2YDLA

Crystal structure of sh3c from cin85
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
67
structure length
67
Chain Sequence
ASDYCKVIFPYEAQNDDELTIKEGDIVTLINKDCIDVGWWEGELNGRRGVFPDNFVKLLPPLEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Distinct Ubiquitin Binding Modes Exhibited by SH3 Domains: Molecular Determinants and Functional Implications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords SH3 DOMAIN-CONTAINING KINASE-BINDING PROTEIN 1
total genus 10
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2011-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ydlA00
1K76A 3H0FA 2X3XD 1I0CA 2ENMA 3EG2A 4R0KA 2BZYA 3VS6A 2O31A 3REAB 1T3LA 4ESRA 2DYBA 1WXTA 2CREA 1SHFA 2D0NA 1AWWA 2GQIA 3VS0A 1NEGA 1NLPC 2KEAA 2BZ8A 4GBQA 2V1RA 2YUPA 4JPBW 3M0PA 1GL5A 1ZSGA 2RQVA 4RTXA 4CC7A 2DE0X 4IIOA 5L23A 3PVQA 3EG0A 1NM7A 4J9FA 4RTZA 1QWFA 4JJBA 2PNIA 1HJDA 1GBRA 4OMOA 2VWFA 4GLMA 5IHKA 1A0NB 2I0NA 2GBQA 4RTYA 1PHTA 1ZX6A 2FRWA 2AZVA 1AOJA 2CUDA 1K0SA 1UGVA 4J9BA 1S1NA 5FWCA 2RQWA 2O88A 1NEBA 3TVTA 1VYVA 1ZUYA 1RLQC 1B07A 2JS2A 2W0ZA 2LJ0A 3LH5A 2LCSA 5I22A 1M3CA 1Z9QA 2GGRA 4RTTA 4X1VA 2CH4A 1TUCA 2OI3A 2KR3A 1K0XA 2AZSA 4F14A 2DL7A 2OJ2A 3A98A 3M0TA 1WLPB 1I1JA 2EPDA 2L0AA 1H92A 2CDTA 1X69A 4ZNXA 3PE0A 4F16A 1YNZA 1QKXA 1UHFA 3EHQA 2O9VA 2KBTA 4AFQC 1XOVA 1X2KA 2JXBA 4HCKA 3KFVA 1ZUKA 3EGUA 3RNJA 2KYBA 1M27C 1GFDA 2QDLA 2KE9A 4JJCA 4Z8AA 2L2PA 2ED1A 4K11A 1GBQA 4OMMA 3GBQA 2NUZA 5IHIA 1QCFA 2ED0A 2DL5A 2DBMA 2EYYA 1E6GA 1GRIA 5IXFA 1PKTA 2PZ1A 3UF4A 2CH4W 1WXUA 3M0UA 4Y92A 4D8DA 2KRSA 2DNUA 1BBZA 3TSZA 2LQWA 4Z88A 1ABQA 3ULRB 1U5SA 2J06A 4LN2A 2JM8A 2HEQA 1RLPC 2DX1A 3UA7A 1RI9A 2GTOA 2DL8A 1I07A 1HD3A 1K1ZA 4HVWA 2YDLA 2CT4A 4HVUA 1E7OA 3FJ5A 1X27A 2LMJA 4RTWA 1YN8A 3SHWA 2P4RA 3EG1A 2H8HA 2DILA 2LP5A 2A36A 1X6GA 2D8JA 1MV3A 1NYGA 1WI7A 1E6HA 1M30A 3ZL7C 2EYZA 1T0HA 1UDLA 3M0SA 2AKLA 3QWYA 1CKAA 4RUGA 2DL3A 2JT4A 3O5ZA 4LUEA 1W70A 1BB9A 3CQTA 2F2VA 4EIKA 2A08A 1UUEA 4D8KA 2J6KA 2BZXA 2F2WA 1YP5A 2O2OA 2M0YA 1YCSB 2JW4A 1GCQC 1JU5C 1Z9ZA 3I5RA 2EGEA 1KIKA 5HCKA 1PRLC 4AFZC 3I9QA 2L3PA 2KRMA 2RQRA 1J3TA 1WX6A 1AZEA 4RTUA 1T0JA 2EGAA 2FEIA 2G6FX 4QT7A 4OMNA 4J9CA 3TSWA 1KJWA 4J9DA 1UHCA 1UE9A 4CC3A 2FPDA 1WXBA 5GJWB 1KSWA 1JXMA 2JTEA 2BTTA 1JEGA 2KGTA 2CT3A 2RQUA 1X2QA 1JXOA 4RTVA 1M3BA 1N5ZA 1QLYA 1X6BA 5FW9A 4J9EA 1OOTA 2SRCA 1PKSA 1PNJA 4DEXA 5FWBA 2ABLA 2F2XA 1WYXA 1ZUUA 2HDAA 2L3SA 2VKNA 4FSSA 1PWTA 4Z89A 2FG0A 3VS1A 4AG1C 1OPKA 4AG2C 2C0IA 2C0TA 2HBWA 3IQLA 1TUDA 3C0CA 4JZ4A 2X3WD 3SEMA 2FPFA 3R6NA 2DRKA 4CC4B 1U06A 4HVVA 2J05A 1FMKA 1B3QA 2K3BA 3JV3A 2J6FA 2EQIA 4F17A 1OV3A 2M51A 1SSHA 1ABOA 1AD5A 4JJDA 4HXJA 2VVKA 1HSQA 1AWXA 1NG2A 1JO8A 1GCQA 1AWJA 1X43A 3EG3A 1H8KA 2EYWA 2C0OA 3M0RA 2D1XA 2YUNA 3VS5A 1M8MA 1WDXA 2JMAA 4OMQA 1UJYA 4LNPA 2RF0A 1M3AA 2YT6A 1W1FA 1G2BA 1CSKA 2DBKA 2A37A 1ZLMA 2ROTA 3RBBB 1GFCA 1Y0MA 2LJ3A 2LJ1A 1W6XA 2DL4A 4JZ3A 2KRNA 1PRMC 4AFUC 2DLPA 2LZ6B 2MIOA 2RPNA 4A63B 1AWOA 4WCIA 2MOXA 3EHRA 1SHGA 2J6OA 1YWPA 3M0QA 2OAWA 1CKBA 2JMCA 1WFWA 3UA6A 2AKKA 1RUWA 2EVRA 1UJ0A 1G83A 2HCKA 4CC2A 4IIMA 1FYNA 4LE9A 1AEYA 1JQQA 1SPKA 3QWXX 4J9HA 1ARKA 2ESWA 5IH2A 5ECAA 3THKA 2XMFA 2JS0A 1UG1A 1Y57A 2MCNA 2KYMA 3NHNA 3NMZC 3I5SA 2EW3A 2YSQA 1ZBJA 5GJVB 4KRTA 1LCKA 2YUOA 1H3HA 4OMPA 1U3OA 2FPEA 1UFFA 2KNBB 2KROA 1KFZA 2RQTA 2HSPA 2D8HA 1VYUA 1AZGB 3PVLA 2GNCA 2V1QA 3H0HA 3VS4A 1WIEA 2EBPA 1BK2A 2K6DA 5EC7A 3H41A 1WA7A 4E6RA 2ROLA 1NYFA 2K9GA 3VS3A 5I11A 1QWEA 2EGCA 3VRYA 2B86A 2SEMA 3I35A 2CSIA 2EKHA 2EYXA 1K9AA 1NLOC 2K7AA 3VRZA 5IXBA 2DMOA 4OMLA 3NGPA 1VA7A 1OPLA 2KXCA 4J9IA 4DEYA 1MV0B 2CSQA 2PTKA 1SEMA 4LUDA 2KT8A 2IIMA 2LQNA 2J7IA 2DA9A 4ORZA 3VS2A 4J9GA 1TG0A 2O9SA 1SRLA 2A28A 2FRYA 2JM9A 2CUBA 1AVZC 3REBB 1YWOA 3UATA 5IHNA 3VS7A 1IO6A 4M4ZA 2KXDA 2NWMA 1K4US 1QKWA 1MUZA 2LNHB 2GTJA 2DRMA 2RN8A 2DM1A 2DF6A 3U23A 2RMOA 1BU1A 2ECZA 2YUQA 2RNAA 1OEBA 2LX7A 2DJQA 2K79A 1T3SA 2AK5A 1SRMA 2FO0A 2K2MA 1VYTA 2DVJA 1UTIA 2E5KA 2KT1A 1GCPA 1UECA 1V1CA 3H0IA 3NPFA 1EFNA 2W10A 4AFSC 2L3QA
chains in the Genus database with same CATH superfamily
2CP0A 2WSCE 2CYZB 2X3XD 4ZGDB 1TWBA 1I0CA 2LX9A 2O31A 1T3LA 4RG8A 4PJJA 1U1TA 2DYBA 3CCET 4A54A 2GFUA 1VQ8A 1WXTA 4JJNK 1WQWA 3A1PA 1NLPC 3OA6A 4QVDA 2GF7A 2BUDA 4JPBW 3J80E 1GL5A 5GAMg 1N8RR 4RTXA 2DE0X 5L23A 2FZCB 2EYQA 1VQ4A 1TSFA 2RHYA 4RTZA 3A5ZB 3KBGA 1KC8R 2HD0A 1KK7A 2QQ9A 3OW2S 1VQNA 4JJBA 2OTJT 2K2VA 1GBRA 2Y90A 3QYHB 4GLMA 3ZBDA 1W2BA 4FCYA 2GBQA 3A8LB 1PC0A 1YFNA 3NTHA 4OGEA 1MNEA 4XU3A 2Y4XA 4J9BA 1IGUA 3CCLT 4C8QF 4BDYA 1NBEB 2ATCB 1VYVA 2IPOB 8AT1B 4WF2A 4PJLA 3CPWA 2EKOA 4CI0C 5GMKe 1Z9QA 4RTTA 3G6ET 3GLXA 1MGQA 1TUCA 3EG9B 2KR3A 1VQ6Q 2CP6A 3OYMA 5LJ5d 1RABB 2X4WA 2E70A 2OJ2A 3A98A 2PVOB 4A4FA 3MPUB 5D6XA 2L3RA 2CZ1B 4XTXA 3RKWA 4F7UA 4ZNXA 3HP9A 1WNLA 3PE0A 4ZGJB 1UHFA 2D0QB 3EG9A 2DTOA 1VQ8Q 3MEWA 3F70A 1XOVA 5CKHA 3SWNA 2JXBA 3N5BB 1ZUKA 3EGUA 2P84A 2KYBA 1M27C 2L8DA 2LT1A 3UDCA 5I2SA 4WTOB 1G5VA 4B9WA 2KI7A 3R6OA 1Q82C 4EPCA 2OX7A 2E3IA 1M4ZA 2ED0A 2DL5A 4E7SA 2JZ2A 1E6GA 3CCVQ 1WHKA 1MMGA 1PKTA 3M0UA 2VC8A 2KRSA 2DTHA 4N0AC 2FHDA 4O6JA 3E9GA 1RAAB 1U5SA 1VQ4T 1B34B 3S6WA 1RLPC 5GMKh 2L89A 2DL8A 1WPYA 1WZOA 5GAN5 1NZ9A 4FU6A 4RTWA 3OW2A 1VQ8T 4BE2A 1IHVA 1FWZA 3MP6A 2H8HA 2DILA 2KQWA 3I55Q 2QI2A 1Q95G 3CC4Q 1MV3A 1NYGA 4LD9K 1WI7A 1OX9A 1E6HA 2K4YA 5CVIA 1NPRA 4OB1B 1T0HA 3RUXA 3CCUQ 1ZHIA 3QDRB 4MZPA 2DL3A 5LJ3g 4EMHA 2DZ9A 3JAME 2E65A 5LJ5e 5DY9A 3CQTA 4EIKA 2ZPIB 1UB4A 2GCXA 2MI6A 3CMEA 1BKBA 1YCSB 4C92F 3I5RA 3MEUA 3FEOA 2COWA 1VQOA 1KIKA 2H3EB 2Y4YA 4N4IA 2DETA 2L3PA 3JB9F 3RERA 1IHWA 2HSEB 3LH0A 4RTUA 4C92E 1T0JA 2FEIA 1G3YA 2KK4A 4OMNA 1YHQA 4J9DA 4HCCA 1M1FA 1Q86R 1BI3A 4KH0B 2B8AA 4BI8B 4C0DC 1VQOT 4PFOA 4BY6C 4XQ3A 2RQUA 1X2QA 1JXOA 3BW1A 4RTVA 1C6VX 2X51A 5GANd 2CZ6B 4L5GA 3EAEA 1X6BA 5FW9A 1NJIC 1XJWB 1ZBXA 3V8KA 5GAMh 4E7KA 1G8XA 2SRCA 1PNJA 4PJMA 4DA4A 3ASKA 4C5EA 3JCMc 4DBRA 3JCMW 4M7AB 4FYWB 4LD6A 2PUOB 1PWTA 1WJQA 4Z89A 2ZPFB 5IN1A 3PNWC 2BKDN 3HRUA 2QDYB 2FG0A 2MYSA 3IQLA 5GAOp 3NTIA 3CCLQ 1FX7A 1WHMA 3MP1A 4M77F 1AT1B 4M77E 3G4SA 2DKGA 1FMKA 4J83A 4PJOA 4F17A 1SSHA 1ABOA 1S72T 3OYYA 5D6WA 1VQKQ 1B34A 2K3YA 3HL8A 2VUBA 2PU9B 2YRDA 2YUNA 1M8MA 5M9OA 4P5NA 4LNPA 3RKXA 1M3AA 3QJ6A 1G2BA 3A8GB 3OY9A 2K5LA 2ROTA 2A3LA 2LJ1A 2XDDA 1W4SA 4M77G 4M78E 4PJOF 3RESA 1BI0A 2KRNA 5GAOr 1XQHA 2CP3A 1VOMA 1QVPA 3EGDB 5CQYA 1SHGA 3OYJA 3M59A 1BI2A 5FU7C 4ZTFA 2COYA 4RKUE 1OZ2A 2MMPA 2JMCA 4QVZA 2LC4A 4JRQA 2JOYA 1G83A 4BI3A 4LE9A 1JQQA 4HCBA 2M0OA 3OQ5A 3QWXX 1QCNA 2LNVA 5FROA 3L42A 3CCEA 3X25B 2YRCA 2XMFA 3JCMJ 3NMZC 3I5SA 2EW3A 1VQLT 4KRTA 1VQKT 1H3HA 5J26A 4M75D 2FPEA 2RH2A 4HA8A 2XDPA 5C0MA 4XTUA 1AZGB 3PVLA 1OU9A 3H0HA 1SF9A 3URGA 2OTJA 4EMKB 1NYFA 3I55T 2K9GA 4JS5A 2XIDA 2QGGA 1U8RA 4M7AD 1RADB 2QGFB 3OYDA 4R55A 1NLOC 1OX8A 3EFOA 3JCMQ 1VQPA 2QEXT 4OMLA 3EH1A 3G7ZA 4Z02A 1VA7A 4J9IA 4DEYA 4N0AA 1MV0B 1ACMB 2PTKA 3HRTA 5KYUA 1U1SA 2IIMA 2LQNA 4ZN1A 4J9GA 3PMTA 3X26B 3E2UA 2QXFA 2FRYA 3HFOA 3PT9A 2CUBA 1AVZC 3REBB 1QW1A 3DB4A 3WVEB 1D3BB 2P0QA 1YWOA 1D0XA 4M4ZA 2KXDA 1K4US 4C8QE 2LNHB 1K9MR 1M1KR 3T9NA 2RN8A 2DM1A 3U23A 1LPLA 3JCMb 2RMOA 3QG1A 3NTKA 1M90C 2LX7A 4FT2A 1ZQ1A 2K79A 4ANJA 5IAYA 3MHXA 1VYTA 2K3XA 4QQDA 4C92A 1UTIA 2E5KA 3RR6A 2RK2A 2KT1A 2E6NA 1SG5A 1UECA 2LRQA 3OYIA 3NPFA 2VGMA 1VQMT 4AFSC 2LCSA 4HXJA 2VB6A 4X9CA 2PQWA 3RMQA 5I21A 1YI2A 3H6ZA 4IKFA 2M02A 4XU0A 1Q7YR 4NL3A 1FMWA 3INZA 1SHFA 4PFZA 1AWWA 2GQIA 2I2LA 3CCSA 2KEAA 3FDRA 2V1RA 2RB6A 1OULA 1KHIA 4CC7A 4E7HA 4OMFB 2G3RA 1D1AA 2RI3A 3CD6Q 4C0FA 3LX7A 2X35A 2MF2A 4M7AA 3LW5E 4OMOA 2HQXA 3QJYA 1W2BP 4EDUA 5IHKA 4C0GA 3V8JA 2E1HA 2FRWA 2AZVA 1UGVA 4B9XA 1YJNQ 3GF5A 2M1HA 1PD0A 1DJ7B 4II1A 3SWNC 1RLQC 2JS2A 3EGXB 3LH5A 5I22A 4C8QG 1M3CA 2YHTA 4FYYB 4UC4A 5J3BA 3C94A 4X1VA 1MMNA 3E9FA 2C06A 3X20B 2AZSA 3SD4A 4XTZA 3G71Q 5CKFA 3M0TA 1WLPB 2EPDA 3RMSA 2CDTA 3X28B 1XTDA 3CCEQ 4F16A 4OGCA 5FU6B 3JB9I 2D9TA 2O9VA 2KBTA 4M75E 4AFQC 1X2KA 3JB9J 3LLRA 2EIFA 2VASA 4ZTJA 1GFDA 2CS7A 3CMAT 4E7ZA 1ZSZC 1VQ6T 2BIVA 2XU8A 2F1LA 2ED1A 1VQPT 2LT4A 3RIRA 3S3NA 4OMMA 4RMOA 1YJNT 2HL5C 1M2OA 4M7AE 2XKOC 5A0GA 1OYXA 2DJZA 5IXFA 4PJOB 1WXUA 1QQJA 4D8DA 2AIRB 4RG2A 1R77A 4QVCA 2DNUA 3G1JA 1M1KC 3WVDB 3CC2Q 1VIFA 3ULRB 2J06A 4LN2A 2DX1A 3UA7A 2EQUA 1Q82R 4PLLA 1K1ZA 1E7OA 5FRNA 3FJ5A 1X27A 3SDZA 1YN8A 5HK3A 3SHWA 2COZA 2DK3A 3EG1A 2XD0A 2V26A 3OYKA 1TU0B 1M2VA 1VQ9A 4M7DF 5GANj 3CEYA 1M30A 3M4YA 1H641 2EYZA 3ZL7C 3QHSA 4ATOA 3M0SA 2AKLA 4RUGA 1C0MA 2JT4A 3UPUA 3QZ9B 4LUEA 4EMKA 2QAZA 2YWWA 3CCSQ 4F7UG 2A08A 1UUEA 1VQNQ 1F1BB 2BZXA 2O2OA 5A0DA 3M57A 3P8DA 5KYWA 2M0YA 3CCJQ 4BE1A 2QTXA 2V8IA 2QTVA 2EGEA 2M16A 2DXBA 3J81E 2DPPB 4AFZC 4C92G 4JLGA 4KH1B 3I9QA 1VQ9T 2KRMA 1RACB 4M7DD 3L2UA 3CCUA 1J3TA 1IXDA 1WX6A 1SKUB 5CQXA 3GOXA 3JCMP 4KGZB 4J9CA 1KJWA 4J7FA 1UE9A 2NUPB 3QKJA 1WXBA 5GJWB 3HRSA 2RHXA 3JCMe 1JXMA 3L2RA 2BTTA 4Q5WA 3G4ST 2ZPBB 2HKQB 5A2QE 2EJ9A 4KBMB 1N5ZA 4N4GA 5A0LA 4HT8A 3HPWA 1N8RC 4Y91A 2E64A 3JCMg 4DEXA 4C92B 5FRMA 2D6FA 5FWBA 2EQMA 3QYGB 3CCUT 1R0BG 1ZUUA 1BCOA 2L3SA 4DBQA 2NLUA 2VKNA 5GAN7 4FL6A 2DAQA 4C5IA 2C0IA 4ZGEB 3BFMA 4OB2B 2DVEA 2X3WD 2MPXC 3JB9D 3R6NA 4F7UE 3ER0A 5GANf 1D09B 1B3QA 1IRXA 1WHGA 5GAN3 2J6FA 3S3OA 5KYUB 1I4K1 2QG9B 2VVKA 1VQ7Q 1HSQA 1NG2A 1JO8A 2ZPGB 1ZA2B 1I5OB 3OSSC 3L2VA 3DLLA 3OW2P 2EYWA 3M0RA 1M8VA 3QIIA 4PNOA 3VS5A 1WDXA 1QVFS 2MWOA 4M75C 1YJ9Q 1Q82U 1YJWQ 1GXIE 2RHZA 2DTIA 2A37A 2O4XA 3JB9H 2RJFA 1LVKA 4M75A 3RBBB 2NYSA 1Y0MA 2LJ3A 4RCBA 3OYAA 4MMLA 1D0ZA 4OP0A 1RAHB 1KG1A 4WCIA 1D1BA 2J6OA 5LJ3d 3M0QA 1CKBA 1RAIB 4Y28E 1WFWA 2AKKA 2KY9A 2EVRA 1UJ0A 4M7DB 5GMKl 5GANh 4FSXA 3CBOA 1ARKA 1YIJT 2DIGA 3EFSA 3THKA 2JS0A 1QMCA 1Y57A 4JRIA 1M2VB 1Q81U 2KYMA 3NHNA 3BDUA 3JCMf 2YSQA 1ZBJA 5GJVB 1LCKA 2YUOA 4OMPA 1U3OA 2KNBB 2KROA 3GNFB 2MAMA 1KFZA 4IUUA 2RQTA 2DIQA 4BB7A 7AT1B 2K57A 1VYUA 2DFUA 2V1QA 4IUPA 1BK2A 3H41A 1RL2A 5LJ3j 4E6RA 2ROLA 3OYHA 1O75A 3UT1A 2OAUA 3VS3A 5I11A 2KSSA 1QWEA 2EGCA 3OYLA 2B86A 4M7DC 5FLXE 4M78F 2PVDB 3JCMd 1K9AA 1YJ9A 3OYEA 1KC8U 2ZGWA 2CP5A 4PL6A 1YBYA 2CSQA 1SEMA 2AHJB 2J7IA 3PIPA 2KMTA 1TG0A 4F7UF 1N9SA 5HY6A 2A28A 3BDLA 2RI5A 2JM9A 5LJ5j 4PJNA 5IHNA 2NWMA 4XU1A 1YCYA 2DEQA 1K9MU 3HFNA 1MUZA 2GTJA 3I56T 2DRMA 4M77A 2DF6A 1N8RU 2KDSA 4D6WA 5GAN4 3CCRT 5CO7A 2ECZA 1PSEA 4XK8E 2X9HA 4M7DA 4JLIA 4BI4A 4M78G 1N27A 5DM7R 3VYGA 2EAYA 4XTWA 1GCPA 5KH6A 3H0IA 2HQEA 1EFNA 1WHLA 3QPHA 2W10A 2OTJQ 3A8MB 3KUFA 4IUTA 1C1AA 4R0KA 2BZYA 4IUVA 3REAB 1YHQT 5KYWB 2NUTA 4ESRA 4B6MA 3CMAA 1UEBA 3ZEHA 2XK0A 2JN0A 2ZAEA 3EGXA 3E19A 2CREA 4LXCA 1NEGA 5CR2A 2BZ8A 2KAFA 4J5YA 1TXQA 3M0PA 1ZSGA 2RQVA 3LYIA 2BE7D 2O4XB 2X4YA 4IIOA 2YRVA 2LQKA 1QWFA 1HJDA 3MJXA 2PVGB 4HT9A 2VWFA 1I5LA 3M58A 2I0NA 2P0KA 1PHTA 4NS5A 3META 3CC2A 3L1AA 1JBMA 2FZGB 1K0SA 4PJOG 5LJ3e 2E3HA 1S1NA 1N9RA 2CZ7B 2K5FA 5GMKi 3GIBA 2RQWA 4J7IA 1ZUYA 1VQ5A 1IB8A 2LJ0A 3QBYA 4PJOC 2GGRA 4C0DB 2OI3A 2JNGA 1OZ3A 4XTVA 4M7AC 1K0XA 4M75F 3C12A 1KC8C 4F14A 2K5IA 1EX4A 1G3TA 3CCLA 2L0AA 1H92A 1M5Q1 1QCOA 5C6SA 3G71A 1QKXA 3HHTB 1N6AA 3EHQA 2RK1A 3CXCS 2HBPA 3OS2A 3KFVA 1VQMQ 1QVGA 2X4JA 4LDYA 5GAMe 4GLKA 4Z8AA 4JJCA 4QQ6A 1K8AU 1VQLA 4LDWA 1V29B 2WSFE 1O9SA 1EZZB 2FZKB 2DXCA 2EYYA 1UGRB 1YJ9T 2PZ1A 3UF4A 2CH4W 4LDXA 1YIJQ 3TSZA 2LQWA 2V8KA 4Z88A 2RHUA 1QP2A 1X75C 1Q7YU 3VKIA 1RI9A 2GTOA 1KQSP 2DERA 4MDWA 1UGQB 1HD3A 2QEXQ 1KQSS 5KCOA 4FYXB 2CT4A 4HVUA 3CPWS 5AYFA 2LMJA 2JUFA 2E10A 2P4RA 1IZ6A 4AMCA 2LP5A 3FC3A 1Y07A 3MCAB 1G3WA 5CAIA 1OI1A 2EQKA 4M7DG 1AHJB 4M77D 1UDLA 3QWYA 1CKAA 2PUKB 3PIOA 2HNIA 2DXUA 1QP3A 3O5ZA 4C92C 1XNIA 1RI0A 2Z0WA 1W70A 2LVMA 4E47A 1BB9A 1YJWA 2F2VA 3I56Q 2GFAA 2YLBA 1M90U 4D8KA 2J6KA 3QSUA 1MMAA 2F2WA 4EMKC 5DLQE 2JW4A 1JU5C 5GAN2 3LGLA 1VQ5T 4EMGA 1PRLC 4M78A 3MKDA 3M5AA 2RQRA 5GANe 2RJEA 2DZCA 1RAEB 3CCRA 2EGAA 4QT7A 3TSWA 4M78D 4CC3A 2QQRA 3L2WA 1OU8A 1KSWA 5GAN8 4X9DA 2P4TA 1KQ2A 4FIBA 2CT3A 3CXCP 5GAN6 2LCCA 1BCMA 1QLYA 4NL2A 1OOTA 1V76A 3V7SA 5KYXA 2RJCA 3EFOB 1PKSA 2XG8D 4E2FB 4HKEA 5LJ5g 1K8AC 2ABLA 5L8RE 1WYXA 2HDAA 4C5HA 4FSSA 2DD5A 1R8OB 3JCMV 1NE8A 4AG2C 2HBWA 1TUDA 3CCST 2JTFA 1K73R 4CC4B 1U06A 2JTMA 3TCJA 2K3BA 4KGVB 3JV3A 2EFIA 1VUBA 1Y96B 1VQLQ 2RI2A 3OYGA 2M51A 4JJDA 2IVWA 1TTHB 4V2SA 3AHUA 1K73U 2YLCA 3MEVA 5KCHA 1NPPA 1GCQA 3CCQQ 1X43A 3EG3A 2HQHA 3CCJT 2D1XA 3TREA 3CD6A 4F7UB 1UJYA 1SSFA 2RF0A 2VXEA 4M77B 2CGHA 1HYOA 2DBKA 1ZLMA 1GFCA 3MO8A 4DOWA 2A7YA 3G71T 4PFPA 4MMKA 4AFUC 2DLPA 2RO0A 4XTYA 3CCMA 2RPNA 1AWOA 1Q7YC 1JJ2P 3EHRA 1YWPA 5GAOn 2OAWA 1VIEA 5KYXB 2VXFA 1YIJA 1LNXA 2HCKA 4CC2A 1FYNA 1VQ6A 1AEYA 4PK4A 5IH2A 5ECAA 2WSEE 4IURA 2MCNA 4M78B 2F5KA 5DLOA 4J6XA 4BACA 3I56A 4PJOD 2HSPA 5GANg 2HL3A 5LJ3f 2OTLT 2FVUA 3VS4A 1KQ1A 2EBPA 2VYTA 3I55A 5EC7A 5IT9E 1WHHA 1K8AR 2OTLA 1ZSZB 1I8FA 1IGQA 3OBYA 4IUQA 3VRYA 3CC2T 1QVFA 2XDBA 3ZFJA 2HZYA 4JRPA 5KYYB 3WXMB 4O5VA 4RCCA 2EKHA 3VUBA 2EYXA 1LOJA 2K7AA 4TVRA 4VUBA 3VRZA 4A4GA 2DMOA 5IXBA 3NGPA 4M78C 5GMKm 4LUDA 3CC7T 2CP7A 4E7LA 2NUTB 3VS2A 3OMCA 4XAXB 5LJ5h 2RA2A 3QXEB 3SFMA 4BY6B 1RAFB 2YXYA 4C0ZA 3M56A 1IO6A 1B7TA 4OB0B 1PG5B 1QKWA 2H3JA 3CPWP 5LJ5f 1PM3A 4L6V5 4A4HA 2LCLA 1BU1A 2RNAA 3Q1JA 1OEBA 3PFSA 3E1SA 2E5QA 1LJOA 2E4HA 1M9SA 3DLMA 3VUZA 1M90R 3OSVA 4AT1B 4LDUA 5CKDA 1V1CA 3M53A 3EGDA 2L3QA 1K9MC 1K76A 4OF1A 3H0FA 3CBPA 3QDFA 3EG2A 2ENMA 1VQ9Q 3VS6A 3V7CA 5D7UA 3CXCA 4A4EA 2HKNA 5GAOm 3GP8A 2D0NA 4C5GA 3VS0A 3OS1A 4GBQA 2YUPA 3A8HB 1VQ5Q 1VQMA 3PVQA 3EG0A 1NM7A 4J9FA 2DD4A 3JB9G 4C92D 5CKEA 2PNIA 1VQPQ 2R5MA 3L2QA 1VQ4Q 3X24B 1MMDA 4MDXA 4FM4B 1A0NB 3GNGA 4RTYA 1ZX6A 3QUIA 3J7AF 1I81A 4QKUA 1AOJA 2CUDA 3HTRA 2DO3A 4J6YA 3DB3A 5FWCA 1YJNA 1D0YA 2O88A 5GAOl 1NEBA 2RHIA 3TVTA 1B07A 2QASA 2W0ZA 3PMIA 5FU7B 2O01E 3TQ7P 4DOVA 1WJSA 1Y7XA 4A4KA 2WACA 3FB9A 3ME9A 2CH4A 2BE9B 3DKMA 4PLIA 1FXXA 2NUPA 3OB9A 3TEEA 2QEXA 4JS4A 5HK0A 4KT0E 2DL7A 1P92A 1I1JA 2KVQG 4M75G 1WQ7A 1YI2Q 3CMET 1KHCA 2V8JA 1X69A 4ELZC 3NFCA 1Q86U 3RDVA 1YNZA 2CZ0B 1JB0E 3HSBA 4KGXB 4KUIA 2GQVA 5CKBA 4YTLA 4E7IA 4HCKA 5KE2A 8ATCB 4NOYA 3RNJA 4C8QB 1YITA 2QDLA 2KE9A 1D1CA 2A0FB 2L2PA 1WHJA 2E41A 4K11A 1GBQA 2FB7A 3LGFA 3OYBA 3CCJA 3GBQA 2NUZA 5IHIA 2R5AA 1QCFA 3OS5A 3H8ZA 2DBMA 2EJFA 2QQBA 3OS0A 1GRIA 3VV0A 4M75B 3EH2A 2EWNA 1YJWT 4JRKA 4Y92A 3CC4T 2QA4Q 1BBZA 1EIFA 2EJGA 2OTLQ 2QA4A 2HAXA 3A8OB 4M7AG 5CIUA 1ABQA 1PSFA 4DBFA 2DYIA 2JM8A 2HEQA 1MHNA 1I07A 4HVWA 2YDLA 4C8QC 2FYKA 1HXDA 1KD1U 3G4SQ 5LJ3h 1KD1R 2QQAA 4FT4A 1NJIR 2A36A 4DQ2A 2CKKA 1G3SA 1X6GA 2D8JA 2FL7A 2F5TX 3OYCA 1MNDA 1M1KU 1TH7A 1Q86C 1HK9A 1JJ2S 2QQSA 3VYHB 1YITQ 1QVGP 1YI2T 1S72Q 4QQGA 5AT1B 5GMKj 3O8VA 1YP5A 4J6WA 2AT1B 4KUDK 1D3BA 3FJPA 1GCQC 1Z9ZA 4R56A 2HMAA 5HCKA 2RM4A 3FLGA 2ZPHB 3CD6T 5J39A 4XU2A 1YHQQ 1BIAA 5CK9A 3G6EA 1AZEA 3SWNB 4ME7A 2G6FX 5CCAA 2JVVA 3CPFA 3RKYA 3VU3C 1UHCA 2FPDA 3CCRQ 1Q81C 2LDMA 1WJRA 3L2ZA 2JTEA 3OYNA 3JCMh 1JEGA 3S3MA 2KGTA 3KXTA 1KQSA 4FW2A 4FW1A 1H3ZA 3LWIA 1M3BA 2QA4T 4C8QD 3PGGA 5GAMj 2ZCFB 4M77C 3UWNA 4J9EA 3GPLA 3P8HA 3C95A 3CC4A 4ELYC 5FU6C 3LWHA 2ZZDA 2F2XA 4OB3B 3QO3A 1W2BS 3CCVT 4E7JA 3JCMX 1Y96A 3VS1A 4AG1C 1OPKA 2C0TA 2P0PA 4PJOE 3SB2A 3C0CA 4JZ4A 4A53A 5KYNA 1Q81R 3CBMA 3SEMA 6AT1B 1VQNT 9ATCB 2FPFA 2DRKA 2M9UA 4HVVA 2J05A 1PCXA 4CRIA 4X34A 4J8OA 5D6YA 1PD1A 2EQIA 1VQKA 1OV3A 3CCVA 1RAGB 3BY7A 3CMAQ 1AD5A 3M54A 1KD1C 2F69A 1YITT 1QVGS 1AWXA 1TOVA 2DXTA 1AWJA 1H8KA 1VQOQ 5KYYA 2JJ9A 2C0OA 2LQ8A 3G6EQ 2JMAA 4OMQA 3CCQA 4BDZA 5I2MA 1BIBA 5GAMd 4M7DE 2YT6A 1W1FA 4BUGA 1CSKA 4BD3A 3PTAA 2E6ZA 1W6XA 3H9NA 3V7RA 2QYZA 3MEAA 1NJIU 2VV5A 2DL4A 2RJDA 4JZ3A 1PRMC 4BE0A 2R58A 3P8BB 2LZ6B 2MIOA 4MZTA 4A63B 2MOXA 3FIFA 2DEUA 2XHCA 3CCQT 3OMGA 4OVAA 1K73C 2QK0A 4HCZA 3VJPA 1M1GA 3UA6A 1RUWA 3D7SB 4DBHA 4QW2A 5GAMf 4IIMA 3V8LA 5GAOq 1SPKA 1R0CB 4J9HA 2ESWA 1S72A 3CCMT 1UG1A 1FMVA 3CMEQ 4M7AF 2MK5A 2LTOA 1UFFA 3AT1B 2E12A 1VQ7T 4LDVA 3MP8A 1X01A 2D8HA 5HKCA 1TS9A 2IG0A 1OQKA 4N4HA 4ZN3A 5EG2A 4GY5A 2GNCA 1WIEA 3JRZA 2K6DA 3FRNA 3OBWA 2VGNA 1WA7A 1QVFP 4MZMA 4JUVA 3M55A 2XI9A 1JRIA 2SEMA 3I35A 1ZA1B 1VQ7A 2CSIA 1BYMA 3C4SA 3BE3A 3JSCA 1WGSA 1OPLA 2KXCA 2ZPEB 4PKCC 5KE3A 2KT8A 2X4XA 4C8QA 2DA9A 4ORZA 4L59A 3OYFA 2O9SA 1SRLA 2MWPA 1JJ2A 2XICA 2RD1A 3EFRA 2EQJA 2CP2A 3UATA 3VS7A 4F04B 3TU4K 3CCMQ 1Y71A 2R57A 3HKSA 2L5QA 1ZSZA 3M9QA 4JDSA 2YUQA 2DJQA 1UGSB 1T3SA 2AK5A 1SRMA 2FO0A 1IREB 2K2MA 4KULA 2DVJA 3CC7Q 5LL6S 1BI1A 3CC7A 1TUGB 4FYVB 1X6OA 3QZ5B 1UGPB 3M4GA
chains in the Genus database with same CATH topology
1K76A 3H0FA 2X3XD 1I0CA 2ENMA 3EG2A 4R0KA 2BZYA 3VS6A 2O31A 3REAB 1T3LA 4ESRA 2DYBA 1WXTA 2CREA 1SHFA 2D0NA 1AWWA 2GQIA 3VS0A 1NEGA 1NLPC 2KEAA 2BZ8A 4GBQA 2V1RA 2YUPA 4JPBW 3M0PA 1GL5A 1ZSGA 2RQVA 4RTXA 4CC7A 2DE0X 4IIOA 5L23A 3PVQA 3EG0A 1NM7A 4J9FA 4RTZA 1QWFA 4JJBA 2PNIA 1HJDA 1GBRA 4OMOA 2VWFA 4GLMA 5IHKA 1A0NB 2I0NA 2GBQA 4RTYA 1PHTA 1ZX6A 2FRWA 2AZVA 1AOJA 2CUDA 1K0SA 1UGVA 4J9BA 1S1NA 5FWCA 2RQWA 2O88A 1NEBA 3TVTA 1VYVA 1ZUYA 1RLQC 1B07A 2JS2A 2W0ZA 2LJ0A 3LH5A 2LCSA 5I22A 1M3CA 1Z9QA 2GGRA 4RTTA 4X1VA 2CH4A 1TUCA 2OI3A 2KR3A 1K0XA 2AZSA 4F14A 2DL7A 2OJ2A 3A98A 3M0TA 1WLPB 1I1JA 2EPDA 2L0AA 1H92A 2CDTA 1X69A 4ZNXA 3PE0A 4F16A 1YNZA 1QKXA 1UHFA 3EHQA 2O9VA 2KBTA 4AFQC 1XOVA 1X2KA 2JXBA 4HCKA 3KFVA 1ZUKA 3EGUA 3RNJA 2KYBA 1M27C 1GFDA 2QDLA 2KE9A 4JJCA 4Z8AA 2L2PA 2ED1A 4K11A 1GBQA 4OMMA 3GBQA 2NUZA 5IHIA 1QCFA 2ED0A 2DL5A 2DBMA 2EYYA 1E6GA 1GRIA 5IXFA 1PKTA 2PZ1A 3UF4A 2CH4W 1WXUA 3M0UA 4Y92A 4D8DA 2KRSA 2DNUA 1BBZA 3TSZA 2LQWA 4Z88A 1ABQA 3ULRB 1U5SA 2J06A 4LN2A 2JM8A 2HEQA 1RLPC 2DX1A 3UA7A 1RI9A 2GTOA 2DL8A 1I07A 1HD3A 1K1ZA 4HVWA 2YDLA 2CT4A 4HVUA 1E7OA 3FJ5A 1X27A 2LMJA 4RTWA 1YN8A 3SHWA 2P4RA 3EG1A 2H8HA 2DILA 2LP5A 2A36A 1X6GA 2D8JA 1MV3A 1NYGA 1WI7A 1E6HA 1M30A 3ZL7C 2EYZA 1T0HA 1UDLA 3M0SA 2AKLA 3QWYA 1CKAA 4RUGA 2DL3A 2JT4A 3O5ZA 4LUEA 1W70A 1BB9A 3CQTA 2F2VA 4EIKA 2A08A 1UUEA 4D8KA 2J6KA 2BZXA 2F2WA 1YP5A 2O2OA 2M0YA 1YCSB 2JW4A 1GCQC 1JU5C 1Z9ZA 3I5RA 2EGEA 1KIKA 5HCKA 1PRLC 4AFZC 3I9QA 2L3PA 2KRMA 2RQRA 1J3TA 1WX6A 1AZEA 4RTUA 1T0JA 2EGAA 2FEIA 2G6FX 4QT7A 4OMNA 4J9CA 3TSWA 1KJWA 4J9DA 1UHCA 1UE9A 4CC3A 2FPDA 1WXBA 5GJWB 1KSWA 1JXMA 2JTEA 2BTTA 1JEGA 2KGTA 2CT3A 2RQUA 1X2QA 1JXOA 4RTVA 1M3BA 1N5ZA 1QLYA 1X6BA 5FW9A 4J9EA 1OOTA 2SRCA 1PKSA 1PNJA 4DEXA 5FWBA 2ABLA 2F2XA 1WYXA 1ZUUA 2HDAA 2L3SA 2VKNA 4FSSA 1PWTA 4Z89A 2FG0A 3VS1A 4AG1C 1OPKA 4AG2C 2C0IA 2C0TA 2HBWA 3IQLA 1TUDA 3C0CA 4JZ4A 2X3WD 3SEMA 2FPFA 3R6NA 2DRKA 4CC4B 1U06A 4HVVA 2J05A 1FMKA 1B3QA 2K3BA 3JV3A 2J6FA 2EQIA 4F17A 1OV3A 2M51A 1SSHA 1ABOA 1AD5A 4JJDA 4HXJA 2VVKA 1HSQA 1AWXA 1NG2A 1JO8A 1GCQA 1AWJA 1X43A 3EG3A 1H8KA 2EYWA 2C0OA 3M0RA 2D1XA 2YUNA 3VS5A 1M8MA 1WDXA 2JMAA 4OMQA 1UJYA 4LNPA 2RF0A 1M3AA 2YT6A 1W1FA 1G2BA 1CSKA 2DBKA 2A37A 1ZLMA 2ROTA 3RBBB 1GFCA 1Y0MA 2LJ3A 2LJ1A 1W6XA 2DL4A 4JZ3A 2KRNA 1PRMC 4AFUC 2DLPA 2LZ6B 2MIOA 2RPNA 4A63B 1AWOA 4WCIA 2MOXA 3EHRA 1SHGA 2J6OA 1YWPA 3M0QA 2OAWA 1CKBA 2JMCA 1WFWA 3UA6A 2AKKA 1RUWA 2EVRA 1UJ0A 1G83A 2HCKA 4CC2A 4IIMA 1FYNA 4LE9A 1AEYA 1JQQA 1SPKA 3QWXX 4J9HA 1ARKA 2ESWA 5IH2A 5ECAA 3THKA 2XMFA 2JS0A 1UG1A 1Y57A 2MCNA 2KYMA 3NHNA 3NMZC 3I5SA 2EW3A 2YSQA 1ZBJA 5GJVB 4KRTA 1LCKA 2YUOA 1H3HA 4OMPA 1U3OA 2FPEA 1UFFA 2KNBB 2KROA 1KFZA 2RQTA 2HSPA 2D8HA 1VYUA 1AZGB 3PVLA 2GNCA 2V1QA 3H0HA 3VS4A 1WIEA 2EBPA 1BK2A 2K6DA 5EC7A 3H41A 1WA7A 4E6RA 2ROLA 1NYFA 2K9GA 3VS3A 5I11A 1QWEA 2EGCA 3VRYA 2B86A 2SEMA 3I35A 2CSIA 2EKHA 2EYXA 1K9AA 1NLOC 2K7AA 3VRZA 5IXBA 2DMOA 4OMLA 3NGPA 1VA7A 1OPLA 2KXCA 4J9IA 4DEYA 1MV0B 2CSQA 2PTKA 1SEMA 4LUDA 2KT8A 2IIMA 2LQNA 2J7IA 2DA9A 4ORZA 3VS2A 4J9GA 1TG0A 2O9SA 1SRLA 2A28A 2FRYA 2JM9A 2CUBA 1AVZC 3REBB 1YWOA 3UATA 5IHNA 3VS7A 1IO6A 4M4ZA 2KXDA 2NWMA 1K4US 1QKWA 1MUZA 2LNHB 2GTJA 2DRMA 2RN8A 2DM1A 2DF6A 3U23A 2RMOA 1BU1A 2ECZA 2YUQA 2RNAA 1OEBA 2LX7A 2DJQA 2K79A 1T3SA 2AK5A 1SRMA 2FO0A 2K2MA 1VYTA 2DVJA 1UTIA 2E5KA 2KT1A 1GCPA 1UECA 1V1CA 3H0IA 3NPFA 1EFNA 2W10A 4AFSC 2L3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K76 A;  3H0F A;  2X3X D;  1I0C A;  2ENM A;  3EG2 A;  4R0K A;  2BZY A;  3VS6 A;  2O31 A;  3REA B;  1T3L A;  4ESR A;  2DYB A;  1WXT A;  2CRE A;  1SHF A;  2D0N A;  1AWW A;  2GQI A;  3VS0 A;  1NEG A;  1NLP C;  2KEA A;  2BZ8 A;  4GBQ A;  2V1R A;  2YUP A;  4JPB W;  3M0P A;  1GL5 A;  1ZSG A;  2RQV A;  4RTX A;  4CC7 A;  2DE0 X;  4IIO A;  5L23 A;  3PVQ A;  3EG0 A;  1NM7 A;  4J9F A;  4RTZ A;  1QWF A;  4JJB A;  2PNI A;  1HJD A;  1GBR A;  4OMO A;  2VWF A;  4GLM A;  5IHK A;  1A0N B;  2I0N A;  2GBQ A;  4RTY A;  1PHT A;  1ZX6 A;  2FRW A;  2AZV A;  1AOJ A;  2CUD A;  1K0S A;  1UGV A;  4J9B A;  1S1N A;  5FWC A;  2RQW A;  2O88 A;  1NEB A;  3TVT A;  1VYV A;  1ZUY A;  1RLQ C;  1B07 A;  2JS2 A;  2W0Z A;  2LJ0 A;  3LH5 A;  2LCS A;  5I22 A;  1M3C A;  1Z9Q A;  2GGR A;  4RTT A;  4X1V A;  2CH4 A;  1TUC A;  2OI3 A;  2KR3 A;  1K0X A;  2AZS A;  4F14 A;  2DL7 A;  2OJ2 A;  3A98 A;  3M0T A;  1WLP B;  1I1J A;  2EPD A;  2L0A A;  1H92 A;  2CDT A;  1X69 A;  4ZNX A;  3PE0 A;  4F16 A;  1YNZ A;  1QKX A;  1UHF A;  3EHQ A;  2O9V A;  2KBT A;  4AFQ C;  1XOV A;  1X2K A;  2JXB A;  4HCK A;  3KFV A;  1ZUK A;  3EGU A;  3RNJ A;  2KYB A;  1M27 C;  1GFD A;  2QDL A;  2KE9 A;  4JJC A;  4Z8A A;  2L2P A;  2ED1 A;  4K11 A;  1GBQ A;  4OMM A;  3GBQ A;  2NUZ A;  5IHI A;  1QCF A;  2ED0 A;  2DL5 A;  2DBM A;  2EYY A;  1E6G A;  1GRI A;  5IXF A;  1PKT A;  2PZ1 A;  3UF4 A;  2CH4 W;  1WXU A;  3M0U A;  4Y92 A;  4D8D A;  2KRS A;  2DNU A;  1BBZ A;  3TSZ A;  2LQW A;  4Z88 A;  1ABQ A;  3ULR B;  1U5S A;  2J06 A;  4LN2 A;  2JM8 A;  2HEQ A;  1RLP C;  2DX1 A;  3UA7 A;  1RI9 A;  2GTO A;  2DL8 A;  1I07 A;  1HD3 A;  1K1Z A;  4HVW A;  2YDL A;  2CT4 A;  4HVU A;  1E7O A;  3FJ5 A;  1X27 A;  2LMJ A;  4RTW A;  1YN8 A;  3SHW A;  2P4R A;  3EG1 A;  2H8H A;  2DIL A;  2LP5 A;  2A36 A;  1X6G A;  2D8J A;  1MV3 A;  1NYG A;  1WI7 A;  1E6H A;  1M30 A;  3ZL7 C;  2EYZ A;  1T0H A;  1UDL A;  3M0S A;  2AKL A;  3QWY A;  1CKA A;  4RUG A;  2DL3 A;  2JT4 A;  3O5Z A;  4LUE A;  1W70 A;  1BB9 A;  3CQT A;  2F2V A;  4EIK A;  2A08 A;  1UUE A;  4D8K A;  2J6K A;  2BZX A;  2F2W A;  1YP5 A;  2O2O A;  2M0Y A;  1YCS B;  2JW4 A;  1GCQ C;  1JU5 C;  1Z9Z A;  3I5R A;  2EGE A;  1KIK A;  5HCK A;  1PRL C;  4AFZ C;  3I9Q A;  2L3P A;  2KRM A;  2RQR A;  1J3T A;  1WX6 A;  1AZE A;  4RTU A;  1T0J A;  2EGA A;  2FEI A;  2G6F X;  4QT7 A;  4OMN A;  4J9C A;  3TSW A;  1KJW A;  4J9D A;  1UHC A;  1UE9 A;  4CC3 A;  2FPD A;  1WXB A;  5GJW B;  1KSW A;  1JXM A;  2JTE A;  2BTT A;  1JEG A;  2KGT A;  2CT3 A;  2RQU A;  1X2Q A;  1JXO A;  4RTV A;  1M3B A;  1N5Z A;  1QLY A;  1X6B A;  5FW9 A;  4J9E A;  1OOT A;  2SRC A;  1PKS A;  1PNJ A;  4DEX A;  5FWB A;  2ABL A;  2F2X A;  1WYX A;  1ZUU A;  2HDA A;  2L3S A;  2VKN A;  4FSS A;  1PWT A;  4Z89 A;  2FG0 A;  3VS1 A;  4AG1 C;  1OPK A;  4AG2 C;  2C0I A;  2C0T A;  2HBW A;  3IQL A;  1TUD A;  3C0C A;  4JZ4 A;  2X3W D;  3SEM A;  2FPF A;  3R6N A;  2DRK A;  4CC4 B;  1U06 A;  4HVV A;  2J05 A;  1FMK A;  1B3Q A;  2K3B A;  3JV3 A;  2J6F A;  2EQI A;  4F17 A;  1OV3 A;  2M51 A;  1SSH A;  1ABO A;  1AD5 A;  4JJD A;  4HXJ A;  2VVK A;  1HSQ A;  1AWX A;  1NG2 A;  1JO8 A;  1GCQ A;  1AWJ A;  1X43 A;  3EG3 A;  1H8K A;  2EYW A;  2C0O A;  3M0R A;  2D1X A;  2YUN A;  3VS5 A;  1M8M A;  1WDX A;  2JMA A;  4OMQ A;  1UJY A;  4LNP A;  2RF0 A;  1M3A A;  2YT6 A;  1W1F A;  1G2B A;  1CSK A;  2DBK A;  2A37 A;  1ZLM A;  2ROT A;  3RBB B;  1GFC A;  1Y0M A;  2LJ3 A;  2LJ1 A;  1W6X A;  2DL4 A;  4JZ3 A;  2KRN A;  1PRM C;  4AFU C;  2DLP A;  2LZ6 B;  2MIO A;  2RPN A;  4A63 B;  1AWO A;  4WCI A;  2MOX A;  3EHR A;  1SHG A;  2J6O A;  1YWP A;  3M0Q A;  2OAW A;  1CKB A;  2JMC A;  1WFW A;  3UA6 A;  2AKK A;  1RUW A;  2EVR A;  1UJ0 A;  1G83 A;  2HCK A;  4CC2 A;  4IIM A;  1FYN A;  4LE9 A;  1AEY A;  1JQQ A;  1SPK A;  3QWX X;  4J9H A;  1ARK A;  2ESW A;  5IH2 A;  5ECA A;  3THK A;  2XMF A;  2JS0 A;  1UG1 A;  1Y57 A;  2MCN A;  2KYM A;  3NHN A;  3NMZ C;  3I5S A;  2EW3 A;  2YSQ A;  1ZBJ A;  5GJV B;  4KRT A;  1LCK A;  2YUO A;  1H3H A;  4OMP A;  1U3O A;  2FPE A;  1UFF A;  2KNB B;  2KRO A;  1KFZ A;  2RQT A;  2HSP A;  2D8H A;  1VYU A;  1AZG B;  3PVL A;  2GNC A;  2V1Q A;  3H0H A;  3VS4 A;  1WIE A;  2EBP A;  1BK2 A;  2K6D A;  5EC7 A;  3H41 A;  1WA7 A;  4E6R A;  2ROL A;  1NYF A;  2K9G A;  3VS3 A;  5I11 A;  1QWE A;  2EGC A;  3VRY A;  2B86 A;  2SEM A;  3I35 A;  2CSI A;  2EKH A;  2EYX A;  1K9A A;  1NLO C;  2K7A A;  3VRZ A;  5IXB A;  2DMO A;  4OML A;  3NGP A;  1VA7 A;  1OPL A;  2KXC A;  4J9I A;  4DEY A;  1MV0 B;  2CSQ A;  2PTK A;  1SEM A;  4LUD A;  2KT8 A;  2IIM A;  2LQN A;  2J7I A;  2DA9 A;  4ORZ A;  3VS2 A;  4J9G A;  1TG0 A;  2O9S A;  1SRL A;  2A28 A;  2FRY A;  2JM9 A;  2CUB A;  1AVZ C;  3REB B;  1YWO A;  3UAT A;  5IHN A;  3VS7 A;  1IO6 A;  4M4Z A;  2KXD A;  2NWM A;  1K4U S;  1QKW A;  1MUZ A;  2LNH B;  2GTJ A;  2DRM A;  2RN8 A;  2DM1 A;  2DF6 A;  3U23 A;  2RMO A;  1BU1 A;  2ECZ A;  2YUQ A;  2RNA A;  1OEB A;  2LX7 A;  2DJQ A;  2K79 A;  1T3S A;  2AK5 A;  1SRM A;  2FO0 A;  2K2M A;  1VYT A;  2DVJ A;  1UTI A;  2E5K A;  2KT1 A;  1GCP A;  1UEC A;  1V1C A;  3H0I A;  3NPF A;  1EFN A;  2W10 A;  4AFS C;  2L3Q A; 
#chains in the Genus database with same CATH topology
 2CP0 A;  2WSC E;  2CYZ B;  2X3X D;  4ZGD B;  1TWB A;  1I0C A;  2LX9 A;  2O31 A;  1T3L A;  4RG8 A;  4PJJ A;  1U1T A;  2DYB A;  3CCE T;  4A54 A;  2GFU A;  1VQ8 A;  1WXT A;  4JJN K;  1WQW A;  3A1P A;  1NLP C;  3OA6 A;  4QVD A;  2GF7 A;  2BUD A;  4JPB W;  3J80 E;  1GL5 A;  5GAM g;  1N8R R;  4RTX A;  2DE0 X;  5L23 A;  2FZC B;  2EYQ A;  1VQ4 A;  1TSF A;  2RHY A;  4RTZ A;  3A5Z B;  3KBG A;  1KC8 R;  2HD0 A;  1KK7 A;  2QQ9 A;  3OW2 S;  1VQN A;  4JJB A;  2OTJ T;  2K2V A;  1GBR A;  2Y90 A;  3QYH B;  4GLM A;  3ZBD A;  1W2B A;  4FCY A;  2GBQ A;  3A8L B;  1PC0 A;  1YFN A;  3NTH A;  4OGE A;  1MNE A;  4XU3 A;  2Y4X A;  4J9B A;  1IGU A;  3CCL T;  4C8Q F;  4BDY A;  1NBE B;  2ATC B;  1VYV A;  2IPO B;  8AT1 B;  4WF2 A;  4PJL A;  3CPW A;  2EKO A;  4CI0 C;  5GMK e;  1Z9Q A;  4RTT A;  3G6E T;  3GLX A;  1MGQ A;  1TUC A;  3EG9 B;  2KR3 A;  1VQ6 Q;  2CP6 A;  3OYM A;  5LJ5 d;  1RAB B;  2X4W A;  2E70 A;  2OJ2 A;  3A98 A;  2PVO B;  4A4F A;  3MPU B;  5D6X A;  2L3R A;  2CZ1 B;  4XTX A;  3RKW A;  4F7U A;  4ZNX A;  3HP9 A;  1WNL A;  3PE0 A;  4ZGJ B;  1UHF A;  2D0Q B;  3EG9 A;  2DTO A;  1VQ8 Q;  3MEW A;  3F70 A;  1XOV A;  5CKH A;  3SWN A;  2JXB A;  3N5B B;  1ZUK A;  3EGU A;  2P84 A;  2KYB A;  1M27 C;  2L8D A;  2LT1 A;  3UDC A;  5I2S A;  4WTO B;  1G5V A;  4B9W A;  2KI7 A;  3R6O A;  1Q82 C;  4EPC A;  2OX7 A;  2E3I A;  1M4Z A;  2ED0 A;  2DL5 A;  4E7S A;  2JZ2 A;  1E6G A;  3CCV Q;  1WHK A;  1MMG A;  1PKT A;  3M0U A;  2VC8 A;  2KRS A;  2DTH A;  4N0A C;  2FHD A;  4O6J A;  3E9G A;  1RAA B;  1U5S A;  1VQ4 T;  1B34 B;  3S6W A;  1RLP C;  5GMK h;  2L89 A;  2DL8 A;  1WPY A;  1WZO A;  5GAN 5;  1NZ9 A;  4FU6 A;  4RTW A;  3OW2 A;  1VQ8 T;  4BE2 A;  1IHV A;  1FWZ A;  3MP6 A;  2H8H A;  2DIL A;  2KQW A;  3I55 Q;  2QI2 A;  1Q95 G;  3CC4 Q;  1MV3 A;  1NYG A;  4LD9 K;  1WI7 A;  1OX9 A;  1E6H A;  2K4Y A;  5CVI A;  1NPR A;  4OB1 B;  1T0H A;  3RUX A;  3CCU Q;  1ZHI A;  3QDR B;  4MZP A;  2DL3 A;  5LJ3 g;  4EMH A;  2DZ9 A;  3JAM E;  2E65 A;  5LJ5 e;  5DY9 A;  3CQT A;  4EIK A;  2ZPI B;  1UB4 A;  2GCX A;  2MI6 A;  3CME A;  1BKB A;  1YCS B;  4C92 F;  3I5R A;  3MEU A;  3FEO A;  2COW A;  1VQO A;  1KIK A;  2H3E B;  2Y4Y A;  4N4I A;  2DET A;  2L3P A;  3JB9 F;  3RER A;  1IHW A;  2HSE B;  3LH0 A;  4RTU A;  4C92 E;  1T0J A;  2FEI A;  1G3Y A;  2KK4 A;  4OMN A;  1YHQ A;  4J9D A;  4HCC A;  1M1F A;  1Q86 R;  1BI3 A;  4KH0 B;  2B8A A;  4BI8 B;  4C0D C;  1VQO T;  4PFO A;  4BY6 C;  4XQ3 A;  2RQU A;  1X2Q A;  1JXO A;  3BW1 A;  4RTV A;  1C6V X;  2X51 A;  5GAN d;  2CZ6 B;  4L5G A;  3EAE A;  1X6B A;  5FW9 A;  1NJI C;  1XJW B;  1ZBX A;  3V8K A;  5GAM h;  4E7K A;  1G8X A;  2SRC A;  1PNJ A;  4PJM A;  4DA4 A;  3ASK A;  4C5E A;  3JCM c;  4DBR A;  3JCM W;  4M7A B;  4FYW B;  4LD6 A;  2PUO B;  1PWT A;  1WJQ A;  4Z89 A;  2ZPF B;  5IN1 A;  3PNW C;  2BKD N;  3HRU A;  2QDY B;  2FG0 A;  2MYS A;  3IQL A;  5GAO p;  3NTI A;  3CCL Q;  1FX7 A;  1WHM A;  3MP1 A;  4M77 F;  1AT1 B;  4M77 E;  3G4S A;  2DKG A;  1FMK A;  4J83 A;  4PJO A;  4F17 A;  1SSH A;  1ABO A;  1S72 T;  3OYY A;  5D6W A;  1VQK Q;  1B34 A;  2K3Y A;  3HL8 A;  2VUB A;  2PU9 B;  2YRD A;  2YUN A;  1M8M A;  5M9O A;  4P5N A;  4LNP A;  3RKX A;  1M3A A;  3QJ6 A;  1G2B A;  3A8G B;  3OY9 A;  2K5L A;  2ROT A;  2A3L A;  2LJ1 A;  2XDD A;  1W4S A;  4M77 G;  4M78 E;  4PJO F;  3RES A;  1BI0 A;  2KRN A;  5GAO r;  1XQH A;  2CP3 A;  1VOM A;  1QVP A;  3EGD B;  5CQY A;  1SHG A;  3OYJ A;  3M59 A;  1BI2 A;  5FU7 C;  4ZTF A;  2COY A;  4RKU E;  1OZ2 A;  2MMP A;  2JMC A;  4QVZ A;  2LC4 A;  4JRQ A;  2JOY A;  1G83 A;  4BI3 A;  4LE9 A;  1JQQ A;  4HCB A;  2M0O A;  3OQ5 A;  3QWX X;  1QCN A;  2LNV A;  5FRO A;  3L42 A;  3CCE A;  3X25 B;  2YRC A;  2XMF A;  3JCM J;  3NMZ C;  3I5S A;  2EW3 A;  1VQL T;  4KRT A;  1VQK T;  1H3H A;  5J26 A;  4M75 D;  2FPE A;  2RH2 A;  4HA8 A;  2XDP A;  5C0M A;  4XTU A;  1AZG B;  3PVL A;  1OU9 A;  3H0H A;  1SF9 A;  3URG A;  2OTJ A;  4EMK B;  1NYF A;  3I55 T;  2K9G A;  4JS5 A;  2XID A;  2QGG A;  1U8R A;  4M7A D;  1RAD B;  2QGF B;  3OYD A;  4R55 A;  1NLO C;  1OX8 A;  3EFO A;  3JCM Q;  1VQP A;  2QEX T;  4OML A;  3EH1 A;  3G7Z A;  4Z02 A;  1VA7 A;  4J9I A;  4DEY A;  4N0A A;  1MV0 B;  1ACM B;  2PTK A;  3HRT A;  5KYU A;  1U1S A;  2IIM A;  2LQN A;  4ZN1 A;  4J9G A;  3PMT A;  3X26 B;  3E2U A;  2QXF A;  2FRY A;  3HFO A;  3PT9 A;  2CUB A;  1AVZ C;  3REB B;  1QW1 A;  3DB4 A;  3WVE B;  1D3B B;  2P0Q A;  1YWO A;  1D0X A;  4M4Z A;  2KXD A;  1K4U S;  4C8Q E;  2LNH B;  1K9M R;  1M1K R;  3T9N A;  2RN8 A;  2DM1 A;  3U23 A;  1LPL A;  3JCM b;  2RMO A;  3QG1 A;  3NTK A;  1M90 C;  2LX7 A;  4FT2 A;  1ZQ1 A;  2K79 A;  4ANJ A;  5IAY A;  3MHX A;  1VYT A;  2K3X A;  4QQD A;  4C92 A;  1UTI A;  2E5K A;  3RR6 A;  2RK2 A;  2KT1 A;  2E6N A;  1SG5 A;  1UEC A;  2LRQ A;  3OYI A;  3NPF A;  2VGM A;  1VQM T;  4AFS C;  2LCS A;  4HXJ A;  2VB6 A;  4X9C A;  2PQW A;  3RMQ A;  5I21 A;  1YI2 A;  3H6Z A;  4IKF A;  2M02 A;  4XU0 A;  1Q7Y R;  4NL3 A;  1FMW A;  3INZ A;  1SHF A;  4PFZ A;  1AWW A;  2GQI A;  2I2L A;  3CCS A;  2KEA A;  3FDR A;  2V1R A;  2RB6 A;  1OUL A;  1KHI A;  4CC7 A;  4E7H A;  4OMF B;  2G3R A;  1D1A A;  2RI3 A;  3CD6 Q;  4C0F A;  3LX7 A;  2X35 A;  2MF2 A;  4M7A A;  3LW5 E;  4OMO A;  2HQX A;  3QJY A;  1W2B P;  4EDU A;  5IHK A;  4C0G A;  3V8J A;  2E1H A;  2FRW A;  2AZV A;  1UGV A;  4B9X A;  1YJN Q;  3GF5 A;  2M1H A;  1PD0 A;  1DJ7 B;  4II1 A;  3SWN C;  1RLQ C;  2JS2 A;  3EGX B;  3LH5 A;  5I22 A;  4C8Q G;  1M3C A;  2YHT A;  4FYY B;  4UC4 A;  5J3B A;  3C94 A;  4X1V A;  1MMN A;  3E9F A;  2C06 A;  3X20 B;  2AZS A;  3SD4 A;  4XTZ A;  3G71 Q;  5CKF A;  3M0T A;  1WLP B;  2EPD A;  3RMS A;  2CDT A;  3X28 B;  1XTD A;  3CCE Q;  4F16 A;  4OGC A;  5FU6 B;  3JB9 I;  2D9T A;  2O9V A;  2KBT A;  4M75 E;  4AFQ C;  1X2K A;  3JB9 J;  3LLR A;  2EIF A;  2VAS A;  4ZTJ A;  1GFD A;  2CS7 A;  3CMA T;  4E7Z A;  1ZSZ C;  1VQ6 T;  2BIV A;  2XU8 A;  2F1L A;  2ED1 A;  1VQP T;  2LT4 A;  3RIR A;  3S3N A;  4OMM A;  4RMO A;  1YJN T;  2HL5 C;  1M2O A;  4M7A E;  2XKO C;  5A0G A;  1OYX A;  2DJZ A;  5IXF A;  4PJO B;  1WXU A;  1QQJ A;  4D8D A;  2AIR B;  4RG2 A;  1R77 A;  4QVC A;  2DNU A;  3G1J A;  1M1K C;  3WVD B;  3CC2 Q;  1VIF A;  3ULR B;  2J06 A;  4LN2 A;  2DX1 A;  3UA7 A;  2EQU A;  1Q82 R;  4PLL A;  1K1Z A;  1E7O A;  5FRN A;  3FJ5 A;  1X27 A;  3SDZ A;  1YN8 A;  5HK3 A;  3SHW A;  2COZ A;  2DK3 A;  3EG1 A;  2XD0 A;  2V26 A;  3OYK A;  1TU0 B;  1M2V A;  1VQ9 A;  4M7D F;  5GAN j;  3CEY A;  1M30 A;  3M4Y A;  1H64 1;  2EYZ A;  3ZL7 C;  3QHS A;  4ATO A;  3M0S A;  2AKL A;  4RUG A;  1C0M A;  2JT4 A;  3UPU A;  3QZ9 B;  4LUE A;  4EMK A;  2QAZ A;  2YWW A;  3CCS Q;  4F7U G;  2A08 A;  1UUE A;  1VQN Q;  1F1B B;  2BZX A;  2O2O A;  5A0D A;  3M57 A;  3P8D A;  5KYW A;  2M0Y A;  3CCJ Q;  4BE1 A;  2QTX A;  2V8I A;  2QTV A;  2EGE A;  2M16 A;  2DXB A;  3J81 E;  2DPP B;  4AFZ C;  4C92 G;  4JLG A;  4KH1 B;  3I9Q A;  1VQ9 T;  2KRM A;  1RAC B;  4M7D D;  3L2U A;  3CCU A;  1J3T A;  1IXD A;  1WX6 A;  1SKU B;  5CQX A;  3GOX A;  3JCM P;  4KGZ B;  4J9C A;  1KJW A;  4J7F A;  1UE9 A;  2NUP B;  3QKJ A;  1WXB A;  5GJW B;  3HRS A;  2RHX A;  3JCM e;  1JXM A;  3L2R A;  2BTT A;  4Q5W A;  3G4S T;  2ZPB B;  2HKQ B;  5A2Q E;  2EJ9 A;  4KBM B;  1N5Z A;  4N4G A;  5A0L A;  4HT8 A;  3HPW A;  1N8R C;  4Y91 A;  2E64 A;  3JCM g;  4DEX A;  4C92 B;  5FRM A;  2D6F A;  5FWB A;  2EQM A;  3QYG B;  3CCU T;  1R0B G;  1ZUU A;  1BCO A;  2L3S A;  4DBQ A;  2NLU A;  2VKN A;  5GAN 7;  4FL6 A;  2DAQ A;  4C5I A;  2C0I A;  4ZGE B;  3BFM A;  4OB2 B;  2DVE A;  2X3W D;  2MPX C;  3JB9 D;  3R6N A;  4F7U E;  3ER0 A;  5GAN f;  1D09 B;  1B3Q A;  1IRX A;  1WHG A;  5GAN 3;  2J6F A;  3S3O A;  5KYU B;  1I4K 1;  2QG9 B;  2VVK A;  1VQ7 Q;  1HSQ A;  1NG2 A;  1JO8 A;  2ZPG B;  1ZA2 B;  1I5O B;  3OSS C;  3L2V A;  3DLL A;  3OW2 P;  2EYW A;  3M0R A;  1M8V A;  3QII A;  4PNO A;  3VS5 A;  1WDX A;  1QVF S;  2MWO A;  4M75 C;  1YJ9 Q;  1Q82 U;  1YJW Q;  1GXI E;  2RHZ A;  2DTI A;  2A37 A;  2O4X A;  3JB9 H;  2RJF A;  1LVK A;  4M75 A;  3RBB B;  2NYS A;  1Y0M A;  2LJ3 A;  4RCB A;  3OYA A;  4MML A;  1D0Z A;  4OP0 A;  1RAH B;  1KG1 A;  4WCI A;  1D1B A;  2J6O A;  5LJ3 d;  3M0Q A;  1CKB A;  1RAI B;  4Y28 E;  1WFW A;  2AKK A;  2KY9 A;  2EVR A;  1UJ0 A;  4M7D B;  5GMK l;  5GAN h;  4FSX A;  3CBO A;  1ARK A;  1YIJ T;  2DIG A;  3EFS A;  3THK A;  2JS0 A;  1QMC A;  1Y57 A;  4JRI A;  1M2V B;  1Q81 U;  2KYM A;  3NHN A;  3BDU A;  3JCM f;  2YSQ A;  1ZBJ A;  5GJV B;  1LCK A;  2YUO A;  4OMP A;  1U3O A;  2KNB B;  2KRO A;  3GNF B;  2MAM A;  1KFZ A;  4IUU A;  2RQT A;  2DIQ A;  4BB7 A;  7AT1 B;  2K57 A;  1VYU A;  2DFU A;  2V1Q A;  4IUP A;  1BK2 A;  3H41 A;  1RL2 A;  5LJ3 j;  4E6R A;  2ROL A;  3OYH A;  1O75 A;  3UT1 A;  2OAU A;  3VS3 A;  5I11 A;  2KSS A;  1QWE A;  2EGC A;  3OYL A;  2B86 A;  4M7D C;  5FLX E;  4M78 F;  2PVD B;  3JCM d;  1K9A A;  1YJ9 A;  3OYE A;  1KC8 U;  2ZGW A;  2CP5 A;  4PL6 A;  1YBY A;  2CSQ A;  1SEM A;  2AHJ B;  2J7I A;  3PIP A;  2KMT A;  1TG0 A;  4F7U F;  1N9S A;  5HY6 A;  2A28 A;  3BDL A;  2RI5 A;  2JM9 A;  5LJ5 j;  4PJN A;  5IHN A;  2NWM A;  4XU1 A;  1YCY A;  2DEQ A;  1K9M U;  3HFN A;  1MUZ A;  2GTJ A;  3I56 T;  2DRM A;  4M77 A;  2DF6 A;  1N8R U;  2KDS A;  4D6W A;  5GAN 4;  3CCR T;  5CO7 A;  2ECZ A;  1PSE A;  4XK8 E;  2X9H A;  4M7D A;  4JLI A;  4BI4 A;  4M78 G;  1N27 A;  5DM7 R;  3VYG A;  2EAY A;  4XTW A;  1GCP A;  5KH6 A;  3H0I A;  2HQE A;  1EFN A;  1WHL A;  3QPH A;  2W10 A;  2OTJ Q;  3A8M B;  3KUF A;  4IUT A;  1C1A A;  4R0K A;  2BZY A;  4IUV A;  3REA B;  1YHQ T;  5KYW B;  2NUT A;  4ESR A;  4B6M A;  3CMA A;  1UEB A;  3ZEH A;  2XK0 A;  2JN0 A;  2ZAE A;  3EGX A;  3E19 A;  2CRE A;  4LXC A;  1NEG A;  5CR2 A;  2BZ8 A;  2KAF A;  4J5Y A;  1TXQ A;  3M0P A;  1ZSG A;  2RQV A;  3LYI A;  2BE7 D;  2O4X B;  2X4Y A;  4IIO A;  2YRV A;  2LQK A;  1QWF A;  1HJD A;  3MJX A;  2PVG B;  4HT9 A;  2VWF A;  1I5L A;  3M58 A;  2I0N A;  2P0K A;  1PHT A;  4NS5 A;  3MET A;  3CC2 A;  3L1A A;  1JBM A;  2FZG B;  1K0S A;  4PJO G;  5LJ3 e;  2E3H A;  1S1N A;  1N9R A;  2CZ7 B;  2K5F A;  5GMK i;  3GIB A;  2RQW A;  4J7I A;  1ZUY A;  1VQ5 A;  1IB8 A;  2LJ0 A;  3QBY A;  4PJO C;  2GGR A;  4C0D B;  2OI3 A;  2JNG A;  1OZ3 A;  4XTV A;  4M7A C;  1K0X A;  4M75 F;  3C12 A;  1KC8 C;  4F14 A;  2K5I A;  1EX4 A;  1G3T A;  3CCL A;  2L0A A;  1H92 A;  1M5Q 1;  1QCO A;  5C6S A;  3G71 A;  1QKX A;  3HHT B;  1N6A A;  3EHQ A;  2RK1 A;  3CXC S;  2HBP A;  3OS2 A;  3KFV A;  1VQM Q;  1QVG A;  2X4J A;  4LDY A;  5GAM e;  4GLK A;  4Z8A A;  4JJC A;  4QQ6 A;  1K8A U;  1VQL A;  4LDW A;  1V29 B;  2WSF E;  1O9S A;  1EZZ B;  2FZK B;  2DXC A;  2EYY A;  1UGR B;  1YJ9 T;  2PZ1 A;  3UF4 A;  2CH4 W;  4LDX A;  1YIJ Q;  3TSZ A;  2LQW A;  2V8K A;  4Z88 A;  2RHU A;  1QP2 A;  1X75 C;  1Q7Y U;  3VKI A;  1RI9 A;  2GTO A;  1KQS P;  2DER A;  4MDW A;  1UGQ B;  1HD3 A;  2QEX Q;  1KQS S;  5KCO A;  4FYX B;  2CT4 A;  4HVU A;  3CPW S;  5AYF A;  2LMJ A;  2JUF A;  2E10 A;  2P4R A;  1IZ6 A;  4AMC A;  2LP5 A;  3FC3 A;  1Y07 A;  3MCA B;  1G3W A;  5CAI A;  1OI1 A;  2EQK A;  4M7D G;  1AHJ B;  4M77 D;  1UDL A;  3QWY A;  1CKA A;  2PUK B;  3PIO A;  2HNI A;  2DXU A;  1QP3 A;  3O5Z A;  4C92 C;  1XNI A;  1RI0 A;  2Z0W A;  1W70 A;  2LVM A;  4E47 A;  1BB9 A;  1YJW A;  2F2V A;  3I56 Q;  2GFA A;  2YLB A;  1M90 U;  4D8K A;  2J6K A;  3QSU A;  1MMA A;  2F2W A;  4EMK C;  5DLQ E;  2JW4 A;  1JU5 C;  5GAN 2;  3LGL A;  1VQ5 T;  4EMG A;  1PRL C;  4M78 A;  3MKD A;  3M5A A;  2RQR A;  5GAN e;  2RJE A;  2DZC A;  1RAE B;  3CCR A;  2EGA A;  4QT7 A;  3TSW A;  4M78 D;  4CC3 A;  2QQR A;  3L2W A;  1OU8 A;  1KSW A;  5GAN 8;  4X9D A;  2P4T A;  1KQ2 A;  4FIB A;  2CT3 A;  3CXC P;  5GAN 6;  2LCC A;  1BCM A;  1QLY A;  4NL2 A;  1OOT A;  1V76 A;  3V7S A;  5KYX A;  2RJC A;  3EFO B;  1PKS A;  2XG8 D;  4E2F B;  4HKE A;  5LJ5 g;  1K8A C;  2ABL A;  5L8R E;  1WYX A;  2HDA A;  4C5H A;  4FSS A;  2DD5 A;  1R8O B;  3JCM V;  1NE8 A;  4AG2 C;  2HBW A;  1TUD A;  3CCS T;  2JTF A;  1K73 R;  4CC4 B;  1U06 A;  2JTM A;  3TCJ A;  2K3B A;  4KGV B;  3JV3 A;  2EFI A;  1VUB A;  1Y96 B;  1VQL Q;  2RI2 A;  3OYG A;  2M51 A;  4JJD A;  2IVW A;  1TTH B;  4V2S A;  3AHU A;  1K73 U;  2YLC A;  3MEV A;  5KCH A;  1NPP A;  1GCQ A;  3CCQ Q;  1X43 A;  3EG3 A;  2HQH A;  3CCJ T;  2D1X A;  3TRE A;  3CD6 A;  4F7U B;  1UJY A;  1SSF A;  2RF0 A;  2VXE A;  4M77 B;  2CGH A;  1HYO A;  2DBK A;  1ZLM A;  1GFC A;  3MO8 A;  4DOW A;  2A7Y A;  3G71 T;  4PFP A;  4MMK A;  4AFU C;  2DLP A;  2RO0 A;  4XTY A;  3CCM A;  2RPN A;  1AWO A;  1Q7Y C;  1JJ2 P;  3EHR A;  1YWP A;  5GAO n;  2OAW A;  1VIE A;  5KYX B;  2VXF A;  1YIJ A;  1LNX A;  2HCK A;  4CC2 A;  1FYN A;  1VQ6 A;  1AEY A;  4PK4 A;  5IH2 A;  5ECA A;  2WSE E;  4IUR A;  2MCN A;  4M78 B;  2F5K A;  5DLO A;  4J6X A;  4BAC A;  3I56 A;  4PJO D;  2HSP A;  5GAN g;  2HL3 A;  5LJ3 f;  2OTL T;  2FVU A;  3VS4 A;  1KQ1 A;  2EBP A;  2VYT A;  3I55 A;  5EC7 A;  5IT9 E;  1WHH A;  1K8A R;  2OTL A;  1ZSZ B;  1I8F A;  1IGQ A;  3OBY A;  4IUQ A;  3VRY A;  3CC2 T;  1QVF A;  2XDB A;  3ZFJ A;  2HZY A;  4JRP A;  5KYY B;  3WXM B;  4O5V A;  4RCC A;  2EKH A;  3VUB A;  2EYX A;  1LOJ A;  2K7A A;  4TVR A;  4VUB A;  3VRZ A;  4A4G A;  2DMO A;  5IXB A;  3NGP A;  4M78 C;  5GMK m;  4LUD A;  3CC7 T;  2CP7 A;  4E7L A;  2NUT B;  3VS2 A;  3OMC A;  4XAX B;  5LJ5 h;  2RA2 A;  3QXE B;  3SFM A;  4BY6 B;  1RAF B;  2YXY A;  4C0Z A;  3M56 A;  1IO6 A;  1B7T A;  4OB0 B;  1PG5 B;  1QKW A;  2H3J A;  3CPW P;  5LJ5 f;  1PM3 A;  4L6V 5;  4A4H A;  2LCL A;  1BU1 A;  2RNA A;  3Q1J A;  1OEB A;  3PFS A;  3E1S A;  2E5Q A;  1LJO A;  2E4H A;  1M9S A;  3DLM A;  3VUZ A;  1M90 R;  3OSV A;  4AT1 B;  4LDU A;  5CKD A;  1V1C A;  3M53 A;  3EGD A;  2L3Q A;  1K9M C;  1K76 A;  4OF1 A;  3H0F A;  3CBP A;  3QDF A;  3EG2 A;  2ENM A;  1VQ9 Q;  3VS6 A;  3V7C A;  5D7U A;  3CXC A;  4A4E A;  2HKN A;  5GAO m;  3GP8 A;  2D0N A;  4C5G A;  3VS0 A;  3OS1 A;  4GBQ A;  2YUP A;  3A8H B;  1VQ5 Q;  1VQM A;  3PVQ A;  3EG0 A;  1NM7 A;  4J9F A;  2DD4 A;  3JB9 G;  4C92 D;  5CKE A;  2PNI A;  1VQP Q;  2R5M A;  3L2Q A;  1VQ4 Q;  3X24 B;  1MMD A;  4MDX A;  4FM4 B;  1A0N B;  3GNG A;  4RTY A;  1ZX6 A;  3QUI A;  3J7A F;  1I81 A;  4QKU A;  1AOJ A;  2CUD A;  3HTR A;  2DO3 A;  4J6Y A;  3DB3 A;  5FWC A;  1YJN A;  1D0Y A;  2O88 A;  5GAO l;  1NEB A;  2RHI A;  3TVT A;  1B07 A;  2QAS A;  2W0Z A;  3PMI A;  5FU7 B;  2O01 E;  3TQ7 P;  4DOV A;  1WJS A;  1Y7X A;  4A4K A;  2WAC A;  3FB9 A;  3ME9 A;  2CH4 A;  2BE9 B;  3DKM A;  4PLI A;  1FXX A;  2NUP A;  3OB9 A;  3TEE A;  2QEX A;  4JS4 A;  5HK0 A;  4KT0 E;  2DL7 A;  1P92 A;  1I1J A;  2KVQ G;  4M75 G;  1WQ7 A;  1YI2 Q;  3CME T;  1KHC A;  2V8J A;  1X69 A;  4ELZ C;  3NFC A;  1Q86 U;  3RDV A;  1YNZ A;  2CZ0 B;  1JB0 E;  3HSB A;  4KGX B;  4KUI A;  2GQV A;  5CKB A;  4YTL A;  4E7I A;  4HCK A;  5KE2 A;  8ATC B;  4NOY A;  3RNJ A;  4C8Q B;  1YIT A;  2QDL A;  2KE9 A;  1D1C A;  2A0F B;  2L2P A;  1WHJ A;  2E41 A;  4K11 A;  1GBQ A;  2FB7 A;  3LGF A;  3OYB A;  3CCJ A;  3GBQ A;  2NUZ A;  5IHI A;  2R5A A;  1QCF A;  3OS5 A;  3H8Z A;  2DBM A;  2EJF A;  2QQB A;  3OS0 A;  1GRI A;  3VV0 A;  4M75 B;  3EH2 A;  2EWN A;  1YJW T;  4JRK A;  4Y92 A;  3CC4 T;  2QA4 Q;  1BBZ A;  1EIF A;  2EJG A;  2OTL Q;  2QA4 A;  2HAX A;  3A8O B;  4M7A G;  5CIU A;  1ABQ A;  1PSF A;  4DBF A;  2DYI A;  2JM8 A;  2HEQ A;  1MHN A;  1I07 A;  4HVW A;  2YDL A;  4C8Q C;  2FYK A;  1HXD A;  1KD1 U;  3G4S Q;  5LJ3 h;  1KD1 R;  2QQA A;  4FT4 A;  1NJI R;  2A36 A;  4DQ2 A;  2CKK A;  1G3S A;  1X6G A;  2D8J A;  2FL7 A;  2F5T X;  3OYC A;  1MND A;  1M1K U;  1TH7 A;  1Q86 C;  1HK9 A;  1JJ2 S;  2QQS A;  3VYH B;  1YIT Q;  1QVG P;  1YI2 T;  1S72 Q;  4QQG A;  5AT1 B;  5GMK j;  3O8V A;  1YP5 A;  4J6W A;  2AT1 B;  4KUD K;  1D3B A;  3FJP A;  1GCQ C;  1Z9Z A;  4R56 A;  2HMA A;  5HCK A;  2RM4 A;  3FLG A;  2ZPH B;  3CD6 T;  5J39 A;  4XU2 A;  1YHQ Q;  1BIA A;  5CK9 A;  3G6E A;  1AZE A;  3SWN B;  4ME7 A;  2G6F X;  5CCA A;  2JVV A;  3CPF A;  3RKY A;  3VU3 C;  1UHC A;  2FPD A;  3CCR Q;  1Q81 C;  2LDM A;  1WJR A;  3L2Z A;  2JTE A;  3OYN A;  3JCM h;  1JEG A;  3S3M A;  2KGT A;  3KXT A;  1KQS A;  4FW2 A;  4FW1 A;  1H3Z A;  3LWI A;  1M3B A;  2QA4 T;  4C8Q D;  3PGG A;  5GAM j;  2ZCF B;  4M77 C;  3UWN A;  4J9E A;  3GPL A;  3P8H A;  3C95 A;  3CC4 A;  4ELY C;  5FU6 C;  3LWH A;  2ZZD A;  2F2X A;  4OB3 B;  3QO3 A;  1W2B S;  3CCV T;  4E7J A;  3JCM X;  1Y96 A;  3VS1 A;  4AG1 C;  1OPK A;  2C0T A;  2P0P A;  4PJO E;  3SB2 A;  3C0C A;  4JZ4 A;  4A53 A;  5KYN A;  1Q81 R;  3CBM A;  3SEM A;  6AT1 B;  1VQN T;  9ATC B;  2FPF A;  2DRK A;  2M9U A;  4HVV A;  2J05 A;  1PCX A;  4CRI A;  4X34 A;  4J8O A;  5D6Y A;  1PD1 A;  2EQI A;  1VQK A;  1OV3 A;  3CCV A;  1RAG B;  3BY7 A;  3CMA Q;  1AD5 A;  3M54 A;  1KD1 C;  2F69 A;  1YIT T;  1QVG S;  1AWX A;  1TOV A;  2DXT A;  1AWJ A;  1H8K A;  1VQO Q;  5KYY A;  2JJ9 A;  2C0O A;  2LQ8 A;  3G6E Q;  2JMA A;  4OMQ A;  3CCQ A;  4BDZ A;  5I2M A;  1BIB A;  5GAM d;  4M7D E;  2YT6 A;  1W1F A;  4BUG A;  1CSK A;  4BD3 A;  3PTA A;  2E6Z A;  1W6X A;  3H9N A;  3V7R A;  2QYZ A;  3MEA A;  1NJI U;  2VV5 A;  2DL4 A;  2RJD A;  4JZ3 A;  1PRM C;  4BE0 A;  2R58 A;  3P8B B;  2LZ6 B;  2MIO A;  4MZT A;  4A63 B;  2MOX A;  3FIF A;  2DEU A;  2XHC A;  3CCQ T;  3OMG A;  4OVA A;  1K73 C;  2QK0 A;  4HCZ A;  3VJP A;  1M1G A;  3UA6 A;  1RUW A;  3D7S B;  4DBH A;  4QW2 A;  5GAM f;  4IIM A;  3V8L A;  5GAO q;  1SPK A;  1R0C B;  4J9H A;  2ESW A;  1S72 A;  3CCM T;  1UG1 A;  1FMV A;  3CME Q;  4M7A F;  2MK5 A;  2LTO A;  1UFF A;  3AT1 B;  2E12 A;  1VQ7 T;  4LDV A;  3MP8 A;  1X01 A;  2D8H A;  5HKC A;  1TS9 A;  2IG0 A;  1OQK A;  4N4H A;  4ZN3 A;  5EG2 A;  4GY5 A;  2GNC A;  1WIE A;  3JRZ A;  2K6D A;  3FRN A;  3OBW A;  2VGN A;  1WA7 A;  1QVF P;  4MZM A;  4JUV A;  3M55 A;  2XI9 A;  1JRI A;  2SEM A;  3I35 A;  1ZA1 B;  1VQ7 A;  2CSI A;  1BYM A;  3C4S A;  3BE3 A;  3JSC A;  1WGS A;  1OPL A;  2KXC A;  2ZPE B;  4PKC C;  5KE3 A;  2KT8 A;  2X4X A;  4C8Q A;  2DA9 A;  4ORZ A;  4L59 A;  3OYF A;  2O9S A;  1SRL A;  2MWP A;  1JJ2 A;  2XIC A;  2RD1 A;  3EFR A;  2EQJ A;  2CP2 A;  3UAT A;  3VS7 A;  4F04 B;  3TU4 K;  3CCM Q;  1Y71 A;  2R57 A;  3HKS A;  2L5Q A;  1ZSZ A;  3M9Q A;  4JDS A;  2YUQ A;  2DJQ A;  1UGS B;  1T3S A;  2AK5 A;  1SRM A;  2FO0 A;  1IRE B;  2K2M A;  4KUL A;  2DVJ A;  3CC7 Q;  5LL6 S;  1BI1 A;  3CC7 A;  1TUG B;  4FYV B;  1X6O A;  3QZ5 B;  1UGP B;  3M4G A; 
#chains in the Genus database with same CATH homology
 1K76 A;  3H0F A;  2X3X D;  1I0C A;  2ENM A;  3EG2 A;  4R0K A;  2BZY A;  3VS6 A;  2O31 A;  3REA B;  1T3L A;  4ESR A;  2DYB A;  1WXT A;  2CRE A;  1SHF A;  2D0N A;  1AWW A;  2GQI A;  3VS0 A;  1NEG A;  1NLP C;  2KEA A;  2BZ8 A;  4GBQ A;  2V1R A;  2YUP A;  4JPB W;  3M0P A;  1GL5 A;  1ZSG A;  2RQV A;  4RTX A;  4CC7 A;  2DE0 X;  4IIO A;  5L23 A;  3PVQ A;  3EG0 A;  1NM7 A;  4J9F A;  4RTZ A;  1QWF A;  4JJB A;  2PNI A;  1HJD A;  1GBR A;  4OMO A;  2VWF A;  4GLM A;  5IHK A;  1A0N B;  2I0N A;  2GBQ A;  4RTY A;  1PHT A;  1ZX6 A;  2FRW A;  2AZV A;  1AOJ A;  2CUD A;  1K0S A;  1UGV A;  4J9B A;  1S1N A;  5FWC A;  2RQW A;  2O88 A;  1NEB A;  3TVT A;  1VYV A;  1ZUY A;  1RLQ C;  1B07 A;  2JS2 A;  2W0Z A;  2LJ0 A;  3LH5 A;  2LCS A;  5I22 A;  1M3C A;  1Z9Q A;  2GGR A;  4RTT A;  4X1V A;  2CH4 A;  1TUC A;  2OI3 A;  2KR3 A;  1K0X A;  2AZS A;  4F14 A;  2DL7 A;  2OJ2 A;  3A98 A;  3M0T A;  1WLP B;  1I1J A;  2EPD A;  2L0A A;  1H92 A;  2CDT A;  1X69 A;  4ZNX A;  3PE0 A;  4F16 A;  1YNZ A;  1QKX A;  1UHF A;  3EHQ A;  2O9V A;  2KBT A;  4AFQ C;  1XOV A;  1X2K A;  2JXB A;  4HCK A;  3KFV A;  1ZUK A;  3EGU A;  3RNJ A;  2KYB A;  1M27 C;  1GFD A;  2QDL A;  2KE9 A;  4JJC A;  4Z8A A;  2L2P A;  2ED1 A;  4K11 A;  1GBQ A;  4OMM A;  3GBQ A;  2NUZ A;  5IHI A;  1QCF A;  2ED0 A;  2DL5 A;  2DBM A;  2EYY A;  1E6G A;  1GRI A;  5IXF A;  1PKT A;  2PZ1 A;  3UF4 A;  2CH4 W;  1WXU A;  3M0U A;  4Y92 A;  4D8D A;  2KRS A;  2DNU A;  1BBZ A;  3TSZ A;  2LQW A;  4Z88 A;  1ABQ A;  3ULR B;  1U5S A;  2J06 A;  4LN2 A;  2JM8 A;  2HEQ A;  1RLP C;  2DX1 A;  3UA7 A;  1RI9 A;  2GTO A;  2DL8 A;  1I07 A;  1HD3 A;  1K1Z A;  4HVW A;  2YDL A;  2CT4 A;  4HVU A;  1E7O A;  3FJ5 A;  1X27 A;  2LMJ A;  4RTW A;  1YN8 A;  3SHW A;  2P4R A;  3EG1 A;  2H8H A;  2DIL A;  2LP5 A;  2A36 A;  1X6G A;  2D8J A;  1MV3 A;  1NYG A;  1WI7 A;  1E6H A;  1M30 A;  3ZL7 C;  2EYZ A;  1T0H A;  1UDL A;  3M0S A;  2AKL A;  3QWY A;  1CKA A;  4RUG A;  2DL3 A;  2JT4 A;  3O5Z A;  4LUE A;  1W70 A;  1BB9 A;  3CQT A;  2F2V A;  4EIK A;  2A08 A;  1UUE A;  4D8K A;  2J6K A;  2BZX A;  2F2W A;  1YP5 A;  2O2O A;  2M0Y A;  1YCS B;  2JW4 A;  1GCQ C;  1JU5 C;  1Z9Z A;  3I5R A;  2EGE A;  1KIK A;  5HCK A;  1PRL C;  4AFZ C;  3I9Q A;  2L3P A;  2KRM A;  2RQR A;  1J3T A;  1WX6 A;  1AZE A;  4RTU A;  1T0J A;  2EGA A;  2FEI A;  2G6F X;  4QT7 A;  4OMN A;  4J9C A;  3TSW A;  1KJW A;  4J9D A;  1UHC A;  1UE9 A;  4CC3 A;  2FPD A;  1WXB A;  5GJW B;  1KSW A;  1JXM A;  2JTE A;  2BTT A;  1JEG A;  2KGT A;  2CT3 A;  2RQU A;  1X2Q A;  1JXO A;  4RTV A;  1M3B A;  1N5Z A;  1QLY A;  1X6B A;  5FW9 A;  4J9E A;  1OOT A;  2SRC A;  1PKS A;  1PNJ A;  4DEX A;  5FWB A;  2ABL A;  2F2X A;  1WYX A;  1ZUU A;  2HDA A;  2L3S A;  2VKN A;  4FSS A;  1PWT A;  4Z89 A;  2FG0 A;  3VS1 A;  4AG1 C;  1OPK A;  4AG2 C;  2C0I A;  2C0T A;  2HBW A;  3IQL A;  1TUD A;  3C0C A;  4JZ4 A;  2X3W D;  3SEM A;  2FPF A;  3R6N A;  2DRK A;  4CC4 B;  1U06 A;  4HVV A;  2J05 A;  1FMK A;  1B3Q A;  2K3B A;  3JV3 A;  2J6F A;  2EQI A;  4F17 A;  1OV3 A;  2M51 A;  1SSH A;  1ABO A;  1AD5 A;  4JJD A;  4HXJ A;  2VVK A;  1HSQ A;  1AWX A;  1NG2 A;  1JO8 A;  1GCQ A;  1AWJ A;  1X43 A;  3EG3 A;  1H8K A;  2EYW A;  2C0O A;  3M0R A;  2D1X A;  2YUN A;  3VS5 A;  1M8M A;  1WDX A;  2JMA A;  4OMQ A;  1UJY A;  4LNP A;  2RF0 A;  1M3A A;  2YT6 A;  1W1F A;  1G2B A;  1CSK A;  2DBK A;  2A37 A;  1ZLM A;  2ROT A;  3RBB B;  1GFC A;  1Y0M A;  2LJ3 A;  2LJ1 A;  1W6X A;  2DL4 A;  4JZ3 A;  2KRN A;  1PRM C;  4AFU C;  2DLP A;  2LZ6 B;  2MIO A;  2RPN A;  4A63 B;  1AWO A;  4WCI A;  2MOX A;  3EHR A;  1SHG A;  2J6O A;  1YWP A;  3M0Q A;  2OAW A;  1CKB A;  2JMC A;  1WFW A;  3UA6 A;  2AKK A;  1RUW A;  2EVR A;  1UJ0 A;  1G83 A;  2HCK A;  4CC2 A;  4IIM A;  1FYN A;  4LE9 A;  1AEY A;  1JQQ A;  1SPK A;  3QWX X;  4J9H A;  1ARK A;  2ESW A;  5IH2 A;  5ECA A;  3THK A;  2XMF A;  2JS0 A;  1UG1 A;  1Y57 A;  2MCN A;  2KYM A;  3NHN A;  3NMZ C;  3I5S A;  2EW3 A;  2YSQ A;  1ZBJ A;  5GJV B;  4KRT A;  1LCK A;  2YUO A;  1H3H A;  4OMP A;  1U3O A;  2FPE A;  1UFF A;  2KNB B;  2KRO A;  1KFZ A;  2RQT A;  2HSP A;  2D8H A;  1VYU A;  1AZG B;  3PVL A;  2GNC A;  2V1Q A;  3H0H A;  3VS4 A;  1WIE A;  2EBP A;  1BK2 A;  2K6D A;  5EC7 A;  3H41 A;  1WA7 A;  4E6R A;  2ROL A;  1NYF A;  2K9G A;  3VS3 A;  5I11 A;  1QWE A;  2EGC A;  3VRY A;  2B86 A;  2SEM A;  3I35 A;  2CSI A;  2EKH A;  2EYX A;  1K9A A;  1NLO C;  2K7A A;  3VRZ A;  5IXB A;  2DMO A;  4OML A;  3NGP A;  1VA7 A;  1OPL A;  2KXC A;  4J9I A;  4DEY A;  1MV0 B;  2CSQ A;  2PTK A;  1SEM A;  4LUD A;  2KT8 A;  2IIM A;  2LQN A;  2J7I A;  2DA9 A;  4ORZ A;  3VS2 A;  4J9G A;  1TG0 A;  2O9S A;  1SRL A;  2A28 A;  2FRY A;  2JM9 A;  2CUB A;  1AVZ C;  3REB B;  1YWO A;  3UAT A;  5IHN A;  3VS7 A;  1IO6 A;  4M4Z A;  2KXD A;  2NWM A;  1K4U S;  1QKW A;  1MUZ A;  2LNH B;  2GTJ A;  2DRM A;  2RN8 A;  2DM1 A;  2DF6 A;  3U23 A;  2RMO A;  1BU1 A;  2ECZ A;  2YUQ A;  2RNA A;  1OEB A;  2LX7 A;  2DJQ A;  2K79 A;  1T3S A;  2AK5 A;  1SRM A;  2FO0 A;  2K2M A;  1VYT A;  2DVJ A;  1UTI A;  2E5K A;  2KT1 A;  1GCP A;  1UEC A;  1V1C A;  3H0I A;  3NPF A;  1EFN A;  2W10 A;  4AFS C;  2L3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...