQB 3JCMe 4WF2A 4FT4A 3META 4IUVA 3JAME 5KYUB 1M30A 1AHJB 3X28B 4N0AA 2FHDA 4MZPA 1SPKA 3OY9A 2HQHA 1QVGP 4KULA 4Z89A 1CSKA 2DD4A 2KXCA 2C0IA 3EHQA 5CKFA 1XNIA 2DXTA 4B9XA 3JSCA 3OYHA 1X6BA 3NHNA 1WJSA 2RQWA 1CKBA 2W10A 1MNDA 2VKNA 4IIOA 2LTOA 2D0NA 1RACB 4HKEA 3J80E 2FRWA 2CP5A 2PNIA 2EWNA 2DXUA 3CMAA 3DB3A 2V8KA 3DB4A 3EG2A 4FU6A 1GFCA 2EGCA 3LGLA 1VQ4T 5HCKA 1M3BA 2MI6A 4DEYA 5CKBA 3A5ZB 4M78C 2RK1A 2DL7A 2DA9A 3OYBA 2KAFA 2L3RA 3OSSC 3M9QA 1Q82R 4J8OA 1G3WA 4J83A 1D1AA 3CMAT 4MMKA 4M78G 4OVAA 4F7UF 4M7DC 2DYBA 2ZPIB 3EGXB 2FYKA 2WSEE 4M7DG 1M1GA 1IB8A 2JMCA 2Z0WA 1WQ7A 1JXOA 1FXXA 1HK9A 4C92F 1YIJA 4IUTA 2HKNA 2K6DA 3PMTA 2MWOA 4BACA 2LVMA 4IUUA 1I8FA 2MYSA 3JRZA 1D09B 3CEYA 2P4RA 2QQSA 3MCAB 3MPUB 3OSVA 4LE9A 1EIFA 1YIJT 3RIRA 1AD5A 2PUOB 3X20B 2RN8A 3H0FA 4OB2B 5IH2A 2LQ8A 5FU6B 1KQSP 1MHNA 4O5VA 1GCQC 3BDLA 2MF2A 4CI0C 2BTTA 5GMKm 5IHNA 4NOYA 4GBQA 1Y96B 4FM4B 5I11A 4OMPA 5GAMd 4E7HA 4OB1B 2HDAA 3UWNA 4M7DB 4E7SA 3GNGA 1RAHB 5KYYB 1UDLA 2W0ZA 3SHWA 3CC7A 1RLPC 2F2VA 2CT4A 4FW1A 5LJ3d 5FRMA 1ZBXA 1RAFB 2CP3A 3RESA 4M77A 2K57A 1W70A 1VQ9A 4LD6A 2LRQA 2IPOB 2X4WA 3CC7T 4PKCC 3JV3A 3SB2A 5GAMj 3VV0A 5KYUA 1OX9A 3CBPA 3V7RA 2BE9B 1VQKQ 2KEAA 2Y90A 3SWNB 2DL8A 2O88A 1VQLQ 1VQ9T 2VVKA 1K9MR 4M7AG 2ENMA 2XU8A 1VQ6T 2E5KA 2GF7A 3N5BB 1KQ1A 1KQSS 3H0HA 4BD3A 2QEXQ 2O4XB 2EGEA 3GPLA 2COWA 3MP1A 4C0GA 1WHHA 1AZGB 3CCQA 5D6XA 2AIRB 3CXCP 4XAXB 3OBYA 3BE3A 2VUBA 3CC2T 1VYTA 2RJCA 5CQXA 3SFMA 1AOJA 2RM4A 4E7KA 2NUZA 1NJIC 2LQKA 4BE1A 1PKTA 4E2FB 1X27A 3PVLA 3SD4A 3MO8A 2DEQA 2DBKA 1C0MA 2PU9B 2QI2A 3QPHA 1T3SA 1QCOA 2CREA 2K5FA 4EMGA 2DD5A 4PJLA 1IHVA 2MWPA 2QTXA 3RKXA 4FYXB 4M7AB 1U8RA 1K8AC 2K79A 4JLGA 1QCNA 3I35A 4PFPA 2ZPGB 4D6WA 3OMCA 4OGCA 1D3BB 3VS3A 3JCMb 1WHJA 3MKDA 4Y91A 3A8GB 3VS2A 4CC2A 3QIIA 2SEMA 3ME9A 5LJ5h 4JZ4A 2EPDA 3H6ZA 3VJPA 4OGEA 5A0DA 4C5GA 1ABOA 5KYXB 2FRYA 3URGA 3A8HB 1UEBA 5KCOA 4PJOE 2JN0A 1KG1A 1UB4A 3FRNA 4OMOA 4BDZA 3VUZA 5GAN2 1G8XA 4HCKA 4HA8A 5KYYA 3P8BB 3X26B 3EGUA 2QAZA 2YLCA 3OW2P 4XU1A 1M1KU 1G5VA 2AZSA 4DBHA 3QG1A 1KQ2A 4HVUA 1XQHA 1ZUKA 4J6XA 1Y7XA 2KI7A 1NLOC 3L2UA 3V8JA 2E6ZA 1NJIR 4V2SA 3TSZA 3RMSA 2DTIA 3JB9I 1BI3A 2A7YA 2FB7A 2RPNA 3CC4Q 4KGVB 3CCMQ 4F7UG 1EZZB 1TG0A 1M3CA 4MZMA 4C92C 2DRMA 4C0DC 5CVIA 3REBB 1HSQA 5GAOr 4LD9K 3CMEA 1M90C 1JU5C 1WXUA 1K8AR 4LDVA 2E4HA 2F69A 2ZCFB 3SWNA 4IKFA 2E64A 4JJDA 2FEIA 4MMLA 1QVPA 2K9GA 1ZQ1A 1BYMA 2RQVA 2HCKA 1NM7A 5GAMf 1K73U 3ASKA 1X69A 2K3BA 3EG3A 4PJOD 4JUVA 2E65A 3J81E 2BZXA 1XOVA 2CDTA 1OU9A 2RQRA 4A53A 1HJDA 4QVDA 3TEEA 3CPFA 5KYNA 1WGSA 2YDLA 3FJ5A 2XKOC 2HSEB 1QLYA 2D8JA 1RAGB 2RK2A 2AT1B 2DXBA 1NE8A 2YRCA 3CMAQ 3G6EQ 4C0DB 3JCMX 1GRIA 3MEUA 5AYFA 1N6AA 4ESRA 3QJYA 2L8DA 2K7AA 2DPPB 5IN1A 3JCMc 2L3PA 4EMKA 4RMOA 3F70A 1LNXA 8ATCB 1TUGB 1VYVA 1D3BA 4N0AC 3G4SA 1U1SA 1QWEA 3LWHA 4DOVA 3M0TA 3OYLA 2LNVA 1OX8A 4J9IA 3HKSA 2HBPA 1M90R 2KGTA 2V26A 2DF6A 4E7IA 1WHLA 4FCYA 2KE9A 3GNFB 1YIJQ 4QKUA 2V8JA 1QWFA 3G4ST 4M78F 4PJJA 3VRZA 5KYXA 1ABQA 3HSBA 4AG2C 2VV5A 3NMZC 1NEGA 2QGGA 4M7DF 1WXTA 1OULA 4M4ZA 4QQ6A 1PD1A 3G7ZA 4PLIA 4X34A 3JB9D 2ZGWA 1RUWA 4X9DA 4QT7A 4E7JA 2DBMA 1SRMA 2H8HA 2OX7A 3LX7A 1KC8U 4M75E 1T0JA 1S72A 1N5ZA 3FLGA 1BI2A 3EH2A 3CD6A 1W6XA 1KIKA 2DZ9A 1X6OA 4N4GA 2GNCA 3JCMd 4TVRA 5CKHA 3VS0A 1S72T 1C1AA 3CD6T 4JDSA 3CC7Q 3SDZA 1TUDA 2RNAA 1P92A 2DIGA 4OMLA 4KGZB 3EG1A 2J06A 3P8DA 2XMFA 1N9RA 3OYDA 2KROA 2GQVA 2LCLA 3ULRB 1WA7A 4C5HA 4QQGA 3M57A 4C0ZA 3A1PA 3M0QA 4J9BA 1I4K1 3QSUA 5CIUA 2BUDA 2FZGB 1OPKA 1WLPB 2L2PA 1FYNA 4ZTFA 5GAN7 1M1KR 2ED1A 3RDVA 1VQPA 1VOMA 3OYKA 4M78E 5CAIA 3M0UA 3VKIA 3TQ7P 2E3IA 1O75A 3R6NA 4M75D 2CP0A 2XK0A 3A8MB 2X3XD 2LX9A 4M7DE 3ER0A 4AG1C 1YI2A 1KHIA 3X24B 2V1RA 3CCQQ 4Y28E 2VASA 1QVFP 1WFWA 4M7AF 1G2BA 3TCJA 5A0GA 2VB6A 5GMKl 2LJ1A 3J7AF 1TWBA 2L0AA 4RTYA 1IGQA 4M77G 3OS0A 1YI2T 5KYWB 2JOYA 1NYFA 3BW1A 4QVCA 4KUDK 2DERA 1EFNA 1MMGA 2MPXC 2DZCA 3I9QA 4ZTJA 1K73R 2LDMA 1TUCA 3PNWC 1D1CA 2FG0A 4LDWA 4MDWA 4QW2A 4C5IA 5GANd 2LT1A 3MP6A 2A0FB 2EQMA 3S3NA 3LWIA 2B86A 2CGHA 2ZPEB 1YJWA 3CXCA 1PWTA 4M78D 2IG0A 5GJWB 3CC4T 2DX1A 2MMPA 2AKLA 3DKMA 1WJQA 4M77B 1Q86U 2HNIA 2ZPFB 3MJXA 1VQ5A 3OYMA 1YJWT 4LDYA 3L42A 3U23A 1B34A 1PNJA 4PJMA 1D0YA 4XTWA 2LX7A 2LCCA 4LNPA 3PGGA 1GBQA 2YT6A 3QBYA 5C6SA 3JB9H 1U1TA 3HRUA 1Q7YC 1NZ9A 4BDYA 2EBPA 1RAIB 4J7FA 2YXYA 1VQ5T 2HZYA 2FPEA 2RHUA 1G3TA 2EIFA 2GTOA 3FIFA 2ECZA 1SHGA 1KD1R 8AT1B 4A54A 3CPWS 1ZA1B 2DMOA 1Q81U 2EYQA 1H92A 1B07A 5GAOm 1KK7A 3REAB 3G6EA 2HQEA 1UFFA 2P0KA 1WI7A 1MUZA 3D7SB 5FU6C 2DL3A 4JRKA 1YHQA 4PJOA 3CMEQ 4B6MA 2OTJA 1NPRA 7AT1B 2KMTA 2QA4A 3OYYA 2KR3A 3G6ET 2O31A 1JBMA 3KUFA 3VS1A 1MMDA 4DEXA 3EG9A 3WVDB 1K76A 3THKA 1YHQT 1FMVA 5GAN3 3OW2A 3FEOA 4C8QB 4A63B 1YITA 3HPWA 2OTJT 1QW1A 4FYYB 2CH4W 2MCNA 1SF9A 1U5SA 4KH1B 1RI9A 4YTLA 2QQRA 2Y4YA 4O6JA 4KT0E 1PSFA 2B8AA 1K9MC 1JO8A 5GMKi 3H41A 1QVGS 4PK4A 4HCCA 2PVGB 1HD3A 1Q7YR 1WPYA 5KYWA 2I0NA 1WYXA 1QKWA 3CBOA 4BE0A 1ZHIA 3SWNC 4BB7A 2CKKA 1IRXA 5GAMh 2X4YA 1RAEB 1WZOA 3CCSA 2VYTA 3LGFA 5D6YA 3HL8A 1XJWB 4KUIA 3QZ5B 5GAN8 1OYXA 3C94A 1JRIA 1UE9A 1RL2A 1WIEA 3G4SQ 3EGDA 1R77A 2A3LA 2V8IA 3RBBB 2EYXA 2RQTA 3VS7A 4QVZA 2F1LA 5GAMg 2CSQA 4AFSC 4II1A 2CZ7B 2DRKA 3CCST 3UPUA 5J39A 5KE3A 1M4ZA 4OMQA 1SSFA 2H3EB 1M2VA 3MP8A 2VGMA 1YFNA 1OZ2A 4X9CA 1HYOA 4F7UE 1ACMB 3PVQA 1VQOA 1X6GA 2OI3A 1Y71A 4M7AC 2HBWA 2BKDN 4C92E 2ZPBB 5I2SA 2G3RA 2LQWA 1S72Q 2YLBA 1K0SA 2QDYB 2RI2A 1VQOT 4LDXA 3CD6Q 5LJ3j 1K4US 1E7OA 3HHTB 2RJEA 2C0OA 2ZZDA 4GLKA 1WHKA 2D1XA 4BE2A 1A0NB 1KHCA 5GANf 2XI9A 5D6WA 2JMAA 4XU3A 3LYIA 4X1VA 3QDRB 1LJOA 3R6OA 3CCRA 5GAOq 2NUPA 3QDFA 1Q86R 5J3BA 3PTAA 3M53A 3CCQT 1YJNA 1ZSZB 1PM3A 4M75A 3CCEA 2QQ9A 2CP2A 2EW3A 3LH0A 1VA7A 4C8QA 1V1CA 2DNUA 3CCRT 4EMKB 2KYMA 4RCBA 1M3AA 4R55A 5L23A 2RF0A 3OS2A 3G1JA 4KGXB 2GBQA 5IXBA 2IVWA 1YJNT 3VYHB 1ARKA 1VQPQ 3NPFA 4L59A 5IHIA 3CCET 1BI0A 4J9FA 5DLOA 2YUOA 4XTXA 4C92D 2KNBB 3VS5A 3OB9A 5KE2A 2KYBA 3HTRA 1YI2Q 1TSFA 2A28A 2QQBA 2RI5A 4WCIA 3AT1B 2X3WD 4IUPA 1ZUYA 1NPPA 4PFZA 3OYNA 2E70A 5LL6S 2DIQA 2DLPA 1M5Q1 3CXCS 1H641 4J6YA 2D0QB 2EKHA 2WSFE 3HRSA 5HK0A 3OYIA 1HXDA 1V29B 2HAXA 4OP0A 1VQNA 4PJNA 5GAMe 3QUIA 2QASA 1YCYA 4FIBA 1T3LA
chains in the Genus database with same CATH topology
2KRMA 1RLQC 1Y0MA 4QT7A 2EQIA 1PRMC 4HVVA 2DBMA 4IIMA 4RTWA 4CC3A 1SRMA 2H8HA 1SEMA 1YWOA 4FSSA 2CUBA 1T0JA 2JTEA 1N5ZA 1UHCA 2DL5A 3KFVA 1LCKA 4J9CA 3M0SA 1W6XA 2F2XA 4JPBW 1KIKA 5IXFA 2OJ2A 2MIOA 1KFZA 2JT4A 2GNCA 2JW4A 1M30A 2KT8A 3VS0A 1OPLA 1SPKA 1K1ZA 5GJVB 3CQTA 3PE0A 4OMNA 3GBQA 1TUDA 2RNAA 4Z89A 1CSKA 2KXCA 4OMLA 2C0IA 3EG1A 2J06A 3EHQA 4J9GA 2XMFA 1X6BA 3NHNA 2KROA 2LCSA 4F16A 2RQWA 1WA7A 4J9EA 1MV0B 4R0KA 3ULRB 1CKBA 1JXMA 2BZYA 1AWWA 2W10A 2LQNA 2VKNA 4IIOA 3M0QA 1NEBA 4J9BA 2D0NA 2DJQA 2QDLA 2FRWA 2O9VA 2PNIA 1OPKA 1GCQA 3EG2A 1WLPB 2L2PA 4K11A 1GFCA 2EGCA 4HVWA 1FYNA 4LN2A 5HCKA 1PKSA 1M3BA 2ED1A 2LZ6B 4DEYA 4E6RA 1QKXA 2DL7A 2DA9A 1I07A 1IO6A 3M0UA 1K9AA 3R6NA 1UTIA 2X3XD 2DYBA 1X2KA 2A36A 4AG1C 1YWPA 2V1RA 2LJ0A 1PHTA 2JMCA 3VS6A 1WFWA 1JXOA 1G2BA 2J6KA 2EYZA 2DVJA 2LJ1A 2L0AA 2K6DA 1PRLC 4RTYA 3I5SA 1NYFA 2P4RA 1ZSGA 4LE9A 2LNHB 1AD5A 2CH4A 1EFNA 2JS2A 3I9QA 2RN8A 1MV3A 3H0FA 1TUCA 1YN8A 5IH2A 2FG0A 1GCQC 2BTTA 2VWFA 5IHNA 2JM9A 4GBQA 1NG2A 4D8KA 5I11A 4OMPA 1UHFA 2HDAA 2B86A 3TVTA 4D8DA 3M0PA 1PWTA 4OMMA 1FMKA 2C0TA 2J6FA 1UDLA 1OEBA 3H0IA 2W0ZA 5GJWB 3SHWA 1BU1A 1RLPC 1YNZA 2DX1A 2AKLA 2PTKA 2F2VA 2CT4A 4AFUC 5FWBA 3U23A 2RQUA 1PNJA 2LX7A 1W70A 4LNPA 1WDXA 1GBQA 2YT6A 3JV3A 1WX6A 2EBPA 2GQIA 2EGAA 4CC7A 2AZVA 2FPEA 1ZLMA 4LUDA 2NWMA 2ABLA 2GTOA 2J05A 2KEAA 2ECZA 2DL8A 1SHGA 3I5RA 2O88A 1E6GA 2JXBA 2VVKA 1S1NA 2BZ8A 2ENMA 2DMOA 2E5KA 1H92A 2EYYA 1B07A 3QWXX 3REAB 2DILA 2GGRA 1U06A 3H0HA 1UJYA 1UFFA 1Z9QA 1WI7A 4EIKA 1MUZA 1K0XA 2EGEA 2KXDA 2DL3A 1AZGB 1T0HA 1UECA 2ROTA 2V1QA 2KT1A 3M0RA 3A98A 5FWCA 1VYTA 1UG1A 2KR3A 1AOJA 2O31A 3VS1A 2NUZA 1PKTA 3UF4A 4DEXA 1X27A 2ED0A 3PVLA 1K76A 3THKA 4RTUA 2DBKA 4A63B 1BK2A 1JQQA 1T3SA 2A08A 2CH4W 4JJBA 2CREA 3VRYA 2MCNA 1BB9A 1U5SA 2EYWA 1RI9A 1ZBJA 2ESWA 2O2OA 1AVZC 4JJCA 1JO8A 2K79A 3H41A 4RTXA 4F17A 1M27C 1CKAA 3I35A 2FO0A 3UA7A 5ECAA 2M51A 1JEGA 1HD3A 3VS3A 3C0CA 1OOTA 1KJWA 1I1JA 3VS2A 2I0NA 2KBTA 1QCFA 2DM1A 2D8HA 2LJ3A 1SSHA 1WYXA 4CC2A 1B3QA 1QKWA 2SEMA 3NGPA 1BBZA 3EG0A 1SRLA 4J9HA 2RMOA 4JZ4A 2EPDA 2KRSA 4ZNXA 2L3SA 2F2WA 1ABOA 2YUNA 2FRYA 4CC4B 2GTJA 4F14A 1UE9A 1WIEA 1UUEA 4OMOA 3RBBB 2EYXA 2RQTA 3VS7A 3O5ZA 1AWXA 2CSQA 3RNJA 4AFSC 2DRKA 1VYUA 3ZL7C 4Z8AA 2OAWA 4HCKA 1AZEA 3EGUA 1U3OA 4OMQA 2AZSA 1YP5A 1YCSB 4HVUA 4HXJA 1AEYA 1ZUKA 2JS0A 1NLOC 3VS4A 3TSZA 1ZUUA 1AWJA 3PVQA 2KRNA 2FPFA 2RPNA 1X6GA 4RUGA 2OI3A 2SRCA 2M0YA 1TG0A 4Z88A 1M3CA 2HBWA 2DL4A 2DRMA 1GBRA 3REBB 1HSQA 1JU5C 1WXUA 1AWOA 4ORZA 5EC7A 2LQWA 2ROLA 3EHRA 1K0SA 3QWYA 1K4US 1E7OA 2A37A 4J9DA 2IIMA 4JJDA 3LH5A 2FEIA 1GCPA 4KRTA 2C0OA 2K9GA 2D1XA 1A0NB 1NLPC 1J3TA 1NYGA 2CSIA 3UA6A 4GLMA 2JM8A 2RQVA 2HCKA 1NM7A 2PZ1A 2JMAA 5IHKA 1X69A 2AK5A 2K3BA 3EG3A 4X1VA 1M8MA 3TSWA 2L3QA 1UJ0A 2BZXA 1XOVA 5I22A 1W1FA 2CDTA 1X2QA 1ZX6A 2RQRA 1E6HA 2CT3A 1H3HA 1HJDA 1KSWA 2K2MA 2YDLA 1Y57A 3FJ5A 1QLYA 2D8JA 2EW3A 1VA7A 1V1CA 2HEQA 1UGVA 2DNUA 4LUEA 2KYMA 1GL5A 1GRIA 1I0CA 1M3AA 1H8KA 5L23A 2RF0A 4ESRA 2GBQA 2YUQA 2DE0X 5IXBA 4JZ3A 2YSQA 2K7AA 2J7IA 4AFQC 1ARKA 3NPFA 2L3PA 5IHIA 3SEMA 3IQLA 4J9FA 2YUOA 1VYVA 2G6FX 1QWEA 2KNBB 5FW9A 1X43A 3VS5A 2AKKA 1SHFA 3M0TA 1Z9ZA 2MOXA 2KYBA 4J9IA 2YUPA 2A28A 2FPDA 1WXBA 4WCIA 2KGTA 4RTTA 2J6OA 2DF6A 2O9SA 1G83A 1ZUYA 2X3WD 2KE9A 4Y92A 1QWFA 2LP5A 3VRZA 2DLPA 1ABQA 2EVRA 2EKHA 1GFDA 4AFZC 4AG2C 3NMZC 1OV3A 1NEGA 1WXTA 4M4ZA 2LMJA 4RTVA 3UATA 2HSPA 2CUDA 4RTZA 1T3LA 1RUWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KRM A;  1RLQ C;  1Y0M A;  4QT7 A;  2EQI A;  1PRM C;  4HVV A;  2DBM A;  4IIM A;  4RTW A;  4CC3 A;  1SRM A;  2H8H A;  1SEM A;  1YWO A;  4FSS A;  2CUB A;  1T0J A;  2JTE A;  1N5Z A;  1UHC A;  2DL5 A;  3KFV A;  1LCK A;  4J9C A;  3M0S A;  1W6X A;  2F2X A;  4JPB W;  1KIK A;  5IXF A;  2OJ2 A;  2MIO A;  1KFZ A;  2JT4 A;  2GNC A;  2JW4 A;  1M30 A;  2KT8 A;  3VS0 A;  1OPL A;  1SPK A;  1K1Z A;  5GJV B;  3CQT A;  3PE0 A;  4OMN A;  3GBQ A;  1TUD A;  2RNA A;  4Z89 A;  1CSK A;  2KXC A;  4OML A;  2C0I A;  3EG1 A;  2J06 A;  3EHQ A;  4J9G A;  2XMF A;  1X6B A;  3NHN A;  2KRO A;  2LCS A;  4F16 A;  2RQW A;  1WA7 A;  4J9E A;  1MV0 B;  4R0K A;  3ULR B;  1CKB A;  1JXM A;  2BZY A;  1AWW A;  2W10 A;  2LQN A;  2VKN A;  4IIO A;  3M0Q A;  1NEB A;  4J9B A;  2D0N A;  2DJQ A;  2QDL A;  2FRW A;  2O9V A;  2PNI A;  1OPK A;  1GCQ A;  3EG2 A;  1WLP B;  2L2P A;  4K11 A;  1GFC A;  2EGC A;  4HVW A;  1FYN A;  4LN2 A;  5HCK A;  1PKS A;  1M3B A;  2ED1 A;  2LZ6 B;  4DEY A;  4E6R A;  1QKX A;  2DL7 A;  2DA9 A;  1I07 A;  1IO6 A;  3M0U A;  1K9A A;  3R6N A;  1UTI A;  2X3X D;  2DYB A;  1X2K A;  2A36 A;  4AG1 C;  1YWP A;  2V1R A;  2LJ0 A;  1PHT A;  2JMC A;  3VS6 A;  1WFW A;  1JXO A;  1G2B A;  2J6K A;  2EYZ A;  2DVJ A;  2LJ1 A;  2L0A A;  2K6D A;  1PRL C;  4RTY A;  3I5S A;  1NYF A;  2P4R A;  1ZSG A;  4LE9 A;  2LNH B;  1AD5 A;  2CH4 A;  1EFN A;  2JS2 A;  3I9Q A;  2RN8 A;  1MV3 A;  3H0F A;  1TUC A;  1YN8 A;  5IH2 A;  2FG0 A;  1GCQ C;  2BTT A;  2VWF A;  5IHN A;  2JM9 A;  4GBQ A;  1NG2 A;  4D8K A;  5I11 A;  4OMP A;  1UHF A;  2HDA A;  2B86 A;  3TVT A;  4D8D A;  3M0P A;  1PWT A;  4OMM A;  1FMK A;  2C0T A;  2J6F A;  1UDL A;  1OEB A;  3H0I A;  2W0Z A;  5GJW B;  3SHW A;  1BU1 A;  1RLP C;  1YNZ A;  2DX1 A;  2AKL A;  2PTK A;  2F2V A;  2CT4 A;  4AFU C;  5FWB A;  3U23 A;  2RQU A;  1PNJ A;  2LX7 A;  1W70 A;  4LNP A;  1WDX A;  1GBQ A;  2YT6 A;  3JV3 A;  1WX6 A;  2EBP A;  2GQI A;  2EGA A;  4CC7 A;  2AZV A;  2FPE A;  1ZLM A;  4LUD A;  2NWM A;  2ABL A;  2GTO A;  2J05 A;  2KEA A;  2ECZ A;  2DL8 A;  1SHG A;  3I5R A;  2O88 A;  1E6G A;  2JXB A;  2VVK A;  1S1N A;  2BZ8 A;  2ENM A;  2DMO A;  2E5K A;  1H92 A;  2EYY A;  1B07 A;  3QWX X;  3REA B;  2DIL A;  2GGR A;  1U06 A;  3H0H A;  1UJY A;  1UFF A;  1Z9Q A;  1WI7 A;  4EIK A;  1MUZ A;  1K0X A;  2EGE A;  2KXD A;  2DL3 A;  1AZG B;  1T0H A;  1UEC A;  2ROT A;  2V1Q A;  2KT1 A;  3M0R A;  3A98 A;  5FWC A;  1VYT A;  1UG1 A;  2KR3 A;  1AOJ A;  2O31 A;  3VS1 A;  2NUZ A;  1PKT A;  3UF4 A;  4DEX A;  1X27 A;  2ED0 A;  3PVL A;  1K76 A;  3THK A;  4RTU A;  2DBK A;  4A63 B;  1BK2 A;  1JQQ A;  1T3S A;  2A08 A;  2CH4 W;  4JJB A;  2CRE A;  3VRY A;  2MCN A;  1BB9 A;  1U5S A;  2EYW A;  1RI9 A;  1ZBJ A;  2ESW A;  2O2O A;  1AVZ C;  4JJC A;  1JO8 A;  2K79 A;  3H41 A;  4RTX A;  4F17 A;  1M27 C;  1CKA A;  3I35 A;  2FO0 A;  3UA7 A;  5ECA A;  2M51 A;  1JEG A;  1HD3 A;  3VS3 A;  3C0C A;  1OOT A;  1KJW A;  1I1J A;  3VS2 A;  2I0N A;  2KBT A;  1QCF A;  2DM1 A;  2D8H A;  2LJ3 A;  1SSH A;  1WYX A;  4CC2 A;  1B3Q A;  1QKW A;  2SEM A;  3NGP A;  1BBZ A;  3EG0 A;  1SRL A;  4J9H A;  2RMO A;  4JZ4 A;  2EPD A;  2KRS A;  4ZNX A;  2L3S A;  2F2W A;  1ABO A;  2YUN A;  2FRY A;  4CC4 B;  2GTJ A;  4F14 A;  1UE9 A;  1WIE A;  1UUE A;  4OMO A;  3RBB B;  2EYX A;  2RQT A;  3VS7 A;  3O5Z A;  1AWX A;  2CSQ A;  3RNJ A;  4AFS C;  2DRK A;  1VYU A;  3ZL7 C;  4Z8A A;  2OAW A;  4HCK A;  1AZE A;  3EGU A;  1U3O A;  4OMQ A;  2AZS A;  1YP5 A;  1YCS B;  4HVU A;  4HXJ A;  1AEY A;  1ZUK A;  2JS0 A;  1NLO C;  3VS4 A;  3TSZ A;  1ZUU A;  1AWJ A;  3PVQ A;  2KRN A;  2FPF A;  2RPN A;  1X6G A;  4RUG A;  2OI3 A;  2SRC A;  2M0Y A;  1TG0 A;  4Z88 A;  1M3C A;  2HBW A;  2DL4 A;  2DRM A;  1GBR A;  3REB B;  1HSQ A;  1JU5 C;  1WXU A;  1AWO A;  4ORZ A;  5EC7 A;  2LQW A;  2ROL A;  3EHR A;  1K0S A;  3QWY A;  1K4U S;  1E7O A;  2A37 A;  4J9D A;  2IIM A;  4JJD A;  3LH5 A;  2FEI A;  1GCP A;  4KRT A;  2C0O A;  2K9G A;  2D1X A;  1A0N B;  1NLP C;  1J3T A;  1NYG A;  2CSI A;  3UA6 A;  4GLM A;  2JM8 A;  2RQV A;  2HCK A;  1NM7 A;  2PZ1 A;  2JMA A;  5IHK A;  1X69 A;  2AK5 A;  2K3B A;  3EG3 A;  4X1V A;  1M8M A;  3TSW A;  2L3Q A;  1UJ0 A;  2BZX A;  1XOV A;  5I22 A;  1W1F A;  2CDT A;  1X2Q A;  1ZX6 A;  2RQR A;  1E6H A;  2CT3 A;  1H3H A;  1HJD A;  1KSW A;  2K2M A;  2YDL A;  1Y57 A;  3FJ5 A;  1QLY A;  2D8J A;  2EW3 A;  1VA7 A;  1V1C A;  2HEQ A;  1UGV A;  2DNU A;  4LUE A;  2KYM A;  1GL5 A;  1GRI A;  1I0C A;  1M3A A;  1H8K A;  5L23 A;  2RF0 A;  4ESR A;  2GBQ A;  2YUQ A;  2DE0 X;  5IXB A;  4JZ3 A;  2YSQ A;  2K7A A;  2J7I A;  4AFQ C;  1ARK A;  3NPF A;  2L3P A;  5IHI A;  3SEM A;  3IQL A;  4J9F A;  2YUO A;  1VYV A;  2G6F X;  1QWE A;  2KNB B;  5FW9 A;  1X43 A;  3VS5 A;  2AKK A;  1SHF A;  3M0T A;  1Z9Z A;  2MOX A;  2KYB A;  4J9I A;  2YUP A;  2A28 A;  2FPD A;  1WXB A;  4WCI A;  2KGT A;  4RTT A;  2J6O A;  2DF6 A;  2O9S A;  1G83 A;  1ZUY A;  2X3W D;  2KE9 A;  4Y92 A;  1QWF A;  2LP5 A;  3VRZ A;  2DLP A;  1ABQ A;  2EVR A;  2EKH A;  1GFD A;  4AFZ C;  4AG2 C;  3NMZ C;  1OV3 A;  1NEG A;  1WXT A;  4M4Z A;  2LMJ A;  4RTV A;  3UAT A;  2HSP A;  2CUD A;  4RTZ A;  1T3L A;  1RUW A; 
#chains in the Genus database with same CATH topology
 2KRM A;  2FL7 A;  2R5M A;  4HVV A;  2MK5 A;  4CC3 A;  1SEM A;  4M77 F;  3OYA A;  4FSS A;  2C06 A;  1WHM A;  2EFI A;  1VQN T;  2DXC A;  1JJ2 A;  4JRQ A;  3FDR A;  5FRO A;  4IUR A;  1LCK A;  3QXE B;  3M0S A;  3OYE A;  2FZC B;  5IXF A;  1PD0 A;  2OJ2 A;  1QVF A;  3ZEH A;  1KFZ A;  2CP7 A;  2DVE A;  4XTU A;  1YJW Q;  3CBM A;  5GAN 5;  2RJF A;  1OPL A;  2X4J A;  4BI8 B;  3CQT A;  3PE0 A;  4OMN A;  3S3O A;  1W2B A;  3GBQ A;  3MEW A;  1VQ5 Q;  6AT1 B;  4OMF B;  4ZN3 A;  3CME T;  3QYH B;  1MV0 B;  1JXM A;  2BZY A;  2LQN A;  4XU2 A;  1NEB A;  2QDL A;  4JJN K;  1UGQ B;  2O9V A;  5A2Q E;  1GCQ A;  4XQ3 A;  1JB0 E;  3CCJ A;  4K11 A;  3C4S A;  4LN2 A;  1PKS A;  3OW2 S;  2RHX A;  4HT9 A;  1QKX A;  5LJ3 f;  5IAY A;  3CCV A;  1IO6 A;  1D1B A;  3PIO A;  4EPC A;  3QJ6 A;  1ZSZ A;  3CCJ T;  1SG5 A;  3L2Z A;  4EDU A;  3NFC A;  3S6W A;  3PIP A;  1YHQ Q;  2KDS A;  5CKD A;  2LJ0 A;  1PHT A;  4OB3 B;  2J6K A;  1B7T A;  2EYZ A;  2OTJ Q;  1OU8 A;  2OTL A;  2QA4 Q;  4L5G A;  1PRL C;  3I5S A;  3TU4 K;  4Z02 A;  5GAN 6;  3M5A A;  4JLI A;  1YIT Q;  3VU3 C;  1FX7 A;  3JCM V;  5EG2 A;  1VIE A;  2CH4 A;  1QMC A;  1SKU B;  2RHI A;  3OYF A;  1M1K C;  4RG8 A;  3GOX A;  3H8Z A;  3JCM W;  4A4E A;  4VUB A;  3C12 A;  2RHZ A;  2EJ9 A;  2VWF A;  2JM9 A;  1VQM A;  1QP2 A;  1NG2 A;  4D8K A;  4E7Z A;  2YHT A;  1UHF A;  4PLL A;  3TVT A;  3GIB A;  3OBW A;  3M0P A;  4OMM A;  1FMK A;  2C0T A;  2J6F A;  3T9N A;  4PJO G;  1OEB A;  2KQW A;  1BU1 A;  1YNZ A;  1B34 B;  5J26 A;  2PTK A;  3CCS Q;  1N8R U;  4IUQ A;  4AFU C;  4JRP A;  5FWB A;  3ZFJ A;  3L2V A;  5GAO l;  2RQU A;  3WVE B;  2JNG A;  3DLL A;  2O01 E;  2FVU A;  1Q82 U;  1WDX A;  5GAO p;  2P4T A;  3TRE A;  2QGF B;  1WX6 A;  5I21 A;  1K73 C;  5CCA A;  3PFS A;  4CC7 A;  2AZV A;  2CZ1 B;  2VGN A;  3MEV A;  1ZLM A;  4LUD A;  2ABL A;  2DEU A;  3I5R A;  1S1N A;  2BZ8 A;  2RJD A;  2X51 A;  1VQO Q;  3QWX X;  5GMK j;  1OI1 A;  4PJO B;  2GGR A;  4N4H A;  3L2R A;  1X75 C;  1PG5 B;  3FJP A;  2KY9 A;  1Z9Q A;  1K0X A;  4EIK A;  1MGQ A;  2VXF A;  2ROT A;  4HT8 A;  2XDD A;  3M0R A;  4XTV A;  5LJ5 f;  3HFN A;  3EG9 B;  3A98 A;  5FWC A;  1UG1 A;  2D9T A;  1JJ2 P;  3UF4 A;  4UC4 A;  4RTU A;  2XDP A;  2P0Q A;  1VQP T;  3JB9 G;  2M02 A;  1JQQ A;  3OQ5 A;  3S3M A;  4JJB A;  4M77 C;  2M0O A;  1BB9 A;  5I2M A;  1ZBJ A;  2ESW A;  2O2O A;  1KD1 C;  2JJ9 A;  3P8H A;  1M2O A;  1W2B P;  4JJC A;  3JCM J;  3CCR Q;  1H3Z A;  1M27 C;  2FO0 A;  5L8R E;  5ECA A;  5CK9 A;  1YJN Q;  3C0C A;  4C92 A;  1OOT A;  1LOJ A;  1Y07 A;  3CCE Q;  3I56 A;  2E5Q A;  2LJ3 A;  3BDU A;  3E9G A;  3EFS A;  2XG8 D;  2DKG A;  3NGP A;  1VQ8 A;  2NLU A;  4DBF A;  4J9H A;  3OYG A;  4PNO A;  4L6V 5;  2KRS A;  1KC8 C;  2K5L A;  3EGD B;  2L3S A;  5A0L A;  2YUN A;  2EQK A;  4CC4 B;  3I56 T;  3CCU A;  4F14 A;  4DBR A;  4BY6 B;  4ELZ C;  1VQ8 T;  5GAN g;  5CQY A;  3O5Z A;  1M2V B;  4Z8A A;  1AZE A;  4OF1 A;  1U3O A;  4M7D D;  1YCS B;  4HXJ A;  1AEY A;  1TH7 A;  2JS0 A;  1QVF S;  4EMH A;  3G71 A;  3VS4 A;  5GAN j;  4C8Q C;  2DET A;  1AWJ A;  4M75 G;  2FPF A;  4BI3 A;  1VQN Q;  2ZPH B;  1R0B G;  5GMK e;  4C8Q G;  2HD0 A;  2EAY A;  2D6F A;  1YJ9 A;  2DL4 A;  2E3H A;  1GBR A;  3NTK A;  4M7A E;  3L1A A;  1RAB B;  3G71 T;  1AWO A;  2NYS A;  1BCM A;  2R57 A;  5D7U A;  4RCC A;  5EC7 A;  3OYC A;  2M16 A;  3EFO B;  2DTH A;  2ZAE A;  1GXI E;  4FSX A;  3OMG A;  1XTD A;  4J9D A;  2IIM A;  2EQJ A;  2AHJ B;  3LH5 A;  2LT4 A;  2JUF A;  2BIV A;  3FC3 A;  1IRE B;  4KRT A;  1YJ9 T;  3DLM A;  2X35 A;  1NLP C;  5FRN A;  4LDU A;  1J3T A;  1NYG A;  4KBM B;  4OB0 B;  1VQ4 A;  2RH2 A;  2P84 A;  2YRV A;  2PZ1 A;  5IHK A;  1VIF A;  4J6W A;  2NUP B;  1D0X A;  1KC8 R;  1PC0 A;  3AHU A;  3TSW A;  4ZN1 A;  5I22 A;  4BI4 A;  1N9S A;  2JTF A;  1ZX6 A;  4M75 B;  1H3H A;  1KSW A;  1N8R R;  2K2M A;  1FWZ A;  3QZ9 B;  2QQA A;  4F04 B;  3QYG B;  2QA4 T;  3OS5 A;  3JCM f;  1UGP B;  1UGV A;  2RHY A;  4FYV B;  3OS1 A;  3CCJ Q;  4LUE A;  2R5A A;  4C0F A;  5DLQ E;  1GL5 A;  1M1F A;  3M55 A;  1I0C A;  1H8K A;  1PSE A;  1YIT T;  2YUQ A;  1I81 A;  2J7I A;  1C6V X;  3SEM A;  3CCV Q;  3IQL A;  4A4K A;  4RKU E;  3E2U A;  1NJI U;  3L2Q A;  2K3X A;  3E19 A;  1TOV A;  4M7A D;  2NUT A;  5CKE A;  1MMN A;  1Z9Z A;  1O9S A;  2MOX A;  2FPD A;  1WXB A;  4RTT A;  2J6O A;  1G83 A;  1K8A U;  2E12 A;  1Q86 C;  1LPL A;  4R56 A;  2LP5 A;  2OTL Q;  3X25 B;  4C5E A;  3A8O B;  1OZ3 A;  1GFD A;  4AFZ C;  5LJ3 h;  5GAN e;  4M78 B;  4DBQ A;  1VQ7 A;  3M4G A;  2LMJ A;  2YRD A;  3UAT A;  2HSP A;  3L2W A;  4ATO A;  2DAQ A;  1RLQ C;  2QG9 B;  3M59 A;  1BI1 A;  2EQI A;  2QTV A;  4HCB A;  4IIM A;  2CYZ B;  5LJ3 g;  1ZSZ C;  1VQ7 T;  1UHC A;  2ATC B;  2CS7 A;  1VQM Q;  4J9C A;  4JPB W;  1Q81 C;  2HL5 C;  5GAN 4;  3ZBD A;  2X9H A;  5AT1 B;  2MIO A;  1Q95 G;  4XU0 A;  2JT4 A;  4XTY A;  3GP8 A;  4EMK C;  2JW4 A;  2KT8 A;  5DM7 R;  5CO7 A;  4Q5W A;  1K1Z A;  1VUB A;  5GJV B;  1VQ6 A;  3V7C A;  4ME7 A;  4XTZ A;  1I5L A;  4J9G A;  3EFO A;  3VUB A;  3CCL A;  2QK0 A;  2LCS A;  4F16 A;  4J9E A;  4R0K A;  4PJO F;  1AWW A;  3INZ A;  3PT9 A;  2DJQ A;  3PMI A;  1QQJ A;  3CC2 A;  1M90 U;  3CCL T;  2XID A;  4MZT A;  4HVW A;  2KSS A;  5HK3 A;  3NTH A;  3I55 A;  2LZ6 B;  4E6R A;  3QHS A;  2FZK B;  3VYG A;  1I07 A;  2DK3 A;  1K9A A;  2CZ6 B;  2XDB A;  2DYI A;  2JTM A;  4HCZ A;  4AMC A;  1UTI A;  1FMW A;  3HRT A;  1X2K A;  2A36 A;  2F5K A;  1DJ7 B;  2DTO A;  3FB9 A;  3I55 T;  1YWP A;  2HQX A;  5IT9 E;  1BKB A;  4BUG A;  3RER A;  3Q1J A;  3VS6 A;  3C95 A;  2DVJ A;  5M9O A;  1MNE A;  2Y4X A;  3EGX A;  3OA6 A;  1Q81 R;  1MMA A;  4J5Y A;  4NL2 A;  2JZ2 A;  1ZSG A;  5DY9 A;  2LNH B;  2JS2 A;  2MAM A;  3GLX A;  1MV3 A;  1YN8 A;  2KK4 A;  2QYZ A;  3UDC A;  2RA2 A;  2DFU A;  1R8O B;  3KBG A;  3JB9 F;  3OYJ A;  2RI3 A;  2R58 A;  4M78 A;  3I56 Q;  4A4G A;  2DO3 A;  4D8D A;  1Y96 A;  3A8L B;  2COY A;  1VQ8 Q;  3H0I A;  2I2L A;  2XHC A;  5LJ5 g;  4M7D A;  4DQ2 A;  2VXE A;  3E1S A;  5LJ3 e;  4A4H A;  4FW2 A;  3RMQ A;  3CCU Q;  1LVK A;  4NL3 A;  1N27 A;  4A4F A;  3O8V A;  5LJ5 j;  1TU0 B;  2GQI A;  1WQW A;  2EGA A;  4ANJ A;  2E1H A;  2NWM A;  1IXD A;  4GY5 A;  2J05 A;  1E6G A;  2JXB A;  5GAO n;  4RG2 A;  3G71 Q;  1I5O B;  1G3Y A;  1X01 A;  4C92 G;  2EYY A;  4FYW B;  2DIL A;  1IZ6 A;  1U06 A;  3RKW A;  1UJY A;  2KVQ G;  4CRI A;  2PQW A;  1YJ9 Q;  2KXD A;  1TS9 A;  3CPW A;  3M4Y A;  1T0H A;  1UEC A;  2PVD B;  3NTI A;  1QP3 A;  5FU7 C;  2V1Q A;  3MEA A;  2KT1 A;  2K5I A;  2O4X A;  4M75 F;  3JCM P;  3BFM A;  5FLX E;  4FL6 A;  2QXF A;  3M56 A;  4C8Q F;  2ED0 A;  4JS4 A;  4F7U B;  5KCH A;  2PUK B;  1BCO A;  1BK2 A;  1VQ4 Q;  3CCV T;  2A08 A;  3VRY A;  9ATC B;  3RUX A;  2EYW A;  1W4S A;  2OAU A;  4M77 E;  1RI0 A;  1AVZ C;  1R0C B;  4C92 B;  3WXM B;  3MHX A;  4RTX A;  4F17 A;  2LC4 A;  4N4I A;  3E9F A;  1CKA A;  3UA7 A;  2M51 A;  1JEG A;  2H3J A;  4M7A A;  3QKJ A;  2E6N A;  1KJW A;  1I1J A;  1WNL A;  2KBT A;  2OTL T;  1QCF A;  2DM1 A;  2D8H A;  1SSH A;  4PFO A;  1B3Q A;  1M8V A;  1F1B B;  4E7L A;  1BBZ A;  3EG0 A;  1SRL A;  3RKY A;  2RMO A;  1QVG A;  5LJ5 d;  5FU7 B;  4ZNX A;  1V76 A;  2F2W A;  1TXQ A;  1KD1 U;  4PJO C;  1G3S A;  2GTJ A;  1UUE A;  1UGS B;  3LW5 E;  1AWX A;  3RNJ A;  5GMK h;  2EQU A;  1VQM T;  1VYU A;  2DJZ A;  3ZL7 C;  2K2V A;  4P5N A;  2COZ A;  3JCM h;  2RD1 A;  2OAW A;  5LJ5 e;  3HFO A;  1BIA A;  4FT2 A;  1VQK A;  1YP5 A;  4ELY C;  2HL3 A;  5HY6 A;  1VQL A;  5KH6 A;  2CZ0 B;  1EX4 A;  2PVO B;  3GF5 A;  3BY7 A;  1ZUU A;  2JVV A;  4C8Q E;  4M77 D;  2KRN A;  3JCM g;  1VQ7 Q;  4RUG A;  2SRC A;  4AT1 B;  5C0M A;  2M0Y A;  1VQK T;  4Z88 A;  4JRI A;  2QEX A;  2F5T X;  1VQL T;  3UT1 A;  2HMA A;  1UGR B;  4XK8 E;  4ORZ A;  3M54 A;  4B9W A;  2ROL A;  3EHR A;  3JCM Q;  3QWY A;  2A37 A;  4E47 A;  4NS5 A;  1GCP A;  2QEX T;  1YBY A;  5HKC A;  4KH0 B;  1Q7Y U;  2CSI A;  3UA6 A;  4GLM A;  2JM8 A;  1VQ9 Q;  5CR2 A;  2AK5 A;  1VQ6 Q;  1M8M A;  2GCX A;  2L3Q A;  1UJ0 A;  4DOW A;  4ZGJ B;  1KQS A;  2GFA A;  3V8L A;  1IGU A;  4QQD A;  1W1F A;  4BY6 C;  1X2Q A;  1BIB A;  1E6H A;  2CT3 A;  3CCL Q;  2BE7 D;  2EJF A;  2XD0 A;  1ZA2 B;  1Y57 A;  4ZGE B;  2M1H A;  3LLR A;  2RO0 A;  4F7U A;  2HEQ A;  3CC2 Q;  2XIC A;  4J7I A;  2M9U A;  4ZGD B;  3EAE A;  3JB9 J;  2YWW A;  3V7S A;  4C8Q D;  3M58 A;  3I55 Q;  2DE0 X;  3V8K A;  1RAA B;  4LXC A;  4JZ3 A;  2YSQ A;  2P0P A;  1PCX A;  1M9S A;  4AFQ C;  1IHW A;  2NUT B;  2X4X A;  2G6F X;  3H9N A;  5FW9 A;  5GAN h;  4JS5 A;  4MDX A;  1X43 A;  3HP9 A;  2AKK A;  1SHF A;  2YUP A;  1AT1 B;  3CPW P;  2O9S A;  4Y92 A;  1K9M U;  3EFR A;  1N8R C;  2GFU A;  3EH1 A;  2WSC E;  2VC8 A;  2EVR A;  1Q82 C;  1OV3 A;  1WHG A;  4PL6 A;  3RR6 A;  2CP6 A;  3CC4 A;  1JJ2 S;  1WJR A;  1TTH B;  4RTV A;  3CCM A;  2CUD A;  2K3Y A;  4RTZ A;  3CCU T;  3QO3 A;  2E10 A;  1Y0M A;  1NBE B;  1PRM C;  1D0Z A;  4M75 C;  4DA4 A;  4RTW A;  2RB6 A;  1YWO A;  2E41 A;  1RAD B;  2CUB A;  2EKO A;  2K4Y A;  2L89 A;  2JTE A;  3KXT A;  2L5Q A;  4WTO B;  2WAC A;  2DL5 A;  3KFV A;  1W2B S;  1OQK A;  3CCM T;  2EJG A;  2F2X A;  2HKQ B;  3JCM e;  4WF2 A;  4FT4 A;  3MET A;  4IUV A;  3JAM E;  5KYU B;  1M30 A;  1AHJ B;  3X28 B;  4N0A A;  2FHD A;  4MZP A;  1SPK A;  3OY9 A;  2HQH A;  1QVG P;  4KUL A;  4Z89 A;  1CSK A;  2DD4 A;  2KXC A;  2C0I A;  3EHQ A;  5CKF A;  1XNI A;  2DXT A;  4B9X A;  3JSC A;  3OYH A;  1X6B A;  3NHN A;  1WJS A;  2RQW A;  1CKB A;  2W10 A;  1MND A;  2VKN A;  4IIO A;  2LTO A;  2D0N A;  1RAC B;  4HKE A;  3J80 E;  2FRW A;  2CP5 A;  2PNI A;  2EWN A;  2DXU A;  3CMA A;  3DB3 A;  2V8K A;  3DB4 A;  3EG2 A;  4FU6 A;  1GFC A;  2EGC A;  3LGL A;  1VQ4 T;  5HCK A;  1M3B A;  2MI6 A;  4DEY A;  5CKB A;  3A5Z B;  4M78 C;  2RK1 A;  2DL7 A;  2DA9 A;  3OYB A;  2KAF A;  2L3R A;  3OSS C;  3M9Q A;  1Q82 R;  4J8O A;  1G3W A;  4J83 A;  1D1A A;  3CMA T;  4MMK A;  4M78 G;  4OVA A;  4F7U F;  4M7D C;  2DYB A;  2ZPI B;  3EGX B;  2FYK A;  2WSE E;  4M7D G;  1M1G A;  1IB8 A;  2JMC A;  2Z0W A;  1WQ7 A;  1JXO A;  1FXX A;  1HK9 A;  4C92 F;  1YIJ A;  4IUT A;  2HKN A;  2K6D A;  3PMT A;  2MWO A;  4BAC A;  2LVM A;  4IUU A;  1I8F A;  2MYS A;  3JRZ A;  1D09 B;  3CEY A;  2P4R A;  2QQS A;  3MCA B;  3MPU B;  3OSV A;  4LE9 A;  1EIF A;  1YIJ T;  3RIR A;  1AD5 A;  2PUO B;  3X20 B;  2RN8 A;  3H0F A;  4OB2 B;  5IH2 A;  2LQ8 A;  5FU6 B;  1KQS P;  1MHN A;  4O5V A;  1GCQ C;  3BDL A;  2MF2 A;  4CI0 C;  2BTT A;  5GMK m;  5IHN A;  4NOY A;  4GBQ A;  1Y96 B;  4FM4 B;  5I11 A;  4OMP A;  5GAM d;  4E7H A;  4OB1 B;  2HDA A;  3UWN A;  4M7D B;  4E7S A;  3GNG A;  1RAH B;  5KYY B;  1UDL A;  2W0Z A;  3SHW A;  3CC7 A;  1RLP C;  2F2V A;  2CT4 A;  4FW1 A;  5LJ3 d;  5FRM A;  1ZBX A;  1RAF B;  2CP3 A;  3RES A;  4M77 A;  2K57 A;  1W70 A;  1VQ9 A;  4LD6 A;  2LRQ A;  2IPO B;  2X4W A;  3CC7 T;  4PKC C;  3JV3 A;  3SB2 A;  5GAM j;  3VV0 A;  5KYU A;  1OX9 A;  3CBP A;  3V7R A;  2BE9 B;  1VQK Q;  2KEA A;  2Y90 A;  3SWN B;  2DL8 A;  2O88 A;  1VQL Q;  1VQ9 T;  2VVK A;  1K9M R;  4M7A G;  2ENM A;  2XU8 A;  1VQ6 T;  2E5K A;  2GF7 A;  3N5B B;  1KQ1 A;  1KQS S;  3H0H A;  4BD3 A;  2QEX Q;  2O4X B;  2EGE A;  3GPL A;  2COW A;  3MP1 A;  4C0G A;  1WHH A;  1AZG B;  3CCQ A;  5D6X A;  2AIR B;  3CXC P;  4XAX B;  3OBY A;  3BE3 A;  2VUB A;  3CC2 T;  1VYT A;  2RJC A;  5CQX A;  3SFM A;  1AOJ A;  2RM4 A;  4E7K A;  2NUZ A;  1NJI C;  2LQK A;  4BE1 A;  1PKT A;  4E2F B;  1X27 A;  3PVL A;  3SD4 A;  3MO8 A;  2DEQ A;  2DBK A;  1C0M A;  2PU9 B;  2QI2 A;  3QPH A;  1T3S A;  1QCO A;  2CRE A;  2K5F A;  4EMG A;  2DD5 A;  4PJL A;  1IHV A;  2MWP A;  2QTX A;  3RKX A;  4FYX B;  4M7A B;  1U8R A;  1K8A C;  2K79 A;  4JLG A;  1QCN A;  3I35 A;  4PFP A;  2ZPG B;  4D6W A;  3OMC A;  4OGC A;  1D3B B;  3VS3 A;  3JCM b;  1WHJ A;  3MKD A;  4Y91 A;  3A8G B;  3VS2 A;  4CC2 A;  3QII A;  2SEM A;  3ME9 A;  5LJ5 h;  4JZ4 A;  2EPD A;  3H6Z A;  3VJP A;  4OGE A;  5A0D A;  4C5G A;  1ABO A;  5KYX B;  2FRY A;  3URG A;  3A8H B;  1UEB A;  5KCO A;  4PJO E;  2JN0 A;  1KG1 A;  1UB4 A;  3FRN A;  4OMO A;  4BDZ A;  3VUZ A;  5GAN 2;  1G8X A;  4HCK A;  4HA8 A;  5KYY A;  3P8B B;  3X26 B;  3EGU A;  2QAZ A;  2YLC A;  3OW2 P;  4XU1 A;  1M1K U;  1G5V A;  2AZS A;  4DBH A;  3QG1 A;  1KQ2 A;  4HVU A;  1XQH A;  1ZUK A;  4J6X A;  1Y7X A;  2KI7 A;  1NLO C;  3L2U A;  3V8J A;  2E6Z A;  1NJI R;  4V2S A;  3TSZ A;  3RMS A;  2DTI A;  3JB9 I;  1BI3 A;  2A7Y A;  2FB7 A;  2RPN A;  3CC4 Q;  4KGV B;  3CCM Q;  4F7U G;  1EZZ B;  1TG0 A;  1M3C A;  4MZM A;  4C92 C;  2DRM A;  4C0D C;  5CVI A;  3REB B;  1HSQ A;  5GAO r;  4LD9 K;  3CME A;  1M90 C;  1JU5 C;  1WXU A;  1K8A R;  4LDV A;  2E4H A;  2F69 A;  2ZCF B;  3SWN A;  4IKF A;  2E64 A;  4JJD A;  2FEI A;  4MML A;  1QVP A;  2K9G A;  1ZQ1 A;  1BYM A;  2RQV A;  2HCK A;  1NM7 A;  5GAM f;  1K73 U;  3ASK A;  1X69 A;  2K3B A;  3EG3 A;  4PJO D;  4JUV A;  2E65 A;  3J81 E;  2BZX A;  1XOV A;  2CDT A;  1OU9 A;  2RQR A;  4A53 A;  1HJD A;  4QVD A;  3TEE A;  3CPF A;  5KYN A;  1WGS A;  2YDL A;  3FJ5 A;  2XKO C;  2HSE B;  1QLY A;  2D8J A;  1RAG B;  2RK2 A;  2AT1 B;  2DXB A;  1NE8 A;  2YRC A;  3CMA Q;  3G6E Q;  4C0D B;  3JCM X;  1GRI A;  3MEU A;  5AYF A;  1N6A A;  4ESR A;  3QJY A;  2L8D A;  2K7A A;  2DPP B;  5IN1 A;  3JCM c;  2L3P A;  4EMK A;  4RMO A;  3F70 A;  1LNX A;  8ATC B;  1TUG B;  1VYV A;  1D3B A;  4N0A C;  3G4S A;  1U1S A;  1QWE A;  3LWH A;  4DOV A;  3M0T A;  3OYL A;  2LNV A;  1OX8 A;  4J9I A;  3HKS A;  2HBP A;  1M90 R;  2KGT A;  2V26 A;  2DF6 A;  4E7I A;  1WHL A;  4FCY A;  2KE9 A;  3GNF B;  1YIJ Q;  4QKU A;  2V8J A;  1QWF A;  3G4S T;  4M78 F;  4PJJ A;  3VRZ A;  5KYX A;  1ABQ A;  3HSB A;  4AG2 C;  2VV5 A;  3NMZ C;  1NEG A;  2QGG A;  4M7D F;  1WXT A;  1OUL A;  4M4Z A;  4QQ6 A;  1PD1 A;  3G7Z A;  4PLI A;  4X34 A;  3JB9 D;  2ZGW A;  1RUW A;  4X9D A;  4QT7 A;  4E7J A;  2DBM A;  1SRM A;  2H8H A;  2OX7 A;  3LX7 A;  1KC8 U;  4M75 E;  1T0J A;  1S72 A;  1N5Z A;  3FLG A;  1BI2 A;  3EH2 A;  3CD6 A;  1W6X A;  1KIK A;  2DZ9 A;  1X6O A;  4N4G A;  2GNC A;  3JCM d;  4TVR A;  5CKH A;  3VS0 A;  1S72 T;  1C1A A;  3CD6 T;  4JDS A;  3CC7 Q;  3SDZ A;  1TUD A;  2RNA A;  1P92 A;  2DIG A;  4OML A;  4KGZ B;  3EG1 A;  2J06 A;  3P8D A;  2XMF A;  1N9R A;  3OYD A;  2KRO A;  2GQV A;  2LCL A;  3ULR B;  1WA7 A;  4C5H A;  4QQG A;  3M57 A;  4C0Z A;  3A1P A;  3M0Q A;  4J9B A;  1I4K 1;  3QSU A;  5CIU A;  2BUD A;  2FZG B;  1OPK A;  1WLP B;  2L2P A;  1FYN A;  4ZTF A;  5GAN 7;  1M1K R;  2ED1 A;  3RDV A;  1VQP A;  1VOM A;  3OYK A;  4M78 E;  5CAI A;  3M0U A;  3VKI A;  3TQ7 P;  2E3I A;  1O75 A;  3R6N A;  4M75 D;  2CP0 A;  2XK0 A;  3A8M B;  2X3X D;  2LX9 A;  4M7D E;  3ER0 A;  4AG1 C;  1YI2 A;  1KHI A;  3X24 B;  2V1R A;  3CCQ Q;  4Y28 E;  2VAS A;  1QVF P;  1WFW A;  4M7A F;  1G2B A;  3TCJ A;  5A0G A;  2VB6 A;  5GMK l;  2LJ1 A;  3J7A F;  1TWB A;  2L0A A;  4RTY A;  1IGQ A;  4M77 G;  3OS0 A;  1YI2 T;  5KYW B;  2JOY A;  1NYF A;  3BW1 A;  4QVC A;  4KUD K;  2DER A;  1EFN A;  1MMG A;  2MPX C;  2DZC A;  3I9Q A;  4ZTJ A;  1K73 R;  2LDM A;  1TUC A;  3PNW C;  1D1C A;  2FG0 A;  4LDW A;  4MDW A;  4QW2 A;  4C5I A;  5GAN d;  2LT1 A;  3MP6 A;  2A0F B;  2EQM A;  3S3N A;  3LWI A;  2B86 A;  2CGH A;  2ZPE B;  1YJW A;  3CXC A;  1PWT A;  4M78 D;  2IG0 A;  5GJW B;  3CC4 T;  2DX1 A;  2MMP A;  2AKL A;  3DKM A;  1WJQ A;  4M77 B;  1Q86 U;  2HNI A;  2ZPF B;  3MJX A;  1VQ5 A;  3OYM A;  1YJW T;  4LDY A;  3L42 A;  3U23 A;  1B34 A;  1PNJ A;  4PJM A;  1D0Y A;  4XTW A;  2LX7 A;  2LCC A;  4LNP A;  3PGG A;  1GBQ A;  2YT6 A;  3QBY A;  5C6S A;  3JB9 H;  1U1T A;  3HRU A;  1Q7Y C;  1NZ9 A;  4BDY A;  2EBP A;  1RAI B;  4J7F A;  2YXY A;  1VQ5 T;  2HZY A;  2FPE A;  2RHU A;  1G3T A;  2EIF A;  2GTO A;  3FIF A;  2ECZ A;  1SHG A;  1KD1 R;  8AT1 B;  4A54 A;  3CPW S;  1ZA1 B;  2DMO A;  1Q81 U;  2EYQ A;  1H92 A;  1B07 A;  5GAO m;  1KK7 A;  3REA B;  3G6E A;  2HQE A;  1UFF A;  2P0K A;  1WI7 A;  1MUZ A;  3D7S B;  5FU6 C;  2DL3 A;  4JRK A;  1YHQ A;  4PJO A;  3CME Q;  4B6M A;  2OTJ A;  1NPR A;  7AT1 B;  2KMT A;  2QA4 A;  3OYY A;  2KR3 A;  3G6E T;  2O31 A;  1JBM A;  3KUF A;  3VS1 A;  1MMD A;  4DEX A;  3EG9 A;  3WVD B;  1K76 A;  3THK A;  1YHQ T;  1FMV A;  5GAN 3;  3OW2 A;  3FEO A;  4C8Q B;  4A63 B;  1YIT A;  3HPW A;  2OTJ T;  1QW1 A;  4FYY B;  2CH4 W;  2MCN A;  1SF9 A;  1U5S A;  4KH1 B;  1RI9 A;  4YTL A;  2QQR A;  2Y4Y A;  4O6J A;  4KT0 E;  1PSF A;  2B8A A;  1K9M C;  1JO8 A;  5GMK i;  3H41 A;  1QVG S;  4PK4 A;  4HCC A;  2PVG B;  1HD3 A;  1Q7Y R;  1WPY A;  5KYW A;  2I0N A;  1WYX A;  1QKW A;  3CBO A;  4BE0 A;  1ZHI A;  3SWN C;  4BB7 A;  2CKK A;  1IRX A;  5GAM h;  2X4Y A;  1RAE B;  1WZO A;  3CCS A;  2VYT A;  3LGF A;  5D6Y A;  3HL8 A;  1XJW B;  4KUI A;  3QZ5 B;  5GAN 8;  1OYX A;  3C94 A;  1JRI A;  1UE9 A;  1RL2 A;  1WIE A;  3G4S Q;  3EGD A;  1R77 A;  2A3L A;  2V8I A;  3RBB B;  2EYX A;  2RQT A;  3VS7 A;  4QVZ A;  2F1L A;  5GAM g;  2CSQ A;  4AFS C;  4II1 A;  2CZ7 B;  2DRK A;  3CCS T;  3UPU A;  5J39 A;  5KE3 A;  1M4Z A;  4OMQ A;  1SSF A;  2H3E B;  1M2V A;  3MP8 A;  2VGM A;  1YFN A;  1OZ2 A;  4X9C A;  1HYO A;  4F7U E;  1ACM B;  3PVQ A;  1VQO A;  1X6G A;  2OI3 A;  1Y71 A;  4M7A C;  2HBW A;  2BKD N;  4C92 E;  2ZPB B;  5I2S A;  2G3R A;  2LQW A;  1S72 Q;  2YLB A;  1K0S A;  2QDY B;  2RI2 A;  1VQO T;  4LDX A;  3CD6 Q;  5LJ3 j;  1K4U S;  1E7O A;  3HHT B;  2RJE A;  2C0O A;  2ZZD A;  4GLK A;  1WHK A;  2D1X A;  4BE2 A;  1A0N B;  1KHC A;  5GAN f;  2XI9 A;  5D6W A;  2JMA A;  4XU3 A;  3LYI A;  4X1V A;  3QDR B;  1LJO A;  3R6O A;  3CCR A;  5GAO q;  2NUP A;  3QDF A;  1Q86 R;  5J3B A;  3PTA A;  3M53 A;  3CCQ T;  1YJN A;  1ZSZ B;  1PM3 A;  4M75 A;  3CCE A;  2QQ9 A;  2CP2 A;  2EW3 A;  3LH0 A;  1VA7 A;  4C8Q A;  1V1C A;  2DNU A;  3CCR T;  4EMK B;  2KYM A;  4RCB A;  1M3A A;  4R55 A;  5L23 A;  2RF0 A;  3OS2 A;  3G1J A;  4KGX B;  2GBQ A;  5IXB A;  2IVW A;  1YJN T;  3VYH B;  1ARK A;  1VQP Q;  3NPF A;  4L59 A;  5IHI A;  3CCE T;  1BI0 A;  4J9F A;  5DLO A;  2YUO A;  4XTX A;  4C92 D;  2KNB B;  3VS5 A;  3OB9 A;  5KE2 A;  2KYB A;  3HTR A;  1YI2 Q;  1TSF A;  2A28 A;  2QQB A;  2RI5 A;  4WCI A;  3AT1 B;  2X3W D;  4IUP A;  1ZUY A;  1NPP A;  4PFZ A;  3OYN A;  2E70 A;  5LL6 S;  2DIQ A;  2DLP A;  1M5Q 1;  3CXC S;  1H64 1;  4J6Y A;  2D0Q B;  2EKH A;  2WSF E;  3HRS A;  5HK0 A;  3OYI A;  1HXD A;  1V29 B;  2HAX A;  4OP0 A;  1VQN A;  4PJN A;  5GAM e;  3QUI A;  2QAS A;  1YCY A;  4FIB A;  1T3L A; 
#chains in the Genus database with same CATH homology
 2KRM A;  1RLQ C;  1Y0M A;  4QT7 A;  2EQI A;  1PRM C;  4HVV A;  2DBM A;  4IIM A;  4RTW A;  4CC3 A;  1SRM A;  2H8H A;  1SEM A;  1YWO A;  4FSS A;  2CUB A;  1T0J A;  2JTE A;  1N5Z A;  1UHC A;  2DL5 A;  3KFV A;  1LCK A;  4J9C A;  3M0S A;  1W6X A;  2F2X A;  4JPB W;  1KIK A;  5IXF A;  2OJ2 A;  2MIO A;  1KFZ A;  2JT4 A;  2GNC A;  2JW4 A;  1M30 A;  2KT8 A;  3VS0 A;  1OPL A;  1SPK A;  1K1Z A;  5GJV B;  3CQT A;  3PE0 A;  4OMN A;  3GBQ A;  1TUD A;  2RNA A;  4Z89 A;  1CSK A;  2KXC A;  4OML A;  2C0I A;  3EG1 A;  2J06 A;  3EHQ A;  4J9G A;  2XMF A;  1X6B A;  3NHN A;  2KRO A;  2LCS A;  4F16 A;  2RQW A;  1WA7 A;  4J9E A;  1MV0 B;  4R0K A;  3ULR B;  1CKB A;  1JXM A;  2BZY A;  1AWW A;  2W10 A;  2LQN A;  2VKN A;  4IIO A;  3M0Q A;  1NEB A;  4J9B A;  2D0N A;  2DJQ A;  2QDL A;  2FRW A;  2O9V A;  2PNI A;  1OPK A;  1GCQ A;  3EG2 A;  1WLP B;  2L2P A;  4K11 A;  1GFC A;  2EGC A;  4HVW A;  1FYN A;  4LN2 A;  5HCK A;  1PKS A;  1M3B A;  2ED1 A;  2LZ6 B;  4DEY A;  4E6R A;  1QKX A;  2DL7 A;  2DA9 A;  1I07 A;  1IO6 A;  3M0U A;  1K9A A;  3R6N A;  1UTI A;  2X3X D;  2DYB A;  1X2K A;  2A36 A;  4AG1 C;  1YWP A;  2V1R A;  2LJ0 A;  1PHT A;  2JMC A;  3VS6 A;  1WFW A;  1JXO A;  1G2B A;  2J6K A;  2EYZ A;  2DVJ A;  2LJ1 A;  2L0A A;  2K6D A;  1PRL C;  4RTY A;  3I5S A;  1NYF A;  2P4R A;  1ZSG A;  4LE9 A;  2LNH B;  1AD5 A;  2CH4 A;  1EFN A;  2JS2 A;  3I9Q A;  2RN8 A;  1MV3 A;  3H0F A;  1TUC A;  1YN8 A;  5IH2 A;  2FG0 A;  1GCQ C;  2BTT A;  2VWF A;  5IHN A;  2JM9 A;  4GBQ A;  1NG2 A;  4D8K A;  5I11 A;  4OMP A;  1UHF A;  2HDA A;  2B86 A;  3TVT A;  4D8D A;  3M0P A;  1PWT A;  4OMM A;  1FMK A;  2C0T A;  2J6F A;  1UDL A;  1OEB A;  3H0I A;  2W0Z A;  5GJW B;  3SHW A;  1BU1 A;  1RLP C;  1YNZ A;  2DX1 A;  2AKL A;  2PTK A;  2F2V A;  2CT4 A;  4AFU C;  5FWB A;  3U23 A;  2RQU A;  1PNJ A;  2LX7 A;  1W70 A;  4LNP A;  1WDX A;  1GBQ A;  2YT6 A;  3JV3 A;  1WX6 A;  2EBP A;  2GQI A;  2EGA A;  4CC7 A;  2AZV A;  2FPE A;  1ZLM A;  4LUD A;  2NWM A;  2ABL A;  2GTO A;  2J05 A;  2KEA A;  2ECZ A;  2DL8 A;  1SHG A;  3I5R A;  2O88 A;  1E6G A;  2JXB A;  2VVK A;  1S1N A;  2BZ8 A;  2ENM A;  2DMO A;  2E5K A;  1H92 A;  2EYY A;  1B07 A;  3QWX X;  3REA B;  2DIL A;  2GGR A;  1U06 A;  3H0H A;  1UJY A;  1UFF A;  1Z9Q A;  1WI7 A;  4EIK A;  1MUZ A;  1K0X A;  2EGE A;  2KXD A;  2DL3 A;  1AZG B;  1T0H A;  1UEC A;  2ROT A;  2V1Q A;  2KT1 A;  3M0R A;  3A98 A;  5FWC A;  1VYT A;  1UG1 A;  2KR3 A;  1AOJ A;  2O31 A;  3VS1 A;  2NUZ A;  1PKT A;  3UF4 A;  4DEX A;  1X27 A;  2ED0 A;  3PVL A;  1K76 A;  3THK A;  4RTU A;  2DBK A;  4A63 B;  1BK2 A;  1JQQ A;  1T3S A;  2A08 A;  2CH4 W;  4JJB A;  2CRE A;  3VRY A;  2MCN A;  1BB9 A;  1U5S A;  2EYW A;  1RI9 A;  1ZBJ A;  2ESW A;  2O2O A;  1AVZ C;  4JJC A;  1JO8 A;  2K79 A;  3H41 A;  4RTX A;  4F17 A;  1M27 C;  1CKA A;  3I35 A;  2FO0 A;  3UA7 A;  5ECA A;  2M51 A;  1JEG A;  1HD3 A;  3VS3 A;  3C0C A;  1OOT A;  1KJW A;  1I1J A;  3VS2 A;  2I0N A;  2KBT A;  1QCF A;  2DM1 A;  2D8H A;  2LJ3 A;  1SSH A;  1WYX A;  4CC2 A;  1B3Q A;  1QKW A;  2SEM A;  3NGP A;  1BBZ A;  3EG0 A;  1SRL A;  4J9H A;  2RMO A;  4JZ4 A;  2EPD A;  2KRS A;  4ZNX A;  2L3S A;  2F2W A;  1ABO A;  2YUN A;  2FRY A;  4CC4 B;  2GTJ A;  4F14 A;  1UE9 A;  1WIE A;  1UUE A;  4OMO A;  3RBB B;  2EYX A;  2RQT A;  3VS7 A;  3O5Z A;  1AWX A;  2CSQ A;  3RNJ A;  4AFS C;  2DRK A;  1VYU A;  3ZL7 C;  4Z8A A;  2OAW A;  4HCK A;  1AZE A;  3EGU A;  1U3O A;  4OMQ A;  2AZS A;  1YP5 A;  1YCS B;  4HVU A;  4HXJ A;  1AEY A;  1ZUK A;  2JS0 A;  1NLO C;  3VS4 A;  3TSZ A;  1ZUU A;  1AWJ A;  3PVQ A;  2KRN A;  2FPF A;  2RPN A;  1X6G A;  4RUG A;  2OI3 A;  2SRC A;  2M0Y A;  1TG0 A;  4Z88 A;  1M3C A;  2HBW A;  2DL4 A;  2DRM A;  1GBR A;  3REB B;  1HSQ A;  1JU5 C;  1WXU A;  1AWO A;  4ORZ A;  5EC7 A;  2LQW A;  2ROL A;  3EHR A;  1K0S A;  3QWY A;  1K4U S;  1E7O A;  2A37 A;  4J9D A;  2IIM A;  4JJD A;  3LH5 A;  2FEI A;  1GCP A;  4KRT A;  2C0O A;  2K9G A;  2D1X A;  1A0N B;  1NLP C;  1J3T A;  1NYG A;  2CSI A;  3UA6 A;  4GLM A;  2JM8 A;  2RQV A;  2HCK A;  1NM7 A;  2PZ1 A;  2JMA A;  5IHK A;  1X69 A;  2AK5 A;  2K3B A;  3EG3 A;  4X1V A;  1M8M A;  3TSW A;  2L3Q A;  1UJ0 A;  2BZX A;  1XOV A;  5I22 A;  1W1F A;  2CDT A;  1X2Q A;  1ZX6 A;  2RQR A;  1E6H A;  2CT3 A;  1H3H A;  1HJD A;  1KSW A;  2K2M A;  2YDL A;  1Y57 A;  3FJ5 A;  1QLY A;  2D8J A;  2EW3 A;  1VA7 A;  1V1C A;  2HEQ A;  1UGV A;  2DNU A;  4LUE A;  2KYM A;  1GL5 A;  1GRI A;  1I0C A;  1M3A A;  1H8K A;  5L23 A;  2RF0 A;  4ESR A;  2GBQ A;  2YUQ A;  2DE0 X;  5IXB A;  4JZ3 A;  2YSQ A;  2K7A A;  2J7I A;  4AFQ C;  1ARK A;  3NPF A;  2L3P A;  5IHI A;  3SEM A;  3IQL A;  4J9F A;  2YUO A;  1VYV A;  2G6F X;  1QWE A;  2KNB B;  5FW9 A;  1X43 A;  3VS5 A;  2AKK A;  1SHF A;  3M0T A;  1Z9Z A;  2MOX A;  2KYB A;  4J9I A;  2YUP A;  2A28 A;  2FPD A;  1WXB A;  4WCI A;  2KGT A;  4RTT A;  2J6O A;  2DF6 A;  2O9S A;  1G83 A;  1ZUY A;  2X3W D;  2KE9 A;  4Y92 A;  1QWF A;  2LP5 A;  3VRZ A;  2DLP A;  1ABQ A;  2EVR A;  2EKH A;  1GFD A;  4AFZ C;  4AG2 C;  3NMZ C;  1OV3 A;  1NEG A;  1WXT A;  4M4Z A;  2LMJ A;  4RTV A;  3UAT A;  2HSP A;  2CUD A;  4RTZ A;  1T3L A;  1RUW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...