2YDLA

Crystal structure of sh3c from cin85
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
67
structure length
67
Chain Sequence
ASDYCKVIFPYEAQNDDELTIKEGDIVTLINKDCIDVGWWEGELNGRRGVFPDNFVKLLPPLEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Distinct Ubiquitin Binding Modes Exhibited by SH3 Domains: Molecular Determinants and Functional Implications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords SH3 DOMAIN-CONTAINING KINASE-BINDING PROTEIN 1
total genus 10
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2011-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ydlA00
2K9GA 1M27C 2L3PA 2OJ2A 4HVUA 1RLPC 4RTYA 1X6GA 2DILA 4LN2A 2M51A 1UUEA 2DRMA 2EYZA 2JXBA 3TVTA 2EQIA 3QWXX 1PRMC 4JJBA 1IO6A 4RTUA 4RTVA 1UGVA 4K11A 2HCKA 2LMJA 2YT6A 4OMNA 2ESWA 2RNAA 5I22A 2XMFA 4J9BA 1KIKA 2GTOA 4M4ZA 2JS0A 2EYYA 1LCKA 1BB9A 1MUZA 2ED1A 2JM9A 2KROA 2MIOA 3EG0A 3I5SA 2CSQA 2FRYA 2YUNA 3M0QA 1WA7A 3REAB 1SHGA 3EG3A 1JXMA 2DBKA 2L3QA 1WDXA 2MCNA 3TSWA 4F17A 2FO0A 1UJYA 2I0NA 4RUGA 1HJDA 4WCIA 5HCKA 4FSSA 1Z9QA 2DLPA 2F2WA 3H41A 1B3QA 1M30A 2ABLA 2KYBA 1GFCA 4D8DA 2AZVA 2YUOA 2DNUA 3VS0A 2JS2A 5FWCA 3SHWA 2DL8A 1PHTA 2JMCA 1K0SA 2NUZA 1Y57A 2DYBA 2F2XA 4CC4B 2JTEA 1QWFA 2BZXA 1BU1A 1YN8A 3O5ZA 1GBQA 2EGCA 1AWJA 4Z89A 1JO8A 2RMOA 1U06A 2K6DA 2SRCA 2BTTA 2LCSA 2LNHB 2FEIA 1Z9ZA 1QLYA 1MV0B 1OOTA 1ZSGA 1T3SA 2DJQA 2KT1A 4A63B 4DEYA 2L2PA 5IHKA 4J9DA 1OV3A 1RI9A 1JU5C 1UG1A 1B07A 1BK2A 3GBQA 2EGEA 2EKHA 2O88A 2CREA 1H92A 1SPKA 1RLQC 2ENMA 3LH5A 4OMLA 1WFWA 3THKA 2KYMA 3VS5A 1E6HA 2KGTA 4D8KA 2LQNA 2O9VA 5IXFA 2D1XA 2DA9A 3NPFA 2DL3A 1WLPB 2DF6A 3RNJA 1NM7A 1I0CA 1K0XA 1VYTA 4ESRA 2X3XD 1YP5A 1ZX6A 1BBZA 5EC7A 2DRKA 2ED0A 1TUDA 2J05A 2EVRA 4RTTA 1QCFA 3M0PA 1I07A 2VWFA 1S1NA 3EHRA 2G6FX 3U23A 2ROTA 2K79A 1AWWA 2LJ0A 3VS3A 4CC7A 3RBBB 4JZ4A 2PZ1A 1EFNA 1AWXA 2CUDA 1UHCA 2F2VA 2C0IA 2FPEA 1M8MA 2RPNA 4RTWA 4Y92A 4AG1C 1T0JA 2AZSA 1ZUUA 2CUBA 1AZGB 1QKXA 2YSQA 4HVVA 1HSQA 2EGAA 2GQIA 4JJDA 4F14A 2KBTA 1V1CA 2BZ8A 2RF0A 1I1JA 2JM8A 2J06A 4GBQA 1NYFA 3UF4A 1G2BA 1SEMA 2DMOA 2ROLA 4J9IA 1NLPC 5I11A 2RQWA 5IHNA 1OPKA 2JW4A 5FWBA 5L23A 3I5RA 1XOVA 2J6FA 4JPBW 3C0CA 1GRIA 3M0RA 1UE9A 4LUDA 4GLMA 2V1RA 1KSWA 2HEQA 2RQTA 1AOJA 1T3LA 2KT8A 2LZ6B 5IH2A 2FPFA 1FYNA 1QKWA 2A08A 1JXOA 3NHNA 1AZEA 1U5SA 3UA7A 3UA6A 1GL5A 2KXCA 1UHFA 2JT4A 3PVLA 2CH4A 2D8HA 1N5ZA 2YUPA 1GFDA 2OI3A 4RTZA 1ZLMA 3VS6A 1WIEA 4J9FA 2GTJA 3VS2A 1ABQA 1WXUA 4AFUC 1K76A 2FRWA 4AG2C 2IIMA 4EIKA 2OAWA 3VS7A 2KEAA 3CQTA 3UATA 1GBRA 1AVZC 4J9HA 5GJVB 1W6XA 1ZBJA 1ZUKA 1AEYA 4HXJA 4J9GA 1WXBA 2CDTA 1FMKA 4AFZC 2AK5A 2CT4A 4R0KA 1YWOA 2B86A 1X6BA 2EYXA 4OMMA 1TUCA 1H8KA 2O2OA 3I35A 2DM1A 2C0OA 4HVWA 1Y0MA 4OMOA 1GCQA 2DBMA 3IQLA 2K3BA 1CKAA 3ZL7C 4KRTA 2HDAA 2GNCA 1PWTA 4RTXA 1YWPA 1WXTA 2HBWA 3EG2A 1X69A 2A28A 2EPDA 2X3WD 3VRZA 2KRMA 4JZ3A 2QDLA 1UECA 2DL4A 3I9QA 3VS1A 2LJ1A 1CKBA 4J9EA 1YNZA 4IIMA 2RN8A 1WX6A 3QWYA 2J7IA 4IIOA 1X2QA 2A36A 2NWMA 3M0TA 2GBQA 1PKTA 1UDLA 2K7AA 4OMQA 1ZUYA 5IXBA 1OPLA 1G83A 1U3OA 2EYWA 1UFFA 2CT3A 1NLOC 1VYUA 2EBPA 2DL5A 1JEGA 2LJ3A 1SRMA 1PKSA 1PRLC 4ZNXA 2PTKA 1MV3A 1WI7A 1J3TA 1W1FA 1SRLA 4CC2A 1NYGA 2YUQA 1KJWA 4J9CA 1X2KA 1W70A 2KR3A 2E5KA 1VYVA 2EW3A 4QT7A 4CC3A 2V1QA 1K4US 2DVJA 2HSPA 4Z88A 2A37A 2KRNA 3EHQA 1GCQC 2LQWA 2DX1A 2KE9A 2KXDA 2L0AA 4LE9A 4AFSC 1M3CA 2FPDA 3H0IA 3PE0A 3EGUA 1ARKA 1K1ZA 1AD5A 4F16A 4LNPA 2AKKA 4JJCA 1TG0A 2CSIA 2RQUA 2LP5A 3VRYA 2LX7A 1YCSB 1M3AA 1NEBA 2J6KA 1T0HA 2DL7A 2K2MA 2O9SA 2VVKA 2KNBB 1A0NB 1WYXA 2BZYA 1QWEA 3FJ5A 2L3SA 2W10A 3M0SA 4X1VA 3VS4A 1M3BA 4OMPA 2M0YA 4E6RA 3H0FA 1X43A 1UTIA 2FG0A 2H8HA 3A98A 2MOXA 5FW9A 2D8JA 3JV3A 1NEGA 1SHFA 3EG1A 1K9AA 2ECZA 2KRSA 3PVQA 3R6NA 3NGPA 2C0TA 1CSKA 3H0HA 1AWOA 1HD3A 1NG2A 1KFZA 2VKNA 4AFQC 2CH4W 2O31A 1SSHA 2W0ZA 3KFVA 1VA7A 2SEMA 3NMZC 1PNJA 2P4RA 2RQRA 1X27A 2D0NA 4ORZA 3TSZA 3ULRB 1E6GA 1H3HA 1RUWA 5ECAA 5IHIA 1E7OA 4Z8AA 2PNIA 1ABOA 3REBB 2RQVA 2DE0X 4LUEA 2YDLA 2AKLA 1UJ0A 4HCKA 1GCPA 1OEBA 2JMAA 2J6OA 4DEXA 3SEMA 3M0UA 1JQQA 5GJWB 2GGRA
chains in the Genus database with same CATH superfamily
2H3EB 1FMVA 4MDXA 1O9SA 2CP7A 1VQ5T 5FU7B 2KVQG 4LN2A 1UUEA 1PC0A 1SF9A 2DRMA 3JCMg 1JJ2S 5M9OA 1M5Q1 4A4GA 3TVTA 4FYXB 2CP0A 1BI3A 3LH0A 5I2SA 3BY7A 2MI6A 1Q86C 4BY6B 2HCKA 2LMJA 2RNAA 5I22A 1M9SA 2O4XB 1KIKA 1EIFA 5FRNA 2EYYA 3L2UA 2JM9A 3QSUA 2COWA 4E7JA 2QGGA 2QQBA 3A8GB 4WTOB 2CSQA 1V29B 3H9NA 3REAB 3EG3A 2YRDA 3WVEB 3RESA 1KQSS 2OTJT 1QVGP 3JAME 4HT8A 3QZ5B 1HJDA 2O4XA 1VQ7T 1BYMA 2DO3A 5HCKA 2VGNA 5KYYA 1Z9QA 1G3TA 1LVKA 2F2WA 1K73R 2HZYA 5KYUA 4D8DA 2DNUA 3CC7Q 3LX7A 3CPFA 3M58A 1PHTA 5KE2A 2NUZA 3CBOA 2DYBA 3INZA 1MNDA 3CEYA 2EQKA 3PGGA 1YN8A 3O5ZA 2EGCA 1NJIC 1JO8A 3OYAA 2ZPHB 2LCSA 1D3BB 1YHQT 1YITQ 4FU6A 2FEIA 1VQ6T 1ZSZA 1ZSGA 2KT1A 2K4YA 2PUKB 4PJOG 4A63B 1QVGA 2CP6A 3PT9A 4C92E 1ZBXA 4BDZA 1JU5C 2A0FB 4C5HA 2EGEA 1H92A 5I21A 1V76A 1RLQC 3HRSA 5GAOr 1WFWA 3VS5A 1M90U 2NUPA 1WHKA 2K5LA 4QVZA 4BACA 2DA9A 4RKUE 3NPFA 2DF6A 1MMGA 3RNJA 1I0CA 3EH1A 2LX9A 3CCVQ 2E3IA 3JB9D 2NLUA 1QCNA 3A8LB 1KQSA 1YJ9Q 2V26A 4DOVA 1Q82U 4C92A 3M0PA 2E1HA 3HTRA 2QEXT 1VQ7A 2YLBA 1AWWA 4FL6A 2F69A 4QVCA 1C6VX 3MJXA 1ZSZB 1HXDA 2LVMA 3VS3A 4DQ2A 1BCOA 3CCMT 3JCMQ 4F7UF 5AYFA 2IPOB 4M7DG 2F2VA 3EFOB 3A8OB 1T0JA 1VIEA 1ZUUA 2AZSA 3X25B 1AZGB 1QKXA 5GAOq 1IREB 2MAMA 1YJNQ 1KC8C 1VQ5A 2IVWA 4ATOA 4JJDA 3M59A 1I1JA 3CMAA 2J06A 3KUFA 4II1A 3UF4A 2QXFA 1G2BA 1SEMA 3QJ6A 4J9IA 3P8BB 1NLPC 3HRUA 4BB7A 5KYWB 1I5LA 2WSEE 1OPKA 1G5VA 3GNFB 5L23A 3I5RA 4XU1A 3C0CA 4IUUA 4LUDA 2BIVA 3CCLQ 4PFZA 4M75B 3MEVA 2V1RA 1KSWA 2E6ZA 4LDWA 3DLLA 2RH2A 1BIAA 1T3LA 2RJCA 4M77G 4X34A 2K2VA 3C95A 1VQKQ 2FPFA 4JUVA 5CR2A 2JN0A 2A08A 1JXOA 3OA6A 2QI2A 1AZEA 4J7FA 1U5SA 3MP8A 2NYSA 3RUXA 4KUIA 2Y4XA 2JT4A 2LT4A 3J80E 2CH4A 4Q5WA 4RMOA 3MCAB 2YUPA 3OMGA 4OGCA 1VQ7Q 3MO8A 2D9TA 4PFPA 1WIEA 2GTJA 3VS2A 4C0DB 2RHXA 4C8QD 3G71A 3H8ZA 1Q86U 2YRVA 4EIKA 3EGXB 3CC7T 2OAWA 3S6WA 3CQTA 2YLCA 4PLIA 4EMGA 4E7HA 4QVDA 5GJVB 4PJOC 2QDYB 3A8MB 1K9MR 1S72T 2CDTA 3SB2A 1OULA 3V7RA 4R0KA 4OMMA 1TUCA 3VUZA 5DM7R 2L3RA 2NUTA 3I35A 3G71T 4KULA 1W2BA 1GCQA 2YXYA 3RMSA 5GANf 2MWPA 3CMAT 3EG2A 3E1SA 3VJPA 2DL4A 4OB1B 4EMHA 4FYVB 1CKBA 1WHJA 1KQSP 4J5YA 4J9EA 1QVGS 4M75E 4IIMA 2RN8A 4X9CA 1LJOA 2AIRB 2RI3A 2A36A 1YJWA 4NOYA 2PU9B 1YITT 1YHQQ 2GBQA 3NTIA 3SD4A 1OPLA 3A1PA 3GF5A 4O5VA 1U3OA 4LD9K 2PVGB 4M78C 2CT3A 4M7DB 1VYUA 3CMEQ 2CKKA 3CCUQ 5GMKi 3UT1A 3FB9A 1IHVA 2V8KA 5A0LA 2CP3A 2EQUA 3FRNA 1W1FA 4PJMA 1SRLA 4CC2A 4C92G 1VQMT 5KYXA 1VQ4A 2KR3A 3V7CA 2E5KA 2DIGA 1VYVA 2EW3A 1YI2A 1TWBA 2V1QA 3HPWA 4Z88A 4QW2A 2A37A 2KRNA 3EHQA 1FWZA 3X28B 5FU7C 2L0AA 1H641 3M53A 4IUPA 3H0IA 1WHHA 3CCET 3EGUA 1M1KC 3LWIA 1AD5A 4F16A 4E7ZA 3OYFA 3O8VA 5AT1B 1VQ6A 5GAN8 4EMKC 4C0ZA 3VRYA 4F7UB 1N8RU 1YIJT 1JJ2A 1Q95G 4HCCA 1UB4A 3S3NA 5GAN5 1ZA1B 4XU3A 2KNBB 3FJ5A 2L3SA 4X1VA 4M75A 3M0SA 3MPUB 4OMPA 2QK0A 3V8KA 2PVOB 3EG9A 1RAFB 1VQ9T 2FG0A 3WVDB 1YJNT 3A98A 3BDLA 1VQPQ 4JS5A 4A53A 1SHFA 1NZ9A 2KRSA 2F1LA 2K5FA 1JBMA 1PCXA 3CPWS 3NGPA 3JCMe 3S3MA 2COZA 3CMEA 3H0HA 1Q81R 5DLOA 1KFZA 1KC8U 2JZ2A 2O31A 2M1HA 2FYKA 1SSHA 3RIRA 3JSCA 1VQ4Q 3CD6T 2JOYA 3G1JA 2RQRA 4PJOD 1I5OB 3TSZA 1H3HA 1ZA2B 1E7OA 4Z8AA 3S3OA 1D1CA 4F7UA 3RDVA 1PSFA 2CZ1B 3LGLA 4ZTJA 3M0UA 4AMCA 3E9GA 1P92A 1M27C 2K9GA 4C5IA 2PQWA 4RTYA 1X6GA 4PK4A 2K3XA 1YFNA 3A5ZB 2CZ6B 1Q7YR 2EYZA 3PTAA 4FIBA 3QWXX 4L6V5 3OW2S 1VIFA 2AT1B 4RTVA 1UGVA 2QA4Q 2QQ9A 4OMNA 2FZGB 1NPRA 4KUDK 1SSFA 5GAN2 4JJNK 2KSSA 4M4ZA 4O6JA 1SG5A 2JS0A 2JUFA 1LCKA 2EKOA 1MUZA 4E47A 2OTJA 3EG0A 1VQPA 2HMAA 2FRYA 3M0QA 5LJ5f 1WA7A 4KH0B 2DBKA 1YJ9A 4PJOB 2FL7A 2HL5C 1WZOA 3I55T 1M1GA 2XICA 2DXUA 4C8QE 3EFRA 3JCMX 4LDYA 4FSSA 1NPPA 1PG5B 1LPLA 1TXQA 2RI2A 3BFMA 2ABLA 4F04B 2KYBA 1GFCA 4PFOA 2AZVA 2YUOA 5LJ5e 1B34B 3VS0A 2LTOA 4C8QB 1OX9A 2JS2A 1WJRA 3I56A 3SHWA 4OGEA 4A54A 1Y57A 1IRXA 3L2QA 4FSXA 2E70A 4ELYC 2FZCB 3V7SA 2BZXA 3PIOA 2DPPB 2RHUA 3FC3A 2LQ8A 4B9WA 3CC4Q 2BTTA 3R6OA 5LJ3e 1K73U 2LNHB 1I8FA 3QKJA 1N9RA 2YWWA 2DERA 3LYIA 4BI3A 1U1SA 4M7AB 5GAMg 1OX8A 2MF2A 4HCZA 4DEYA 5IHKA 5DLQE 3FJPA 3G6ET 1IB8A 4J9DA 1Q81U 1OV3A 4M75D 1QCOA 1BI2A 2E5QA 1BK2A 4L59A 3GBQA 3C94A 2CREA 2MMPA 5CAIA 3THKA 3QDFA 2LQNA 2O9VA 5IXFA 3HP9A 4R55A 5CQYA 4YTLA 1VQKA 3TU4K 2VGMA 3HRTA 3OS1A 1K0XA 3CCEQ 3JCMc 4ESRA 3G4SQ 2X3XD 3BE3A 5EC7A 2ED0A 2KQWA 1TUDA 2QTXA 3KBGA 4RTTA 3CC2A 1QCFA 4B6MA 3JCMf 5KE3A 2VWFA 2P0KA 1MMAA 3EHRA 2G6FX 1Y96B 3ZFJA 1VQNT 1VQ4T 2X4YA 1IZ6A 2QQAA 3F70A 3CXCS 4N4IA 3PNWC 5LJ5h 3RBBB 3HHTB 4J6XA 4RTWA 2HKNA 3CXCP 1WHLA 3MEUA 4V2SA 2OTLT 2KAFA 5CK9A 6AT1B 4C0GA 4F14A 1TH7A 2MYSA 3M57A 4N0AC 5HY6A 2JM8A 1OU8A 1OU9A 4GBQA 2CZ0B 3CCVT 5I11A 2DMOA 5FWBA 4M78G 5LJ3h 1R77A 4JPBW 4L5GA 2LDMA 5J3BA 3M0RA 3CMAQ 3J81E 2CS7A 3OYMA 2K3YA 5KH6A 2WACA 4C8QC 1PD0A 5LJ5g 4XTYA 2R57A 4C92C 5IH2A 2EWNA 3GPLA 1QKWA 1TUGB 1WJQA 3NHNA 4M77E 3TREA 4PJOE 3E2UA 1KHCA 1MMDA 2K5IA 2KXCA 2LT1A 2G3RA 2A7YA 2X4JA 2E4HA 2NUPB 3OYYA 2EQJA 1ABQA 4NL3A 1K9MC 4AFUC 5LJ3g 2ZGWA 3DKMA 3OY9A 5A0GA 3VS7A 1AVZC 1NJIR 3UWNA 4J9HA 1W6XA 1ZBJA 1ZUKA 4PJLA 4J9GA 4M77C 1YJWT 1WJSA 3CCVA 2HNIA 4KT0E 4CRIA 1X6BA 2EYXA 4KGVB 5DY9A 2XK0A 3JB9J 4FT4A 4ZGDB 1KG1A 2X4XA 1VQKT 5CKHA 1Q7YC 2O2OA 2YRCA 2DM1A 4XTVA 4OMOA 4JRIA 1Y0MA 3PMTA 2QGFB 2R5AA 3IQLA 4JS4A 1CKAA 1RAIB 3M54A 4OMFB 1VQPT 2GNCA 4X9DA 3JCMb 1WXTA 2HBWA 3MEWA 1X69A 2RHIA 2VASA 4F7UG 2X3WD 4IUQA 1B34A 3I9QA 2DEQA 3VS1A 4OB2B 3CD6Q 4JLIA 1BI1A 1D09B 3QWYA 1R0BG 4FW2A 3OYEA 3EG9B 5GAMh 4PL6A 3H6ZA 4HT9A 2HQHA 1WNLA 2RK2A 1WQWA 1PKTA 1UDLA 4QKUA 3SWNB 1UFFA 1VQLQ 1JEGA 1PKSA 3G6EQ 1FX7A 1PRLC 3QHSA 2DK3A 1IGQA 5KYNA 5HK3A 3LW5E 1KJWA 1X2KA 1Q81C 1AT1B 2WSCE 3QXEB 3CCRT 4P5NA 1M4ZA 2DVJA 1WPYA 3ASKA 1GCQC 4BI8B 2KE9A 2KMTA 2KXDA 4M78A 4LE9A 4AFSC 1M3CA 1FXXA 1VQOA 3EGDA 1ARKA 4M7AE 3OBWA 2B8AA 1QW1A 5GANd 4LNPA 2RQUA 4DA4A 1QQJA 1M3AA 5FU6C 4GLKA 2J6KA 3GOXA 1Y7XA 2K2MA 8AT1B 3P8DA 4FW1A 1WYXA 2FZKB 4MMKA 1QWEA 2RD1A 2QA4T 3VS4A 2L89A 1VQ8T 3CC2T 3FIFA 4M78E 4LDUA 2MOXA 2RJFA 2CYZB 4PNOA 3RKXA 1TU0B 4A4KA 1YBYA 2XDBA 3FLGA 1JRIA 3CBMA 3CCMA 1CSKA 1AWOA 1HD3A 2L8DA 1ZQ1A 2CH4W 2W0ZA 3JCMP 3GNGA 4JRPA 3A8HB 4M7DF 1PNJA 1YCYA 2WSFE 4DBHA 1X27A 4ORZA 3ULRB 2XDDA 1RUWA 5IAYA 2JJ9A 3REBB 2YDLA 2AKLA 4ZGEB 1UJ0A 2VC8A 1OEBA 2E41A 1ACMB 3L42A 1JQQA 2AHJB 4OVAA 1Q82C 1W2BS 4FM4B 2L3PA 2R58A 2RB6A 3QUIA 2OJ2A 4HVUA 2IG0A 1RLPC 2VYTA 2M51A 4C5EA 3EFSA 2JXBA 4OB0B 1FMWA 2MK5A 3CPWP 1PRMC 1IO6A 4RTUA 2YT6A 4XTWA 2ESWA 5CKEA 1RI0A 3I56T 3X26B 2GTOA 4PJOF 2ED1A 2MIOA 3QO3A 2HL3A 3VKIA 4HCBA 2E10A 2DTOA 4MZMA 1WGSA 2EQMA 4N4GA 5CKBA 1RL2A 1WDXA 3CD6A 1I81A 3G4ST 4BDYA 3TSWA 3MP1A 1UJYA 4RUGA 1N9SA 4JDSA 4C92D 5J39A 5GANe 1MHNA 3OSSC 2ZZDA 1M30A 2DD4A 1M1FA 3G6EA 1K8AR 4C0DC 1UGPB 5FWCA 1Q82R 3LWHA 2DIQA 2DL8A 2JMCA 1K0SA 3VYGA 3CCLA 3SFMA 3QJYA 4C92F 1EX4A 4CC4B 2JTEA 1QWFA 1YITA 2CGHA 3CCSA 1BU1A 1X6OA 2DXBA 1GBQA 1KD1U 1VQLA 4M7AA 2RMOA 4QQDA 5CO7A 4OB3B 2DJZA 1UGQB 5GAMd 1Z9ZA 5KYYB 2DJQA 2GFAA 4M78D 1C1AA 3CCST 3VUBA 1TOVA 4A4FA 3FDRA 2L2PA 2RHZA 4C0FA 5L8RE 2LRQA 1SPKA 3LH5A 4OMLA 5HKCA 2KYMA 2P0QA 1E6HA 1N27A 2KGTA 2XG8D 2Z0WA 5GAMe 1YJ9T 2DL3A 1M2OA 2RK1A 1VYTA 3CCQA 3M4YA 3UPUA 5GAOm 4XQ3A 2HAXA 2J05A 2EVRA 1VQMA 2KDSA 2O01E 4J6YA 4NL2A 1D0YA 3CC4T 2HKQB 1M2VB 3G4SA 4J83A 3TQ7P 3CCRA 2KI7A 1IHWA 5FROA 3CCJA 4XTXA 2ROTA 2DYIA 2LJ0A 2RHYA 2XKOC 3E9FA 2LC4A 3OYBA 2PZ1A 2RA2A 3M9QA 1EFNA 1VQOQ 1AWXA 2CUDA 4PLLA 1WQ7A 2C0IA 2QTVA 1M8MA 4RCBA 4M7AD 4ELZC 1U1TA 4Y92A 4AG1C 4M77D 2YSQA 2EGAA 1OI1A 3CCQQ 2L5QA 2GQIA 5GAMf 2M0OA 1D0ZA 2KBTA 2BZ8A 3CCUA 1Y71A 1VQ8A 3NTKA 3URGA 5EG2A 1NYFA 2ROLA 3CMET 2RQWA 3RMQA 4F7UE 3CCUT 4FCYA 2JW4A 1RADB 2J6FA 1IGUA 1MNEA 1GRIA 3ER0A 1UE9A 4GLMA 4VUBA 3EH2A 1KQ1A 4PKCC 2Y4YA 5GAOp 3CC7A 2HEQA 2RM4A 3I56Q 4A4EA 1MMNA 1BI0A 2KT8A 1YJNA 1M1KU 2XDPA 3SWNC 1X01A 1FYNA 2M02A 1VQ6Q 3OYCA 3E19A 3OW2P 1N8RC 3CCJT 3QG1A 3UA6A 3EFOA 1NJIU 1GL5A 1R8OB 3PVLA 2D8HA 1IXDA 1R0CB 2OI3A 1N8RR 1ZLMA 3HSBA 4J9FA 4M75C 4M7DD 1W2BP 4XTUA 3V8LA 4BE1A 4C8QA 3M56A 3QYHB 5C0MA 2KEAA 5I2MA 5LJ3d 2PVDB 3G71Q 1TS9A 3C12A 4AFZC 1YWOA 1VQ8Q 3ME9A 1H8KA 3EAEA 1O75A 4E7KA 4HVWA 2FHDA 2DBMA 1G8XA 1S72Q 3ZL7C 4KRTA 1KHIA 2E3HA 4XU2A 1PWTA 2QQSA 4C92B 1G3SA 1ZSZC 2KRMA 4JZ3A 1UECA 3M55A 3PIPA 1NE8A 2LJ1A 2DZCA 4QQGA 4UC4A 4BI4A 2JTFA 1I4K1 5CCAA 2J7IA 3RKYA 2NWMA 2X9HA 3M0TA 1GXIE 2D0QB 2ZPGB 4OMQA 5IXBA 1G83A 2DL5A 3L2VA 1RACB 2OTLA 1Q86R 3OBYA 1TSFA 1QVFS 5D7UA 3GIBA 4IKFA 3J7AF 3VV0A 2MWOA 1OZ3A 3TCJA 4M75F 3L2RA 1NYGA 2YUQA 2GF7A 2LQKA 4J9CA 4DBQA 1C0MA 2DTIA 1W70A 4E7IA 2QQRA 2ZPFB 1OYXA 3QYGB 5A2QE 4KGXB 1M8VA 2LCLA 1VQOT 1KD1R 5J26A 2LQWA 2DX1A 5GANg 7AT1B 1XQHA 2FPDA 3PE0A 2YHTA 3OYNA 1K1ZA 1VQ9A 2KK4A 3L2WA 4M77F 2AKKA 4JJCA 3VU3C 1TG0A 2CSIA 3JB9H 4PJJA 4XK8E 2LX7A 1YCSB 4QQ6A 1NEBA 1T0HA 2DL7A 2CZ7B 2VVKA 2BZYA 2EAYA 4KGZB 1QMCA 1YI2T 3SDZA 4E6RA 3ZEHA 4RG8A 3DB3A 1X43A 2DAQA 1YIJQ 1PSEA 3C4SA 3CC4A 1N6AA 1JJ2P 2EJ9A 3JB9G 1M90R 3CCRQ 2VV5A 2VXFA 3RKWA 1NEGA 2ECZA 3PVQA 1VQ9Q 1D1AA 2C0TA 4M77B 4OF1A 1U8RA 2ZPIB 2H3JA 4AFQC 1BCMA 4MMLA 3KFVA 2SEMA 1HYOA 2HQEA 1RAAB 3NMZC 4IUVA 1VQNA 2FVUA 3JCMV 5KYWA 2D0NA 5ECAA 2PNIA 2DTHA 4JLGA 5KYUB 5FRMA 1RAHB 1TTHB 1D1BA 4HCKA 1GCPA 4MZTA 4DEXA 3SEMA 4IURA 5GAN3 4N0AA 3D7SB 1YHQA 2GGRA 1K8AC 3BDUA 1OZ2A 9ATCB 2DILA 3OYLA 3JRZA 4PJOA 4WF2A 5LJ3f 5GMKj 2EQIA 4XTZA 3DLMA 3JCMd 4JJBA 3OYGA 1VOMA 4K11A 5LL6S 4KH1B 1JB0E 2QEXA 3OQ5A 2VXEA 2XMFA 2RJDA 4J9BA 3OB9A 4EDUA 1RAGB 5D6WA 2HD0A 4D6WA 4DBFA 1BB9A 5FLXE 2KROA 4GY5A 3MEAA 2HBPA 3I5SA 3OS2A 1OQKA 2YUNA 1WHGA 1SHGA 3OS5A 1JXMA 2L3QA 1VQMQ 2MCNA 5CIUA 1W4SA 4C8QG 4F17A 2FO0A 2I0NA 4M7DE 1BIBA 2XIDA 1MGQA 4WCIA 5KCOA 3NFCA 3JCMW 2DLPA 3LGFA 3NTHA 2R5MA 2ZAEA 4M7AF 3H41A 1B3QA 4MZPA 3T9NA 8ATCB 2P84A 1D3BA 2F2XA 5GAN4 3GLXA 1AWJA 4Z89A 2X35A 4FYWB 1U06A 2K6DA 2SRCA 3CCQT 4LXCA 2EIFA 4J8OA 1QLYA 1MV0B 1OOTA 4FYYB 1T3SA 2EYQA 3KXTA 1K9MU 5GANh 4KBMB 3AT1B 3AHUA 1NBEB 2DXCA 3CCMQ 2LCCA 5GMKh 2XHCA 1M1KR 1RI9A 1UG1A 1B07A 2EKHA 2O88A 2ENMA 1G3WA 2VUBA 4RCCA 2QYZA 4MDWA 4M7AG 5GAN6 5LJ5d 1HK9A 4PJNA 4D8KA 2LNVA 3QPHA 3HL8A 2D1XA 4M77A 4M7AC 1WLPB 3OYJA 1NM7A 3JCMh 3UDCA 1YIJA 4ANJA 5A0DA 3QDRB 1PD1A 3V8JA 1YP5A 1ZX6A 5GAN7 1BBZA 2BUDA 2RI5A 2DRKA 1BKBA 3L2ZA 4R56A 2JVVA 2X4WA 3CCEA 1I07A 1KK7A 1RABB 2PUOB 3M5AA 1S1NA 2QA4A 3HFOA 3U23A 5KYXB 2K79A 4XU0A 3OYIA 4LDXA 1ZHIA 3CCSQ 4EPCA 2HQXA 3N5BB 4CC7A 1XTDA 1KC8R 4JZ4A 4LD6A 3DB4A 3WXMB 1UHCA 2DVEA 2D6FA 2FPEA 2RPNA 2DKGA 4AT1B 2DZ9A 3JB9I 2CUBA 2RO0A 4HVVA 1HSQA 5GAOl 3META 1V1CA 3QZ9B 2RF0A 2P0PA 2GCXA 1VUBA 2ZCFB 2XD0A 5GMKe 2BKDN 5IHNA 2Y90A 2E12A 1XOVA 2CP2A 5C6SA 3QBYA 4ZTFA 3OS0A 4LDVA 4JRKA 5KCHA 1LNXA 1QP3A 4BD3A 1UGRB 1LOJA 3I55Q 3LLRA 2RQTA 1AOJA 1QVFA 1KQ2A 4M7DC 5HK0A 4M78B 3X24B 2LZ6B 4ZN1A 1DJ7B 2DFUA 3JB9F 2OX7A 3M4GA 2NUTB 3UA7A 1K8AU 4A4HA 2QEXQ 1UHFA 5CQXA 4DOWA 4ME7A 3EGXA 1XJWB 2MPXC 1N5ZA 1GFDA 2EFIA 2ATCB 2E6NA 4RTZA 1K73C 1B7TA 3VS6A 2DEUA 2RJEA 3MKDA 1WXUA 1G3YA 5IT9E 1K76A 2FRWA 4AG2C 2IIMA 4C5GA 4BE2A 5GMKm 4BY6C 3UATA 2GFUA 1GBRA 4HKEA 1XNIA 1AEYA 4HXJA 5GAMj 4BUGA 1VQ5Q 2XI9A 1WXBA 3JCMJ 1FMKA 4Y28E 2AK5A 2CT4A 2B86A 2OTJQ 4N4HA 2C0OA 5CKFA 2K3BA 1VQNQ 2HDAA 3OYHA 4RTXA 1YWPA 3CCJQ 2E65A 2EJGA 2A28A 2EPDA 3CCLT 4HA8A 5CVIA 3SWNA 3VRZA 4M75G 2QDLA 1S72A 4EMKA 2X51A 3PFSA 1YI2Q 3OW2A 3HFNA 2E64A 1YNZA 4EMKB 1WX6A 2GQVA 5D6YA 4IIOA 1X2QA 4ZN3A 3OYKA 1PM3A 2COYA 2JNGA 1UGSB 3HKSA 2K7AA 1ZUYA 2ZPEB 2JTMA 3OYDA 2EYWA 1QP2A 1NLOC 4DBRA 2QAZA 2EBPA 2HSEB 2LJ3A 3QIIA 1SRMA 4BE0A 4ZNXA 5D6XA 2PTKA 2BE7D 1MV3A 1WI7A 4Y91A 1J3TA 5GAOn 3GP8A 1M90C 1VQLT 4J6WA 4B9XA 2OTLQ 2M9UA 2F5TX 4QT7A 4CC3A 5CKDA 1K4US 3OSVA 2HSPA 4E2FB 2C06A 2KY9A 3EGDB 1EZZB 3MHXA 2QG9B 1Y96A 4C8QF 3BW1A 1M2VA 4M7DA 5GANj 2P4TA 3L1AA 2BE9B 2LP5A 4CI0C 4NS5A 1Y07A 2XU8A 2F5KA 2DXTA 3P8HA 5LJ3j 1X75C 3CPWA 2O9SA 4E7SA 2EJFA 1KD1C 1A0NB 3G7ZA 4XAXB 5FU6B 2ZPBB 2DD5A 2V8IA 3TEEA 2W10A 4JRQA 1QVFP 1M3BA 1WHMA 1D0XA 2M0YA 2K57A 3H0FA 5GMKl 1SKUB 4E7LA 4IUTA 1UTIA 2M16A 3VYHB 1YJWQ 1H3ZA 2H8HA 3X20B 2DETA 5FW9A 2D8JA 1RAEB 2CP5A 2I2LA 3JV3A 5LJ5j 3EG1A 1K9AA 2VB6A 3R6NA 2OAUA 5IN1A 4J7IA 3CC2Q 3RR6A 1NG2A 2VKNA 4OP0A 1QVPA 1VA7A 4FT2A 3OMCA 4Z02A 2P4RA 3I55A 4TVRA 1Q7YU 1E6GA 3Q1JA 3CXCA 5IHIA 4M78F 4ZGJB 1ABOA 2V8JA 3PMIA 2RQVA 2DE0X 4LUEA 3MP6A 1UEBA 2FB7A 4RG2A 2JMAA 2J6OA 2QASA 1AHJB 3RERA 3FEOA 3CBPA 3ZBDA 5GJWB 1F1BB 2A3LA
chains in the Genus database with same CATH topology
2K9GA 1M27C 2L3PA 2OJ2A 4HVUA 1RLPC 4RTYA 1X6GA 2DILA 4LN2A 2M51A 1UUEA 2DRMA 2EYZA 2JXBA 3TVTA 2EQIA 3QWXX 1PRMC 4JJBA 1IO6A 4RTUA 4RTVA 1UGVA 4K11A 2HCKA 2LMJA 2YT6A 4OMNA 2ESWA 2RNAA 5I22A 2XMFA 4J9BA 1KIKA 2GTOA 4M4ZA 2JS0A 2EYYA 1LCKA 1BB9A 1MUZA 2ED1A 2JM9A 2KROA 2MIOA 3EG0A 3I5SA 2CSQA 2FRYA 2YUNA 3M0QA 1WA7A 3REAB 1SHGA 3EG3A 1JXMA 2DBKA 2L3QA 1WDXA 2MCNA 3TSWA 4F17A 2FO0A 1UJYA 2I0NA 4RUGA 1HJDA 4WCIA 5HCKA 4FSSA 1Z9QA 2DLPA 2F2WA 3H41A 1B3QA 1M30A 2ABLA 2KYBA 1GFCA 4D8DA 2AZVA 2YUOA 2DNUA 3VS0A 2JS2A 5FWCA 3SHWA 2DL8A 1PHTA 2JMCA 1K0SA 2NUZA 1Y57A 2DYBA 2F2XA 4CC4B 2JTEA 1QWFA 2BZXA 1BU1A 1YN8A 3O5ZA 1GBQA 2EGCA 1AWJA 4Z89A 1JO8A 2RMOA 1U06A 2K6DA 2SRCA 2BTTA 2LCSA 2LNHB 2FEIA 1Z9ZA 1QLYA 1MV0B 1OOTA 1ZSGA 1T3SA 2DJQA 2KT1A 4A63B 4DEYA 2L2PA 5IHKA 4J9DA 1OV3A 1RI9A 1JU5C 1UG1A 1B07A 1BK2A 3GBQA 2EGEA 2EKHA 2O88A 2CREA 1H92A 1SPKA 1RLQC 2ENMA 3LH5A 4OMLA 1WFWA 3THKA 2KYMA 3VS5A 1E6HA 2KGTA 4D8KA 2LQNA 2O9VA 5IXFA 2D1XA 2DA9A 3NPFA 2DL3A 1WLPB 2DF6A 3RNJA 1NM7A 1I0CA 1K0XA 1VYTA 4ESRA 2X3XD 1YP5A 1ZX6A 1BBZA 5EC7A 2DRKA 2ED0A 1TUDA 2J05A 2EVRA 4RTTA 1QCFA 3M0PA 1I07A 2VWFA 1S1NA 3EHRA 2G6FX 3U23A 2ROTA 2K79A 1AWWA 2LJ0A 3VS3A 4CC7A 3RBBB 4JZ4A 2PZ1A 1EFNA 1AWXA 2CUDA 1UHCA 2F2VA 2C0IA 2FPEA 1M8MA 2RPNA 4RTWA 4Y92A 4AG1C 1T0JA 2AZSA 1ZUUA 2CUBA 1AZGB 1QKXA 2YSQA 4HVVA 1HSQA 2EGAA 2GQIA 4JJDA 4F14A 2KBTA 1V1CA 2BZ8A 2RF0A 1I1JA 2JM8A 2J06A 4GBQA 1NYFA 3UF4A 1G2BA 1SEMA 2DMOA 2ROLA 4J9IA 1NLPC 5I11A 2RQWA 5IHNA 1OPKA 2JW4A 5FWBA 5L23A 3I5RA 1XOVA 2J6FA 4JPBW 3C0CA 1GRIA 3M0RA 1UE9A 4LUDA 4GLMA 2V1RA 1KSWA 2HEQA 2RQTA 1AOJA 1T3LA 2KT8A 2LZ6B 5IH2A 2FPFA 1FYNA 1QKWA 2A08A 1JXOA 3NHNA 1AZEA 1U5SA 3UA7A 3UA6A 1GL5A 2KXCA 1UHFA 2JT4A 3PVLA 2CH4A 2D8HA 1N5ZA 2YUPA 1GFDA 2OI3A 4RTZA 1ZLMA 3VS6A 1WIEA 4J9FA 2GTJA 3VS2A 1ABQA 1WXUA 4AFUC 1K76A 2FRWA 4AG2C 2IIMA 4EIKA 2OAWA 3VS7A 2KEAA 3CQTA 3UATA 1GBRA 1AVZC 4J9HA 5GJVB 1W6XA 1ZBJA 1ZUKA 1AEYA 4HXJA 4J9GA 1WXBA 2CDTA 1FMKA 4AFZC 2AK5A 2CT4A 4R0KA 1YWOA 2B86A 1X6BA 2EYXA 4OMMA 1TUCA 1H8KA 2O2OA 3I35A 2DM1A 2C0OA 4HVWA 1Y0MA 4OMOA 1GCQA 2DBMA 3IQLA 2K3BA 1CKAA 3ZL7C 4KRTA 2HDAA 2GNCA 1PWTA 4RTXA 1YWPA 1WXTA 2HBWA 3EG2A 1X69A 2A28A 2EPDA 2X3WD 3VRZA 2KRMA 4JZ3A 2QDLA 1UECA 2DL4A 3I9QA 3VS1A 2LJ1A 1CKBA 4J9EA 1YNZA 4IIMA 2RN8A 1WX6A 3QWYA 2J7IA 4IIOA 1X2QA 2A36A 2NWMA 3M0TA 2GBQA 1PKTA 1UDLA 2K7AA 4OMQA 1ZUYA 5IXBA 1OPLA 1G83A 1U3OA 2EYWA 1UFFA 2CT3A 1NLOC 1VYUA 2EBPA 2DL5A 1JEGA 2LJ3A 1SRMA 1PKSA 1PRLC 4ZNXA 2PTKA 1MV3A 1WI7A 1J3TA 1W1FA 1SRLA 4CC2A 1NYGA 2YUQA 1KJWA 4J9CA 1X2KA 1W70A 2KR3A 2E5KA 1VYVA 2EW3A 4QT7A 4CC3A 2V1QA 1K4US 2DVJA 2HSPA 4Z88A 2A37A 2KRNA 3EHQA 1GCQC 2LQWA 2DX1A 2KE9A 2KXDA 2L0AA 4LE9A 4AFSC 1M3CA 2FPDA 3H0IA 3PE0A 3EGUA 1ARKA 1K1ZA 1AD5A 4F16A 4LNPA 2AKKA 4JJCA 1TG0A 2CSIA 2RQUA 2LP5A 3VRYA 2LX7A 1YCSB 1M3AA 1NEBA 2J6KA 1T0HA 2DL7A 2K2MA 2O9SA 2VVKA 2KNBB 1A0NB 1WYXA 2BZYA 1QWEA 3FJ5A 2L3SA 2W10A 3M0SA 4X1VA 3VS4A 1M3BA 4OMPA 2M0YA 4E6RA 3H0FA 1X43A 1UTIA 2FG0A 2H8HA 3A98A 2MOXA 5FW9A 2D8JA 3JV3A 1NEGA 1SHFA 3EG1A 1K9AA 2ECZA 2KRSA 3PVQA 3R6NA 3NGPA 2C0TA 1CSKA 3H0HA 1AWOA 1HD3A 1NG2A 1KFZA 2VKNA 4AFQC 2CH4W 2O31A 1SSHA 2W0ZA 3KFVA 1VA7A 2SEMA 3NMZC 1PNJA 2P4RA 2RQRA 1X27A 2D0NA 4ORZA 3TSZA 3ULRB 1E6GA 1H3HA 1RUWA 5ECAA 5IHIA 1E7OA 4Z8AA 2PNIA 1ABOA 3REBB 2RQVA 2DE0X 4LUEA 2YDLA 2AKLA 1UJ0A 4HCKA 1GCPA 1OEBA 2JMAA 2J6OA 4DEXA 3SEMA 3M0UA 1JQQA 5GJWB 2GGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K9G A;  1M27 C;  2L3P A;  2OJ2 A;  4HVU A;  1RLP C;  4RTY A;  1X6G A;  2DIL A;  4LN2 A;  2M51 A;  1UUE A;  2DRM A;  2EYZ A;  2JXB A;  3TVT A;  2EQI A;  3QWX X;  1PRM C;  4JJB A;  1IO6 A;  4RTU A;  4RTV A;  1UGV A;  4K11 A;  2HCK A;  2LMJ A;  2YT6 A;  4OMN A;  2ESW A;  2RNA A;  5I22 A;  2XMF A;  4J9B A;  1KIK A;  2GTO A;  4M4Z A;  2JS0 A;  2EYY A;  1LCK A;  1BB9 A;  1MUZ A;  2ED1 A;  2JM9 A;  2KRO A;  2MIO A;  3EG0 A;  3I5S A;  2CSQ A;  2FRY A;  2YUN A;  3M0Q A;  1WA7 A;  3REA B;  1SHG A;  3EG3 A;  1JXM A;  2DBK A;  2L3Q A;  1WDX A;  2MCN A;  3TSW A;  4F17 A;  2FO0 A;  1UJY A;  2I0N A;  4RUG A;  1HJD A;  4WCI A;  5HCK A;  4FSS A;  1Z9Q A;  2DLP A;  2F2W A;  3H41 A;  1B3Q A;  1M30 A;  2ABL A;  2KYB A;  1GFC A;  4D8D A;  2AZV A;  2YUO A;  2DNU A;  3VS0 A;  2JS2 A;  5FWC A;  3SHW A;  2DL8 A;  1PHT A;  2JMC A;  1K0S A;  2NUZ A;  1Y57 A;  2DYB A;  2F2X A;  4CC4 B;  2JTE A;  1QWF A;  2BZX A;  1BU1 A;  1YN8 A;  3O5Z A;  1GBQ A;  2EGC A;  1AWJ A;  4Z89 A;  1JO8 A;  2RMO A;  1U06 A;  2K6D A;  2SRC A;  2BTT A;  2LCS A;  2LNH B;  2FEI A;  1Z9Z A;  1QLY A;  1MV0 B;  1OOT A;  1ZSG A;  1T3S A;  2DJQ A;  2KT1 A;  4A63 B;  4DEY A;  2L2P A;  5IHK A;  4J9D A;  1OV3 A;  1RI9 A;  1JU5 C;  1UG1 A;  1B07 A;  1BK2 A;  3GBQ A;  2EGE A;  2EKH A;  2O88 A;  2CRE A;  1H92 A;  1SPK A;  1RLQ C;  2ENM A;  3LH5 A;  4OML A;  1WFW A;  3THK A;  2KYM A;  3VS5 A;  1E6H A;  2KGT A;  4D8K A;  2LQN A;  2O9V A;  5IXF A;  2D1X A;  2DA9 A;  3NPF A;  2DL3 A;  1WLP B;  2DF6 A;  3RNJ A;  1NM7 A;  1I0C A;  1K0X A;  1VYT A;  4ESR A;  2X3X D;  1YP5 A;  1ZX6 A;  1BBZ A;  5EC7 A;  2DRK A;  2ED0 A;  1TUD A;  2J05 A;  2EVR A;  4RTT A;  1QCF A;  3M0P A;  1I07 A;  2VWF A;  1S1N A;  3EHR A;  2G6F X;  3U23 A;  2ROT A;  2K79 A;  1AWW A;  2LJ0 A;  3VS3 A;  4CC7 A;  3RBB B;  4JZ4 A;  2PZ1 A;  1EFN A;  1AWX A;  2CUD A;  1UHC A;  2F2V A;  2C0I A;  2FPE A;  1M8M A;  2RPN A;  4RTW A;  4Y92 A;  4AG1 C;  1T0J A;  2AZS A;  1ZUU A;  2CUB A;  1AZG B;  1QKX A;  2YSQ A;  4HVV A;  1HSQ A;  2EGA A;  2GQI A;  4JJD A;  4F14 A;  2KBT A;  1V1C A;  2BZ8 A;  2RF0 A;  1I1J A;  2JM8 A;  2J06 A;  4GBQ A;  1NYF A;  3UF4 A;  1G2B A;  1SEM A;  2DMO A;  2ROL A;  4J9I A;  1NLP C;  5I11 A;  2RQW A;  5IHN A;  1OPK A;  2JW4 A;  5FWB A;  5L23 A;  3I5R A;  1XOV A;  2J6F A;  4JPB W;  3C0C A;  1GRI A;  3M0R A;  1UE9 A;  4LUD A;  4GLM A;  2V1R A;  1KSW A;  2HEQ A;  2RQT A;  1AOJ A;  1T3L A;  2KT8 A;  2LZ6 B;  5IH2 A;  2FPF A;  1FYN A;  1QKW A;  2A08 A;  1JXO A;  3NHN A;  1AZE A;  1U5S A;  3UA7 A;  3UA6 A;  1GL5 A;  2KXC A;  1UHF A;  2JT4 A;  3PVL A;  2CH4 A;  2D8H A;  1N5Z A;  2YUP A;  1GFD A;  2OI3 A;  4RTZ A;  1ZLM A;  3VS6 A;  1WIE A;  4J9F A;  2GTJ A;  3VS2 A;  1ABQ A;  1WXU A;  4AFU C;  1K76 A;  2FRW A;  4AG2 C;  2IIM A;  4EIK A;  2OAW A;  3VS7 A;  2KEA A;  3CQT A;  3UAT A;  1GBR A;  1AVZ C;  4J9H A;  5GJV B;  1W6X A;  1ZBJ A;  1ZUK A;  1AEY A;  4HXJ A;  4J9G A;  1WXB A;  2CDT A;  1FMK A;  4AFZ C;  2AK5 A;  2CT4 A;  4R0K A;  1YWO A;  2B86 A;  1X6B A;  2EYX A;  4OMM A;  1TUC A;  1H8K A;  2O2O A;  3I35 A;  2DM1 A;  2C0O A;  4HVW A;  1Y0M A;  4OMO A;  1GCQ A;  2DBM A;  3IQL A;  2K3B A;  1CKA A;  3ZL7 C;  4KRT A;  2HDA A;  2GNC A;  1PWT A;  4RTX A;  1YWP A;  1WXT A;  2HBW A;  3EG2 A;  1X69 A;  2A28 A;  2EPD A;  2X3W D;  3VRZ A;  2KRM A;  4JZ3 A;  2QDL A;  1UEC A;  2DL4 A;  3I9Q A;  3VS1 A;  2LJ1 A;  1CKB A;  4J9E A;  1YNZ A;  4IIM A;  2RN8 A;  1WX6 A;  3QWY A;  2J7I A;  4IIO A;  1X2Q A;  2A36 A;  2NWM A;  3M0T A;  2GBQ A;  1PKT A;  1UDL A;  2K7A A;  4OMQ A;  1ZUY A;  5IXB A;  1OPL A;  1G83 A;  1U3O A;  2EYW A;  1UFF A;  2CT3 A;  1NLO C;  1VYU A;  2EBP A;  2DL5 A;  1JEG A;  2LJ3 A;  1SRM A;  1PKS A;  1PRL C;  4ZNX A;  2PTK A;  1MV3 A;  1WI7 A;  1J3T A;  1W1F A;  1SRL A;  4CC2 A;  1NYG A;  2YUQ A;  1KJW A;  4J9C A;  1X2K A;  1W70 A;  2KR3 A;  2E5K A;  1VYV A;  2EW3 A;  4QT7 A;  4CC3 A;  2V1Q A;  1K4U S;  2DVJ A;  2HSP A;  4Z88 A;  2A37 A;  2KRN A;  3EHQ A;  1GCQ C;  2LQW A;  2DX1 A;  2KE9 A;  2KXD A;  2L0A A;  4LE9 A;  4AFS C;  1M3C A;  2FPD A;  3H0I A;  3PE0 A;  3EGU A;  1ARK A;  1K1Z A;  1AD5 A;  4F16 A;  4LNP A;  2AKK A;  4JJC A;  1TG0 A;  2CSI A;  2RQU A;  2LP5 A;  3VRY A;  2LX7 A;  1YCS B;  1M3A A;  1NEB A;  2J6K A;  1T0H A;  2DL7 A;  2K2M A;  2O9S A;  2VVK A;  2KNB B;  1A0N B;  1WYX A;  2BZY A;  1QWE A;  3FJ5 A;  2L3S A;  2W10 A;  3M0S A;  4X1V A;  3VS4 A;  1M3B A;  4OMP A;  2M0Y A;  4E6R A;  3H0F A;  1X43 A;  1UTI A;  2FG0 A;  2H8H A;  3A98 A;  2MOX A;  5FW9 A;  2D8J A;  3JV3 A;  1NEG A;  1SHF A;  3EG1 A;  1K9A A;  2ECZ A;  2KRS A;  3PVQ A;  3R6N A;  3NGP A;  2C0T A;  1CSK A;  3H0H A;  1AWO A;  1HD3 A;  1NG2 A;  1KFZ A;  2VKN A;  4AFQ C;  2CH4 W;  2O31 A;  1SSH A;  2W0Z A;  3KFV A;  1VA7 A;  2SEM A;  3NMZ C;  1PNJ A;  2P4R A;  2RQR A;  1X27 A;  2D0N A;  4ORZ A;  3TSZ A;  3ULR B;  1E6G A;  1H3H A;  1RUW A;  5ECA A;  5IHI A;  1E7O A;  4Z8A A;  2PNI A;  1ABO A;  3REB B;  2RQV A;  2DE0 X;  4LUE A;  2YDL A;  2AKL A;  1UJ0 A;  4HCK A;  1GCP A;  1OEB A;  2JMA A;  2J6O A;  4DEX A;  3SEM A;  3M0U A;  1JQQ A;  5GJW B;  2GGR A; 
#chains in the Genus database with same CATH topology
 2H3E B;  1FMV A;  4MDX A;  1O9S A;  2CP7 A;  1VQ5 T;  5FU7 B;  2KVQ G;  4LN2 A;  1UUE A;  1PC0 A;  1SF9 A;  2DRM A;  3JCM g;  1JJ2 S;  5M9O A;  1M5Q 1;  4A4G A;  3TVT A;  4FYX B;  2CP0 A;  1BI3 A;  3LH0 A;  5I2S A;  3BY7 A;  2MI6 A;  1Q86 C;  4BY6 B;  2HCK A;  2LMJ A;  2RNA A;  5I22 A;  1M9S A;  2O4X B;  1KIK A;  1EIF A;  5FRN A;  2EYY A;  3L2U A;  2JM9 A;  3QSU A;  2COW A;  4E7J A;  2QGG A;  2QQB A;  3A8G B;  4WTO B;  2CSQ A;  1V29 B;  3H9N A;  3REA B;  3EG3 A;  2YRD A;  3WVE B;  3RES A;  1KQS S;  2OTJ T;  1QVG P;  3JAM E;  4HT8 A;  3QZ5 B;  1HJD A;  2O4X A;  1VQ7 T;  1BYM A;  2DO3 A;  5HCK A;  2VGN A;  5KYY A;  1Z9Q A;  1G3T A;  1LVK A;  2F2W A;  1K73 R;  2HZY A;  5KYU A;  4D8D A;  2DNU A;  3CC7 Q;  3LX7 A;  3CPF A;  3M58 A;  1PHT A;  5KE2 A;  2NUZ A;  3CBO A;  2DYB A;  3INZ A;  1MND A;  3CEY A;  2EQK A;  3PGG A;  1YN8 A;  3O5Z A;  2EGC A;  1NJI C;  1JO8 A;  3OYA A;  2ZPH B;  2LCS A;  1D3B B;  1YHQ T;  1YIT Q;  4FU6 A;  2FEI A;  1VQ6 T;  1ZSZ A;  1ZSG A;  2KT1 A;  2K4Y A;  2PUK B;  4PJO G;  4A63 B;  1QVG A;  2CP6 A;  3PT9 A;  4C92 E;  1ZBX A;  4BDZ A;  1JU5 C;  2A0F B;  4C5H A;  2EGE A;  1H92 A;  5I21 A;  1V76 A;  1RLQ C;  3HRS A;  5GAO r;  1WFW A;  3VS5 A;  1M90 U;  2NUP A;  1WHK A;  2K5L A;  4QVZ A;  4BAC A;  2DA9 A;  4RKU E;  3NPF A;  2DF6 A;  1MMG A;  3RNJ A;  1I0C A;  3EH1 A;  2LX9 A;  3CCV Q;  2E3I A;  3JB9 D;  2NLU A;  1QCN A;  3A8L B;  1KQS A;  1YJ9 Q;  2V26 A;  4DOV A;  1Q82 U;  4C92 A;  3M0P A;  2E1H A;  3HTR A;  2QEX T;  1VQ7 A;  2YLB A;  1AWW A;  4FL6 A;  2F69 A;  4QVC A;  1C6V X;  3MJX A;  1ZSZ B;  1HXD A;  2LVM A;  3VS3 A;  4DQ2 A;  1BCO A;  3CCM T;  3JCM Q;  4F7U F;  5AYF A;  2IPO B;  4M7D G;  2F2V A;  3EFO B;  3A8O B;  1T0J A;  1VIE A;  1ZUU A;  2AZS A;  3X25 B;  1AZG B;  1QKX A;  5GAO q;  1IRE B;  2MAM A;  1YJN Q;  1KC8 C;  1VQ5 A;  2IVW A;  4ATO A;  4JJD A;  3M59 A;  1I1J A;  3CMA A;  2J06 A;  3KUF A;  4II1 A;  3UF4 A;  2QXF A;  1G2B A;  1SEM A;  3QJ6 A;  4J9I A;  3P8B B;  1NLP C;  3HRU A;  4BB7 A;  5KYW B;  1I5L A;  2WSE E;  1OPK A;  1G5V A;  3GNF B;  5L23 A;  3I5R A;  4XU1 A;  3C0C A;  4IUU A;  4LUD A;  2BIV A;  3CCL Q;  4PFZ A;  4M75 B;  3MEV A;  2V1R A;  1KSW A;  2E6Z A;  4LDW A;  3DLL A;  2RH2 A;  1BIA A;  1T3L A;  2RJC A;  4M77 G;  4X34 A;  2K2V A;  3C95 A;  1VQK Q;  2FPF A;  4JUV A;  5CR2 A;  2JN0 A;  2A08 A;  1JXO A;  3OA6 A;  2QI2 A;  1AZE A;  4J7F A;  1U5S A;  3MP8 A;  2NYS A;  3RUX A;  4KUI A;  2Y4X A;  2JT4 A;  2LT4 A;  3J80 E;  2CH4 A;  4Q5W A;  4RMO A;  3MCA B;  2YUP A;  3OMG A;  4OGC A;  1VQ7 Q;  3MO8 A;  2D9T A;  4PFP A;  1WIE A;  2GTJ A;  3VS2 A;  4C0D B;  2RHX A;  4C8Q D;  3G71 A;  3H8Z A;  1Q86 U;  2YRV A;  4EIK A;  3EGX B;  3CC7 T;  2OAW A;  3S6W A;  3CQT A;  2YLC A;  4PLI A;  4EMG A;  4E7H A;  4QVD A;  5GJV B;  4PJO C;  2QDY B;  3A8M B;  1K9M R;  1S72 T;  2CDT A;  3SB2 A;  1OUL A;  3V7R A;  4R0K A;  4OMM A;  1TUC A;  3VUZ A;  5DM7 R;  2L3R A;  2NUT A;  3I35 A;  3G71 T;  4KUL A;  1W2B A;  1GCQ A;  2YXY A;  3RMS A;  5GAN f;  2MWP A;  3CMA T;  3EG2 A;  3E1S A;  3VJP A;  2DL4 A;  4OB1 B;  4EMH A;  4FYV B;  1CKB A;  1WHJ A;  1KQS P;  4J5Y A;  4J9E A;  1QVG S;  4M75 E;  4IIM A;  2RN8 A;  4X9C A;  1LJO A;  2AIR B;  2RI3 A;  2A36 A;  1YJW A;  4NOY A;  2PU9 B;  1YIT T;  1YHQ Q;  2GBQ A;  3NTI A;  3SD4 A;  1OPL A;  3A1P A;  3GF5 A;  4O5V A;  1U3O A;  4LD9 K;  2PVG B;  4M78 C;  2CT3 A;  4M7D B;  1VYU A;  3CME Q;  2CKK A;  3CCU Q;  5GMK i;  3UT1 A;  3FB9 A;  1IHV A;  2V8K A;  5A0L A;  2CP3 A;  2EQU A;  3FRN A;  1W1F A;  4PJM A;  1SRL A;  4CC2 A;  4C92 G;  1VQM T;  5KYX A;  1VQ4 A;  2KR3 A;  3V7C A;  2E5K A;  2DIG A;  1VYV A;  2EW3 A;  1YI2 A;  1TWB A;  2V1Q A;  3HPW A;  4Z88 A;  4QW2 A;  2A37 A;  2KRN A;  3EHQ A;  1FWZ A;  3X28 B;  5FU7 C;  2L0A A;  1H64 1;  3M53 A;  4IUP A;  3H0I A;  1WHH A;  3CCE T;  3EGU A;  1M1K C;  3LWI A;  1AD5 A;  4F16 A;  4E7Z A;  3OYF A;  3O8V A;  5AT1 B;  1VQ6 A;  5GAN 8;  4EMK C;  4C0Z A;  3VRY A;  4F7U B;  1N8R U;  1YIJ T;  1JJ2 A;  1Q95 G;  4HCC A;  1UB4 A;  3S3N A;  5GAN 5;  1ZA1 B;  4XU3 A;  2KNB B;  3FJ5 A;  2L3S A;  4X1V A;  4M75 A;  3M0S A;  3MPU B;  4OMP A;  2QK0 A;  3V8K A;  2PVO B;  3EG9 A;  1RAF B;  1VQ9 T;  2FG0 A;  3WVD B;  1YJN T;  3A98 A;  3BDL A;  1VQP Q;  4JS5 A;  4A53 A;  1SHF A;  1NZ9 A;  2KRS A;  2F1L A;  2K5F A;  1JBM A;  1PCX A;  3CPW S;  3NGP A;  3JCM e;  3S3M A;  2COZ A;  3CME A;  3H0H A;  1Q81 R;  5DLO A;  1KFZ A;  1KC8 U;  2JZ2 A;  2O31 A;  2M1H A;  2FYK A;  1SSH A;  3RIR A;  3JSC A;  1VQ4 Q;  3CD6 T;  2JOY A;  3G1J A;  2RQR A;  4PJO D;  1I5O B;  3TSZ A;  1H3H A;  1ZA2 B;  1E7O A;  4Z8A A;  3S3O A;  1D1C A;  4F7U A;  3RDV A;  1PSF A;  2CZ1 B;  3LGL A;  4ZTJ A;  3M0U A;  4AMC A;  3E9G A;  1P92 A;  1M27 C;  2K9G A;  4C5I A;  2PQW A;  4RTY A;  1X6G A;  4PK4 A;  2K3X A;  1YFN A;  3A5Z B;  2CZ6 B;  1Q7Y R;  2EYZ A;  3PTA A;  4FIB A;  3QWX X;  4L6V 5;  3OW2 S;  1VIF A;  2AT1 B;  4RTV A;  1UGV A;  2QA4 Q;  2QQ9 A;  4OMN A;  2FZG B;  1NPR A;  4KUD K;  1SSF A;  5GAN 2;  4JJN K;  2KSS A;  4M4Z A;  4O6J A;  1SG5 A;  2JS0 A;  2JUF A;  1LCK A;  2EKO A;  1MUZ A;  4E47 A;  2OTJ A;  3EG0 A;  1VQP A;  2HMA A;  2FRY A;  3M0Q A;  5LJ5 f;  1WA7 A;  4KH0 B;  2DBK A;  1YJ9 A;  4PJO B;  2FL7 A;  2HL5 C;  1WZO A;  3I55 T;  1M1G A;  2XIC A;  2DXU A;  4C8Q E;  3EFR A;  3JCM X;  4LDY A;  4FSS A;  1NPP A;  1PG5 B;  1LPL A;  1TXQ A;  2RI2 A;  3BFM A;  2ABL A;  4F04 B;  2KYB A;  1GFC A;  4PFO A;  2AZV A;  2YUO A;  5LJ5 e;  1B34 B;  3VS0 A;  2LTO A;  4C8Q B;  1OX9 A;  2JS2 A;  1WJR A;  3I56 A;  3SHW A;  4OGE A;  4A54 A;  1Y57 A;  1IRX A;  3L2Q A;  4FSX A;  2E70 A;  4ELY C;  2FZC B;  3V7S A;  2BZX A;  3PIO A;  2DPP B;  2RHU A;  3FC3 A;  2LQ8 A;  4B9W A;  3CC4 Q;  2BTT A;  3R6O A;  5LJ3 e;  1K73 U;  2LNH B;  1I8F A;  3QKJ A;  1N9R A;  2YWW A;  2DER A;  3LYI A;  4BI3 A;  1U1S A;  4M7A B;  5GAM g;  1OX8 A;  2MF2 A;  4HCZ A;  4DEY A;  5IHK A;  5DLQ E;  3FJP A;  3G6E T;  1IB8 A;  4J9D A;  1Q81 U;  1OV3 A;  4M75 D;  1QCO A;  1BI2 A;  2E5Q A;  1BK2 A;  4L59 A;  3GBQ A;  3C94 A;  2CRE A;  2MMP A;  5CAI A;  3THK A;  3QDF A;  2LQN A;  2O9V A;  5IXF A;  3HP9 A;  4R55 A;  5CQY A;  4YTL A;  1VQK A;  3TU4 K;  2VGM A;  3HRT A;  3OS1 A;  1K0X A;  3CCE Q;  3JCM c;  4ESR A;  3G4S Q;  2X3X D;  3BE3 A;  5EC7 A;  2ED0 A;  2KQW A;  1TUD A;  2QTX A;  3KBG A;  4RTT A;  3CC2 A;  1QCF A;  4B6M A;  3JCM f;  5KE3 A;  2VWF A;  2P0K A;  1MMA A;  3EHR A;  2G6F X;  1Y96 B;  3ZFJ A;  1VQN T;  1VQ4 T;  2X4Y A;  1IZ6 A;  2QQA A;  3F70 A;  3CXC S;  4N4I A;  3PNW C;  5LJ5 h;  3RBB B;  3HHT B;  4J6X A;  4RTW A;  2HKN A;  3CXC P;  1WHL A;  3MEU A;  4V2S A;  2OTL T;  2KAF A;  5CK9 A;  6AT1 B;  4C0G A;  4F14 A;  1TH7 A;  2MYS A;  3M57 A;  4N0A C;  5HY6 A;  2JM8 A;  1OU8 A;  1OU9 A;  4GBQ A;  2CZ0 B;  3CCV T;  5I11 A;  2DMO A;  5FWB A;  4M78 G;  5LJ3 h;  1R77 A;  4JPB W;  4L5G A;  2LDM A;  5J3B A;  3M0R A;  3CMA Q;  3J81 E;  2CS7 A;  3OYM A;  2K3Y A;  5KH6 A;  2WAC A;  4C8Q C;  1PD0 A;  5LJ5 g;  4XTY A;  2R57 A;  4C92 C;  5IH2 A;  2EWN A;  3GPL A;  1QKW A;  1TUG B;  1WJQ A;  3NHN A;  4M77 E;  3TRE A;  4PJO E;  3E2U A;  1KHC A;  1MMD A;  2K5I A;  2KXC A;  2LT1 A;  2G3R A;  2A7Y A;  2X4J A;  2E4H A;  2NUP B;  3OYY A;  2EQJ A;  1ABQ A;  4NL3 A;  1K9M C;  4AFU C;  5LJ3 g;  2ZGW A;  3DKM A;  3OY9 A;  5A0G A;  3VS7 A;  1AVZ C;  1NJI R;  3UWN A;  4J9H A;  1W6X A;  1ZBJ A;  1ZUK A;  4PJL A;  4J9G A;  4M77 C;  1YJW T;  1WJS A;  3CCV A;  2HNI A;  4KT0 E;  4CRI A;  1X6B A;  2EYX A;  4KGV B;  5DY9 A;  2XK0 A;  3JB9 J;  4FT4 A;  4ZGD B;  1KG1 A;  2X4X A;  1VQK T;  5CKH A;  1Q7Y C;  2O2O A;  2YRC A;  2DM1 A;  4XTV A;  4OMO A;  4JRI A;  1Y0M A;  3PMT A;  2QGF B;  2R5A A;  3IQL A;  4JS4 A;  1CKA A;  1RAI B;  3M54 A;  4OMF B;  1VQP T;  2GNC A;  4X9D A;  3JCM b;  1WXT A;  2HBW A;  3MEW A;  1X69 A;  2RHI A;  2VAS A;  4F7U G;  2X3W D;  4IUQ A;  1B34 A;  3I9Q A;  2DEQ A;  3VS1 A;  4OB2 B;  3CD6 Q;  4JLI A;  1BI1 A;  1D09 B;  3QWY A;  1R0B G;  4FW2 A;  3OYE A;  3EG9 B;  5GAM h;  4PL6 A;  3H6Z A;  4HT9 A;  2HQH A;  1WNL A;  2RK2 A;  1WQW A;  1PKT A;  1UDL A;  4QKU A;  3SWN B;  1UFF A;  1VQL Q;  1JEG A;  1PKS A;  3G6E Q;  1FX7 A;  1PRL C;  3QHS A;  2DK3 A;  1IGQ A;  5KYN A;  5HK3 A;  3LW5 E;  1KJW A;  1X2K A;  1Q81 C;  1AT1 B;  2WSC E;  3QXE B;  3CCR T;  4P5N A;  1M4Z A;  2DVJ A;  1WPY A;  3ASK A;  1GCQ C;  4BI8 B;  2KE9 A;  2KMT A;  2KXD A;  4M78 A;  4LE9 A;  4AFS C;  1M3C A;  1FXX A;  1VQO A;  3EGD A;  1ARK A;  4M7A E;  3OBW A;  2B8A A;  1QW1 A;  5GAN d;  4LNP A;  2RQU A;  4DA4 A;  1QQJ A;  1M3A A;  5FU6 C;  4GLK A;  2J6K A;  3GOX A;  1Y7X A;  2K2M A;  8AT1 B;  3P8D A;  4FW1 A;  1WYX A;  2FZK B;  4MMK A;  1QWE A;  2RD1 A;  2QA4 T;  3VS4 A;  2L89 A;  1VQ8 T;  3CC2 T;  3FIF A;  4M78 E;  4LDU A;  2MOX A;  2RJF A;  2CYZ B;  4PNO A;  3RKX A;  1TU0 B;  4A4K A;  1YBY A;  2XDB A;  3FLG A;  1JRI A;  3CBM A;  3CCM A;  1CSK A;  1AWO A;  1HD3 A;  2L8D A;  1ZQ1 A;  2CH4 W;  2W0Z A;  3JCM P;  3GNG A;  4JRP A;  3A8H B;  4M7D F;  1PNJ A;  1YCY A;  2WSF E;  4DBH A;  1X27 A;  4ORZ A;  3ULR B;  2XDD A;  1RUW A;  5IAY A;  2JJ9 A;  3REB B;  2YDL A;  2AKL A;  4ZGE B;  1UJ0 A;  2VC8 A;  1OEB A;  2E41 A;  1ACM B;  3L42 A;  1JQQ A;  2AHJ B;  4OVA A;  1Q82 C;  1W2B S;  4FM4 B;  2L3P A;  2R58 A;  2RB6 A;  3QUI A;  2OJ2 A;  4HVU A;  2IG0 A;  1RLP C;  2VYT A;  2M51 A;  4C5E A;  3EFS A;  2JXB A;  4OB0 B;  1FMW A;  2MK5 A;  3CPW P;  1PRM C;  1IO6 A;  4RTU A;  2YT6 A;  4XTW A;  2ESW A;  5CKE A;  1RI0 A;  3I56 T;  3X26 B;  2GTO A;  4PJO F;  2ED1 A;  2MIO A;  3QO3 A;  2HL3 A;  3VKI A;  4HCB A;  2E10 A;  2DTO A;  4MZM A;  1WGS A;  2EQM A;  4N4G A;  5CKB A;  1RL2 A;  1WDX A;  3CD6 A;  1I81 A;  3G4S T;  4BDY A;  3TSW A;  3MP1 A;  1UJY A;  4RUG A;  1N9S A;  4JDS A;  4C92 D;  5J39 A;  5GAN e;  1MHN A;  3OSS C;  2ZZD A;  1M30 A;  2DD4 A;  1M1F A;  3G6E A;  1K8A R;  4C0D C;  1UGP B;  5FWC A;  1Q82 R;  3LWH A;  2DIQ A;  2DL8 A;  2JMC A;  1K0S A;  3VYG A;  3CCL A;  3SFM A;  3QJY A;  4C92 F;  1EX4 A;  4CC4 B;  2JTE A;  1QWF A;  1YIT A;  2CGH A;  3CCS A;  1BU1 A;  1X6O A;  2DXB A;  1GBQ A;  1KD1 U;  1VQL A;  4M7A A;  2RMO A;  4QQD A;  5CO7 A;  4OB3 B;  2DJZ A;  1UGQ B;  5GAM d;  1Z9Z A;  5KYY B;  2DJQ A;  2GFA A;  4M78 D;  1C1A A;  3CCS T;  3VUB A;  1TOV A;  4A4F A;  3FDR A;  2L2P A;  2RHZ A;  4C0F A;  5L8R E;  2LRQ A;  1SPK A;  3LH5 A;  4OML A;  5HKC A;  2KYM A;  2P0Q A;  1E6H A;  1N27 A;  2KGT A;  2XG8 D;  2Z0W A;  5GAM e;  1YJ9 T;  2DL3 A;  1M2O A;  2RK1 A;  1VYT A;  3CCQ A;  3M4Y A;  3UPU A;  5GAO m;  4XQ3 A;  2HAX A;  2J05 A;  2EVR A;  1VQM A;  2KDS A;  2O01 E;  4J6Y A;  4NL2 A;  1D0Y A;  3CC4 T;  2HKQ B;  1M2V B;  3G4S A;  4J83 A;  3TQ7 P;  3CCR A;  2KI7 A;  1IHW A;  5FRO A;  3CCJ A;  4XTX A;  2ROT A;  2DYI A;  2LJ0 A;  2RHY A;  2XKO C;  3E9F A;  2LC4 A;  3OYB A;  2PZ1 A;  2RA2 A;  3M9Q A;  1EFN A;  1VQO Q;  1AWX A;  2CUD A;  4PLL A;  1WQ7 A;  2C0I A;  2QTV A;  1M8M A;  4RCB A;  4M7A D;  4ELZ C;  1U1T A;  4Y92 A;  4AG1 C;  4M77 D;  2YSQ A;  2EGA A;  1OI1 A;  3CCQ Q;  2L5Q A;  2GQI A;  5GAM f;  2M0O A;  1D0Z A;  2KBT A;  2BZ8 A;  3CCU A;  1Y71 A;  1VQ8 A;  3NTK A;  3URG A;  5EG2 A;  1NYF A;  2ROL A;  3CME T;  2RQW A;  3RMQ A;  4F7U E;  3CCU T;  4FCY A;  2JW4 A;  1RAD B;  2J6F A;  1IGU A;  1MNE A;  1GRI A;  3ER0 A;  1UE9 A;  4GLM A;  4VUB A;  3EH2 A;  1KQ1 A;  4PKC C;  2Y4Y A;  5GAO p;  3CC7 A;  2HEQ A;  2RM4 A;  3I56 Q;  4A4E A;  1MMN A;  1BI0 A;  2KT8 A;  1YJN A;  1M1K U;  2XDP A;  3SWN C;  1X01 A;  1FYN A;  2M02 A;  1VQ6 Q;  3OYC A;  3E19 A;  3OW2 P;  1N8R C;  3CCJ T;  3QG1 A;  3UA6 A;  3EFO A;  1NJI U;  1GL5 A;  1R8O B;  3PVL A;  2D8H A;  1IXD A;  1R0C B;  2OI3 A;  1N8R R;  1ZLM A;  3HSB A;  4J9F A;  4M75 C;  4M7D D;  1W2B P;  4XTU A;  3V8L A;  4BE1 A;  4C8Q A;  3M56 A;  3QYH B;  5C0M A;  2KEA A;  5I2M A;  5LJ3 d;  2PVD B;  3G71 Q;  1TS9 A;  3C12 A;  4AFZ C;  1YWO A;  1VQ8 Q;  3ME9 A;  1H8K A;  3EAE A;  1O75 A;  4E7K A;  4HVW A;  2FHD A;  2DBM A;  1G8X A;  1S72 Q;  3ZL7 C;  4KRT A;  1KHI A;  2E3H A;  4XU2 A;  1PWT A;  2QQS A;  4C92 B;  1G3S A;  1ZSZ C;  2KRM A;  4JZ3 A;  1UEC A;  3M55 A;  3PIP A;  1NE8 A;  2LJ1 A;  2DZC A;  4QQG A;  4UC4 A;  4BI4 A;  2JTF A;  1I4K 1;  5CCA A;  2J7I A;  3RKY A;  2NWM A;  2X9H A;  3M0T A;  1GXI E;  2D0Q B;  2ZPG B;  4OMQ A;  5IXB A;  1G83 A;  2DL5 A;  3L2V A;  1RAC B;  2OTL A;  1Q86 R;  3OBY A;  1TSF A;  1QVF S;  5D7U A;  3GIB A;  4IKF A;  3J7A F;  3VV0 A;  2MWO A;  1OZ3 A;  3TCJ A;  4M75 F;  3L2R A;  1NYG A;  2YUQ A;  2GF7 A;  2LQK A;  4J9C A;  4DBQ A;  1C0M A;  2DTI A;  1W70 A;  4E7I A;  2QQR A;  2ZPF B;  1OYX A;  3QYG B;  5A2Q E;  4KGX B;  1M8V A;  2LCL A;  1VQO T;  1KD1 R;  5J26 A;  2LQW A;  2DX1 A;  5GAN g;  7AT1 B;  1XQH A;  2FPD A;  3PE0 A;  2YHT A;  3OYN A;  1K1Z A;  1VQ9 A;  2KK4 A;  3L2W A;  4M77 F;  2AKK A;  4JJC A;  3VU3 C;  1TG0 A;  2CSI A;  3JB9 H;  4PJJ A;  4XK8 E;  2LX7 A;  1YCS B;  4QQ6 A;  1NEB A;  1T0H A;  2DL7 A;  2CZ7 B;  2VVK A;  2BZY A;  2EAY A;  4KGZ B;  1QMC A;  1YI2 T;  3SDZ A;  4E6R A;  3ZEH A;  4RG8 A;  3DB3 A;  1X43 A;  2DAQ A;  1YIJ Q;  1PSE A;  3C4S A;  3CC4 A;  1N6A A;  1JJ2 P;  2EJ9 A;  3JB9 G;  1M90 R;  3CCR Q;  2VV5 A;  2VXF A;  3RKW A;  1NEG A;  2ECZ A;  3PVQ A;  1VQ9 Q;  1D1A A;  2C0T A;  4M77 B;  4OF1 A;  1U8R A;  2ZPI B;  2H3J A;  4AFQ C;  1BCM A;  4MML A;  3KFV A;  2SEM A;  1HYO A;  2HQE A;  1RAA B;  3NMZ C;  4IUV A;  1VQN A;  2FVU A;  3JCM V;  5KYW A;  2D0N A;  5ECA A;  2PNI A;  2DTH A;  4JLG A;  5KYU B;  5FRM A;  1RAH B;  1TTH B;  1D1B A;  4HCK A;  1GCP A;  4MZT A;  4DEX A;  3SEM A;  4IUR A;  5GAN 3;  4N0A A;  3D7S B;  1YHQ A;  2GGR A;  1K8A C;  3BDU A;  1OZ2 A;  9ATC B;  2DIL A;  3OYL A;  3JRZ A;  4PJO A;  4WF2 A;  5LJ3 f;  5GMK j;  2EQI A;  4XTZ A;  3DLM A;  3JCM d;  4JJB A;  3OYG A;  1VOM A;  4K11 A;  5LL6 S;  4KH1 B;  1JB0 E;  2QEX A;  3OQ5 A;  2VXE A;  2XMF A;  2RJD A;  4J9B A;  3OB9 A;  4EDU A;  1RAG B;  5D6W A;  2HD0 A;  4D6W A;  4DBF A;  1BB9 A;  5FLX E;  2KRO A;  4GY5 A;  3MEA A;  2HBP A;  3I5S A;  3OS2 A;  1OQK A;  2YUN A;  1WHG A;  1SHG A;  3OS5 A;  1JXM A;  2L3Q A;  1VQM Q;  2MCN A;  5CIU A;  1W4S A;  4C8Q G;  4F17 A;  2FO0 A;  2I0N A;  4M7D E;  1BIB A;  2XID A;  1MGQ A;  4WCI A;  5KCO A;  3NFC A;  3JCM W;  2DLP A;  3LGF A;  3NTH A;  2R5M A;  2ZAE A;  4M7A F;  3H41 A;  1B3Q A;  4MZP A;  3T9N A;  8ATC B;  2P84 A;  1D3B A;  2F2X A;  5GAN 4;  3GLX A;  1AWJ A;  4Z89 A;  2X35 A;  4FYW B;  1U06 A;  2K6D A;  2SRC A;  3CCQ T;  4LXC A;  2EIF A;  4J8O A;  1QLY A;  1MV0 B;  1OOT A;  4FYY B;  1T3S A;  2EYQ A;  3KXT A;  1K9M U;  5GAN h;  4KBM B;  3AT1 B;  3AHU A;  1NBE B;  2DXC A;  3CCM Q;  2LCC A;  5GMK h;  2XHC A;  1M1K R;  1RI9 A;  1UG1 A;  1B07 A;  2EKH A;  2O88 A;  2ENM A;  1G3W A;  2VUB A;  4RCC A;  2QYZ A;  4MDW A;  4M7A G;  5GAN 6;  5LJ5 d;  1HK9 A;  4PJN A;  4D8K A;  2LNV A;  3QPH A;  3HL8 A;  2D1X A;  4M77 A;  4M7A C;  1WLP B;  3OYJ A;  1NM7 A;  3JCM h;  3UDC A;  1YIJ A;  4ANJ A;  5A0D A;  3QDR B;  1PD1 A;  3V8J A;  1YP5 A;  1ZX6 A;  5GAN 7;  1BBZ A;  2BUD A;  2RI5 A;  2DRK A;  1BKB A;  3L2Z A;  4R56 A;  2JVV A;  2X4W A;  3CCE A;  1I07 A;  1KK7 A;  1RAB B;  2PUO B;  3M5A A;  1S1N A;  2QA4 A;  3HFO A;  3U23 A;  5KYX B;  2K79 A;  4XU0 A;  3OYI A;  4LDX A;  1ZHI A;  3CCS Q;  4EPC A;  2HQX A;  3N5B B;  4CC7 A;  1XTD A;  1KC8 R;  4JZ4 A;  4LD6 A;  3DB4 A;  3WXM B;  1UHC A;  2DVE A;  2D6F A;  2FPE A;  2RPN A;  2DKG A;  4AT1 B;  2DZ9 A;  3JB9 I;  2CUB A;  2RO0 A;  4HVV A;  1HSQ A;  5GAO l;  3MET A;  1V1C A;  3QZ9 B;  2RF0 A;  2P0P A;  2GCX A;  1VUB A;  2ZCF B;  2XD0 A;  5GMK e;  2BKD N;  5IHN A;  2Y90 A;  2E12 A;  1XOV A;  2CP2 A;  5C6S A;  3QBY A;  4ZTF A;  3OS0 A;  4LDV A;  4JRK A;  5KCH A;  1LNX A;  1QP3 A;  4BD3 A;  1UGR B;  1LOJ A;  3I55 Q;  3LLR A;  2RQT A;  1AOJ A;  1QVF A;  1KQ2 A;  4M7D C;  5HK0 A;  4M78 B;  3X24 B;  2LZ6 B;  4ZN1 A;  1DJ7 B;  2DFU A;  3JB9 F;  2OX7 A;  3M4G A;  2NUT B;  3UA7 A;  1K8A U;  4A4H A;  2QEX Q;  1UHF A;  5CQX A;  4DOW A;  4ME7 A;  3EGX A;  1XJW B;  2MPX C;  1N5Z A;  1GFD A;  2EFI A;  2ATC B;  2E6N A;  4RTZ A;  1K73 C;  1B7T A;  3VS6 A;  2DEU A;  2RJE A;  3MKD A;  1WXU A;  1G3Y A;  5IT9 E;  1K76 A;  2FRW A;  4AG2 C;  2IIM A;  4C5G A;  4BE2 A;  5GMK m;  4BY6 C;  3UAT A;  2GFU A;  1GBR A;  4HKE A;  1XNI A;  1AEY A;  4HXJ A;  5GAM j;  4BUG A;  1VQ5 Q;  2XI9 A;  1WXB A;  3JCM J;  1FMK A;  4Y28 E;  2AK5 A;  2CT4 A;  2B86 A;  2OTJ Q;  4N4H A;  2C0O A;  5CKF A;  2K3B A;  1VQN Q;  2HDA A;  3OYH A;  4RTX A;  1YWP A;  3CCJ Q;  2E65 A;  2EJG A;  2A28 A;  2EPD A;  3CCL T;  4HA8 A;  5CVI A;  3SWN A;  3VRZ A;  4M75 G;  2QDL A;  1S72 A;  4EMK A;  2X51 A;  3PFS A;  1YI2 Q;  3OW2 A;  3HFN A;  2E64 A;  1YNZ A;  4EMK B;  1WX6 A;  2GQV A;  5D6Y A;  4IIO A;  1X2Q A;  4ZN3 A;  3OYK A;  1PM3 A;  2COY A;  2JNG A;  1UGS B;  3HKS A;  2K7A A;  1ZUY A;  2ZPE B;  2JTM A;  3OYD A;  2EYW A;  1QP2 A;  1NLO C;  4DBR A;  2QAZ A;  2EBP A;  2HSE B;  2LJ3 A;  3QII A;  1SRM A;  4BE0 A;  4ZNX A;  5D6X A;  2PTK A;  2BE7 D;  1MV3 A;  1WI7 A;  4Y91 A;  1J3T A;  5GAO n;  3GP8 A;  1M90 C;  1VQL T;  4J6W A;  4B9X A;  2OTL Q;  2M9U A;  2F5T X;  4QT7 A;  4CC3 A;  5CKD A;  1K4U S;  3OSV A;  2HSP A;  4E2F B;  2C06 A;  2KY9 A;  3EGD B;  1EZZ B;  3MHX A;  2QG9 B;  1Y96 A;  4C8Q F;  3BW1 A;  1M2V A;  4M7D A;  5GAN j;  2P4T A;  3L1A A;  2BE9 B;  2LP5 A;  4CI0 C;  4NS5 A;  1Y07 A;  2XU8 A;  2F5K A;  2DXT A;  3P8H A;  5LJ3 j;  1X75 C;  3CPW A;  2O9S A;  4E7S A;  2EJF A;  1KD1 C;  1A0N B;  3G7Z A;  4XAX B;  5FU6 B;  2ZPB B;  2DD5 A;  2V8I A;  3TEE A;  2W10 A;  4JRQ A;  1QVF P;  1M3B A;  1WHM A;  1D0X A;  2M0Y A;  2K57 A;  3H0F A;  5GMK l;  1SKU B;  4E7L A;  4IUT A;  1UTI A;  2M16 A;  3VYH B;  1YJW Q;  1H3Z A;  2H8H A;  3X20 B;  2DET A;  5FW9 A;  2D8J A;  1RAE B;  2CP5 A;  2I2L A;  3JV3 A;  5LJ5 j;  3EG1 A;  1K9A A;  2VB6 A;  3R6N A;  2OAU A;  5IN1 A;  4J7I A;  3CC2 Q;  3RR6 A;  1NG2 A;  2VKN A;  4OP0 A;  1QVP A;  1VA7 A;  4FT2 A;  3OMC A;  4Z02 A;  2P4R A;  3I55 A;  4TVR A;  1Q7Y U;  1E6G A;  3Q1J A;  3CXC A;  5IHI A;  4M78 F;  4ZGJ B;  1ABO A;  2V8J A;  3PMI A;  2RQV A;  2DE0 X;  4LUE A;  3MP6 A;  1UEB A;  2FB7 A;  4RG2 A;  2JMA A;  2J6O A;  2QAS A;  1AHJ B;  3RER A;  3FEO A;  3CBP A;  3ZBD A;  5GJW B;  1F1B B;  2A3L A; 
#chains in the Genus database with same CATH homology
 2K9G A;  1M27 C;  2L3P A;  2OJ2 A;  4HVU A;  1RLP C;  4RTY A;  1X6G A;  2DIL A;  4LN2 A;  2M51 A;  1UUE A;  2DRM A;  2EYZ A;  2JXB A;  3TVT A;  2EQI A;  3QWX X;  1PRM C;  4JJB A;  1IO6 A;  4RTU A;  4RTV A;  1UGV A;  4K11 A;  2HCK A;  2LMJ A;  2YT6 A;  4OMN A;  2ESW A;  2RNA A;  5I22 A;  2XMF A;  4J9B A;  1KIK A;  2GTO A;  4M4Z A;  2JS0 A;  2EYY A;  1LCK A;  1BB9 A;  1MUZ A;  2ED1 A;  2JM9 A;  2KRO A;  2MIO A;  3EG0 A;  3I5S A;  2CSQ A;  2FRY A;  2YUN A;  3M0Q A;  1WA7 A;  3REA B;  1SHG A;  3EG3 A;  1JXM A;  2DBK A;  2L3Q A;  1WDX A;  2MCN A;  3TSW A;  4F17 A;  2FO0 A;  1UJY A;  2I0N A;  4RUG A;  1HJD A;  4WCI A;  5HCK A;  4FSS A;  1Z9Q A;  2DLP A;  2F2W A;  3H41 A;  1B3Q A;  1M30 A;  2ABL A;  2KYB A;  1GFC A;  4D8D A;  2AZV A;  2YUO A;  2DNU A;  3VS0 A;  2JS2 A;  5FWC A;  3SHW A;  2DL8 A;  1PHT A;  2JMC A;  1K0S A;  2NUZ A;  1Y57 A;  2DYB A;  2F2X A;  4CC4 B;  2JTE A;  1QWF A;  2BZX A;  1BU1 A;  1YN8 A;  3O5Z A;  1GBQ A;  2EGC A;  1AWJ A;  4Z89 A;  1JO8 A;  2RMO A;  1U06 A;  2K6D A;  2SRC A;  2BTT A;  2LCS A;  2LNH B;  2FEI A;  1Z9Z A;  1QLY A;  1MV0 B;  1OOT A;  1ZSG A;  1T3S A;  2DJQ A;  2KT1 A;  4A63 B;  4DEY A;  2L2P A;  5IHK A;  4J9D A;  1OV3 A;  1RI9 A;  1JU5 C;  1UG1 A;  1B07 A;  1BK2 A;  3GBQ A;  2EGE A;  2EKH A;  2O88 A;  2CRE A;  1H92 A;  1SPK A;  1RLQ C;  2ENM A;  3LH5 A;  4OML A;  1WFW A;  3THK A;  2KYM A;  3VS5 A;  1E6H A;  2KGT A;  4D8K A;  2LQN A;  2O9V A;  5IXF A;  2D1X A;  2DA9 A;  3NPF A;  2DL3 A;  1WLP B;  2DF6 A;  3RNJ A;  1NM7 A;  1I0C A;  1K0X A;  1VYT A;  4ESR A;  2X3X D;  1YP5 A;  1ZX6 A;  1BBZ A;  5EC7 A;  2DRK A;  2ED0 A;  1TUD A;  2J05 A;  2EVR A;  4RTT A;  1QCF A;  3M0P A;  1I07 A;  2VWF A;  1S1N A;  3EHR A;  2G6F X;  3U23 A;  2ROT A;  2K79 A;  1AWW A;  2LJ0 A;  3VS3 A;  4CC7 A;  3RBB B;  4JZ4 A;  2PZ1 A;  1EFN A;  1AWX A;  2CUD A;  1UHC A;  2F2V A;  2C0I A;  2FPE A;  1M8M A;  2RPN A;  4RTW A;  4Y92 A;  4AG1 C;  1T0J A;  2AZS A;  1ZUU A;  2CUB A;  1AZG B;  1QKX A;  2YSQ A;  4HVV A;  1HSQ A;  2EGA A;  2GQI A;  4JJD A;  4F14 A;  2KBT A;  1V1C A;  2BZ8 A;  2RF0 A;  1I1J A;  2JM8 A;  2J06 A;  4GBQ A;  1NYF A;  3UF4 A;  1G2B A;  1SEM A;  2DMO A;  2ROL A;  4J9I A;  1NLP C;  5I11 A;  2RQW A;  5IHN A;  1OPK A;  2JW4 A;  5FWB A;  5L23 A;  3I5R A;  1XOV A;  2J6F A;  4JPB W;  3C0C A;  1GRI A;  3M0R A;  1UE9 A;  4LUD A;  4GLM A;  2V1R A;  1KSW A;  2HEQ A;  2RQT A;  1AOJ A;  1T3L A;  2KT8 A;  2LZ6 B;  5IH2 A;  2FPF A;  1FYN A;  1QKW A;  2A08 A;  1JXO A;  3NHN A;  1AZE A;  1U5S A;  3UA7 A;  3UA6 A;  1GL5 A;  2KXC A;  1UHF A;  2JT4 A;  3PVL A;  2CH4 A;  2D8H A;  1N5Z A;  2YUP A;  1GFD A;  2OI3 A;  4RTZ A;  1ZLM A;  3VS6 A;  1WIE A;  4J9F A;  2GTJ A;  3VS2 A;  1ABQ A;  1WXU A;  4AFU C;  1K76 A;  2FRW A;  4AG2 C;  2IIM A;  4EIK A;  2OAW A;  3VS7 A;  2KEA A;  3CQT A;  3UAT A;  1GBR A;  1AVZ C;  4J9H A;  5GJV B;  1W6X A;  1ZBJ A;  1ZUK A;  1AEY A;  4HXJ A;  4J9G A;  1WXB A;  2CDT A;  1FMK A;  4AFZ C;  2AK5 A;  2CT4 A;  4R0K A;  1YWO A;  2B86 A;  1X6B A;  2EYX A;  4OMM A;  1TUC A;  1H8K A;  2O2O A;  3I35 A;  2DM1 A;  2C0O A;  4HVW A;  1Y0M A;  4OMO A;  1GCQ A;  2DBM A;  3IQL A;  2K3B A;  1CKA A;  3ZL7 C;  4KRT A;  2HDA A;  2GNC A;  1PWT A;  4RTX A;  1YWP A;  1WXT A;  2HBW A;  3EG2 A;  1X69 A;  2A28 A;  2EPD A;  2X3W D;  3VRZ A;  2KRM A;  4JZ3 A;  2QDL A;  1UEC A;  2DL4 A;  3I9Q A;  3VS1 A;  2LJ1 A;  1CKB A;  4J9E A;  1YNZ A;  4IIM A;  2RN8 A;  1WX6 A;  3QWY A;  2J7I A;  4IIO A;  1X2Q A;  2A36 A;  2NWM A;  3M0T A;  2GBQ A;  1PKT A;  1UDL A;  2K7A A;  4OMQ A;  1ZUY A;  5IXB A;  1OPL A;  1G83 A;  1U3O A;  2EYW A;  1UFF A;  2CT3 A;  1NLO C;  1VYU A;  2EBP A;  2DL5 A;  1JEG A;  2LJ3 A;  1SRM A;  1PKS A;  1PRL C;  4ZNX A;  2PTK A;  1MV3 A;  1WI7 A;  1J3T A;  1W1F A;  1SRL A;  4CC2 A;  1NYG A;  2YUQ A;  1KJW A;  4J9C A;  1X2K A;  1W70 A;  2KR3 A;  2E5K A;  1VYV A;  2EW3 A;  4QT7 A;  4CC3 A;  2V1Q A;  1K4U S;  2DVJ A;  2HSP A;  4Z88 A;  2A37 A;  2KRN A;  3EHQ A;  1GCQ C;  2LQW A;  2DX1 A;  2KE9 A;  2KXD A;  2L0A A;  4LE9 A;  4AFS C;  1M3C A;  2FPD A;  3H0I A;  3PE0 A;  3EGU A;  1ARK A;  1K1Z A;  1AD5 A;  4F16 A;  4LNP A;  2AKK A;  4JJC A;  1TG0 A;  2CSI A;  2RQU A;  2LP5 A;  3VRY A;  2LX7 A;  1YCS B;  1M3A A;  1NEB A;  2J6K A;  1T0H A;  2DL7 A;  2K2M A;  2O9S A;  2VVK A;  2KNB B;  1A0N B;  1WYX A;  2BZY A;  1QWE A;  3FJ5 A;  2L3S A;  2W10 A;  3M0S A;  4X1V A;  3VS4 A;  1M3B A;  4OMP A;  2M0Y A;  4E6R A;  3H0F A;  1X43 A;  1UTI A;  2FG0 A;  2H8H A;  3A98 A;  2MOX A;  5FW9 A;  2D8J A;  3JV3 A;  1NEG A;  1SHF A;  3EG1 A;  1K9A A;  2ECZ A;  2KRS A;  3PVQ A;  3R6N A;  3NGP A;  2C0T A;  1CSK A;  3H0H A;  1AWO A;  1HD3 A;  1NG2 A;  1KFZ A;  2VKN A;  4AFQ C;  2CH4 W;  2O31 A;  1SSH A;  2W0Z A;  3KFV A;  1VA7 A;  2SEM A;  3NMZ C;  1PNJ A;  2P4R A;  2RQR A;  1X27 A;  2D0N A;  4ORZ A;  3TSZ A;  3ULR B;  1E6G A;  1H3H A;  1RUW A;  5ECA A;  5IHI A;  1E7O A;  4Z8A A;  2PNI A;  1ABO A;  3REB B;  2RQV A;  2DE0 X;  4LUE A;  2YDL A;  2AKL A;  1UJ0 A;  4HCK A;  1GCP A;  1OEB A;  2JMA A;  2J6O A;  4DEX A;  3SEM A;  3M0U A;  1JQQ A;  5GJW B;  2GGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...