2YDXA

Crystal structure of human s-adenosylmethionine synthetase 2, beta subunit
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
312
structure length
312
Chain Sequence
MNRRVLVTGATGLLGRAVHKEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAAERRPDVVENQPDAASQLNVDASGNLAKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVMFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIADAFNLPSSHLRPITDSPVLGAQRPRNAQLDCSKLETLGIGQRTPFRIGIKESLWPFLIDKRWRQTVFHAENL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insight Into S-Adenosylmethionine Biosynthesis from the Crystal Structures of the Human Methionine Adenosyltransferase Catalytic and Regulatory Subunits.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords METHIONINE ADENOSYLTRANSFERASE 2 SUBUNIT BETA
total genus 110
structure length 312
sequence length 312
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04321 RmlD_sub_bind RmlD substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ydxA00
3VAZA 4MDHA 4E2WA 2Y68A 1VPDA 1IPFA 3WWZA 3PJFA 1PL6A 1YOVB 1RJWA 3DHEA 2EP7A 4FR5A 1NHWA 4IDAA 3U49A 4Y6SA 1N9GA 4B4VA 1ZZEA 4YCAA 5ER6A 4Q3EA 4GBJA 3FF4A 3MJTA 4NZ9A 1SB9A 2VUSA 3AI3A 3RASA 1GZ4A 1RM4A 2EGHA 3NT2A 1GD1O 2JL1A 3ANNA 1IULA 3DFZA 3RCBA 2XPCA 4LMRA 2EIHA 5ENVA 4RVUA 1ORRA 5I9MA 1RWBA 4BNGA 2AQHA 2GZ1A 4JJIA 3SLKA 4R3NA 4EDFA 3H2SA 3P2YA 2JCYA 3JQCA 4BVAA 3KYDA 3O9ZA 1LC3A 2HK9A 1ZCJA 4XGKA 1B14A 4LCEA 3OP4A 1NBOA 3AM3A 1Q1NA 1GV1A 5JE8A 4HX5A 2VHZA 3L6OO 3N58A 1E77A 4RVFA 1G0OA 5A9TA 2I76A 1HXHA 2DLDA 4JIGA 4PZEA 5TGDA 3HHPA 3ONDA 3RUDA 1X1EA 4NG5A 2I66A 3DZGA 4GSKA 3LSYA 5A04A 1WW8A 2VTEA 2DBVO 5CHEA 4F3YA 5F1PA 4XB2A 5CEEA 2XXBA 5IXYA 1E6UA 3VHRA 3W8FA 3VTFA 3E9QA 3B1FA 3OIGA 1GR0A 5IAAA 1K6IA 4CQMD 4DRYA 3DAFA 5JNLA 3LLSA 2E4AA 3UUWA 1C14A 5JBIA 4CPDA 2DVMA 3AM5A 5TSDA 4Y98A 3VZQA 4JK3A 5EL0A 1PL7A 3LT4A 3ZWAA 3L9XA 3RU7A 1KVTA 1CYDA 1HE5A 4IPTA 5DZSA 1ADGA 3L4SO 4NQZA 5JYDA 1QV7A 1EVIA 2Y1GA 2W2KA 3HWRA 4RF2A 4YRAA 2FPGA 5I7SA 3GEDA 2WSBA 3GZ4A 5AXCA 5HRUA 5JO0A 1I3LA 3RAJA 3K92A 1G1AA 2DBZA 2VWQA 2WE8A 3O8QA 4JCOA 2PD4A 4XJTA 3RUHA 2BD0A 2V65A 3OECA 3ZNQA 5LDHA 2Q2VA 3GGOA 1VJ1A 4P4NA 3ZHBA 4C7KA 2PD6A 2FOIA 1GPJA 3HFSA 4I5EA 5KVQA 5JAIA 2CUKA 4AJPA 3ZV6A 1C1DA 2B37A 4PRKA 3KVOA 1K2WA 3UCEA 1ADCA 3MOIA 4FJ0A 2EP5A 3O26A 1PQWA 4WK6A 5CPBA 4B3JA 4HUJA 2EKQA 1VKOA 4NU5A 4LRSB 3W6UA 3LT1A 4XYGA 3QRWA 1UAGA 4BKOA 4CM6A 3B70A 2G82A 1YB5A 4WLVA 3CIFA 3GDFA 1ULSA 4XB1A 4RPKA 9LDTA 2GSDA 5DNAA 3KO8A 2R00A 3EHEA 3ETDA 5HA5A 4CR7A 4MJLA 1F17A 1LLQA 3U4IA 4UREA 5KTKA 3BHMA 3A1NA 3C7AA 4IS2A 2FRDA 3WIEA 3M2TA 1QRRA 1Y8RA 3DTYA 4Z9XA 1OC4A 1UDBA 2YHIA 2CVZA 5B4UA 2YDYA 4UUNA 4XDYA 1YBVA 1YL7A 4IXWA 4F6LA 4A10A 3JQAB 3GNSA 4R5MA 3UVEA 1NFFA 1ZBQA 1Z74A 2G5CA 4CQLA 3BXXA 5C3MA 2JKVA 2R00C 3Q3CA 4QEDA 4A7PA 2X6TA 4LCJA 5JMPA 2NADA 3F46A 5IFLA 3GMSA 2PH5A 1GAEO 1LA2A 4CM9A 1G6KA 1O94A 2WE7A 5IDWA 1R0SA 4RV9A 4YB8A 1HL3A 4W9NC 1DSSG 1N7GA 1YL5A 5A9SA 1AUPA 2P4QA 1LX6A 5F1OA 1HDZA 4CUJA 1CEQA 1UUFA 2QIOA 2WD7A 1M67A 4RDHA 3GFBA 5K0ZA 2C2YA 1BVUA 4L9RA 1GYPA 2FSSA 5A3VA 1YO6A 5COAA 3PGJA 2GZ2A 4ZVVA 2VT2A 3GH3A 4BNZA 3ETGA 1DHRA 4L74A 1N1GA 4ZHSA 2GASA 1O9BA 2GN6A 3GK3A 2VWHA 3GHYA 4BNHA 3ENKA 1XYGA 2XAAA 3FPLA 3FTNA 3QIVA 4DC1A 3TPCA 1XWFA 2ZQZA 3RBXA 1D1TA 3MZ0A 1E0DA 5DN9A 2RIRA 5JDIC 3ITKA 2X86A 4KZPA 1DO8A 4WEOA 2BH9A 2G76A 1ZVMA 5F1KA 3T7CA 4QECA 5I7VA 4Z3KA 4EGFA 3WQSB 2CF5A 3RBVA 1GV0A 3PK0A 1UH5A 5A9RA 3DC2A 1D1SA 4FIZA 1EUZA 4NFSA 4YRBA 5CDUA 3ZHYA 4BO7A 5KWEA 3JQ7A 2ZIZA 3GN2A 4D3DA 3WGOA 4NI5A 4GX2A 4TRJA 2FY8A 3DMYA 3KYBA 1VJ0A 2BI8A 2IZZA 5KKAA 1NWCA 3AFMA 1W8DA 2ZJ0A 2ZTUA 4CL8A 4GAEA 5C7IO 2JHFA 4Y67A 3PLRA 4TMFA 2ZYGA 3GNTA 1DEHA 4PLVA 4RORA 4FN4A 4N5LA 3PHHA 1VRWA 1UXGA 1MXFA 2GR9A 4IBOA 2AG8A 3WYBA 3PGXA 4JLWA 2LDBA 2PKQO 3Q9UA 1GQYA 3D0OA 2Y99A 3DTTA 3KBOA 4PIVA 5JPIA 3AUAA 3TSCA 4K28A 4CLRB 3JQAD 5CEFA 4DPLA 1MA0A 4EBFA 4DIBA 3H8VA 1YJQA 2I5PO 3GGGA 3IUSA 3JSAA 2AG5A 3INTA 4N7RA 1GZ3A 2YFQA 4G65A 1UXKA 2PD3A 4LVCA 4J4HA 4Y9DA 5ICSA 4OGWA 1E7WA 2X5JO 3NDJA 4HXYA 4J2OA 4FJ1A 1MG0A 2JAPA 3CZRA 4RF4A 2I3GA 3A4VA 4YAKA 4AL4A 1C0PA 1XGKA 2HMUA 1GADO 4E30A 3MEQA 4L8VA 1JAXA 4GGPA 4DLBA 3P7MA 1FDTA 3DBLB 3SLGA 1PJSA 3G79A 3OJOA 4JJGA 4BO9A 3KETA 3I3OA 4RCVA 1E7QA 4IQ0A 1RYDA 1LLCA 4OKNA 4MPDA 3ULKA 2Q4BA 3H2ZA 3HN7A 4CMHA 3EGOA 4BIIA 3GZNA 1T26A 2AXQA 3OIFA 4M86A 2O3RA 1BXGA 1XU7A 1KVQA 3VPGA 3ZWWA 3UAGA 4A2CA 2WDZA 3QJ5A 3KV3O 4I08A 4AJNA 1HDGO 2X4GA 3WSWA 4TRMA 5CFZA 5I9LA 3DBHA 3QWHA 1DRUA 1T4BA 2ZYAA 1QYDA 1UP4A 3E5MA 1BXGB 4BOYA 4YQZA 3JQ6A 3PJGA 1LDEA 2D59A 3OQBA 1Z75A 5JCXA 3JQBA 3O03A 4K9DA 4K6CA 4MP8A 4UUOA 5BR7A 3H3FA 2RH8A 4TRNA 4H16A 2VRBA 5HM8A 4CLOA 2YDXA 4XGNA 3NKLA 3A06A 1ENZA 1PJ4A 3S2GA 1E5QA 3UKOA 1OC2A 2J3IA 4CMGA 3H4VA 3BTOA 1GL3A 1BHSA 3IOYA 5H81A 3OEYA 5JCJA 3S8MA 4R51A 4BKUA 1UDAA 1LSUA 1F06A 5G4KA 2RH4A 1HE4A 2HK8A 4GLLA 1QKIA 1DIHA 4YJHB 1LRJA 5BT9A 4ALIA 2EG9A 4IGEA 2IEDA 3V2GA 4LISA 5JDCC 4RF5A 3HFGA 1ZSNA 2ZQYA 1QSGA 3I9LA 4QFCA 4QT0A 2QYTA 1ENOA 1F12A 4DUPA 3VPHA 1ENPA 5TX7A 4Z9FA 1YBMA 4HFNA 5EIOA 3DZBA 1D3AA 1P31A 4FGSA 4KUHA 3VPFA 4NK4A 4Q3AA 4D45A 4Q3BA 1YQXA 1A72A 1YDEA 4WLFA 3PQEA 1Z7BA 3ICCA 3QLJA 3JYPA 3UFXA 2C0CA 3L6EA 2BFMA 3EC7A 3PXXA 1ONNA 1JN0A 2DBRA 4CMCA 1NWHA 2OMEA 1O8CA 3ZU4A 3L6DA 4QFDA 2PK3A 2X23A 1A5ZA 1ISGA 1C0LA 1HDRA 3KYCB 4TVOA 1V3VA 4WECA 1HYHA 1O95A 2Y67A 4YQYA 3OA2A 1WAMA 3WGGA 1K0UA 3I52A 2I99A 4U5QA 4GPD1 1VL6A 1FDWA 1P44A 5ADHA 4XKJA 4M55A 3I6QA 5DCYA 3FNEA 1ZJYA 3K73O 4GKBA 3V1UA 1U28A 1EFLA 2PZJA 4KTTE 4Q3NA 2BGKA 1ONPA 4BNTA 4CR8A 2I65A 2W2LA 4KWIA 3H9JA 5CEJA 4GMFA 3KRTA 3RUAA 1YVEI 3DQPA 3KYDB 1NAHA 1LBEA 3TZQA 4OXKA 4MVJP 1FF9A 1NVMB 2DKNA 1QYXA 4M89A 3U4HA 4WGGA 4YXFA 3OICA 4XZ3A 3H9EO 1NPYA 3D5TA 4OMUA 5IG2A 1ISIA 1NAIA 4XIJA 4DYVA 2IYOA 2NVBA 5JMWA 5G0VA 2PGJA 3VPXA 3QSGA 3DONA 5FFFA 2FHSA 2X8LA 5BSEA 3AJRA 1VI2A 5C5IA 3DOCA 1C1XA 3OEWA 3QP9A 1H0KA 2EW8A 4BNWA 3HDJA 1I2CA 3DXFA 4J16A 2DTDA 4I9UA 1DLJA 1JKJA 3MJEA 2FZEA 4BO1A 4HNHA 3ZWXA 5COBA 2J3KA 2VQ3A 1C0KA 1V0JA 4B8WA 4ND2A 3QHAA 4F46A 2OUIA 1TT5B 1N5DA 1P45A 1UZMA 3AOEC 2F00A 1U3VA 4CQLB 4D7AA 3GLQA 5JCJD 3E8XA 1P74A 3NEPX 1EEHA 1I33A 3FI9A 1DRWA 3LF2A 3MOGA 3EW7A 2QYSA 3EY4A 5KKCA 4EEZA 2Y0CA 1V35A 1HRDA 3ZN2A 4BV9A 5L40A 4D79A 4I9HA 3W8DA 1I3NA 3MTGA 5TJHA 4B3HA 4CV3A 2OFPA 4GQAA 3OA0A 4IUYA 4UAGA 3W4JA 2PH3A 3S55A 1L7DA 3KOUA 3OIDA 3RSHA 3LC1O 4CM4B 5TS3A 1O89A 2FMUA 1K6JA 2YZ7A 5G0UA 3ZV5A 5IN5A 1X7DA 1YB1A 4J1TA 3AW9A 3GVPA 3MJCA 3MWEB 4BNXA 5CDYA 2HQ1A 4WCFC 4TQGA 1VC2A 1SEPA 4RGBA 1X1TA 3DHNA 4C7JA 2GO1A 2Q4EA 1AN9A 3GG9A 2D2IA 4ESOA 5JDIA 3ZU2A 1DJQA 2C5AA 4ONEA 2YY7A 3VTZA 4WCDA 2HMVA 4NIMA 4QUKA 3NGLA 4GWKA 4BUCA 4A03A 1E6WA 3MTJA 4IDBA 1JU9A 1DIGA 3ZNPA 3O8QB 3GNQA 4E6PA 4ZQFA 2EKPA 5JW6A 1HYGA 5KIAA 1B8PA 5KOIA 3INGA 4J1NA 1PWXA 2NQTA 2NVUA 1UZLA 4ZA2A 3RI3A 3WBBA 2X5KO 1B16A 3D64A 4KDEA 3W6ZA 4CJXA 4P38A 4GL4A 3AOGA 1WNTA 4PRLA 3BMNA 1RM0A 4BGVA 4YJFA 1T24A 2EF1A 4MO2A 2DPGA 3TFQA 5IXSA 3GY0A 4D3SA 4YJHA 3B1JA 4IQGA 4D44A 1IOLA 1RPNA 2Q49A 1UAYA 4XRGA 4YWJA 4NHEA 4P8RA 4CM9D 1Q2XA 3HZZA 2HU2A 4FQ8A 3WNQA 3RBZA 1KEUA 1K89A 1O5IA 4O6VA 1YQGA 3C1TA 1FXSA 4CMEA 2CNBA 5FEUA 4XD2A 5F3RA 3LYLA 1I30A 4II2A 1Q7BA 1NR1A 2QHXA 3OQ1A 3HB5X 3IJPA 7MDHA 4CLOB 1R4MB 1EK5A 1HE2A 2ZTMA 2V6FA 1VLLA 2GGSA 4J1QA 3BZUA 1FJHA 3NYWA 3H6KA 3ZWVA 4NMHA 2VYVD 4E12A 1F8GA 3NT4A 1DFGA 1B2LA 2B4TO 4AVYA 5ITWA 1I2BA 1MX3A 1YONA 1EE9A 3OMLA 4IJVA 2Y1OA 4WASA 4XX0A 1ADFA 1SCUA 3GN1A 4LN1A 3ZU3A 4BNIA 5JC1A 3RUCA 1V9LA 3GG2A 3U9LA 1EFKA 4JP2A 2HK7A 1QV6A 3W4IA 3WGZA 1JAYA 5IDYA 5I7FA 2WYVA 2BFPA 1P77A 1R6DA 4NH4A 2HJRA 4KUGA 2DFDA 5TIIA 1WWKA 4CV2A 1EVZA 3NJ4A 2BHLA 1B26A 3IP1A 3BHJA 1ISJA 1AHHA 5GMOA 4E33A 3TRIA 4MVJE 4FW8A 3H9QA 1U2GA 3OJEA 4UEOA 1D4FA 3JQGB 4XIYA 5TC4A 2ZB4A 3GAFA 5T8KC 3I9NA 3GZNB 5IDXA 3PHIA 4R4JA 3ZHXA 4Z6KA 4YBZA 3JQFA 2FR0A 3BMOB 4NBUA 1E3LA 3PTZA 3VH4A 3X2FA 1KEPA 5A5FA 3BMQB 3WX0A 1O6ZA 3DBLA 3H5AA 3FBGA 3WLFA 1Y9EA 1LSJA 2P9CA 1IY8A 3G49A 5H82A 3WR5A 5C7OO 1R4MA 3EK2A 1PS8A 4D0RA 5G0TA 1MGOA 3STHA 5G0WA 4DBVO 4EUEA 4NBWA 3I9MA 5FYDA 4HNGA 5K6AA 4E2XA 4PLTA 1H2BA 2Z95A 1WMAA 1HWYA 3GT0A 4E13A 5KNLA 2O23A 3I83A 3ROKA 3M6IA 3GF4A 4E31A 1HSOA 4D41A 1P1KA 2YUTA 4NBVA 1F14A 1PJTA 1OOEA 2HMSA 3DL2A 1WXDA 4H15A 5B12A 1B15A 5BSFA 4BGIA 1BXKA 1IZ9A 1T1RA 1I3KA 1ZEJA 3F47A 3IJRA 1BDMA 4ND3A 3U09A 4XQ9A 4U7WA 4XRRA 5K9ZA 4IGFA 1DDOA 1GCOA 3JQ7B 5DBIA 1DBVO 1AXGA 1NP3A 3K31A 2J6IA 2AQ8A 2B83A 1LI4A 4M87A 2FPPA 3QWIA 2PZMA 1XU9A 3K6JA 4MIOA 1XKQA 3M1AA 5L45A 3QW2A 2Y1CA 2ZB3A 1E5LA 3QVSA 2OL4A 1P1FA 3FR7A 1DXYA 2CF6A 4IJWA 3TQHA 3CMCO 3ETEA 1QP8A 3VZRA 1NR7A 3SEFA 3CZMA 2UV8A 3GUCA 1HZJA 4N5MA 3NV9A 1E92A 3DWFA 1V3TA 1MP0A 2OOSA 3VKUA 5JDCA 1J6UA 1SB8A 3RFTA 4H3VA 2FR1A 4CR6A 5A02A 5IDQA 1HDOA 5EN4A 1KVRA 2EW2A 4URFA 3JV7A 4QXMA 3CXRA 3KZVA 2X9GA 3CKYA 1VM6A 4CQMA 5KVSA 2B4QA 3PVZA 3NTRA 5ER9A 3I4CA 4J7XA 1K5HA 3EVTA 5JAZA 3U4DA 2X0IA 3KLPX 1PJLA 2D5CA 4RL6A 3VZSA 2VUUA 1MC4A 5FWNA 4BO2A 1CF2O 3GFGA 3WNVA 4XYLA 2W2LD 3DFUA 2GF2A 2J8ZA 2VNSA 4LSMA 4GX5A 3VOSA 3ZI0A 3T4XA 1Z7EA 3PYLA 4J90A 3FCOA 3SX2A 4FFMA 1MXHA 1KC3A 1LEHA 1H6AA 4RPHA 3WMWA 4OO3A 1Y81A 4R9SA 1RM5A 2VCYA 5A03A 3JQBC 4Q3DA 1X7HA 3L4BC 5HS6A 4OQYA 3WS7A 2PZKA 4ZD6A 5EESA 3L0DA 3LT0A 4G2NA 4A5OA 1PZGA 3DBVO 4CM5A 4XQGA 1YQDA 2JJYA 2VWGA 1TI7A 2ZYDA 5FI5A 4CV1A 3VZPA 4YAIA 2A35A 4IINA 3ZDFA 1Y9AA 3O38A 2PFGA 4MVJD 2CDCA 3INRA 4PLZA 4D0SA 3JQEA 1N8KA 4A0SA 3WYCA 3KUXA 4RPJA 2NNLD 1Z82A 1DB3A 1PU2A 2ZCVA 2PR2A 4OSOA 4AFNA 3C1OA 4B7UA 4ALMA 1T2AA 1GEEA 1KEWA 4YAJA 3C7DB 3UH1A 2WJPA 4J43A 1YH3A 1HDXA 1J5PA 4I5DA 3MJ4A 3TN7A 4CMIB 3OBBA 1LC0A 4M54A 4Z0HO 2WYUA 4HWKA 4PLYA 4PG8A 3WFJA 4DIOA 2QRLA 1PJ2A 3IC5A 3F3SA 3FWNA 1EUCA 5TQVA 1P33A 2UAGA 2J3HA 5ILGA 4XYMA 1P1RA 4YTEA 1ZK4A 4X54A 3VDRA 1EBUA 1GPDG 2JHGA 2X58A 1F8FA 4FJ2A 4ZN6A 4XQEA 4OOFA 2NM0A 3GQVA 4ZJUA 1KC1A 2VYVA 1C1DB 3RUFA 2AE1A 1EZ4A 3CMMA 3ZGYA 4R1NA 1FDSA 3RC1A 2PZLA 2Y1EA 5EQFA 5HWSA 2GYYA 2NQ8A 4DYDA 3DHYA 2EHDA 2O3QA 3PI7A 3SVTA 1GCUA 1HTBA 1ENYA 3WIDA 1R66A 2PNFA 5KVVA 4E5YA 1DAPA 3NTQA 4XYBA 3ANLA 3TZKA 3VH3A 1J4AA 3WTBA 1JVBA 4E21A 4K1LA 1LRKA 4BKPA 4EJMA 5AYVA 3KEOA 2HJSA 1YB4A 5TNXA 4YPOA 2VNAA 3ANMA 3HDYA 3ZWOA 4ALLA 1SMKA 3GR6A 4Q3CA 2GZ3A 3NGXA 4TZTA 4B4OA 1R12A 4FFPA 3L07A 4NJOA 3QVTA 4KDFA 4L75A 3KTDA 1HSZA 1IB6A 2JCXA 5IZCA 1X14A 2Y0DA 1JWBB 4NU6A 2Q3EA 4F6CA 4CM3A 2OGUA 3I1JA 3W8EA 1DOHA 3C7CB 2DFVA 1XG5A 4MOWA 3IIEA 5GY7A 1TT7A 5IN4A 4FOSA 5LDGA 4J9VA 4RLSA 1PQUA 5DP1A 4W4TA 2C7GA 2HO5A 4XDZA 2YQ5A 4OQZA 3OHSX 1NM5A 4E5NA 4UEJA 1XQ6A 4R69A 4B7CA 4J9UE 3WYEA 1AXEA 5EQDA 1WVGA 1KERA 4XEHA 3IAHA 4EJ0A 2TMDA 2DT5A 2B36A 4CV0A 1A27A 2H1SA 5JAMA 2VRCD 1TEHA 4CQMB 3RC9A 3RU9A 3ST7A 1JLLA 4PG5A 1GFSA 2ZCUA 1U7HA 4WOKA 2WM3A 2Y0EA 3SJ7A 3C3XA 4DLLA 5DOZA 4DVJA 2ZKLA 3E1KA 1ZO8A 4D42A 1E7YA 4PVDA 4WUVA 4CMEC 3DOOA 4BO3A 3GOHA 3PYXA 4DMMA 2GD1O 4W7HA 2FSVA 1MB4A 2D5AA 3GUYA 1LLDA 2Q1SA 4RO0A 4FFRA 4ILKA 3E48A 2PKQP 2UVDA 4JX8A 1HDYA 1Y6JA 2VRCA 3ROPA 3E82A 3GHHA 1P3DA 3HUDA 3ONEA 5T64A 2NTNA 1JKIA 3ADPA 1YE3A 3D3EA 3DOJA 3NUGA 1ML3A 4HBGA 1WLYA 4AJ2A 3V2UA 2QRJA 2O48X 1E1MA 3BTUA 1XEAA 3PPIA 3TWOA 4HKTA 2IXBA 2VN8A 2VYNA 1E7RA 1I8TA 1PX0A 2BMAA 2O3JA 3GVHA 4GI2A 1IL0A 1CQJA 3F5SA 4AG3A 3WOHA 3OJLA 3UW3A 3VVBA 1XQ1A 2XXJA 3K5PA 5A06A 3L77A 4NJMB 1E1KA 4WNIA 2YJZA 4OM8A 1PJCA 3PHJA 2B35A 4YAEA 3WQRA 1ZSVA 1B3RA 1U4OA 2NU9A 3HQ4O 4FSHA 1IHXA 1VL0A 4DL9A 4MIEA 2P91A 3NJ8A 2BLLA 3PQFA 1BG6A 4NJMA 3PFFA 2QX7A 1XA0A 3AU9A 4JNKA 3F4BA 3RIHA 3H5NA 1HT0A 4DQXA 4YT8A 2IEBA 2QRKA 4AJKA 2X22A 4WJZA 1E3EA 1QLHA 4RPLA 2HDHA 3TZCA 1PZHA 3WGTA 3JD1A 5G4KB 4J6FA 3F6YA 4A26A 4R1UA 4EI2A 4CUKA 1JTVA 1V3UA 5U9CA 2Q46A 1OI7A 2QG4A 2Q99A 3B1KA 3PP8A 4Y8VA 3AM4A 4M49A 1ZXLA 4QO7A 1WMBA 1LDGA 1U5AA 2NACA 3IS3A 1CWUA 3PZBA 1EK6A 3R6DA 5L3ZA 3FSRA 1IE3A 3RQSA 3F5QA 2ZB8A 3FWZA 1M76A 3R3JA 3BMQA 4E2YA 5KJFA 1ZIDA 5AXBA 2GDZA 2GUGA 4MVJM 4WNCA 2OP0A 3EUWA 3BMOA 6LDHA 4CM1A 4WLOA 2GLXA 3H7AA 3QVWA 3LC2O 4R5HA 4RPGA 2DPHA 4FFLA 4JXKA 4C4OA 5TJ9A 1D7OA 1DIBA 2O50A 4GLOA 2D3TA 5HS4A 3AUUA 1P1JA 1BXZA 4RZIA 2Y93A 1AE1A 3CTMA 1OMOA 2YV2A 1IZ0A 5CG2A 4BV8A 5DBFA 2IYPA 1U3TA 4HV4A 3SJUA 4UUMA 4O1MA 4TKLA 4YJGB 2DU8A 4BO5A 3JQAA 4CODB 3MJVA 1JQBA 1X13A 3KSDO 1QMGA 1SPXA 5JAQA 3V2HA 2I3AA 2J5RA 3EAGA 4YDRA 4QSMA 1ZJZA 5FI3A 3X2EA 1GEGA 1ZFNA 4F45A 4PN3A 1DIAA 3NDIA 1KIFA 4RDIA 4CUZA 3QVXA 1ZW1A 1GY8A 4MVJA 4W82A 5L53A 1P9LA 4XGIA 4AJ4A 2BGLA 3DMTC 3AI1A 5LCXA 1H6BA 1U5CA 2BRUA 3D1LA 5EERA 6ADHA 1NQOA 3GAZA 1EBFA 5B4TA 5CPFA 1KYQA 1TB4A 1B8UA 1H9BA 4I9NA 4MINA 1Y8RB 3BIOA 3FD8A 2IE0A 3C24A 1E1LA 2C29D 4BNYA 2W8ZA 1ARZA 2X0JA 3KLMX 1M66A 2D0IA 2X5OA 5A05A 3PHLA 5HTOA 1E6EA 5B37A 2Z5LA 5C37A 1CERA 8ADHA 1Z45A 5ICMA 4IMPA 1PGNA 1VSUA 1XR3A 3K8ZA 2C54A 3JD0A 3K96A 4YJFB 3S2EA 1TLTA 2P5UA 1LNQA 4KP7A 1R16A 5AXDA 2VZ8A 1SAYA 4M1QA 3ZV3A 3NRCA 3F9IA 4D3FA 2H63A 1HZZA 1NVTA 3WFIA 1EVYA 1ZEMA 1NQ5A 4MP6A 4WOJA 1ZK2A 5L7WA 2QW8A 3W1VA 4ALNA 2R2GA 3D4NA 1AGNA 4NPCA 3G3EA 3GA0A 4WCFB 3QE3A 4U8GA 2VZ0A 2X7HA 4GH5A 1Y5MA 2VHWA 4O5OA 5I8ZA 2B4RO 5DBGA 2P68A 1MV8A 1VJTA 1N2SA 1B8VA 1PGOA 2TMGA 3H3JA 4AICA 2D4AA 4ZGWA 3DMTA 3RKUA 1Y8QB 5A3JA 1GYQA 1CRWG 4KMSA 4RVHA 3GDGA 5EMHA 5FF9A 1LQUA 1QR6A 5ES3A 1TA4A 4RVDA 2RHCA 1CDOA 1N1EA 4CL3A 3RKRA 1YRLA 2W4QA 4L4XA 5IJZA 3E03A 3ROQA 4EW6A 2DC1A 2UUPA 1I5RA 2EERA 3DO5A 3JQ8A 1N7HA 4PGFA 1X15A 2NTJA 4TSKA 1HYEA 3UN1A 5I8WA 5DF1A 3AU8A 4WPGA 3OETA 3QV1A 2Y05A 2POQX 2DTXA 4PLGA 1JVSA 3FTPA 4R16A 5BQFA 4R3WA 1JKFA 2ET6A 1KS9A 2H9IA 2VWPA 3I23A 4JBGA 2WD7B 2Q50A 4DMLA 4DTIA 3HN2A 2AEFA 1H6CA 4JJFA 4MIYA 2ZTVA 4CM4A 2H6EA 2VYND 4A73A 1LQTA 5KJ6A 3IKTA 1KBZA 1LDBA 1ID1A 2J5KA 4BNNA 4HADA 1S6YA 1PZEA 1HLPA 3JQ9C 3U0BA 3E18A 2E37A 3LF1A 2HMWA 1WZIA 5JLAA 5MDHA 4XR4A 4R54A 1ZMOA 3LQFA 2JD0A 4BB5A 1PR9A 2DTEA 5JS6A 3DAPA 5THKA 5K6AC 1TVEA 1DC3A 1F0YA 3RJ9A 3IL2A 4YA6A 3LK7A 1PS9A 5DULA 1K6XA 4RQUA 4BMVA 2P9EA 4TROA 5I9NA 1I2ZA 1L7EA 5TT0A 1U7TA 1KOLA 5IF3A 1EE2A 5CP8A 3K2EA 4J1SA 3E6AA 1U8XX 3CINA 2P4HX 3QWAA 3SC4A 3DZHA 4OSPA 4U0KA 5L95A 1N9GB 4L0QA 3FNFA 1C1XB 4YAGA 3N74A 2PTGA 3G1TA 3I9OA 4L4RA 1X7GA 4KTVE 4QTZA 3SBOA 2UUOA 1J0XO 2G0TA 2A92A 2PY6A 4IDFA 2QZ9A 1I24A 2AEMA 2EJWA 3DBRB 4ZRNA 1DIRA 1BRMA 5B4VA 4M8SA 3WQQA 1UP7A 3H9GA 4B79A 4YR9A 1LLUA 5F5LA 2JD2A 1H9AA 5G0SA 3BA1A 2Y66A 2Y1DA 3HJAA 4ALJA 1M6HA 3Q2KA 4DWVA 9LDBA 1JDJA 1PZFA 4FS3A 2NTVA 4HFJA 1W0CA 1NTOA 1R0KA 3QWBA 3ICPA 5L7YA 2DUWA 3IDSA 3ROMA 4YT2A 2BGMA 4R01A 4Z0PA 4AJLA 3WXBA 3HDQA 3JYLA 4Q9NA 3DAGA 1LTHR 4W6ZA 1ISHA 2GN9A 2C82A 5BNIA 4CM8A 1ONOA 1VKNA 3G17A 4RVSA 3S1LA 3ENNA 3VH1A 2J3JA 2IDZA 3C85A 3M1LA 4CMJA 3K9QO 4XWYA 4J4BA 4ND5A 5KJCA 4FFNA 1CETA 2O4UX 3WB9A 1KETA 4PG6A 1PIWA 4P4GA 5LC1A 5TT1A 3PHGA 3KB6A 3WJ7A 4G81A 1RKXA 1CIVA 1E3JA 5KJ1A 3G0OA 2Q1WA 3BMCA 2SCUA 1N92A 2CY0A 4J3FA 1XHLA 4I8XA 2A94A 3PRJA 4J4TA 4E5PA 3QQPA 5GZ1A 2W2KB 4JP3A 3GC6A 3AFNA 2O3TA 4UVGA 3JQFC 3V8BA 4CM8B 3PFWO 3PLNA 5BSHA 8LDHA 1NFRA 2HCTA 4OYRA 3I6IA 2WTBA 2RBEA 4CM7A 1GUZA 2C7VA 2ILTA 2UYYA 3FBTA 4EJ6A 1E3IA 3ZW9A 4WKGA 1ISMA 1Z6ZA 4EUFA 2IZ1A 3ZZNA 4ROSA 4BKRA 3VKVA 1ZKMA 5JXWA 4JN6B 4IS3A 4AJHA 2O4CA 4BS9A 2EXXA 5TF4A 4K6FA 2X0NA 1NX6A 1VSVA 3BYZA 1I01A 4DREA 3C1AA 1DC6A 3LC7O 4MVJH 4DPKA 3P2OA 3QVOA 1B0AA 5BNTA 2G17A 5KCZA 3PZRA 3Q2IA 5G2OA 2BI7A 1SOWA 3OH8A 4FFOA 1Y7TA 3VDQA 3DBRA 1M6WA 5IZ4A 3RROA 4XA8A 4B3IA 1YS4A 3RVDA 3QWFA 3ZCXA 3ZW8A 4E2ZA 2C2XA 3JTMA 1PEDA 2E49A 4G5HA 4MKXA 1GYRA 5CDTA 3GRPA 1MFZA 3F4LA 3DZJA 4QO8A 1A9ZA 1CJCA 3RJ5A 3GPDG 3UHAA 4AJ1A 1KEVA 1K3TA 3ORFA 5CAEA 3PWSA 4UULA 2JD1A 2VOEA 1V6AA 1DPGA 5KJEA 3V5NA 3ZU5A 1M2WA 1PWZA 2VOJA 4ALKA 4PLFA 3SC6A 5A4DA 4DC0A 4N18A 1XSEA 4NR0A 2AW5A 2V6MA 4FPXA 4RZHA 2CVQA 2CSUA 1IHYA 2P9GA 1ULUA 3BTSA 1TXGA 1XCBA 3CEAA 4W7IA 3CUKA 2OORA 3GPIA 1YOVA 1BWSA 4MP3A 1I0ZA 3AUTA 4OXNA 5L4SA 1C3VA 1T2FA 4ZU3A 4ZICA 3GVIA 2Z1NA 4IJUA 4J49A 1E7MA 2CVOA 1PGPA 2FZWA 2OO5A 4LVUA 4OXYA 1SZJG 4BNVA 3UICA 1Y5RA 1XDWA 3D7LA 2NWQA 2H5LA 3AOEA 4FC7A 1YXMA 4BNMA 1EQ2A 2YV1A 3KEQA 3TF5A 1T2DA 3NAQA 3JD2A 4UUPA 4CLRA 4TKMA 3OF2A 1EDZA 3JQ9A 4RJTA 4DQUA 1A7KA 1WDKA 4QQRA 2ZK7A 3ZWBA 4GX1A 1NVGA 1JWAB 1ZH8A 1Y1PA 1GZ6A 1UXHA 2NLOA 1PJQA 1NNUA 2WD8A 3BTVA 3GGPA 4JGBA 2X9NA 3JYOA 1NASA 2WYWA 3ADOA 1BTOA 2I6TA 4GMGA 3WLEA 1BGVA 4PLHA 5KVCA 2O7QA 1U9JA 4LGVA 4FGWA 2X9VA 4CMAA 1S7CA 4IXTA 4R41A 4TRRA 2V7PA 3FPCA 5A1TA 1ZXBA 2DQ4A 4UVIA 1R0LA 2PLAA 4IIVA 2X1HA 4RQTA 2XF8A 5EINA 4FOOA 1BSVA 2NU6A 2PA3A 3EMKA 2HRBA 1SOVA 2A4KA 2JFFA 1MUUA 3DZIA 4GVXA 1PJ3A 4PZCA 3P19A 2E48A 2BFOA 5T5QA 4J7UA 3RUEA 1BVRA 1AHIA 1WPQA 2R6JA 4FDAA 4BGUA 4CLEA 3WWYA 7ADHA 3JQDA 4WLUA 2IXAA 4ZQEA 4P4LA 4FBGA 4GKVA 2P5YA 2FR8A 1ZMTA 1R4NB 2NU8A 2EWMA 3V1TC 3UOGA 4DGSA 2O2SA 1A9YA 4FCCA 4I5FA 2CFCA 3GRKA 1SO8A 4L76A 4ZQHA 1ISFA 1ZUD1 4GVLA 5ITVA 3ASUA 3VH2A 2AMFA 2Z1MA 4O63O 2A9FA 5T67A 3U3XA 3UCXA 4YVFA 2BELA 2V6BA 4PZDA 4KOAA 4BMNA 2VHXA 4W99A 1I32A 1U4SA 3T7EA 2ZATA 3GVXA 4WE3A 3JQGA 2HSDA 1OFGA 4OOEA 5DCWA 4UVEA 4YACA 2EEZA 1EVJA 3BHIA 3DR3A 3LVFO 1LUAA 4OIMA 1E1NA 3G1UA 4E32A 4DIFA 2YHIB 3A28A 1T2EA 1QG6A 1GTMA 3IKVA 2Q2QA 4U6QA 4NBTA 3T4EA 2YFHA 1B3BA 1YKFA 4Z9YA 4EYEA 1GQQA 2VHVA 4NBRA 2QZZA 3ZH2A 4EEXA 1KVUA 1LJ8A 1B7GO 1NQTA 3LDHA 5GZ3A 4BO8A 2X0RA 1WP4A 2HAEA 2HKIA 1NPDA 3JYNA 3PEFA 1LSSA 4DA9A 5H83A 2JCVA 1BW9B 4BO4A 1LDMA 4BNJA 3L9WA 4DXHA 2CMDA 2VTDA 4O0LA 1PS0A 1MFPA 3L4BA 4J7CA 2OP1A 4B7XA 1H93A 5JO9A 3GVCA 4CLHA 2OHXA 4E0BA 3CH6A 4MVJI 2FP4A 5CDSA 1A71A 4MKRA 2B5VA 5L4LA 3R1IA 5ILOA 3GEMA 4I5GA 3ZWMA 4UEKA 4PLWA 4R68A 1EMDA 2AQIA 1U8FO 3JD3A 3PWZA 1RYEA 3WTCA 2P2SA 5U4QA 4L4SA 3I5MA 4IY1A 3TNLA 3V1YA 3IUPA 1A7AA 2NVUB 1DFHA 3EZLA 4U6SA 5F21A 4PCVA 3OQ6A 5DP2A 3C8MA 2DAPA 1SBYA 3DEYX 1PL8A 3RUIA 3AK4A 4R1TA 3R3SA 2F1KA 3BMCB 3KHUA 2PKRA 3FRJA 4ZQGA 2IODA 2Q2WA 1ZK1A 4NK5A 4TVBA 4UVHA 5BNFA 1KY4A 3LZ6A 3Q1LA 1QLJA 3Q11A 4XJSA 3A9WA 1E3SA 1HKUA 1JW9B 1FMCA 2YQ4A 4YJDA 1QYVA 1T25A 4FB5A 2NU7A 3PIIA 3QA9A 4ZQBA 4I1IA 1MLDA 3FN4A 4YRDA 2AQKA 4KWHA 2LDXA 5T6BA 3ZWYA 3HG7A 1HETA 2OBNA 1WDLA 1LU9A 3WMXA 2BKAA 3AY3A 1XELA 2AE2A 2C20A 5MGBA 4IZIA 2HRZA 4ZRMA 2B0JA 4BQRA 3EZYA 1I3MA 2QQ5A 2FPIA 3QY9A 4IMRA 3D4OA 5EJ2A 1W6UA 1HEUA 4Y6PA 2Y1FA 1PJBA 4FD3A 5GZ6A 4INAA 2RCYA 3DDNA 1HE3A 2NSDA 1LXCA 1T4DA 2O2YA 3ASVA 1QYCA 4YT5A 2Q1UA 5THQA 1TT5A 1NQAO 2Q1TA 3RC2A 3PJDA 4BHTA 1LSOA 4TZKA 4J0EA 3HNPA 2V6GA 1CQIA 3MCVA 4B8ZA 2ZTLA 3DBHB 1QXSA 4Z0TA 4PFJA 3VVCA 3H9UA 1HF3A 3H65A 4PG4A 2YW9A 3TFOA 4WLEA 1PTJA 4YT4A 4BNFA 1WZEA 1YGYA 1U2DA 3K2BA 1SC6A 3R0IA 1NFQA 3NTOA 2WMDA 4U0JA 1SNYA 2C59A 1QORA 1PQPA 3I4FA 3AY7A 1U3UA 3PJEA 1FDVA 4XQCA 5T8KA 2OBYA 1OZAA 4LK3A 1ZK3A 5AOVA 4IDDA 5BSGA 4UVDA 4BL5A 1BDBA 4R1SA 1T2CA 1DJNA 3IMFA 3DZKA 4OHUA 4L73A 3TZHA 3WICA 4EUHA 2EKLA 3RFXA 1GDHA 1DC5A 4DPMA 4S3MA 5JC8A 3N7UA 1EQUA 3CE6A 4OL9A 3RD5A 1YBAA 3FNGA 1DC4A 2O3UA 3OSUA 3Q0EA 1LDNA 2YV3A 3Q9NA 3AI2A 3TZ6A 4BKQA 2UDPA 2VUTA 3D3WB 2D1YA 2OZPA 4W9NA 4P22A 4PLPA 2IZ0A 1QYWA 5DOVA 3OJFA 1A4IA 1Q0LA 3KSZO 1UXIA 4IIUA 5CG1A 4BGEA 1KY5A 5DCUA 1IPEA 4K26A 3FNHA 5I7EA 2HUNA 4NNJA 1UDCA 4KQXA 1YWGO 2D8AA 3E5RA 4MKZA 4AJIA 1R4NA 1Z73A 2C07A 2E82A 1D8AA 3PDJA 2NVWA 1EUDA 5IZCC 1C0IA 1UXJA 3HB4X 5F5NA 3PIDA 4ITUA 3ABIA 1HDCA 5AVOA 4YYZA 4XR9A 1OBFO 1KVSA 3JQ8B 1GUFA 4PG7A 5C7LO 1Y8QA 2AHRA 4XYEA 2XOXA 1Q0QA 4LMPA 4HFRA 4WCFA 3U5TA 2EGGA 4N54A 3W4KA 3P5SA 5L4NA 3S2IA 1OAAA 2AA3A 4LRTB 4E4YA 3KYCA 3WSVA 4CMKA 3Q6IA 2VHYA 4NFHA 2DM6A 1YJ8A 3KSUA 1X0VA 4RVGA 2PGDA 4JQCA 3VC7A 2GN4A 4ID9A 3PDUA 3GDOA 4O59O 2EV9A 1FK8A 2RAFA 3RC7A 3COSA 1H2HA 4BMSA 3KXDA 4E5KA 4J0FA 2GRAA 1R15A 1P0FA 4ND1A 2O7SA 3GEGA 2G1UA 3UF0A 1YDWA 4TWRA 4EITA 2NUAA 2PV7A 5G4LA 4B4UA 1XLTA 3ZWNA 1DHTA 2Q45A 4HP8A 4CMIA 5JSFA 4CLDA 1BW9A 1X0XA 3UCFA 3I9KA 4YEDA 3ZNNA 4BB6A 2BFAA 5AQ1A 4IDEA 1NHGA 3OJ0A 1U3WA 4MVJG 1XIVA 2HLPA 3BAZA 2IRWA 4HY3A 1E3WA 2FN7A 1LRLA 3I9JA 2AEJA 3D4PA 1W4ZA 2JAHA 3ZWCA 2RHRA 3KM0A 3VPSA 1EDOA 3HDHA 1ZNQO 2FWMX 2ZB7A 1WDMA 1MG5A 5B1YA 5EPOA 4NFYA 4PVCA 1JA9A 3H5RA 4GX0A 5JY6A 3EDMA 3IQDB 4II3A 1NXQA 3LLVA 3PQDA 1RM3A 4E5MA 4DBZA 4B4WA 1A4UA 1I10A 1Q7CA 1YL6A 2YHUA 4OJNA 2OXIA 5L51A 3HE3A 1GUYA 3ON5A 2JFHA 5JY1A 3WBFA 1IUKA 5DDIP 4DLAA 3FR8A 1PGJA 4XCVA 4OH1A 3NX4A 2GCGA 4OKIA 4IM7A 4OAQA 5A5EA 5J23A 2CD9A 3ZV4A 2BF7A 4BO0A 4RLHA 4YJGA 1E3WB 2W98A 3B20A 4FC6A 3JYQA 2YYYA 3CPSA 4GGOA 4JBIA 2GN8A 1BMDA 4JBHA 3GMDA 2DBQA 4Q39A 1LDYA 1DFIA 2CDBA 2CZCA 2PWZA 4BNUA 3TJRA 2VT3A 3ZHZA 1H94A 4CMBA 4IDGA 1DAOA 3LU1A 3NT5A 3WDSA 4QX6A 4AJEA 3TDKA 3ONFA 1L1FA 1H5QA 2CDAA 3E9MA 3K30A 1PR3A 3WJAA 4EZBA 2W90A 3B6ZA 1VL8A 4BO6A 3SXPA 1PSDA 3EYWA 4KUEA 3WG9A 3U4CA 3LT2A 4GWGA 4BNKA 4A27A 1UZNA 3PYMA 1NYTA 3BMNB 1P0CA 3UXYA 4JROA 1J49A 4GSLA 3E9NA 4AJJA 3EVNA 1SEVA 1E7SA 1Q0HA 2O3SA 3TOXA 3A14A 1W73A 3PWKA 4E3ZA 5CDGA 1DLIA 2E6UX 4J91A 1HLDA 3WGIA 2B69A 1Q7GA 1DRVA 3AUSA 3CSDA 2EJVA 3MJSA 3WGHA 3WGQA 2I9PA 1H6DA 1GU7A 2B5WA 1PGQA 4CLXA 5JYEA 3F1KA 2WWRA 4LSWA 2DUUA 4WLNA 1ZSYA 4Y6RA 2ZJ1A 1UP6A 1P1IA 4AJOA 1UJMA 3F1LA 3UGKA 4S1VA 3ZWPA 1ZK0A 3JD4A 2VZ9A 3S2FA 3TL3A 3HADA 4PLCA 5ENDA 3FHLA 1U1IA 5DT9A 1MC5A 5JFOA 2C5EA 3O4RA 2GPTA 2PGLA 3AY6A 1FDUA 3MWDB 3TOZA 4D43A 3AWDA 3RWBA 1VE9A 1R37A 1IYZA 2GERA 3NDRA 4IZHA 2I67A 5L7TA 2NV6A 1O0SA 4KQWA 5T57A 5U1PA 3U62A 3HSKA 4Z3DA 4LW8A 2HMTA 1M75A 4DQVA 1G0NA 4IQ8A 4RF3A 4HFMA 4BQPA 4J2HA 1UR5A 4R9RA 3DZFA 3OFSA 2JFGA 5HBRA 5L9AA 4BNLA 1I36A 1NPTO 5TLSA 3M2PA 3TL2A 4NDNE 3JCZA 2GNAA 3D3WA 4WEQA 3RFVA 1GQ2A 2J5QA 4H7PA 1V8BA 4N5NA 4D46A 4IDCA 3WGYA 1P1HA 5A9SB 3D5QA 4IJKA 3IP3A 3ITDA 3OM9A 2WEKA 1ADBA 4ND4A 4MVJF 5TRTA 3DB2A 3ZNOA 5COQA 5AXAA 1T1SA
chains in the Genus database with same CATH superfamily
2W4MA 4I4TA 4MDHA 3RK0A 3VAZA 3ZXSA 4EZEA 3U19A 1RPJA 3VPAA 4MR8A 2BP7A 3EOBI 3H1EA 4GD3Q 5AKEA 1IPFA 3JAKB 2BR3A 1QC5B 2HLNA 2Y71A 4EMTA 5IASA 3SVLA 2VDKB 4BXOB 2C3OA 4IDAA 1FBNA 4Y6SA 1CHDA 2Z8XA 3V4PB 4B4VA 5KHAA 1ZUHA 4CEIB 4RYLA 3AGQA 1W5SA 3NWEA 3MJTA 1E9FA 3U80A 1Q3HA 1WZCA 5FTKA 3UPTA 2V3CC 2A7QA 4A23A 3A6FA 5HZKA 1UJ4A 3AI3A 1VCHA 2R44A 1GD1O 1YR2A 2QR5A 1IULA 3HB9A 3L05A 4O4JB 4QL3A 3ND6A 3VU9A 1DKLA 2Q3DA 3QKRA 2XPCA 3FHOA 2EIHA 4F84A 3UJNA 2ZP1A 2GZ1A 4MWDA 2OZEA 2CNDA 3A31A 4F4DA 5GWXA 4EDFA 3PRHA 5SYAA 3W3ZB 2JCYA 4BVAA 3KHSA 1IH8A 3KYDA 3LWNA 4MYDA 4Q1EA 5CLIA 3TO5A 5SZJA 3A2MA 1B14A 2HFJA 1IVSA 4YV7A 1NBOA 3OZDA 5DLEA 5BN1A 3WLHA 2FFAA 2ZEJA 3U7RA 2QJTA 3USZA 3LDGA 4NESA 1E77A 2BGUA 2P35A 4RVFA 1MRSA 1YQUA 3BK2A 4R8LA 5FBKA 3RUDA 4ZCMA 3HHPA 4IX9A 4DMKA 4NG5A 4FINA 4EHHA 5A04A 3LSYA 3RNOA 4UHFA 4EKIA 3IP6A 3D8NA 4XI9A 1YHYA 3AHHA 5EJMA 3K32A 3M1YA 1MAVA 3RRZA 2M32A 3D1JA 4ZVNA 3SQOA 3SFTA 3LOQA 3THYA 1JYEA 2Y0BA 4Z9AA 4EHBA 1WM1A 5EHGA 4KGDA 1QNFA 2OV3A 3B1FA 3P9KA 1GR0A 1WU7A 5IAAA 1QZZA 3CZCA 3DAFA 3HYTA 3LLSA 3RH0A 5HCUA 4RTRA 3H13A 1KQNA 2YWBA 2QTMA 3GCXA 4TKUB 2VP9A 1Y82A 3NBXX 4C2AA 5JBIA 1PG2A 2BKLA 2L69A 1XVIA 4HRVA 4Y1FA 4Y98A 3VR5D 5I7RA 1RKUA 4W5HA 1SGWA 2O1XA 2RGBA 1E9AA 3BN3A 1CYDA 2UKDA 1POWA 1HE5A 1IM5A 2JFUA 2NUPB 4MVYA 3STWA 3VR4H 1B42A 1J2EA 1FDRA 2FCAA 4NQZA 5JZOA 4RD1A 5I8PA 5JEDA 5CIQA 1OA0A 4DCMA 2MSCB 2P2ZA 3C0KA 4YXWD 2Y1GA 2W2KA 3DP7A 4RF2A 4B35A 3A6KA 5JSUA 1J90A 2F1IA 2FPGA 2G5PA 3M6MD 2GZMA 3M83A 3PPYA 2SCUB 1TUBA 4PAOA 4DMRA 1KARA 1JQKA 3Q87B 2VWQA 3GUZA 4NRDA 2PD4A 1G16A 1J24A 2V65A 3OECA 4KQKA 5LDHA 4G4JA 1VJ1A 2WUEA 1E2QA 3FFWA 4MUHA 5FLYA 5FWYA 3CV3A 2DMRA 4HHEA 4PYKA 5TQ2B 1L7VC 2FOIA 1YK1A 1YI0A 1GPJA 1ORVA 4DY6A 2JFNA 4GMDA 4RABA 1RXWA 2CUKA 1WSWA 1UANA 5K3SA 2CLHB 3M49A 3DF7A 3QJGA 1YZ3A 4PRKA 5FTJA 5JZVA 3JVVA 3LYAA 4Y7CA 2JIOA 4X3OA 3O26A 3S40A 5CPBA 4AO8A 5AUPB 4UDOA 4RLQA 4AMUA 4KMMA 2ISCA 4PFSA 2RK4A 2W0SA 2WJAA 4KSYA 4D9KA 4DDTA 4M46A 2G9ZA 4MS3A 4FEEA 3LT1A 3L7DA 2PIAA 4R1MA 4MUGA 3C3DA 3LGAA 1Q1ZA 3W5IA 4M1TA 4QLBA 2XE4A 3WLRA 2ZFUA 2BFFB 3DYVA 1A2OA 1O94D 1QDUA 1WEHA 9LDTA 4FWTA 2GSDA 2BWJA 1FFYA 2NZ8A 3AWIA 3UA3A 4NE7A 4MJLA 4LFAB 2FEPA 3D3KA 1F17A 4HDAA 4YUVA 5J5CA 4KG7A 3LBNA 3GOQA 4Q9HA 1DXHA 3A1NA 5LVAA 2FRDA 1M5UA 1CJUC 2OBFA 2Q3HA 3KB8A 4RK6A 2Z5VA 3FAZA 4ZFNA 2JI9A 1UDBA 1C4OA 3W90A 1M7BA 1XEFA 3H9BA 1PR1A 1W30A 2BM8A 4Y2JA 5JWOA 4IXWA 2QLFA 3FPGA 3HN6A 4F6LA 3GNSA 1LFDB 3UYLA 4C5CA 1F2UA 1Z22A 2GPBA 1ZBQA 4JJEA 4YLEA 4B09A 1E3MA 2OM2A 1RDFA 3IQHX 3Q3CA 4MR7A 3MCAA 4PYIA 4QEDA 4A7PA 5JCZA 2X6TA 3CRVA 2QA5A 2VRNA 5D51S 1H8HA 1XAJA 3ZLTA 2PH5A 1O9HA 3X1WA 4CF6A 2CXXA 1LA2A 2BHTA 1G6KA 1O94A 4IIJA 3LQ4A 3QU5A 4GLFA 3EH2A 4YMIA 3TCNA 4E15A 3BJZA 1HL3A 2P2NA 1A9XB 4BVLA 3HP1A 2QG6A 1J0CA 1YL5A 3QUBA 1M2EA 5SY9A 3I0ZA 1OSNA 4CZ2A 3OX3A 5F1OA 4Z8YA 4D4IA 4RESA 4FX2A 4KPFC 4DV7B 3Q7IA 4MR9A 2IYNA 3OOHA 1CSEE 3EXEB 5E9QA 4E51A 1BKYA 3KAKA 3GFBA 1EX6A 4L8LA 4V03A 3LY5A 5KSZA 2I34A 2A0KA 2V7XA 5B1SA 5HKAA 3MRVA 6PFKA 5HK9A 1YO6A 3BXFA 1XA3A 4CKBA 2OTCA 1Z17A 4X95A 3OFJA 2RG7A 4FDTA 5LU8A 4E5VA 4L74A 5AIBA 1I1HA 3HKCA 2V1XA 2VWHA 4FHZA 4K0KB 3DCNA 3QU4A 4YI3A 4EDHA 1XYGA 3LTNC 1PNQA 2BMFA 3O0TA 4NC9A 4A6DA 1FPMA 3QIVA 5CJPA 4XASA 2CL7X 1SD1A 1XVTA 1XWFA 2ZQZA 1R8QA 4R6WA 1G6OA 3TPCA 3RBXA 5LZ9A 5HFJA 1D1TA 4NYMQ 5IBRA 4OFWA 1TD1A 2HLDA 5CK4A 4YXWA 1F2DA 3QBTA 3LBIA 4WEOA 5E0OA 1VI5A 2QRMA 4D8UA 4P3NA 1XDSA 1M0WA 3T7CA 4YP9A 1TJYA 3CNQS 2BGGA 4BWFB 4EGFA 1P4HA 2CF5A 2FF5A 1P62B 3JARA 4EBBA 4A36A 1GV0A 1KEZA 1Z0KA 1UH5A 4QPJC 4IFIA 4A0FA 5A9RA 5KPJA 1NBME 2JGKA 3UY4A 4OQ4A 1A5SB 1TGVA 4GX2A 3IUQA 4AMVA 2F90A 1J9ZA 2J1LA 4J76A 4F71A 1RAFA 2FY8A 3G13A 4EO7A 1U0JA 2BI8A 4CNQA 1NWCA 2ZJ0A 4UZSA 2ZTUA 2HIAA 4PC1A 1PUXA 2H4XA 5JH7F 5EMJA 1TAGA 2WNSA 3GNTA 5DM1A 1DEHA 3ZCRA 4M1SA 5EKDA 1VG8A 3NEAA 4N5LA 3CHYA 4JDUA 4UNRA 1D4AA 1MXFA 2RARA 1PQ4A 2ZRGA 3S29A 2GR9A 5HYVA 5IVDA 3A1WA 1QH0A 4IBOA 3L1HA 3WYBA 4OBBA 3ZVRA 3PGXA 4JT9A 3PNPA 2I2FA 5D1HA 4YX9A 5DPMA 2XCUA 1TE2A 1A2KC 3NWOA 3QOYA 3I5UA 4EL5A 4K87A 2W2XA 2LPMA 2GO7A 1R5OA 3D0OA 3DTTA 4I1RA 4PIVA 1C8KA 5EIBC 3AUAA 3REFA 3NU1A 3E7PA 1I7QB 1W88A 4P9NA 1MA0A 1Y7LA 4PGHA 4AURA 4DKXA 2UYCA 3E35A 3GGGA 5HQTA 2ZIAA 3IUSA 3INTA 4ZCIA 3ZLBA 2QU7A 4EELA 2EC5A 3S68A 1AQNA 1S9DA 2FXIA 3C8ZA 2GHRA 3IQXA 2X5JO 1LF0A 1GM5A 4J2OA 1T2NA 1KAHA 5KTYA 4FNAA 3T1OA 5LIPA 1J5XA 4A2QA 3G2HA 3EQ2A 4ANFA 3FOZA 1U4NA 1A9SA 2C9ZA 3EG9A 4AL4A 4AI6A 1C0PA 3M82A 1SIOA 1E9RA 2D5LA 4RHCA 1JAXA 3JPYA 3HKCB 4NAVA 5WRFA 3JY6A 2O06A 4OJKA 3G79A 3OJOA 5SYNA 2P41A 2ZRQA 5IM5A 4Z3OA 1R0WA 4A6EA 5IWCA 2QLLA 5DBOA 5FPHA 3UMYA 4H08A 1A82A 5DH9A 1IVYA 4CMHA 1Q74A 3H2BA 1YCGA 2QKYA 1T13A 2HJHA 5J2UB 1E3DA 2MINA 3NVMB 3TBFA 2VC2B 2G71A 4I2VA 2DGDA 1GOTA 1KVQA 2YOHA 3VPGA 4K2HA 4R8MA 3UAGA 2DPMA 2FETA 1CT9A 4CNBA 5C2JB 5EHZA 1VPVA 1UJCA 3GX1A 5CFZA 4U1RA 1R4AA 1U2PA 2WKSA 2ZI6A 3GD7A 5ARDA 1L4NA 2QMOA 3AZPA 1E2KA 2GHTA 1BXGB 4YQZA 4P3YA 4B32A 4KC0A 3WKBA 3I6YA 1L1QA 1L3IA 2O0JA 3SVZA 5FUMA 2O8CB 3H1PA 4AU1A 3NOXA 1FFWA 4YDQA 2X8JB 3K7EA 1FFEA 3NOVA 4IIBA 4K6CA 4MP8A 5FO1A 1M1YE 4BTLA 2XA2A 1SCJA 3FAKA 3IUMA 2GK7A 2QM0A 5LP6B 5HM6A 2RKOA 1EIZA 3EC1A 2YZ2A 2VRBA 3LI2A 2BZ1A 4JHLA 3IA2A 5JXHA 2IBSA 1SUDA 6REQA 5CD1A 3S2GA 1IJKA 1ZN8A 1E5QA 1K27A 3GJRA 3ZD6A 1BKDR 1LPNA 2J3IA 4X3PA 1IN1A 2AUTA 3UPDA 1VP3A 3HP7A 4LOJA 1G21A 1GA1A 2NOAA 3DDHA 3U3JA 3NB0A 4JUIA 4R51A 1JAZA 3PPWA 1UDAA 3I09A 1M8FA 5G4KA 3V4SA 3KELA 1V41E 5GAJA 1T9ZA 5ICGA 2HK8A 2PXAA 1FS4A 5JYCA 2I03A 2GAJA 3EQ8A 1QKIA 4D74A 3NKVA 2A9PA 1LI7A 4ALIA 2FPXA 4IMIB 4N0PA 1E1DA 2G9QA 1NP7A 1ZQ9A 1FS5A 3IT3A 3HFGA 1ZSNA 2ZQYA 2FX5A 4FU0A 5K2MA 3CQ9A 3RHTA 5AVZA 3F78A 4ZDWA 1EG7A 2EU8A 3HC7A 4KXYA 1YBMA 1TAQA 1I14A 3HWWA 4HFNA 4F4UA 1D3AA 2M2IA 1TF5A 1OTHA 3BRCA 4HI0E 1N5RA 2PUDA 4HQRA 4KUHA 1W7AA 2CLMB 4FEGA 4R2XA 1I80A 4IRUB 5DIZA 3ZBPA 2BJHA 4D45A 2OUKA 3CUSA 1JE1A 4M0LA 5FI1B 1A72A 3IULA 1AV7A 1YDEA 1KXJA 5KAMA 2FX3A 4BN5A 4EJFA 5EJ4A 3IIIA 4ZARA 5D3KA 1KDRA 4JB8A 2XWQA 2VUHB 2EP8A 3ZZUA 3R7WA 1P7VA 3C87A 1QONA 4CMCA 4AO6A 1T2VA 3N2LA 4OCZA 1L3BA 3FYTA 4ITVA 2YIVX 5DISB 4DZZA 2IIBA 1KK2A 2YXEA 4FI3C 5E8RA 1ISGA 1C0LA 4D2IA 1HDRA 4ZVQA 4ZJUA 1M5RA 5AVKA 1NW5A 4G0VA 1CCWA 2PH7A 3KEFA 3OA2A 4YQYA 5HIIA 1NE7A 3E23A 1OI2A 4I99A 3I52A 2R4UA 5CT9A 2X0KA 2CGEA 2I99A 4GPD1 2PZFA 3AZOA 2HSWA 5JWRA 1PV1A 3BWDD 1XQXA 1EM8B 1P44A 3WYGA 3RR2A 4XKJA 5J59A 3CKKA 5FOVA 5DCYA 4BJ6A 3FNEA 1B8OA 1ZJYA 1YULA 2H4FA 3K73O 4G5QA 4GKBA 1SUEA 1Q16A 1U28A 4JI0B 4OM7A 3IB3A 4X93A 1ONPA 5LB2A 5IVPA 5BXQC 1TLLA 3Q5EA 4YASA 3F3KA 4M0UA 2LR0A 4KWIA 4M0KA 2BHSA 3DAHA 3F67A 2H17A 2J31A 4DIFA 1TNDA 3OIYA 4B6EA 3GDHA 5IP5A 3U44B 2O8BB 4GZ3A 4OXKA 2PGOA 1FF9A 1ZZGA 2DKNA 4M89A 3GLIE 3IUNA 4K46A 1FSZA 3DP9A 3R76A 2YY5A 2ZBRA 3LP6A 1E66A 1ZBDA 4OMUA 3D5TA 4QPZA 2CEAA 1NAIA 4JLBA 5JBQA 5EFZA 1A9PA 4FKZA 4EKYA 5JMWA 1C1YA 1RXCA 5G0VA 3WC4A 3VPXA 3H17A 4QNRA 3R5TA 3HEMA 2ACKA 3TNYA 2FHSA 4OEHA 2CXTA 1VI2A 3KXIA 5DM4A 1E94E 3DOCA 4LXUA 5AM0A 5AWFC 1W49A 3D6AA 4BNWA 5C5IA 5KU1A 3ZDCA 4PHFA 2PWBA 4N0QA 3DXFA 3G7SA 1VA4A 2BP7B 2QN3A 3HKBB 4RZUA 5EUQB 1RLTA 4O29A 1BDJA 1WXIA 1U2GC 1JKJA 4HNHA 4OXXA 3L0PA 3D7KA 1ZITA 1V0JA 4B8WA 4DZTA 2OUIA 2LXNA 1P45A 1UZMA 3VKFA 4LYDA 1Z56C 3EQ9A 1YZYA 2D7CA 3HXQA 2FW7A 3LQKA 3GLQA 4GZ6A 4PYMA 3WMFA 4D97A 5JDIA 1DRWA 3EW7A 2BEWB 3E9ZA 2C9BA 2ZB2A 1HRDA 2AKYA 3A11A 5ALXA 4PPNA 5EJ5A 2C3UA 1K8XB 3QXJA 1CJTC 4CV3A 1NU8A 1XZCA 3PKIA 4ZDKA 2OG2A 3OA0A 4IUYA 5DCLA 4B6OA 1X1AA 3QPUA 4FMCF 2YHAA 5K3CA 3L0YA 4RQAA 4UTNA 3DDZX 2ZRCA 2JEYA 3C2QA 4J0GA 5CT4A 1GCAA 5DVZA 4HTFB 4AC9A 3N2YA 3BCHA 4CCWA 5IN5A 3ZG6A 2H85A 1DRKA 4MVWA 4A91A 2CWWA 1H1DA 2JLRA 2XDAA 3FLEA 3K53A 5JROA 5KB3A 1R2QA 5B1HA 5I5GA 3RREA 4YQFA 1ST3A 4D0NA 2XCLA 4Y6LA 3RQIA 1PNVA 4R83A 1X1TA 1PD0A 5AP9A 1AN9A 4WN9A 4O4HB 1FVXA 3LUJA 1Q0RA 1VFPA 1SRQA 1OCEA 1ORTA 1YD7A 3C6BA 4MV0A 4AF8A 1JAHA 2W58A 1C8LA 3A4YA 3PQ6A 3TTYA 4BY9E 4GZMA 1YR3A 1X7ZA 4DM4A 1MT0A 3PFHA 1O6BA 2HMVA 2QTZA 4UDYX 4NIMA 3U6KA 4LRQA 2W42A 4CF3A 1ABBA 3T7KA 4KVFA 4TGLA 4GWKA 5GV8A 2Y1XA 2ZVPX 3HL0A 3DDOA 2ZAMA 3O90A 2Z3WA 1IN8A 1AKRA 4KIWA 4OQFA 1MTOA 1OPRA 2JI8A 1G7RA 3GNQA 4E6PA 4ZQFA 1JJ7A 3FCAA 3HO6A 5FT9A 2FZGA 3CU5A 5KOIA 1CBUA 2BCGY 2RMKA 3INGA 3QXCA 4BRSA 4JXZA 3M5CA 2IEYA 1IAQA 5GOTA 3NIWA 2CYAA 2JEOA 3N59A 3PCTA 4KDEA 1TTQB 4P38A 3W6ZA 4F2HA 1RJ9B 1XNGA 1XQYA 3AONB 4RHYA 3S5JA 4WNYA 3U7IA 4PRLA 1RM0A 2XLCA 3JRXA 4HAIA 2ZPAA 4YJFA 4I0WB 4XH9B 5JD4A 4MO2A 4RTSA 1U81A 1TU0A 3KKQA 3DAYA 4D44A 2OOKA 1IOLA 2QLNA 1CUCA 1NUQA 4QUIA 5I9TA 4NHEA 1XCPA 5AVQA 2JIZA 3HZZA 4TKUA 1ES9A 2DUNA 2HU2A 2O8DA 2ODEA 3FKSA 1KQPA 4QYMA 5ELLA 2N1MA 3WNQA 4EATA 3OQMA 3IJEB 4B81A 4DV6B 2H1HA 1Y42X 4HD8A 1XPUA 2P8SA 1RKVA 3M6UA 2QB5A 2CNBA 3EEFA 5CVEA 4CMEA 4Q4LA 4XD2A 5F3RA 2RGWA 1E99A 3K0KA 2HW8A 3EGWA 1WCXA 2P9YA 3PC3A 1H0HA 4V0ME 2ONKA 3IKJA 2H3HA 3OQ1A 4ZVUA 2GJ8A 3IJPA 5ADUS 1PEAA 4DR2B 2P78A 1EK5A 3DC7A 2ZTMA 3TVDA 3ICVA 1PT9A 4IFEA 4L3WA 2DECA 3BZUA 1YE8A 2J4CA 4UUQA 1MH9A 3NNDA 1DFGA 1B2LA 2P90A 3FPSA 5C5CA 2ZSFA 3CLHA 1E2EA 1YCDA 1MX3A 4FN5A 4IJVA 1EE9A 5EZQA 2BSXA 2Y1OA 4HUTA 4WASA 1WP9A 3GN1A 3IPYA 1DQNA 4LN1A 4JH0A 5ECYA 3GA7A 4MVCA 4XGQA 1FTWA 5F51A 1T9DA 1IWOA 1J00A 4M3NA 3RUCA 2DLNA 3ODPA 4L16A 3QKRB 2PUEA 4X1KB 1EFKA 1UOPA 3I62A 3UT0A 5ALHA 5C1BA 1QV6A 4X8LA 3WGZA 1CUUA 1T6BY 1WBJB 3HZRA 4ITRC 5H02A 3W2FA 5I7FA 2BBTA 4E4RA 3KZNA 3V1NA 4EHAA 1TTTA 4LG1A 4KR3A 2WYVA 2BFPA 2IX3A 1P77A 4MK4A 4RXMA 4TLAA 3SIRA 2HJRA 1OWMA 2WF8A 2BE7A 1Z5OA 1NMXA 4DJJA 5I4CA 1B26A 3D4IA 3IP1A 3BHJA 1TYCA 1O0CA 1TW3A 1AHHA 5GMOA 1JLRA 3LAWA 2R9VA 4MVJE 2VBIA 1EG2A 2XTMA 3H9QA 4FGKA 1JZSA 1U2GA 3FYHA 3OJEA 3OM0A 5T3YA 2AOVA 1RZUA 2ID4A 1U0EA 3GAFA 1SRRA 1MOPA 3E84A 3DT6A 4DCCA 2PRZA 1JEDA 2IUEA 2QUJA 4LHYA 3ZHXA 4HH4A 1JTFA 4DA7A 2H4HA 1WMFA 3B89A 1XALA 3A9RA 4NBUA 5AM4A 1W4AA 3PTZA 3VH4A 2Q07A 3IAFA 1IN4A 5A5FA 2IEIA 1EWTA 2P0YA 2QN7A 3WX0A 3PL5A 2PZBA 1ZRHA 5KX5B 1HDIA 3RSOA 1WUHS 5BT8A 1LSJA 3FMGA 2PEYA 3HNRA 1ZOOA 2IVFA 4GDMA 1IAVA 3W6PA 1VMKA 1R4MA 3EK2A 5CLJA 2JK1A 3U60B 1ZUNA 1PS8A 5ALGA 2J3LA 3GFTA 4DSNA 3AB3A 1NZDA 1PCXA 1H8HD 1SH7A 5G0WA 1U0SY 3ICWA 3I9MA 2DH5A 5AI0A 5CFPA 3ZE6A 1UBTS 1ITZA 1XRLA 1BXRA 4PLTA 3VBEA 4F9TA 1JSRA 2OMKA 4Q7EA 3TCKA 4GC5A 1GT91 5BSVA 1P72A 4E13A 5KNLA 1PF7E 2B3DA 3RV3A 4MLDA 4RD0A 3TTXA 2C8KA 3K2IA 3ROKA 3M6IA 3PEWA 2QY6A 3KP1A 2XODA 1DS6A 1DCMA 1P2VA 1V16A 4YUZA 4YJ2A 4G63A 2JARA 1F14A 3KOWA 4BDSA 1F4VA 2CJWA 1B15A 4Q4JA 5ESDA 4IVQA 3NH9A 2XGOA 4D4LA 1GGHA 2HX1A 3B7GA 4NY1A 2F6RA 3TKYA 4XQ9A 4HWTA 4PYRA 5BQOA 4A8PA 5K9ZA 3UGTA 3JQ7B 4O1IA 2AK2A 2QDKA 2P9TA 4N1AA 5F5XA 5BYJA 5I4KA 1QAQA 4UPVA 5SY6A 4GBMA 5DFAA 4JC8A 3ZKWB 1SBCA 3TBKA 2XE6A 2J6IA 5DYIA 2B83A 1LI4A 1XRPA 2VJYA 3RU3A 1PVVA 2PZMA 3KKPA 4IV5A 5TQ0A 4QGSA 2C8LA 5M34A 3WQHA 2ZI7A 3FDIA 3P45A 1P1FA 2R86A 3BEDA 3EFOA 3FR7A 1DXYA 1HG0A 1L5ZA 3OPVA 4JYAB 5HF5A 1L8OA 4RWZA 2I4IA 3CMCO 1JB1A 4HDKA 4RZQA 5IKPA 3TR5A 4NECA 5EJ6A 1XUOA 1DWQA 2C97A 1DBPA 3H8SA 4JL6A 5DSTA 3THSA 3NV9A 1YDGA 3O31A 5KNDD 4F21A 2WUGA 5JDCA 1J6UA 3NYRA 1OH6A 1YZHA 4UNPA 1VGRA 3LHKA 3K5IA 2PHZA 3CN7A 4IIYA 1U11A 2JRCA 2X40A 1DCKA 1HDOA 3GRAA 1KVRA 2EW2A 3JALA 4LGCA 4P98A 3JV7A 5AKHA 5EN4A 5PGMA 3MWEA 1DCTA 3CXRA 3WK4A 2JGDA 3P4YA 2EZUA 3CKYA 1VM6A 5JALA 3COZA 2W6ID 2EFJA 1KZ9A 1YRWA 3I4CA 2V7QA 4OXIA 1G8AA 1O96A 3SIXA 4RL6A 1ZJWA 2VUUA 4PQRA 1N1DA 1N8NA 5BOSA 4OQLA 1MORA 2ZSUA 3WNVA 3RS4A 1J1ZA 1TGYA 2RGEA 2BY4A 2WNHA 4F86A 3WLKX 3DFUA 2YXNA 1PYGA 4MLZA 2J8ZA 4GX5A 4ZOAA 3KCQA 1M5TA 3T4XA 1GGJA 2Q5OA 4FFMA 3G2OA 1P80A 5A0FA 3VR5A 4YMHA 2FG6C 4KWTA 1CY8A 2E0IA 3NBYC 4FONA 3NASA 4OO3A 3WMWA 1AKVA 3OMXA 2VCYA 1I6WA 3G8AA 5KHOC 1GT6A 3L4BC 4BN0A 3IEMA 1KO1A 4H18A 1NC3A 4BLTA 1P0MA 1TO1E 3IODA 1ECCA 4GKKB 3VR2A 2WILA 2KSQA 4DJDC 1PZGA 4L95C 4F1WA 1OGIA 4ZT3A 3GJ3A 3TM4A 4DIKA 4XVCA 1ILEA 4CM5A 1CJKC 2YXBA 2OYCA 4HLDA 2QU8A 2B6NA 1CFJA 2Q5CA 2VWGA 3NW9A 4YAIA 4RX1A 3LX4A 2A35A 2R0QC 4UMDA 2PFGA 4D0SA 1Z36A 1K6MA 2H7YA 4RDXA 3IPLA 1FP6A 3IR5A 4QU9A 3WYCA 1QG2A 5KYUB 1YCHA 1DB3A 1PU2A 2ZVJA 2PYIA 4M38A 3STYA 2ZCVA 1KBQA 1IZZA 5H4HA 5LZ5A 2ZSEA 2XKJE 3WNDA 1WKCA 4EJSA 5EIWA 1L5RA 5TVKA 2J5XA 3LPLA 4YAJA 1L5GB 3C7DB 3IOBA 1KDVA 4MAAA 4B76A 1J5PA 4Z86A 3RHFA 2Z6UA 4BWGA 4HSGA 3TKAA 4S24A 3QVUA 2WYUA 4MWCA 1NVVQ 4PG8A 1T3TA 5K1ZA 1F48A 3OQHA 4LNUB 2H7CA 4ZZIA 1MW8X 2ZZMA 4CE6A 2D74A 1UBMS 4G0YA 4Y2VA 5TQVA 3VDMA 5ILGA 3T3HA 3DFMA 3AF1A 1ZK4A 4X54A 4LJRA 4P7KA 4I3HA 4XLZA 3VDRA 4X1OA 3EDOA 1GPDG 2JHGA 3TZLA 4R1OA 2WYIA 1ZD5A 1FXWA 4OOFA 4BFTA 2PKWA 4B83A 4CN9A 4ZHQB 1Y48E 3NC1C 2JJ1D 2QM7A 4LMAA 1H2EA 1OJLA 3I92A 3NWBA 2PUVA 5FP0A 2YZMA 2EG5A 2RGDA 2X13A 3KJQA 4P0PB 4GXQA 4ZO9A 1E5XA 1U1DA 1WXQA 2FPGB 2AWNA 1X1QA 3G2LA 5DYYA 5JEEA 5EQFA 5HWSA 2BGJA 4C06A 4FBMA 3AHIA 3I2IA 2EHDA 1TYAE 4GYKA 3K3PA 4CFSA 3ZE0B 5M04A 4L6IA 3SVTA 4KX3A 2ODAA 3E9CA 4UQLA 1YI1A 2VP0A 1R66A 1K4KA 2PNFA 3F6CA 5CUQA 1I7DA 3QPVA 3TZKA 3THWA 1J4AA 2OORC 3FLAA 2Y6VA 3H8WA 3U31A 1JVBA 4NEGA 2PWYA 1TRHA 1Z12A 3IBFA 4M37A 4QUAA 4BKPA 3TQIA 4IJ5A 3M5DA 3E1GA 3KEOA 3ILXA 1CD5A 3MMSA 2LRHA 4JJ4A 3HDYA 1N4AA 1SMKA 2WVAA 1K3FA 1NRIA 2O2CA 2EBHX 1M2HA 4FFPA 3L07A 4D56A 4KDFA 1P3JA 2IHKA 3LUPA 1SOMA 3KTDA 2JCXA 2V7TA 3W78A 5IZCA 3RT7A 1X14A 5FH9A 1GZ7A 4P0TA 2PMDA 4JEMA 3CNEA 1JWBB 3A6GA 2Q3EA 4NU6A 4EX6A 3JASA 4EHIA 8MHTA 4FDUA 3I1JA 4XJXA 1DOHA 5KNDH 4EKGA 1P6QA 1JHZA 1XRRA 4UBKA 3ROZA 1XG5A 3BC1A 4TLBA 3V2IA 5KYUA 3ZHUA 2ZI3A 1QHGA 2HWWA 3VR0A 1N0VC 1R88A 4OMDA 1NVEA 5FNVB 1ZPDA 1GPYA 2O5EA 3U7GA 1FJXA 1PQUA 4BLRA 5DP1A 2C7GA 2X0EA 1P29A 4U2GA 2F4VB 3DKKA 4XDZA 4GEGA 2GVDC 5DI3B 4QYXA 2C2HA 5TF0A 1NM5A 3TTVA 1MKYA 1J06A 4F60A 2IYEA 1AXEA 3EVCA 2ZKIA 4ZO4A 3WYEA 4CDRA 1CY7A 4EJ0A 5B36A 4K9SA 4UEWA 3C6ZA 1O96B 2BMDA 1KPIA 2E1PA 3Q8WA 5KQMA 4OA5A 1FVFA 1T29A 4HS9A 5CVDA 3T7RA 3WRXC 3CEMA 4Y1EA 3VR5H 2ZUWA 4UHEA 4REMA 1FFXA 1RKQA 4B6GA 3GYGA 1Z7GA 4BP1A 5HZMA 3L7JA 1VZ3A 4IHQA 1NQWA 2ENWA 2WM3A 3I2JA 4NYJQ 4MGHA 3PR1A 2A3NA 3NBKA 2ZYVX 4FGLA 4FP9A 3V8RA 4DLLA 2GCNA 5JHGB 4EP1A 3MERA 4S05A 2ZKLA 3E1KA 3FG9A 5JAHA 5E4YA 3AR7A 2O0LA 1AK2A 4D8TA 4CMEC 1HPLA 5JUWA 2W6JA 2YS6A 2GKSA 4DMMA 1VJGA 4W7HA 2GTHA 4ECAA 1PTJC 3FOWA 1NNLA 1P6UA 4KQGA 4TVSA 3UIEA 4AN0A 2D4HA 3QOXA 1VYUA 1HDYA 1YFLA 1QWOA 4TMTA 4EX7A 4MX8A 3SR4A 1P2DA 3DZDA 4LRYA 4KPEC 3NHYA 3SSAA 1PK7A 2SNIE 3L0BA 3ONEA 1SKMA 1DBSA 3CZ9A 2O2HA 4ZEOA 2QRGA 1JKIA 1M2KA 1QAMA 3BG5A 2R5WA 4G4IA 4M88A 4NXNB 3ADPA 1YE3A 4JUAA 2CHUA 3D3EA 3V97A 1WY7A 2C5FA 1E60A 3PE4A 5LMCA 1QX4A 3RADC 1DEOA 3SCZA 3FRHA 4HBGA 4B3TB 1KFKB 4AJ2A 2WDPA 3N8HA 1M8PA 3V2UA 3VU0A 3O83A 2O48X 4EA6A 4DDWA 2C42A 4HKTA 4N3BA 3VFDA 2IXBA 3I53A 3BRWA 3N2NA 4U6NA 1PI3A 2VN8A 4K9MA 1P60A 1PX0A 2I8LA 2O3JA 4H27A 3O8NA 3ZJYA 3AETA 3CX8A 3NAZA 1B73A 4LAFA 2XXJA 3RS8A 5A06A 4Z7QB 4NJMB 3B1WA 4LHSA 2YJZA 4AWBA 3ZVMA 4Y30A 4LC9A 4OM8A 1M2FA 3D7MA 1ZSVA 3OZVA 2JHCA 2NU9A 1EEXB 1IRIA 2PVPA 1CJBA 3GAMA 2DXIA 1VL0A 1TUEA 3O7WA 2ZE6A 3U1BA 1OB5A 4MIEA 3OFVA 1N6PA 2P91A 4P83A 4PIPA 4G26A 4UU7A 2QN2A 1D1PA 1A8SA 1NJ2A 4EYQA 1TJNA 4F5YA 1IEVA 1S3FA 1W29A 4HUQA 4U8HA 5JQWA 3AU9A 5D6OA 1M33A 4DQXA 4MRAA 1M1UA 2ALJA 5THXA 3NIDB 2X22A 3UHPA 4AJKA 3R6TA 5D3MB 3VO9A 3VR2D 2W6NA 3B5IA 4KDRA 1QTRA 4XQ0A 3VUEA 1VMAA 3X1YA 1G6HA 1PSWA 1ZCZA 2R6GA 4MQLA 4G1EB 3JD1A 4P31A 5G4KB 4J6FA 3WGTA 4HSEA 1H22A 4OSEA 4R8VA 4R1UA 1LPMA 4LXTA 4EI2A 1SVKA 4H4CA 1EHIA 4WT7A 2JANA 5KSOA 2AL7A 4G5YA 2FUG6 4M6WA 4YS6A 4O4LB 1REQB 2QG4A 3QM1A 2HMAA 3OOWA 1H1TA 1MB2A 4BMDA 13PKA 1RQXA 2B1JA 2ZJAA 3RVPA 4MZXA 1XCLA 4H77A 1ZGJA 1N7IA 2FWAA 3PZBA 4FDLA 2WKQA 3B7PA 3MLEA 4GI7A 4HOYA 3RQSA 1WPRA 1K06A 4FCTA 2I55A 3F5QA 5HQ3B 2ZB8A 4HF7A 3A1SA 4LE2A 1JSZA 2XTZA 3R3JA 5E2BA 2G5TA 3LXXA 1P9OA 4E2YA 3KBBA 1CF4A 4LQDA 2OP0A 3KUKA 4OI4A 1NUUA 1M34A 521PA 1FTGA 6LDHA 2YJ5A 4WOBA 4P5EA 3QVWA 1J42A 5B6JA 2R7MA 3SKXA 2P11A 2EQBA 1FSPA 3DE1X 4N65A 4OKSA 4RM3A 4URVR 1H3EA 5LU9A 2O50A 9GPBA 2F1JA 3EGVA 5AHXA 5DWVA 5L3QA 1D5CA 1DXQA 1TZBA 3AUUA 2QW1A 1BXZA 4RZIA 3CTMA 4RWEA 3EWNA 4KRGA 3RRYA 3TEMA 4D9EA 3R09A 2C2MA 5CG2A 1XZNA 4OGGA 5A9SA 3LPNA 3PWTA 1YT5A 1V1RA 3OZCA 1U3TA 2V54A 4YFYA 5D6NA 2ZZKA 4HV4A 3M4XA 4UOEA 3V4RA 4TYYA 4LXXA 4EG1A 1NW6A 3AFHA 3F9CA 3RG2A 3IILA 1M10A 4EWLA 1LBIA 3ASZA 2BMWA 2DU8A 3A6EA 3JQAA 1E20A 3MJVA 4OAPA 4KLRA 3QMVA 1ND5A 4FLFA 2ZIVB 4H4EA 1Z26A 2M6RA 4YLYA 1CQZA 3O1HB 4COOA 4LA4A 1NVVR 1SKQA 2ZIXB 4YDRA 4AULA 4BJ3A 1N2BA 4FDVA 4Z4FA 5FI3A 2HT1A 1XD2B 1G42A 4V38A 3GUVA 4LV8B 3WKDA 2OSBA 1G4AE 4I55F 4RDIA 3OOSA 2JAXA 2FMXA 5C8DA 1X42A 3G1WA 4G6ZA 4FUTA 4JLVA 4W82A 1P9LA 2QV7A 4PQFA 2BGLA 1S3GA 3HEBA 4NFLA 1JXOA 5EERA 1NYQA 2BRUA 4DDVA 1NQOA 3GAZA 3DLCA 2GFHA 3KTFA 2LTAA 1ZJ5A 3QE4A 4RZ2A 5ECDA 1SXQA 1QBGA 2F43B 2VJKA 3H18A 2EJTA 2JBWA 2WABA 3OPYB 3HPQA 5LUAA 5K0JA 1H9BA 3OUZA 5E95A 4EA7A 3KFLA 4ARVA 2VQ6A 3BIOA 1VB3A 4IEEA 1XTIA 3HVHA 4DDKA 1H5NA 1TO2E 5KMGA 3PT9A 4JVSB 3E27A 3II6X 2JVIA 1HBJA 3FFAA 2HM7A 1DAFA 5CB8A 1DPFA 2X0JA 3U1TA 4PR0A 2IFTA 4WN3A 4EKEA 5B37A 3SXJA 5IAEA 8ADHA 5C37A 5ICMA 4WXEA 5D1NA 1JIKA 3GLUA 3HS3A 1EWKA 4HVTA 1PGNA 3RIEA 1V7QA 4MPTA 1RWNA 1Z29A 1JZQA 1TLTA 2H57A 3GQBA 5ALQA 1VBMA 3ROEA 4C03A 1TZMA 3NBMA 4M1QA 2W2NA 2XGGA 3NRCA 5E6SA 2BE9A 2REBA 3CBGA 1NVTA 5IAOA 3KG2A 1O5OA 1NQ5A 4TV9F 2GA9A 3W1VA 1VLVA 5L6MB 5ITZB 2BTEA 3NV7A 1AGNA 2DQZA 3G3EA 3KLNA 1OAOA 3QE3A 3HCRA 4WXYB 2VZ0A 2ZRAA 1KZ1A 4YP0A 5E0KB 3ZE9A 3WB2A 3HFJA 2P68A 1GLVA 4Q4HA 2W37A 3KJIA 1DT5A 2C9DA 4LOIA 3S0JA 5BN5B 3DMTA 3A9TA 1GYQA 1CRWG 5DBEX 3C3PA 4KMSA 1PJRA 2XRMA 5EMHA 5FF9A 4FMPA 2EFGA 2I62A 5ES3A 3K0SA 1IJEA 1CDOA 3CUUA 3RKRA 3DMDA 3DGFC 4L4XA 5LM3A 4Z1MA 4EW6A 4DCGA 2OV6A 1KQOA 3RS0A 3K6SB 4LDPA 3MG9A 1N7HA 2HBZA 3PC2A 2RG1A 4PGFA 1HYEA 3KNZA 3TSWA 5DF1A 4D8WA 2KE5A 3AU8A 3P97A 3ORQA 1ZC4A 2FKAA 1NSTA 2DTXA 2POQX 1JVSA 1KYVA 2X15A 3LLMA 5I4IA 2E4ZA 1NZJA 3OAAA 3L5OA 4JBGA 1BVYF 4KAFA 3TI7A 4B84A 4BB0A 1JFFA 2W9XA 4DMLA 1KMQA 3DT9A 4UOQA 2A5GA 2QVZX 2IV3A 5KYNA 2H6EA 1BGWA 2DPXA 1H8EA 3WL7A 3P71T 3DM5A 2ZSBA 2HXSA 3AMVA 1KBZA 5T4EA 3EBLA 4DARA 1GNVA 1B23P 2DJIA 2PKXA 2PSFA 2CNOA 1Q15A 4IIGA 4LYHA 5FAKA 1UOEA 1B1AA 3DLHA 2V3VA 3JQ9C 4KVAA 4IIJB 5CFNA 2H9AA 2E37A 2OLKA 1UJ2A 4Q0MA 1WZIA 4RANA 1SVSA 2G7ZA 1DOZA 2PMFA 4XUEA 1MN6A 4F92B 1AKMA 1NONA 3SJZA 5KUTA 1KZGB 1THZA 1KHTA 3LCRA 3OX2A 4BB5A 3KJNA 5JS6A 4ND6A 3PNLA 3TQTA 4UFOA 3RJ9A 2F64A 2PLWA 3LUGA 4JU8A 1IPHA 4YA6A 4ZVLA 1U2TA 4DLKA 4DV0B 1JHAA 2KX7A 3NVAA 2ABWA 1NUSA 2OO5C 4UBNA 1I2ZA 3VX3A 1L4LA 4JI4B 3T3DA 3RAFC 4GEKA 2R4QA 3FW1A 1IHUA 4DSOA 4NXMB 3QFHA 4N7JA 1L2TA 3FGNA 2FW8A 1U8XX 5ETJA 4AG6A 5IBPA 4G0ZA 4OH7A 4N0MA 2IQ5A 2VP6A 5DEOA 3QEOA 1CQIB 1KQ3A 1BMQA 1TCUA 5JMTA 2O8BA 1QZ3A 1VRCA 4U2KA 3N74A 3E2PA 3V80A 2E4XA 4UCXA 4L4RA 1VCNA 3L7LA 4GE0A 4HPWA 4MCHA 3ESDA 3JATB 1PR0A 2DWUA 2G0TA 2JGJA 3BBPA 4J94A 1QGAA 4JQYA 2ORIA 4LXHA 3VUFA 4FX5A 1BEEA 1J99A 3HU2A 5EWLB 1SQGA 4ZCRA 3I76A 5IX8A 3WQQA 1UP7A 7MHTA 4B79A 3BSSA 4YR9A 5JRDS 3BFPA 5F5LA 6YASA 1H9AA 2NG1A 3R9WA 1L5WA 4BEBA 2OO7A 1NTRA 5KQGA 5B2ZA 5CK5A 3KT3A 1QQ6A 1C29B 4FWIB 4HFJA 4ESEA