2YDXA

Crystal structure of human s-adenosylmethionine synthetase 2, beta subunit
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
312
structure length
312
Chain Sequence
MNRRVLVTGATGLLGRAVHKEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAAERRPDVVENQPDAASQLNVDASGNLAKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVMFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIADAFNLPSSHLRPITDSPVLGAQRPRNAQLDCSKLETLGIGQRTPFRIGIKESLWPFLIDKRWRQTVFHAENL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insight Into S-Adenosylmethionine Biosynthesis from the Crystal Structures of the Human Methionine Adenosyltransferase Catalytic and Regulatory Subunits.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords METHIONINE ADENOSYLTRANSFERASE 2 SUBUNIT BETA
total genus 110
structure length 312
sequence length 312
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04321 RmlD_sub_bind RmlD substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ydxA00
4ND5A 2NTVA 4A27A 1D7OA 4J91A 2QHXA 3GFBA 1QORA 3DBVO 1R6DA 4KTVE 4CM8B 1KIFA 1CQJA 1PSDA 1U28A 2NVUA 3GNSA 1R37A 4IDBA 3AY6A 1AXGA 4HKTA 3U09A 1ZW1A 1EVZA 4EEXA 2QRJA 4O0LA 2GN6A 1BXGB 2O3SA 1LSJA 3BHJA 4LRSB 2XPCA 4AG3A 4GLOA 3LU1A 3RC2A 2E4AA 3D3WB 2DBRA 3SX2A 2D2IA 5L95A 2NVUB 5IDWA 1PGQA 4IGEA 4D42A 3BTVA 9LDTA 3I5MA 4TZTA 4FJ0A 3KYDA 3D5TA 4NBRA 4OHUA 1GZ4A 2AE1A 1YBVA 3TDKA 4D41A 3K2BA 2FSSA 4R51A 3JTMA 7ADHA 3H3JA 1I3NA 1YGYA 3IKVA 2WE7A 3AM5A 3MJSA 2X9NA 4R9SA 2AG5A 1BVUA 1IZ9A 3FNFA 3G1TA 4Q3AA 3D3WA 2EP7A 4LSMA 1C1DA 5GZ6A 1HZZA 4CL3A 5FEUA 4HNHA 4PCVA 3AI2A 2YW9A 1IY8A 1ONPA 3I1JA 4IS2A 4LN1A 1ONNA 3TJRA 1JVBA 1O95A 5I7EA 2GERA 3KSUA 1KERA 1DPGA 1H6DA 1R0KA 1Y8RB 5EESA 5JAIA 2HMTA 4NIMA 4YAJA 4L75A 1I33A 1Q2XA 4PLCA 3ZU5A 3LZ6A 3M1AA 3P2YA 3UCEA 2BI8A 4HNGA 5B37A 3A28A 1GQ2A 1MGOA 2VZ9A 3LT2A 4L0QA 2W4QA 1YE3A 3U4HA 3ZHZA 3MJVA 4D45A 5F1OA 5A04A 1F06A 4IS3A 5TSDA 2QQ5A 1H6CA 3LC2O 4XX0A 1U3TA 1VJ0A 5I9MA 5HS4A 5IFLA 3F5SA 3WJAA 1B2LA 3PDUA 3ZV5A 3GVXA 4E5YA 3KB6A 4IPTA 1UDBA 2VNAA 4B7UA 5KKAA 3NEPX 1P33A 3I6IA 3PWKA 4ILKA 2B4QA 1ZUD1 2HKIA 3RBZA 4QECA 2OZPA 5HWSA 2GYYA 3DHNA 4ND2A 1PJ3A 5JYEA 1NR1A 1J6UA 1FDVA 4YJHB 1C0LA 5TGDA 2Q1WA 3L4BC 2HMWA 4WCDA 2VUUA 4FD3A 4K6CA 4MJLA 3ETGA 2HLPA 2G76A 1YB5A 4B4WA 3TZKA 3T4XA 4AJLA 5IG2A 4IJUA 1NAIA 1QV7A 2VN8A 4I5EA 4GMGA 4J4TA 2D59A 3QJ5A 5CFZA 1PEDA 3BMQA 1DC6A 2WYVA 2PGDA 3GHYA 4XGKA 4CMCA 1VL6A 4XB2A 4NH4A 5I8WA 5CPBA 3RUHA 4AJEA 3DQPA 1YL5A 2IE0A 1FMCA 4JN6B 2D4AA 1JU9A 3PHLA 1LU9A 1MV8A 3O8QA 1FDTA 5ILOA 5TRTA 4A73A 3ANMA 1ZK4A 4N54A 4TZKA 3VAZA 4HFRA 4GWKA 3HSKA 5JO9A 1RYDA 3PHJA 1EMDA 3JYOA 4KP7A 3RCBA 1AHIA 1NBOA 1SOVA 3OM9A 4A0SA 5L7WA 5DOVA 3GN2A 1MLDA 3M2PA 3QVWA 4L76A 1T1SA 1ZEMA 1T2CA 4Z3DA 4BNLA 1I5RA 5JAMA 3OIGA 4QX6A 4RF2A 2BRUA 4R3WA 1DSSG 1HKUA 1PU2A 5TIIA 1LBEA 5A9RA 1DAOA 2Y1OA 1WP4A 3RKUA 2VT2A 2GZ3A 4PG6A 1M6WA 4U0JA 3DAPA 1GUYA 5HM8A 3ASUA 3GG9A 4PZEA 1U7TA 4N5MA 3V2UA 5JY1A 2OP1A 1O8CA 4PLYA 2VWHA 4Y6RA 2BHLA 2O7SA 3ZU4A 2P9CA 2HRBA 2VOJA 2AQKA 1U5AA 3WFIA 4CV2A 4M49A 1MFPA 2JJYA 3MWEB 4IUYA 5T5QA 3E9QA 1Y6JA 1PJTA 2O7QA 1Q0HA 4RZIA 4B8ZA 3K6JA 3JQ6A 4PLWA 3WIDA 1ADFA 3ENNA 2B4TO 3EW7A 2HK9A 3PI7A 4RF4A 2NADA 2AEJA 4RPJA 3QVOA 1Y8QA 2VOEA 2AEFA 3UKOA 1GUZA 1P1HA 1YDEA 1BW9A 4J7XA 4D3DA 5KJ6A 4TRJA 1MA0A 3LLSA 3R6DA 3PFFA 3FRJA 4MVJH 4BGIA 4RLSA 3AOGA 2WM3A 4N5NA 1PL6A 1KVUA 2VWQA 2X1HA 1ZXBA 3X2FA 4E3ZA 1M76A 1Y7TA 1YL6A 4ZD6A 4BKQA 1X7DA 1SZJG 4G2NA 2DLDA 5JC1A 4P4LA 1A9ZA 1PZFA 2XXJA 4UVEA 4XJTA 4FR5A 3GGGA 2DAPA 3K96A 2WD8A 1O94A 4ALNA 2PY6A 2YHIA 2NLOA 4NK4A 1YO6A 2VCYA 2X22A 3VZQA 1TA4A 1J49A 1AN9A 3RFXA 3P5SA 4TKMA 1RPNA 5KVVA 2JCVA 4FSHA 1DRUA 1VI2A 1R4MB 2W8ZA 5FWNA 4WK6A 2DTEA 3GDOA 2EKPA 1LLQA 1X1EA 4H15A 2EG9A 3EZLA 3OIFA 4BKUA 4RF3A 1NAHA 2EF1A 4FFRA 4CM8A 2VZ8A 1B3RA 1G0OA 3E1KA 4LGVA 4MIOA 3GEMA 2WWRA 4RPLA 1W6UA 4XDYA 2BGKA 3S2GA 9LDBA 2GCGA 3UGKA 4W9NC 1C1XB 4NZ9A 1D1TA 3OJFA 1LLDA 1MC4A 1E3WA 1PQWA 1Z73A 2YJZA 2QZZA 4BHTA 3F9IA 3JQDA 3GGPA 5F1KA 1ADBA 4PN3A 2IRWA 3OJEA 4LISA 1TT5B 2V65A 3DL2A 1DB3A 1N1EA 1XKQA 3D1LA 1LDGA 1ZJZA 1EBUA 4RLHA 3KHUA 3VPSA 1KS9A 3TSCA 3NDIA 2C5AA 3WXBA 4BMVA 1LDMA 1Y5MA 1LC3A 2WYUA 5GZ1A 2FR8A 1X14A 1LXCA 1Q7BA 4YA6A 3DO5A 4ZQBA 5JPIA 1U8XX 5KKCA 4AJ4A 3IC5A 3JD1A 4AICA 3E9NA 2HUNA 2Y1DA 4FFLA 2C5EA 3RROA 2GN8A 4TVOA 1GAEO 4JNKA 4BMNA 3PJEA 4FBGA 1V0JA 4JROA 3EVNA 5DCUA 2O4CA 1BXKA 1KVSA 4L4XA 1HETA 4OXNA 4CLHA 1QSGA 4XGNA 1PGOA 3L77A 2YV3A 4PLFA 4WCFB 3KYBA 1QLHA 1QV6A 4U6QA 3GLQA 4FC7A 3GR6A 1ULUA 5IN5A 3TWOA 2OO5A 4R5HA 4FPXA 4OO3A 2YZ7A 1HWYA 2ZB4A 3GPIA 5ER6A 4WCFC 4E2ZA 2X0IA 3H5AA 4IZIA 1UXGA 4GSLA 2RH4A 4XD2A 4XR4A 4Y6SA 3OEYA 4ONEA 2JCXA 3CIFA 1QG6A 2H9IA 5H83A 4OSOA 4KDFA 1SB8A 3FN4A 4O5OA 1O0SA 4IZHA 2PD3A 4GX1A 1JLLA 2QX7A 2DBZA 3HE3A 2OL4A 3JQBA 3INGA 4MVJP 4NPCA 3TN7A 5EJ2A 1Y9AA 1NFFA 3GC6A 3QRWA 5L3ZA 5K0ZA 3JYLA 3MZ0A 4GKVA 3QVSA 4GI2A 1SBYA 4XZ3A 4U5QA 3BZUA 1PWXA 4KOAA 3KBOA 3KV3O 3ZH2A 3G1UA 4OL9A 2IDZA 1U4OA 4QTZA 1GADO 1HDXA 2ZTVA 3FD8A 5TF4A 1HDOA 3E18A 3LT1A 3WWZA 4EEZA 5BSEA 3F6YA 3NTQA 1ENPA 4BNXA 2P5UA 5KIAA 1WXDA 3E03A 3ZW8A 4MVJE 4H7PA 1BWSA 4TRRA 2I66A 2AXQA 4M86A 1WDLA 3GHHA 3LF1A 5A03A 1XWFA 3DFUA 5DDIP 4JXKA 2NVWA 3F1KA 3JQEA 3PFWO 3ZWXA 1VKNA 3QWHA 1U8FO 1MG0A 3HZZA 4BNMA 1KVRA 1DIRA 2XAAA 1XYGA 3DOJA 5L40A 2NTJA 1T2EA 3JYQA 1OAAA 2HJRA 1HEUA 5FFFA 3U0BA 1A27A 3ONFA 3PGJA 4RVHA 1BRMA 3JQ8B 2BMAA 3BTSA 5F5LA 3VH3A 4DBZA 3WGYA 1N5DA 3O8QB 1QYCA 4BNWA 2UDPA 2RCYA 1KEUA 1P45A 1SPXA 2X8LA 3OQ1A 3ROQA 4QO7A 3DBLA 4J9UE 5T64A 2X0JA 4ZRNA 5ICSA 1F0YA 2GLXA 2RH8A 4NG5A 3W6UA 4J16A 4IIVA 4FJ2A 2G1UA 3AUAA 3K30A 3UW3A 2PNFA 3S2IA 4AJJA 4D3FA 4J1NA 3DXFA 3WMXA 2PR2A 3H5RA 1ZBQA 5IF3A 5JW6A 5T67A 4NJMB 3L4BA 1M6HA 2CMDA 2X0RA 1Z6ZA 2HU2A 4YBZA 3L9WA 3I23A 4RVFA 1LDNA 2IXBA 2YY7A 3FPLA 4FOOA 4PLVA 3VOSA 4DLBA 1KC1A 1XHLA 4TRNA 3U49A 2I9PA 4UULA 1PQUA 3NDJA 4LK3A 2VWPA 2EHDA 3NUGA 4UEOA 5B4UA 1TLTA 4HFJA 2UYYA 5A5EA 3GGOA 3TZQA 4J4HA 4LW8A 2ZIZA 1X15A 2QYSA 5EL0A 5EQFA 1JW9B 5T8KC 3IDSA 3E6AA 4L4RA 4INAA 1HLPA 1NNUA 1DDOA 3I83A 1GEGA 5CPFA 1N9GB 3ZU3A 3KZVA 4PGFA 1DRWA 4BQRA 1HTBA 3NRCA 1E1KA 4XQCA 4Z0PA 1V3TA 3EAGA 3KM0A 3RC9A 4ESOA 2ZQYA 3B1KA 4AJ2A 1Y8QB 4NDNE 3AM3A 1GEEA 1UDAA 1ADGA 5BR7A 2DKNA 3B70A 5IDXA 1BTOA 3DOOA 4HFNA 1RJWA 3PQFA 1I01A 1IYZA 3H9QA 4ZQHA 5AXCA 4FFOA 1WWKA 1FDUA 3RBVA 1ARZA 3E82A 1PJ2A 3V1UA 4Y98A 1NVTA 3PQEA 4BGUA 3KTDA 5IZCA 3I9LA 3GT0A 4JQCA 1XCBA 3B6ZA 4YJDA 1XSEA 1ZIDA 4J9VA 4YJGB 2CSUA 3NTRA 3E8XA 3F47A 4KTTE 4E31A 3NDRA 4TWRA 3CSDA 3QWIA 1PGPA 4WNCA 2H5LA 4Y6PA 2YHIB 5LDGA 3WSVA 3UH1A 1YH3A 2A92A 3WNQA 4DREA 5A05A 3VC7A 1IPEA 4TMFA 2O2SA 1VL8A 1M67A 5BQFA 3C1OA 3AOEC 3OJOA 4AJHA 2X5JO 4L4SA 4XCVA 1B26A 3GNQA 3SC4A 4CM1A 2W2KB 4OAQA 3L6DA 4B8WA 4NK5A 2CDCA 1FDSA 3UN1A 3GK3A 2I76A 2B36A 2GNAA 1PWZA 4Q3BA 3GY0A 2AE2A 4XR9A 4RJTA 5F1PA 3SLGA 4CL8A 3PWSA 1DFGA 4LCJA 1UAGA 2VZ0A 4EGFA 2P91A 2G5CA 4E30A 1NHGA 2PZKA 3COSA 2I5PO 3G49A 4QUKA 4CM4A 1U2DA 1ZNQO 4RL6A 3RWBA 4BOYA 1K6JA 1I2ZA 4A03A 1NASA 4DA9A 4M8SA 5HA5A 4YYZA 4IDDA 1K6XA 2ZTUA 4XGIA 3DC2A 4BNZA 1GQQA 2O48X 1HDCA 3MEQA 5I9NA 2H1SA 1T4DA 1WDMA 4FN4A 1F8GA 4PZCA 5AVOA 5LC1A 4M54A 1T26A 2O2YA 3W4JA 4BB6A 1M66A 1MP0A 1B8UA 4CLEA 2I3GA 1C3VA 1NR7A 1BDBA 4PVDA 4YT5A 3ZI0A 5I8ZA 3Q6IA 2CNBA 4W7HA 5L4NA 3VPFA 3JQ7B 4J0FA 4NBUA 1NTOA 4FCCA 1Z74A 4G65A 5HRUA 4ZJUA 4BKOA 1ENZA 3RUEA 3JQAB 4OGWA 2V6FA 2X9GA 1LRKA 4BO5A 5EERA 1DFHA 3AI1A 3UCXA 3VPHA 2D5CA 2RAFA 3D4NA 2A94A 1P3DA 4TQGA 4JCOA 4W99A 5AXBA 3PZBA 4RVDA 3I9NA 3JQ7A 1PL8A 3FF4A 3OIDA 2GDZA 4BNNA 4XQGA 5CEFA 3KLPX 1PS9A 4EUHA 1C14A 1I10A 3CTMA 2GRAA 3DBRA 2DPGA 1P77A 2Z5LA 1DBVO 5JY6A 4DL9A 1MFZA 1YONA 4IQ0A 3M2TA 4CLRA 5ENVA 1UP6A 4J49A 4TRMA 1H94A 4WOJA 5DCWA 2EERA 1A9YA 4LVUA 5TJHA 5L45A 1UP7A 2NNLD 3KEQA 1GCUA 3JQCA 1H5QA 3U9LA 2CF6A 1GCOA 2Y1FA 2W2LA 3K73O 2I65A 3ZWYA 5COQA 1B15A 1LC0A 3H65A 1IULA 4UAGA 1ZEJA 4WLVA 3VPGA 1P0CA 1Y81A 3DTTA 1B3BA 2PKQP 4PG8A 4DBVO 4J43A 3K5PA 5COBA 4PLHA 1Q0QA 4QSMA 2X23A 3ZV4A 4UUPA 3ADPA 3BMCA 1CWUA 1T2DA 1P1KA 1QYWA 2RHRA 4YRAA 2X9VA 3DHYA 5DN9A 1B8VA 3VKVA 3LDHA 4DLAA 5U1PA 4AJNA 2VYVA 1HDRA 2PV7A 1VE9A 4DGSA 1L7EA 4OKNA 4R1UA 4F3YA 1ZSYA 2VHWA 3FWZA 4WOKA 3WGTA 3HADA 4HWKA 3D5QA 1EQUA 4BO1A 2EJVA 3CKYA 1XDWA 3JD4A 4N5LA 4PLTA 4CMGA 2WJPA 4II2A 5C3MA 3ROMA 1GFSA 2HJSA 1YQGA 4K6FA 3OH8A 2NV6A 1ZFNA 4KWHA 2YV1A 3IOYA 1UP4A 3P2OA 3ZGYA 5A02A 3I3OA 2PTGA 3I9MA 3H8VA 3HB4X 4RO0A 1SNYA 5JLAA 1QLJA 2EV9A 1NVMB 4DIBA 3RBXA 1E1MA 1XR3A 3KXDA 4UVDA 3WGHA 1B0AA 3W4KA 1GYRA 4XRRA 1HE3A 1JQBA 1ZO8A 2FHSA 5GZ3A 3TFQA 4O1MA 1FJHA 5JDIA 1E7QA 3HHPA 4MP6A 4DUPA 1ENYA 2OBNA 3UOGA 3HDYA 1LRJA 1DIAA 1SMKA 4WKGA 5U4QA 3F5QA 3Q2IA 3ICPA 3WLEA 4MP8A 3GRKA 1Q7GA 4HADA 4ROSA 5MDHA 4IBOA 4DC1A 1KVQA 2Q1SA 3OETA 3OA2A 3JD3A 2JHGA 5G4KB 4RPKA 1GZ3A 4BNVA 4M1QA 1KETA 4DIFA 4YAIA 1LLCA 2NU6A 2NQ8A 2PLAA 5JFOA 4FS3A 1A5ZA 4GH5A 5TT1A 3W4IA 1Z7EA 1XG5A 2BKAA 3QWAA 2I99A 3C7AA 2GZ1A 3H9EO 2A4KA 1PTJA 3DAGA 4IIUA 3KSZO 2BD0A 3EUWA 3GG2A 2YQ4A 4E5MA 1Q0LA 3IUPA 4MVJF 4YPOA 1KEVA 1PL7A 4JBHA 1CRWG 1PJLA 2R6JA 4XQEA 1DJQA 4ZGWA 4KQXA 2Y1EA 1AHHA 5I7SA 3WGIA 4CMKA 1N1GA 1RKXA 3HFSA 3V2HA 1NQOA 4CM3A 3E5MA 2YFHA 1RWBA 2VRBA 2FN7A 4BVAA 1ZMOA 4XJSA 1EVIA 1T1RA 1NPTO 1KEPA 4R5MA 1D1SA 1TT5A 3V8BA 2CD9A 2E6UX 2O4UX 2W90A 3CINA 3DWFA 4S1VA 4U6SA 4U8GA 5G2OA 4BO9A 4Z6KA 4YDRA 2EGGA 4R3NA 4TVBA 2BFOA 1I2BA 1NP3A 4AJIA 3Q1LA 1JA9A 3NYWA 3RUFA 2H63A 1IE3A 1LNQA 4DRYA 1BDMA 4CM7A 3GRPA 4WLEA 2DBVO 5KJCA 5CDYA 1DAPA 5JMPA 3QE3A 1L1FA 4J1QA 1R66A 1KEWA 2QYTA 1T2AA 4OMUA 4NU6A 3NT2A 5DT9A 4Y9DA 4D3SA 1NQTA 2C20A 4YR9A 2FPGA 2Y0EA 2Q2QA 3PEFA 3WYBA 5DP1A 4EUEA 1I24A 1DLJA 3X2EA 4K1LA 4B3HA 3LSYA 4IM7A 1P44A 1SCUA 1I36A 2QG4A 5JAQA 3LC1O 5U9CA 4X54A 3GUCA 3I4CA 1UR5A 2Y93A 4BIIA 4RVGA 1Y5RA 3SLKA 4GX2A 1YVEI 3PQDA 1QYXA 3ADOA 5JC8A 3WBFA 1I3KA 4D0RA 1Y8RA 3ULKA 4EYEA 3IUSA 3ZZNA 1C0IA 3M6IA 1TXGA 4DPKA 3RU9A 3QIVA 2P9GA 4NFHA 4R9RA 2ZTLA 1GPDG 1KC3A 4J3FA 2NUAA 3UCFA 3ITDA 5JCXA 3OBBA 3RKRA 2PZMA 4FC6A 4J1TA 4AL4A 1ZVMA 2RBEA 3WGGA 4CR7A 4XA8A 2EW8A 5ITWA 3DMTA 3ONEA 3SJUA 1IHXA 1OC2A 2J3JA 4E2YA 3JQGA 4FB5A 3QP9A 2B5VA 3H7AA 5C7LO 2PK3A 3UXYA 1BSVA 5DNAA 1I0ZA 2JKVA 4YQYA 2PZLA 1EDZA 4OM8A 2C54A 1BVRA 4FGSA 5GMOA 3ZV3A 4L8VA 1K3TA 3KVOA 1PQPA 3WSWA 3PPIA 1Z7BA 3AK4A 2DTXA 4Q3CA 4IMPA 5TQVA 1DEHA 4UREA 1WPQA 2WD7B 2Z95A 3DOCA 2Z1NA 1E3JA 2IYOA 2OMEA 4M55A 3ZV6A 1LTHR 1HE2A 4NHEA 1MXFA 1YQXA 1JN0A 1OBFO 2UV8A 1P74A 3PWZA 1NVGA 1YB1A 2CDBA 3RAJA 2VTDA 1XLTA 3WS7A 1HYEA 1WZIA 3QVXA 4QT0A 1YL7A 3UHAA 4ZQGA 5A5FA 3WB9A 5I7FA 1B8PA 4YT8A 3SJ7A 3KEOA 4IXWA 3JQ9C 3VPXA 2HMVA 4GLLA 5ENDA 1NPDA 5L7YA 1P1IA 1E3WB 2ZB8A 3EK2A 3RC7A 3VZSA 4XQ9A 2ZTMA 1J4AA 4Y8VA 5A1TA 2BLLA 1MXHA 2Q4BA 5IDQA 1ISHA 1ZJYA 3JD2A 1HXHA 1H93A 2TMDA 4CUKA 3INRA 3SBOA 4CLOB 1Y1PA 4E0BA 1RYEA 1CIVA 4RORA 5THQA 1GTMA 2FP4A 2CVOA 4I08A 4IINA 4IQ8A 1EBFA 2Y0DA 2I67A 2PZJA 2AHRA 1EE2A 1H6AA 5EINA 4BNIA 3ZWCA 5A06A 3IS3A 4CV3A 8ADHA 4XEHA 3BA1A 1TI7A 2VRCD 3R3JA 3HN7A 2C2XA 4YT4A 3AFNA 2CDAA 3KYCB 1U3UA 4XYBA 4PRKA 4UVIA 5BSFA 2GASA 3LF2A 3TZCA 5JDIC 4PLPA 2ZCVA 4NNJA 1H2BA 1WW8A 3CPSA 3F1LA 4BNKA 3WGQA 4NBTA 5I9LA 5IZCC 3LT0A 3DBHA 1UZNA 3IP3A 1LDBA 4CM9D 2WDZA 1E1LA 5HTOA 5DF1A 3MCVA 3TL3A 3GAZA 4P8RA 4L9RA 1MX3A 1K6IA 1ZMTA 3BTUA 4BNTA 3DB2A 3FTPA 3K92A 5JMWA 1N9GA 4HXYA 2D3TA 4F46A 3H9UA 3PK0A 4N7RA 2NVBA 1PZHA 4JJFA 2JL1A 1PJQA 3RUCA 3ITKA 3NJ8A 2E37A 1LJ8A 4GWGA 2TMGA 3DBHB 5CAEA 5IDYA 5IXSA 3GA0A 1E3LA 5KTKA 5JXWA 2JFHA 3KSDO 1A72A 5FI5A 3LT4A 5JNLA 3ZWPA 3VH4A 2P2SA 2FRDA 3CMMA 2X58A 4PIVA 1E6WA 5B12A 3ZNOA 1FK8A 4DYVA 2B69A 3FHLA 3MTJA 3DZHA 4TKLA 2HMUA 4QQRA 4ID9A 1V35A 3PYXA 2C59A 3R1IA 4GBJA 4W82A 3S2FA 5G4KA 1WLYA 2FSVA 1MB4A 1Y9EA 2QRLA 4QO8A 2PD6A 3C8MA 4Z0TA 5G0SA 1HE4A 1GR0A 4HBGA 2H6EA 2VRCA 2YQ5A 1NYTA 2Q2WA 4XKJA 2YYYA 1UXJA 2IXAA 3RJ9A 1R12A 2DC1A 2CUKA 1RM3A 6LDHA 4ZQFA 2DBQA 3ETEA 3WGOA 4I9UA 2X86A 3TNLA 1DO8A 2GGSA 4II3A 1HRDA 3GVHA 2OBYA 2PGLA 2P4QA 1H0KA 2HO5A 3GVPA 3W6ZA 4MOWA 3ZHBA 4BB5A 1ISIA 4P22A 1UXHA 3Q11A 4B4OA 3FCOA 5ES3A 1Q7CA 1G6KA 1ML3A 2ZJ0A 4R69A 3DZBA 4I5GA 4BNJA 3MTGA 4OQZA 1EQ2A 1LQUA 3C3XA 1KY5A 4ZQEA 3T4EA 1PGNA 3GMSA 3FNGA 1N92A 3KOUA 4HUJA 3RUIA 4R68A 4WLUA 3VTFA 4D46A 3WNVA 5EPOA 4YJFA 4RVSA 4CLXA 4N18A 3EYWA 4R54A 3DEYX 2WMDA 4GSKA 4KWIA 4CMAA 4YEDA 3WJ7A 1IL0A 1QYVA 2D0IA 3ANNA 3GMDA 5FI3A 2NU8A 2EJWA 3S8MA 1RM5A 4NFSA 1P31A 3A9WA 3RUAA 1E6EA 1DOHA 3ANLA 3RU7A 4G81A 3W8FA 1PZEA 1DJNA 3GDFA 3GN1A 4UVGA 2AW5A 4BO0A 3Q3CA 1PZGA 3GUYA 3WGZA 2FZWA 1DLIA 3FSRA 3VVCA 3IL2A 3QLJA 2CY0A 5CDGA 4UEKA 2C29D 2IZ1A 2AMFA 3HDHA 2GF2A 3A14A 4CMHA 2E82A 3ZN2A 4CMEC 4MKXA 1SAYA 4CMJA 2X6TA 2VHYA 3HUDA 1A4IA 4CODB 3UFXA 4J1SA 1U3WA 1IHYA 2Z1MA 3ST7A 4E2WA 3NJ4A 3DBRB 1QXSA 3UF0A 4GL4A 1H2HA 4JLWA 1WVGA 2F1KA 4JIGA 4FDAA 5EQDA 1QKIA 2O23A 4K28A 4XYMA 4B7CA 4URFA 4C7KA 2AQ8A 3NGXA 4GX5A 2PA3A 2W2KA 2PGJA 3RVDA 4NBVA 1JKIA 5CP8A 1KBZA 4CJXA 4CMBA 3OP4A 3D4PA 2NU9A 1E3IA 4LRTB 1JTVA 3T7CA 3TPCA 4ZICA 3GH3A 3CUKA 3OJ0A 3JQFA 2EIHA 4YJHA 4WLNA 8LDHA 2ZQZA 1HSZA 4CM5A 3FBTA 4CM9A 4E12A 1YWGO 1VLLA 4MIYA 3RFVA 1ISFA 4OJNA 5AOVA 3HDQA 3GFGA 2Q3EA 3DZJA 2HSDA 3MOGA 1KOLA 2OGUA 5B4TA 1Z75A 1CF2O 1KYQA 3K8ZA 3KLMX 5BNTA 4CQLA 3HDJA 3BMQB 4BKPA 4M89A 3FR7A 4WGGA 2ZKLA 5ILGA 1E7WA 4JJGA 3UUWA 3B1FA 6ADHA 4J7CA 1R15A 3OQ6A 3OJLA 5FYDA 1NQAO 5ADHA 4DQUA 3DMTC 1LDEA 3TZ6A 3WTCA 1ZK3A 2FMUA 5HBRA 3EY4A 2O3JA 1ZSVA 4KQWA 1YJQA 2IEDA 1JVSA 3NV9A 4WLOA 4KUEA 4XYLA 3D3EA 4KDEA 3JYPA 4HX5A 1M2WA 5IXYA 3PJDA 1AE1A 1U2GA 3EVTA 1LSSA 4DIOA 2DT5A 2D5AA 3QWFA 5JO0A 4JBIA 4E32A 3WQRA 1CERA 1DRVA 1EFKA 1PJ4A 1C1XA 2Y0CA 5ITVA 3F4BA 1QRRA 2QRKA 1E3EA 3DAFA 1ZK1A 4CM6A 2NSDA 1CETA 4BNUA 3CZRA 2C7VA 2JHFA 5TT0A 5CG2A 4DVJA 3BMNB 4E5KA 3ABIA 5C7IO 4BUCA 2W98A 4ND3A 1LSOA 3G17A 1A71A 3KYCA 5F21A 3FI9A 4YRDA 3CMCO 4RV9A 4CUZA 1BGVA 2PWZA 1GQYA 4EJMA 2FZEA 1NHWA 4YQZA 4ALKA 1PIWA 1P1JA 2BF7A 1B14A 4PVCA 5C7OO 5JBIA 2HDHA 2FY8A 2ET6A 3FPCA 1NFRA 3CH6A 5TX7A 2GO1A 4JX8A 3SC6A 1YDWA 5IN4A 2UAGA 4RZHA 1AXEA 2JD1A 3BMNA 4U0KA 4FW8A 1LLUA 4BNGA 3LQFA 4WNIA 5GY7A 2DM6A 1E5LA 4Z9YA 3RSHA 3L6EA 4JP2A 4BMSA 5DCYA 1I8TA 4TROA 1V3UA 4YAGA 3IP1A 3Q9NA 2V6MA 3JQ9A 2AG8A 1SOWA 3VZPA 3H9JA 2FR0A 3GVIA 3O38A 3R0IA 3AM4A 3CXRA 1BW9B 3HQ4O 4IDEA 3K2EA 4M87A 1V9LA 4BNFA 4DTIA 2WEKA 3G79A 4CMEA 3GEGA 4LSWA 4Z9XA 1EVYA 2YUTA 4K9DA 1T25A 3WIEA 2LDXA 3PYLA 3TF5A 2UUPA 2QIOA 4AFNA 4EUFA 2C7GA 2EKQA 1A4UA 1BXZA 1JKFA 4CQMA 3D0OA 4CQMD 1GDHA 1MUUA 2GN9A 4DC0A 3IJPA 4WASA 4UUMA 1ENOA 2FPPA 2CF5A 5F3RA 5JDCC 4UVHA 3NAQA 1G1AA 5DZSA 4E13A 5CDUA 3C7CB 4ZN6A 1HYHA 1R0SA 5JCJA 3ZDFA 1LQTA 1GYPA 1PR3A 2LDBA 4RQUA 1N7HA 5KNLA 3IQDB 1V3VA 4R16A 4KZPA 3UICA 4EDFA 4DQVA 4Q3EA 3WTBA 4Q3DA 1DHRA 3D64A 1XU9A 2BFPA 1ID1A 5A3JA 3PLNA 1P0FA 3PJGA 1FXSA 3Q0EA 4IMRA 5JE8A 4BV8A 3PGXA 1C0KA 3U4CA 1UDCA 5KVCA 1P9LA 3ONDA 4NFYA 5LCXA 1DHTA 2O50A 2W2LD 3G3EA 3LVFO 3SVTA 3ORFA 4OYRA 4ZHSA 4MIEA 3EC7A 3GVCA 4IXTA 4NR0A 5A9SB 5KOIA 3QA9A 2Y67A 3STHA 1IOLA 3ZWBA 2NTNA 4YAKA 1MC5A 1KVTA 2J5KA 3GZNA 2ZB7A 4A7PA 3DZFA 1DC3A 2YDXA 2OFPA 3BXXA 3OF2A 1H9AA 4CUJA 4MVJD 3ZHYA 3BMOB 2O3RA 1DXYA 3FR8A 2C82A 3A06A 2EP5A 1J0XO 4R01A 3WWYA 1O5IA 1E7RA 3E9MA 1SEVA 1HSOA 3DHEA 3VVBA 1EZ4A 3M1LA 1GL3A 1L7DA 1W0CA 1R16A 5T57A 1VC2A 4CMIA 4DMMA 2BGLA 1X13A 4Q39A 5AYVA 4Z3KA 3DTYA 1T2FA 3PIDA 5ICMA 1EDOA 3PJFA 1WMAA 5IAAA 1D4FA 2D1YA 2DFVA 4JK3A 3I9OA 1K0UA 4GKBA 5K9ZA 4A26A 3BHIA 1D8AA 1E92A 3PXXA 4GGOA 2Q4EA 1YOVA 3JYNA 1NQ5A 3WQSB 3V1TC 4LVCA 2I3AA 4B7XA 4BL5A 3GQVA 4ZVVA 1LEHA 1V6AA 5BT9A 3WICA 1GPJA 5AQ1A 3PYMA 1X7GA 5HS6A 4PG4A 3QWBA 1FDWA 3OQBA 4JJIA 4BO6A 2X0NA 5T6BA 3I6QA 7MDHA 1UUFA 3ROKA 2P5YA 3PHIA 1O6ZA 4CPDA 3H2ZA 5KJ1A 3OA0A 3OSUA 1GV1A 3DFZA 3OMLA 1LUAA 1NX6A 3DZKA 4RPHA 4W9NA 5I7VA 1GY8A 1LRLA 2RHCA 4YCAA 2VQ3A 3OFSA 3AW9A 3GEDA 3JSAA 3QHAA 2RIRA 5AXAA 4CV0A 1Z45A 1DC4A 3HFGA 2IEBA 1XA0A 3KYDB 4OOEA 1E7YA 4JGBA 3AUSA 4MINA 1NWCA 4ZA2A 1ISJA 2EXXA 4MKRA 4DPLA 3AUUA 1H9BA 3GPDG 4XIJA 4DWVA 1EFLA 3NGLA 4FOSA 4YAEA 3KETA 2A9FA 5ER9A 3DONA 4MPDA 1OFGA 2GPTA 4DXHA 5A3VA 3DDNA 3WOHA 2EWMA 3C85A 2Y99A 2ZB3A 2J3KA 4Z9FA 4FQ8A 1C1DB 1KY4A 3RQSA 5DP2A 5G0UA 3DZIA 1VKOA 1K89A 3P19A 2ZYAA 2NM0A 3ZU2A 2XF8A 4D44A 4D7AA 1UJMA 1ADCA 3AOEA 1YJ8A 2CVZA 1Q1NA 3ZWMA 4E21A 2ZYDA 4RPGA 2WTBA 5K6AC 3VTZA 2E48A 2IZZA 3EHEA 4FFNA 5EN4A 2JFGA 4L74A 2J8ZA 3PTZA 1I3MA 3LC7O 2B37A 1BHSA 4QXMA 2B83A 2G0TA 2VYVD 4J4BA 4ALLA 3ZWWA 3U4IA 4BO3A 1NPYA 2PH3A 2Y05A 1W73A 5DOZA 4GGPA 3VKUA 3CEAA 4YT2A 2VYNA 3JQGB 4ALJA 2AEMA 4BGEA 5CHEA 1WMBA 1W8DA 3MWDB 4OSPA 2ZATA 4A10A 4BO7A 2Q99A 3VH1A 1E0DA 4B4UA 5CEEA 3L0DA 4BS9A 3V1YA 2VHVA 3ZHXA 1QR6A 2P68A 2VHXA 4E4YA 2VUTA 1VPDA 3AWDA 4Q9NA 1EK6A 1UH5A 4IGFA 1F12A 2POQX 4H3VA 3MJTA 4I5FA 1O9BA 1E77A 4O59O 1E3SA 1LA2A 3WR5A 1DIHA 2JD0A 3ZWOA 3NX4A 3SXPA 1YBMA 1F8FA 3NTOA 1S6YA 4D0SA 1BMDA 1ISGA 1BG6A 4BKRA 3B20A 1YBAA 4RDIA 4AJKA 1HDYA 4D79A 1ZK2A 3W1VA 1HYGA 4GPD1 1K5HA 5DBFA 1E5QA 3C7DB 3WMWA 1OOEA 2R00C 2ZK7A 4GMFA 5BSHA 1ZK0A 1UZLA 3ZWVA 1UXKA 1I3LA 1X1TA 3HN2A 3A1NA 3H3FA 4UEJA 1LI4A 2VYND 4JP3A 3NKLA 3JV7A 1U7HA 2AA3A 3KRTA 2QZ9A 1N2SA 2ZCUA 3FWNA 4GQAA 1OC4A 4J2OA 3EZYA 4LMRA 4MO2A 3GNTA 1ONOA 1CQIA 4IDAA 2HRZA 5DBGA 5T8KA 4WJZA 4IY1A 3PLRA 3F46A 4E5NA 4PG7A 1F17A 2GUGA 1TEHA 3OEWA 3GZ4A 2EW2A 5EMHA 3JQAA 3U4DA 4CV1A 2VNSA 3TZHA 2VUSA 4JBGA 1GD1O 3B1JA 2EEZA 3ASVA 3KO8A 2Q49A 1WAMA 1IPFA 4L73A 3FBGA 2VTEA 1CDOA 2X4GA 4QEDA 1LSUA 4R1NA 4P4GA 4J90A 4PFJA 4DYDA 2C07A 3PZRA 4MVJM 4W4TA 4KUHA 2B5WA 5THKA 1B7GO 4YJFB 3TRIA 1NM5A 2JAPA 4CLRB 3RFTA 3G0OA 1ZKMA 3L07A 1AUPA 3RIHA 3L4SO 3RUDA 5C37A 2V7PA 4E5PA 4OQYA 4OKIA 2DU8A 1HF3A 1EUCA 3VDRA 2IODA 2R00A 5L53A 1TT7A 4QFCA 1YS4A 5H81A 3WYCA 1P1RA 1QMGA 2VHZA 2WSBA 3EDMA 3ON5A 1OZAA 4YJGA 4ALIA 1I32A 5J23A 3WFJA 4IDGA 3TOZA 1HT0A 1PJSA 3U5TA 2Y1CA 3LK7A 3O4RA 5TC4A 2BGMA 4RGBA 4MVJI 2FOIA 4ZU3A 2UUOA 3ZCXA 1H6BA 3T7EA 1N7GA 1X7HA 2AQHA 2HAEA 4W7IA 1JWAB 3IMFA 2O3UA 5CEJA 2HK8A 3I9KA 3WG9A 1ZH8A 4D43A 5L4LA 1C0PA 4BO2A 3PP8A 4IJVA 1A7KA 2DFDA 3VZRA 2X5OA 3ICCA 1E1NA 4I1IA 3RI3A 2CZCA 1VM6A 3C24A 4NMHA 4C7JA 3MJEA 4RQTA 2IYPA 2Q1TA 1VSVA 4IJWA 1A7AA 4YTEA 4ND4A 2YHUA 4BO8A 4F45A 3BMOA 3K9QO 5BNIA 1HDZA 4O63O 3H9GA 1DC5A 2OHXA 2IZ0A 4UUOA 1OI7A 2Q2VA 1XIVA 3CZMA 5BNFA 4HP8A 2YV2A 1R4MA 3DR3A 1X0XA 3PHHA 5COAA 1ORRA 4EI2A 2XXBA 3PHGA 1GV0A 5AXDA 1JDJA 4KUGA 4ZRMA 4CR6A 1NWHA 1JAYA 3AI3A 3C1AA 3ZWAA 2R2GA 1EE9A 5G4LA 1XELA 4LCEA 3JQBC 3N58A 1D3AA 1OMOA 1DFIA 4BQPA 3BIOA 3TOXA 4ALMA 3FTNA 4WLFA 5K6AA 5BSGA 3EGOA 2JCYA 3HWRA 4PRLA 4HFMA 3AU8A 1YOVB 1HE5A 3MJCA 1ZSNA 5CDSA 3U3XA 3BYZA 5G0WA 4A5OA 2B0JA 3MJ4A 1EEHA 4EJ0A 4J7UA 3NT5A 4MKZA 2PH5A 1U9JA 3F4LA 4P38A 5JYDA 2B35A 2ILTA 3W8DA 4F6LA 1HDGO 1ULSA 2QW8A 4CLDA 5G0TA 3H4VA 4ITUA 1WDKA 4NU5A 4AVYA 2FR1A 2NU7A 1VJTA 4R4JA 2FPIA 3WQQA 4FIZA 5JS6A 2O3QA 1RM0A 4KMSA 3ETDA 3H6KA 1E7MA 2SCUA 4EBFA 3QV1A 1E7SA 2HMSA 4LMPA 2OXIA 3D4OA 3LYLA 1CEQA 4I8XA 3U62A 1IUKA 4DQXA 1UZMA 1VJ1A 3ZNPA 5IZ4A 3QW2A 5G0VA 3JD0A 2GR9A 2WYWA 4WCFA 3GAFA 3IJRA 3MOIA 1S7CA 3ROPA 1EUZA 3D7LA 2DUWA 4FJ1A 3IIEA 4Z0HO 3ZWNA 2VT3A 3GDGA 5CG1A 4R41A 1HLDA 3VDQA 3NT4A 1AGNA 1W4ZA 1B16A 3HJAA 2GD1O 1X0VA 3LLVA 3O26A 4MVJG 4PG5A 4CLOA 5JAZA 1YKFA 4BV9A 4XYGA 4J6FA 1RM4A 4Y67A 2P4HX 2PKQO 2DUUA 4GAEA 1I2CA 4RF5A 1ISMA 2BFAA 2BFMA 4J2HA 3E48A 2NWQA 4FGWA 5L4SA 3OICA 1ZXLA 2AQIA 3PVZA 2EGHA 4B4VA 3DZGA 3AUTA 4EITA 4DPMA 3WYEA 4XIYA 1F14A 3ZW9A 1T24A 4YRBA 2X5KO 3WLFA 2J6IA 4MDHA 1ZCJA 2ZYGA 2A35A 1I30A 3KUXA 4OH1A 4P4NA 1PR9A 4IDFA 1FF9A 3ZNNA 5TLSA 3AY3A 3BAZA 5L9AA 5L51A 4H16A 1JAXA 2JAHA 3C1TA 1YXMA 5TNXA 3WBBA 1N8KA 1J5PA 4R1SA 1XQ6A 2PFGA 1PGJA 1TVEA 2GN4A 1YB4A 4I5DA 1ZZEA 3RD5A 2DQ4A 2HQ1A 3QY9A 3UAGA 4EZBA 4YB8A 3W8EA 2D8AA 4HY3A 3FNHA 4GX0A 1IZ0A 2G82A 4E6PA 3PIIA 1M75A 2P9EA 2CFCA 4ND1A 2F00A 4MP3A 3VH2A 5A4DA 1QP8A 1PS8A 5EIOA 4MVJA 5B1YA 1T4BA 3JCZA 2I6TA 3AU9A 3BHMA 2VWGA 1EUDA 1PJBA 3CE6A 1GYQA 3QVTA 3HNPA 3JQ8A 5TS3A 1TB4A 1CYDA 4BGVA 5IJZA 5KJFA 3RJ5A 2BELA 1EVJA 4R1TA 2Q45A 3Q9UA 1V8BA 5JDCA 4GVXA 1QYDA 4IDCA 3V2GA 2GZ2A 3O9ZA 1NFQA 4I9HA 4OOFA 4CQLB 2HK7A 4OIMA 4YACA 5C5IA 3OHSX 2E49A 1HZJA 2JD2A 1LDYA 2J3IA 1HL3A 2WD7A 4C4OA 1U1IA 1GZ6A 1LX6A 1U5CA 4J0EA 1PS0A 2V6BA 4XB1A 2Y68A 3N7UA 1PJCA 4W6ZA 5H82A 5A9SA 4WUVA 5JCJD 3IKTA 3WX0A 4RVUA 1EK5A 4WE3A 3DBLB 4BO4A 3V5NA 4UUNA 4YWJA 1GU7A 4K26A 3S2EA 2Y1GA 2HCTA 2J5QA 3Q2KA 3S1LA 2OOSA 1VSUA 4PZDA 2YFQA 5FF9A 4RDHA 3HG7A 4WECA 4RCVA 1SC6A 2PKRA 2V6GA 5DULA 4QFDA 3UVEA 3GOHA 2Q50A 3AFMA 2UVDA 1O89A 4F6CA 3PDJA 3EMKA 1PX0A 4NJOA 4XWYA 1U4SA 5TJ9A 3INTA 4BNHA 2B4RO 2BI7A 3S55A 1XEAA 3HB5X 4NJMA 4EJ6A 3I4FA 3F3SA 3OECA 2OORA 3TFOA 1JWBB 1XQ1A 3SEFA 2DTDA 5KVSA 3BMCB 1P1FA 1XGKA 2DVMA 3QQPA 4G5HA 3O03A 4O6VA 3TL2A 4A2CA 1JKJA 1UXIA 4AJOA 1SEPA 4YXFA 2O3TA 3ZNQA 3AY7A 3DMYA 1YQDA 5LDHA 2C2YA 2G17A 3RC1A 3BTOA 1R0LA 3L9XA 1WNTA 4FFMA 5DBIA 4BNYA 1R4NB 3FNEA 2OUIA 1YRLA 2GSDA 2FWMX 4DLLA 4PLZA 4IJKA 2BH9A 1U3VA 1G0NA 3N74A 5JSFA 3WDSA 2XOXA 5B4VA 4I9NA 4AJ1A 4B3JA 2WE8A 4CQMB 3JQAD 1IB6A 2OP0A 3IAHA 4XDZA 4HV4A 3P7MA 1R4NA 3AJRA 3I52A 4B3IA 1DIGA 4CR8A 4OXYA 2X7HA 2PD4A 5KWEA 2Q1UA 4S3MA 2J5RA 2DPHA 1Z82A 5KCZA 2ZJ1A 4WPGA 5KJEA 1XU7A 4XYEA 5F5NA 3R3SA 4NI5A 4B79A 3H2SA 5A9TA 3VHRA 2CVQA 4FFPA 3H5NA 1GUFA 1E6UA 3L6OO 4TSKA 4E33A 3TQHA 1SO8A 1SB9A 2EKLA 1NXQA 1UAYA 4NBWA 4WEQA 1CJCA 4CM4B 3I9JA 3RASA 2J3HA 4DMLA 2Y66A 3GZNB 5L7TA 3QSGA 1WZEA 2NACA 4U7WA 1VRWA 5MGBA 3JQFC 3GF4A 4EW6A 2JFFA 3A4VA 4GVLA 2YDYA 4PLGA 2Q46A 4Q3NA 4CMIB 1MG5A 1DIBA 1VL0A 2NQTA 4OXKA 1K2WA 3E5RA 4WEOA 4NQZA 4AJPA 5KVQA 5CDTA 1BXGA 4IQGA 2C0CA 4YVFA 3K31A 3PRJA 4E2XA 4XRGA 3ENKA
chains in the Genus database with same CATH superfamily
2IYWA 2NTVA 4H1HA 4HDAA 3IVMA 2C0QA 4RK6A 4YC7A 4A27A 1Q22A 2DUNA 4FN5A 4BFXA 4Q7QA 1K2VN 4EVSA 1C8VB 2R3SA 4CM8B 3F71A 1KIFA 3ETLA 2GPWA 1S3FA 1FDRA 3U09A 3E05A 4WY8A 3I5XA 4BEWA 4B45A 2QRJA 3SM3A 2ZUCA 2GN6A 3PVSA 5JFGA 4PQFA 1Y42X 2IPOA 3NP9A 1GNTA 3T1VA 4LRSB 3ZHCA 1UWLA 2WR8A 1IEWA 2XPCA 3JVUA 2YRXA 1PF7E 3ETNA 3K9CA 4OHPA 3KQTA 4UTPA 4W9MC 3QXGA 5LVAA 2NO5A 2OKGA 3QKUA 4P80A 4GLOA 1V26A 1XZGA 3ACBA 3RC2A 5J2TB 5EKXA 2Y76A 3L43A 4QYXA 4LQDA 5E3HA 4K7JA 3UFBA 1EFVB 4MWGA 3V46A 4K0KB 3I5MA 1FB5A 3N59A 2PX8A 2A0YA 2QB5A 1P7ZA 4LRXA 4G4SP 2HA6A 5LIRA 4IDNA 4UM5A 1YBVA 3NTXA 1GKYA 1A9XB 4D41A 3AVTA 3R74A 1MIOA 4UPVA 3JTMA 1EWTA 2BRUC 3KUCA 3BXHA 2WE7A 2X9NA 1SXGA 2GCNA 2IHBA 1U8YA 1VPTA 3HEBA 4HN2A 4C78A 4EW3A 1G59A 5IHPA 1PTKA 4PPQA 3VV3A 2D7DA 1VHLA 3R3VA 1P8AA 1VA4A 2IVZA 3QU7A 4HNHA 4J1TC 1DDIA 3AI2A 2QGZA 4IS2A 4ZMSA 1JVBA 1K68A 1DDGA 1DPGA 1GNVA 1NLUA 4EHJA 2HMTA 2PRSA 3C3WA 1NJ6A 3H13A 3M82A 4P4TA 1Z6YA 2ZJBA 1JB9A 3LZ6A 3ZU5A 3KB2A 1ZRSA 2BUBA 5AW7A 3SYKA 3W5BA 3RQIA 1HFKA 3A28A 3B6IA 3N39C 1ST3A 5ALUA 1P5JA 3R3YA 1MGOA 5F5XA 4ZI7B 2VZ9A 3ROZA 5EIXA 2LZ0A 1KR2A 2Z4TA 1DQRA 2OT3B 1US8A 3AEUB 3MJVA 3KCNA 4FOPA 1TCBA 1F06A 4IS3A 4MS3B 4RK4A 4TMVA 4EAAA 2IFTA 3LC2O 4I6EA 4XX0A 2XVMA 2ZBRA 3WHKA 4LBVA 3UQZA 4E14A 5I9MA 4E3WA 2NTEA 2PYIA 5FTLA 1UODA 5B1DA 3WJAA 3AY0A 4JUFA 1B2LA 4PNHA 4DT1B 5TQJA 2JDIA 3GVXA 1RQXA 5ADUS 1YQWA 3GRCA 4I55F 4YDQA 1UDBA 2E9SA 4IHAA 5HE9A 2PUHA 4EUKA 3KU1A 4H3SA 3N05A 1NUAA 3NEPX 4LXXA 3HXLA 4FSDA 4EB8A 5BR1A 4DV0B 3EUAA 4NVRA 1AOXA 1JG6A 4JSYA 3D8RA 2GYYA 5AVYA 4Q0MA 4L8FA 3RC3A 4ZGBA 3HKBA 4TKVA 1FDVA 4JASB 1X3LA 2F3SA 4QBTA 1FTQA 1CR6A 1KYVA 1V8ZA 1DNPA 2GWHA 3FTQA 4KXQA 5L3SB 1KZ1A 1Q95A 3DVSX 5TGDA 3R8CA 1II8A 3LRTA 4HTAA 3RC8A 1G5TA 4FTWA 4WCDA 2LE0A 1XP5A 3B7PA 4MJLA 4B3CA 2Z1DA 4NF2A 3QUQA 1YB5A 3OUUA 3CZQA 3T4XA 3V55A 1GZVA 2OPBA 2RARA 4AJLA 5IG2A 3K4QA 2K5UA 1NAIA 3MTAA 5CYGA 1SKYE 1OBCA 2JHPA 3KPUA 1PEDA 3O90A 1M6EX 1W8IA 1IZYA 2PGDA 4JQZA 4CEJB 1UMCB 3G9XA 1UBRS 3EQ6A 2B20A 1TZKA 3F4KA 3O4VA 4NH4A 1FLNA 4TS9A 4JWTA 3DLAA 3O3OB 3JRXA 3RUHA 5BSRA 2CUZA 2EFYA 5EMKA 1AMNA 4G1UC 1TMGE 2D4AA 3PHLA 4QATA 1KNXA 3A1SA 5TRTA 5K3BA 2XB6A 4MVXA 2J7KA 3ANMA 1J21A 2BONA 3GRAA 3FVTA 3N8DA 1ELOA 4JH0A 4RTQA 3VAZA 5H0IA 4EA8A 5JZSA 2FGKA 1YMUA 4JVOA 1XN4A 1NUSA 3NBFA 4KP7A 3JXEA 3RCBA 1IVYA 2ZU0C 1NBOA 3AGPA 3U3RA 3OM9A 3ZYZA 4AULA 4YV1A 4HLUC 1CY4A 4M0MA 3A27A 2ZULA 2AN3A 3M2PA 5EIAA 3UJPA 3BQMB 4QOHA 2Z43A 3LIIA 4QT4A 4EI9A 5J4HA 4BLRA 3HLTA 2QGFA 5BSWA 3REOA 5T3YA 4R71A 3OJXA 2I2XB 5JAMA 3OIGA 1YZUA 2QVCA 2AD5A 2O0LA 1JG7A 3R0XA 1TUBA 2DY0A 1PU2A 4R3WA 3RNLA 5TEWA 4CL2A 5ECWA 3DA8A 3W7BA 1TCVA 5I5EA 1RWMA 1J2EA 4PG6A 4QDUA 5MN6A 4U0JA 2O8FA 1LX7A 4IUCS 3TMYA 1U2SA 1IHOA 3DT8A 4EO9A 4DCCA 1YDMA 1H1DA 3PKJA 3QE0A 4M6WB 2OECA 4PFKA 1X2EA 2VWHA 4UUAA 4Y6RA 1K3FA 2QL9A 3ZUPA 4NXMB 5D84A 3GFRA 4UHKA 4N7MA 2VPTA 1MQSA 1VBKA 2QUHA 4MW4A 5BR8B 1FNCA 4QBFA 1U5AA 1OFIA 4M49A 2CMKA 2JJYA 1X2BA 3HSYA 5T5QA 3E9QA 1DE0A 2B4AA 2WWHA 1K6EA 2O7QA 1JZQA 3DCJA 3W5AA 3DGFC 4WKCA 2CLKB 5BNWA 4ME6A 2O8FB 3ZH9B 3JASB 1E6MA 1K97A 2FPGB 4IMJB 2G1KA 4REQB 5E1BA 1U0OC 3THRA 4QPDA 2JGEA 4C4XA 4B82A 2B4TO 3PI7A 2B6HA 4MYTA 4RF4A 4P4SB 2JGDA 3G8AA 1N75A 4C0BA 2R6DA 1MR3F 3T9DA 4XXHA 4UCFA 2HSGA 3H8SA 1R6XA 3R6DA 5AVUA 2Y71A 3CCBA 4JLAA 1KEZA 4CN8A 2GLUA 4MVJH 1R9NA 3II6X 3H1GA 1XN1A 3H2JA 5DSZA 4JC5A 5E7QA 3V7WA 1ZXBA 1A88A 3Q6NA 4E3ZA 3DZDA 5IJ9A 4BFWA 1J8YF 2JCGA 2WNHA 4YIHA 3CLSD 3HWSA 1EXNA 1PG5A 3FYHA 1IVNA 5ALXA 1GCAA 3C43A 4UVEA 3UHPA 1STOA 4LJ8A 3CH5A 4QYMA 1NI4A 4RFSA 1NR5A 3MMSA 3TLXA 4PCUA 4QREA 3RLIA 2ST1A 1O94A 1U0FA 4ZTBA 4ALNA 3IEUA 4Z3OA 2GKOA 5DNVA 5JVDA 2YHIA 2FAXA 2NLOA 2NW6A 2Q5IA 1M0WA 4DLNA 1V4VA 2X22A 3FGOA 5CYOA 3LRPA 1ZD1A 4WAUA 4CKWA 5AM5A 1J49A 2C9OA 4FKMA 3RFXA 3P5SA 3FMPB 4HMOA 4TKMA 1FVHA 2I03A 1HT1E 4B35A 2R97A 7ABPA 2ODBA 4P7FA 4ZT6A 1MOPA 1VI2A 3CEHA 3L4EA 1KAHA 2WHEA 3ETCA 3N75A 2EFJA 4DG8A 3QEMA 1IUNA 1N6IA 2VPIA 5MHTA 2DQKA 2NO6A 2RK4A 1E0KA 4H15A 1CQPA 2EG9A 3NHSA 4B5LA 5HKBA 4FX5A 2V55B 3W77A 3H97A 4IRXA 4RF3A 4BKUA 3HYCA 4JJ6A 5CU7A 4AMGA 1N57A 3IEMA 4CCYB 1ODKA 4H7DA 4CM8A 4MIOA 2WWRA 1BE0A 1CZRA 3G8YA 4RPLA 4BVEA 1W6UA 3ECCA 2C4VA 3RAEC 5E9WA 3S2GA 5IVDA 4W9NC 4ZVMA 4M1YA 4NZ9A 2OXFA 2V8BA 3ZCTA 4JB0A 1P5RA 2Y9MB 4P81A 1E3WA 1ABEA 2XUAA 3TPZA 2PJZA 2YJZA 4IICA 1XA3A 4I3GA 1TTHA 3F9IA 5HILA 3GGPA 1CK4A 1L4EA 3ZD9A 3H5OA 1TJ5A 1L1RA 4AURA 1XZFA 3OJEA 2VP2A 1DB3A 1N1EA 5JWRA 2FUG6 5IX8A 1EBUA 3KHUA 2XZDA 2BN4A 4G25A 2HA0A 3PTLA 4O8CA 3TSCA 4F9FA 3G5TA 3IBSA 4W5WA 2F59A 2QQGA 4RH3A 5BVHB 1Y5MA 4U2FA 4ZOBA 2H4JA 3U3JA 3OPYA 4HJRA 2RBGA 5E0KB 1WZUA 2FR8A 4YA6A 1C0EA 1AUXA 1YZGA 3HWX1 4ZQBA 1R74A 1AHPA 2CUNA 4FYIA 2B6NA 1UKCA 2BGWA 1A96A 3E9NA 4FFLA 4UAVA 4W5QA 1XYYA 4TVOA 1B1CA 2FSIA 2PU7A 1GAEO 2WJ4A 1Q6YA 3A9VA 3I9V1 3N2ZB 5KTPA 5LQDA 3A1FA 4BMNA 4CF7A 1A1VA 2ALJA 2DQZA 4KFCA 4DR7B 1FFYA 1WABA 3EVNA 4IG4A 1YDFA 3PSHA 4RYLA 2UXCB 2O4CA 4MUAA 1EIZA 2CE7A 3ME5A 3QKIA 4GRIA 1IJEA 2HWUA 4YYEA 4OXNA 4D9IA 1KRWA 3DTNA 3VZDA 4ZEWA 4WCFB 2YV3A 4RXMA 4Y2XA 4B17A 3LXUX 4U6QA 3V7FA 1TGYA 2X1VA 2ZPTX 5JWHA 5KNDA 2F3UA 4CGYA 5ESXA 4R5HA 4FPXA 3GPIA 5ER6A 1D4AA 1WCIA 3OOHA 3ICVA 3D7SA 1MNQA 3SF8B 4M1EA 2HLDD 3UATA 3VZBA 1RXWA 5SY4A 3MBKA 1XC7A 1FTYA 4X97A 2OG2A 1E2IA 5KINB 2JNWA 1SB8A 3HXQA 3PDHA 1GNPA 1DJPA 2QRQA 4O5OA 4OI2A 3TKYA 1I4EB 1NT2A 1O0SA 2PD3A 2ZJAA 3OFND 4LA4A 4GX1A 4R8SA 2P8JA 3AB7A 4LY9A 4MUNA 1RZRD 3E9ZA 3T38A 2WHRA 4Y2GA 3V4SA 1NYLA 3BXPA 1NT4A 4NPCA 2PT5A 2XODA 2R7KA 2GNPA 1UOEA 2WUWE 5EJ2A 2CBZA 4DSTA 1AS0A 1M34E 1PFWA 3DWIA 2BBTA 2VZLA 5K0ZA 2I4IA 3MZ0A 2PFKA 5CIWA 3SSAA 2RJOA 1B6GA 1YVUA 2NO0A 3BZUA 4W6QA 5EGSA 1E2NA 5SYMA 4B9EA 5HYVA 1W48A 2IPNA 3G1UA 2F8LA 1NX9A 4WVFA 3Q1KA 1GADO 3AQ4A 2IVFA 4XCQA 2C7RA 2D06A 1O87A 3O1HB 5CRIA 4L07A 2F43A 4D45A 3IIIA 3F6YA 5BSEA 4YMLA 3HYRA 4OLBA 3LNTA 3K6RA 3VTKA 2P5UA 4O4LB 1RP7A 3EMDA 4QHYA 4ZT5A 3FNRA 1SG9A 5AKHA 1O5TA 2RD2A 3HCOA 3EZXA 2I4RA 4MVJE 3BULA 3WLLA 4ACAA 1WMEA 4TRRA 3REFA 2PIAA 2OENG 5ALTA 3LF1A 3FMOB 5A03A 1TO2E 3DOHA 2G88A 4FGKA 2NVWA 3WQHA 5BW8A 3HPQA 5IABA 1JHAA 3FIJA 4TYPA 3OEHD 1R6UA 2QY6A 1U8FO 3KFXA 3KT0A 4YP1A 2WQ7A 4OFBA 1T5HX 3D2AA 3V4RA 4D56A 1CVLA 1YA4A 5CK5A 2DLCX 1ABBA 1N0VC 3Q5GA 5I8PA 4IGKA 5KQSA 1J8FA 2Q4OA 2XB4A 1YRYE 2HEIA 1JILA 1IU9A 4MV6A 4F6RB 4X60A 3URKA 2PDAA 4K3VA 4CT0A 5F5LA 4IWXA 1VE5A 1FTGA 2FB9A 3VH3A 5HUHA 10MHA 5FT9A 3D8HA 3G2QA 3LBAA 3O8QB 4D57A 1QTNA 2W2VA 1MJNA 2UDPA 1SXJB 2MMCA 3KQWA 3KVVA 2JAXA 2XZTA 3OUZA 2X8LA 3OQ1A 3PXCX 1CFJA 4LVOA 1QJCA 2YIDA 5K0NA 3ROQA 2IS2A 2HEGA 2CJXA 4J9UE 1JZTA 3OIYA 4HAZA 4BQFA 4XTCS 1RACA 5HBGA 4G1MB 4OX9B 1CUYA 4E08A 3VSDA 5K3OA 1HE8B 4F4UA 5ICSA 2QN3A 1K0FA 3EWIA 2PXXA 1U99A 2RH8A 2XRYA 4UU7A 3SMVA 4B34A 4DZTA 3UXMA 1W5TA 1MVOA 4J16A 5BPHA 1LS1A 3VUFA 3AUAA 2NXNA 2PNFA 4D3FA 4J1NA 3DXFA 2JFNA 1K8QA 2YZMA 4XUCA 5GV8A 2DWOA 2PR2A 3AR3A 4ITRC 4B40A 4S1OA 1DS6A 1ZBQA 1H0SA 3BERA 2XJ9A 2PT7A 1G41A 4NJMB 3Q7TA 1IC6A 2C3PA 5T67A 4MYHA 4P7JA 3T06B 5KAMA 4JC4A 2XDQA 5DLYA 4FOOA 4EYKA 1QNFA 2D4HA 2H4XA 1XHLA 2ODAA 2ORWA 1KDZA 3VR4H 1ZGBA 1OPXA 3U7HB 2CYAA 1P81A 2QTBA 4UULA 3N9IA 4IWYA 4LK3A 2A1TR 5EZYF 2AF4C 3PR1A 1TLTA 1ZN7A 4FE3A 2BZ0A 4HFJA 4RLQA 3OBIA 2D5IA 4RD3A 1HZZC 3H2HA 3HCFA 5FNVF 3TZQA 1BMFD 2QYSA 3BCSA 1XVAA 4XE5A 3WGNA 4E94A 3CB2A 1OYVA 1OREA 1TYBE 1XL1A 3O8CA 2FI1A 3OCCA 1DDOA 2FPWA 3EH1A 1MB0A 1VHTA 3SE7A 4WBNB 4ARZB 2E1RA 1BFUA 1E9CA 2BMEA 1GO2A 2YJ6A 4XQCA 3G8DA 4Z0PA 3L6BA 2ZE7A 3T3DA 3EAGA 1QPBA 2EZ4A 2QAGC 4LE2A 4PQYA 3ENVA 4ESOA 2OAQ1 5DLPA 3AM3A 3DFMA 1Z6XA 1UDAA 4BAUA 1BTOA 2RGYA 1CXZA 4YJ3B 4IXMA 4KCGA 2WJHA 5AXCA 2YHBA 4A6XA 1M1NA 4G84A 1N0IA 3G0CA 3V1UA 4K5QA 1YACA 1GPWB 2B25A 2EOAA 1L7BA 2C5BA 3GT0A 4JQCA 4NBSA 4DJEC 1DAMA 2UZIR 3B6ZA 5KWSA 1B73A 2P77A 2FV8A 3EIFA 3NTRA 4IEEA 4ANFA 4ZVUA 4QYWA 3UG6A 1CIJA 4TWRA 3CSDA 5JVDB 4AN0A 1NULA 5EHIA 1A2QA 1GPBA 2NYVA 4JA2A 4UHDA 3KPYA 3AHJA 4JLBA 3WSVA 2EDCA 4ENUA 2QBYA 4TTQA 5DHQA 3TVDA 3RSOA 2OY0A 3PC2A 1QMPA 1XAIA 1V5EA 3BSFA 2CCKA 1EAYA 3HV0A 3RS9A 3C1OA 5BQFA 4AJHA 5LMUB 1QUFA 4F3NA 1FFDA 1OZHA 2XY4A 3SC4A 4L2IB 2J3LA 4OAQA 1NVUQ 2JFZA 2P4SA 3BFXA 2IV3A 4MV4A 3OKCA 1GT91 1FDSA 1P0QA 4BU1A 4GL2A 4F0JA 3GK3A 2I76A 4LJ9A 2Z09A 1E66A 1X86B 2KHZA 2HQRA 1YFZA 5BYKA 5JSHA 3ZJUA 4BMXA 1X8KA 3WA7A 5ALWA 2QL5A 4EBBA 5DYWA 3SLGA 4RJTA 1DC8A 1U7ZA 1DFGA 1K08A 4FILA 4LCJA 4C7VA 2OXEA 2G5CA 4V38A 2P0YA 5EJIA 4E30A 3OO0A 2PZKA 4MZDA 4HH0A 1C7IA 1RBZA 1TX4B 3I8XA 1E2DA 4FWBA 4BQSA 1DXQA 5AM2A 3G5UA 5AI5A 3RWBA 4BOYA 1K6JA 1YCGA 2VQDA 4XVHA 3BRWD 3FCUB 3NDPA 4HDCA 2YYSA 2ZTUA 1W36B 2YH2A 1NKTA 2OM2A 3DC2A 4FYJA 3T5CA 3TAXA 5I7RA 3NOOA 3GAMA 3AP1A 5ECDA 5I9NA 5KVAA 1T4DA 4HO1X 1WDMA 3CR7A 1NNLA 3RIGA 4G0UA 2O8VA 5ITZB 3W4JA 1QQAA 4YAWA 1M34A 2G4VA 4ZO9A 4IUDS 1HEYA 3KSRA 1G8KA 2K4MA 3B6KA 3IQGX 1PKXA 4N65A 4GDFA 1Y6GA 2CJPA 1QFSA 1Z83A 2PFSA 1M33A 3W34A 4LKRA 1GPLA 3FSGA 4NBUA 2KB0A 1NTOA 2XKJE 4FCCA 3MGKA 1ZLXA 2C8LA 4ZJUA 1H4TA 2DXIA 2DX7A 4YRRA 1IAQA 3VAYA 4J29A 3RUEA 3VR5A 4I50B 2GPYA 4B33A 2V6FA 1M6YA 1MJFA 2I6XA 2V96A 3H0CA 3PGVA 1DFHA 3EVBA 1JQAA 5FPHA 1TMYA 1QFYA 1L5NA 4QUBA 2A94A 2QAJA 3PNKA 3CX7A 4TQGA 1HYBA 1XTIA 3BE8A 2WAXA 4RVDA 2WHXA 3JQ7A 1G3IA 3K1AB 2GDZA 4Q9HA 5BMOA 1B4DA 4X66B 1EA7A 4N5IX 3D1JA 3F3KA 5F7ZA 3CTMA 4EY8A 3C70A 2X5XA 3QOFA 3F3MA 5CA1B 3T54A 4DDMA 1V2HE 3QMVA 4IQ0A 3M2TA 2QP4A 2WWXA 3ABQB 1CVIA 4J49A 5TDHA 2GN2A 4M9SA 4PO3X 5AJXA 2DETA 3ZIDA 1HOTA 5BSUA 5L45A 3BK7A 3S6JA 2BMVA 1QCCA 1UP7A 1GZDA 2LIVA 2PQ0A 4Z4HA 3UY4A 1A2OA 2FQQA 3D6JA 4CFSA 2CF6A 1GCOA 2XVXA 2W2LA 4X7PA 3WO1A 2GKGA 1LC0A 1MO2A 4RCZA 2ODWA 1QGUA 1ZEJA 2JGAA 3WB0A 5JH7F 1MW8X 4Z8XA 3C45A 2QJRA 3EDQA 1P0CA 4KAJA 2IIQA 3VTAA 2PKQP 5F4BA 3OU6A 4CIDA 4J43A 4DBVO 5AESA 2AFIB 5COBA 4E22A 1SCNE 4F5DA 2X23A 5EAIA 4AS2A 4JT2A 4ZIRA 1A9RA 3ADPA 5J4KA 3PI6A 3INYA 4LF4B 3IX7A 1T2DA 1X1CA 1E5TA 5C1OA 3EG9B 2Y1XA 1C4KA 1QYWA 1IK6A 3F67A 4LJSA 3FPJA 4MQUA 2H2WA 2X9VA 4AU1A 1YS2X 3ZDXB 1UBJS 5DYNA 1B8VA 3SR3A 3VKVA 4DLAA 1K06A 5U1PA 5J58A 5LZ5A 2VYVA 2C83A 5L6MB 5ELMA 5AJYA 2UZ1B 1L7EA 4MKGA 1ZSYA 1FP7A 1XB2A 4U1RA 2Z9CA 1USIA 4DR4B 4IH9A 3HM2A 1PQ4A 3ZHVA 3F73A 4WA8A 3GH1A 1EQUA 5K3AA 4CMGA 2R6R1 1M0TA 2WJPA 1AY0A 3FB4A 4NWIA 1SBZA 1WETA 1N8SA 2FMKA 4LZJA 2OHVA 2Q3BA 3UK0A 1A5BB 5KNDH 5F3DA 1P2VA 1RABA 1YQGA 4MJXA 3T3PB 4BFSA 1XMPA 3VU9A 5CVTA 2NV6A 1IONA 4KWHA 3RB8A 4U9HS 1Z36A 2FLWA 2XA2A 3HUFA 1BXRB 4TV8B 2Z6VA 3TIIA 5BW4A 3FLAA 3P2OA 4P4UA 3IBGA 6ABPA 5FTWA 4M7OA 4FT4A 1U0EA 4RO0A 4LECA 3VNSA 3VSBA 2AUNA 4X64B 3L8CA 5CH5A 1CZUA 1O08A 4OHVA 3UOAB 1UC5B 2JGNA 4X7RA 1E59A 1GYRA 3C6QA 3IHLA 3PGA1 2FFJA 3BEDA 2NU6B 4KXWA 3KKQA 4UXHA 5B6IA 3U44A 4Y2YA 3RU3A 5JDIA 4DUPA 2BHNA 3HHPA 2EFGA 4F3YA 1GUBA 4FT2A 1SMKA 1SU6A 3F5QA 3Q2IA 1ECFA 3QGMA 3SZMA 4MHTA 1ZRMA 4CF3A 1Q7GA 2QZJA 3MVEA 3DF7A 3A6GA 4G01B 2GETA 2PO5A 5MDHA 5IM4A 5IU6A 3OM8A 4IBOA 1D6SA 1L7XA 2QX4A 3OA2A 3C97A 1L4UA 3E22B 4OU5A 1ZM3A 2WU8A 2IYYA 4UZSA 4JDUA 5G4KB 3STWA 4CN9A 3S8YA 2G1PA 1A8HA 4PHFA 2AYYA 4KSYA 3GUUA 4M1QA 1KETA 4WZBB 1TJPB 1L8OA 1TLFA 3M9WA 4O4JA 2ZRAA 2Z2JA 4DANA 1XG5A 1SFRA 2H2HA 4BTVA 3DYBA 4ZKEA 5AUNB 2BKAA 5ALZA 2EKBA 3GLGE 2MINB 1CF4A 3C7AA 5GAJA 2BFCB 3VDMA 4AUMA 3JWGA 2ASVA 1QOZA 2PSDA 2X8AA 2A4KA 2KYRA 2DSNA 4FHCA 4ERNA 3L0BA 1Q0PA 1VZ2A 1XD8A 1S7GA 1T6XA 3DAGA 1UIMA 5CURA 3VPAA 2ZM6B 1UL1X 3KSZO 2BD0A 3AVYA 2ZWIA 4E5MA 4MVJF 1F20A 5CLHA 2J4CA 4JBHA 1CRWG 1PJLA 1DJQA 1Z0DA 4GF5A 3M9LA 3WV5A 4ZGWA 3M4JA 2C9YA 2Y1EA 3MLAA 3MT9A 4CZ2A 1RKXA 2ZUTA 1OH7A 4ZVLA 3PKZA 4Z1MA 4CM3A 1K75A 2AZ4A 2AMYA 3B3AA 3N3BC 5C4MA 1GKUB 1ULHA 4H0FA 1GDDA 1G8GA 5AJHA 3SF0A 1NPTO 5K6RA 3SVLA 2QKYA 2QPAA 3OQJA 1YRBA 2O4UX 1NUPA 3O9VA 3I01A 4GM4A 4YDRA 1KK2A 2NU8B 2JB9A 3OWOA 4B0OA 5C8YF 3TEJA 4IKOA 4HNAB 4RK1A 3NYWA 3WZMA 1LNQA 2ZBDA 1AKQA 1W25A 4F4JA 1ESZA 3GD5A 5KJCA 5LP6B 1DAPA 4ZO8A 4YR7A 4Z7QB 1EP2B 3H84A 2PKYX 1AKUA 2P90A 3NHUA 5GOZA 3D0RA 1QFXA 1F60A 1KEWA 2QYTA 1T2AA 1AMUA 5F64A 3NT2A 4L02A 4RGQA 4TTSA 2QSJA 2GHTA 2Q2QA 2NUAB 5DP1A 1U04A 3WYBA 4I5IA 1I24A 1DLJA 1VRCA 4KQJA 4K1LA 3FCYA 3S5JA 2D1QA 1JT9A 2QG4A 3A9RA 1LNZA 1RXSA 2Y93A 4HWSA 1P2DA 1LBHA 3UMMA 2XUOA 3SLKA 2IYUA 5HKLA 1KDVA 4EGSA 4RD4A 1W35A 3ANYB 3PQDA 4RIGA 2A2ZA 3EEYA 4CI9A 1L4BA 3M4YA 4D0RA 2XSZD 3ZZNA 1Z5VA 2ZEJA 2JGJA 3M0EA 4JD5A 3KTAA 1TXGA 1I1NA 3A1WA 3EEFA 3M6IA 3M81A 3NIDB 1A69A 3TW0A 1T8WA 3EN0A 4CU5A 2OCBA 2W71A 1QANA 2VJLA 3OU2A 4BBAA 3RKRA 3EY9A 2YVUA 1L7QA 5EEHA 13PKA 2PZMA 3GGDA 2EFEB 3HNRA 3IB6A 2YJ4A 3A1DA 3LWBA 3NW9A 2WYIA 4FC6A 4K9NA 1Q44A 1G9XA 4GW3A 3D6UA 4TMWA 2YVLA 2QM8A 2EW8A 1Y1KE 5FAXA 1KDRA 3DMTA 3FMGA 1NF9A 3ONEA 2RONA 1KO7A 3DE2X 1OC2A 3WRYC 821PA 3A3KA 3JQGA 3GFVA 2XMBA 2JGLA 1N77A 3TR6A 5CA0B 2PK3A 4QYIB 2AJ8A 5DNAA 4YN3A 5JS1A 5DK4A 1H05A 2HFJA 4YQYA 4J2TA 5KYXA 1AKNA 1XL0A 1T4CA 2C54A 2VAVA 3T0IA 3N1UA 5GMOA 2A5GA 3C6MA 2G09A 1SU7A 1JE1A 1RQPA 1UM8A 1U6IA 1VHJA 3KVOA 3PC8C 4KFUA 5TQ2B 3UG7A 1VMAA 5IYZA 1Z7BA 2R68A 5K7SA 5KC9A 1QKJA 2DTXA 3LKDA 4IMPA 4REMA 5EUQB 2OQVA 1DEHA 1TC1A 1UBEA 2V45A 2I7DA 2Z83A 3AL3A 3CZAA 3EOZA 2WD7B 3LWDA 5CLIA 1ZUHA 3DOCA 1EP1B 2IYOA 2WU4A 2JANA 3ZV6A 4B4DA 4Z1OA 1HE2A 4IR7A 3RVJA 4DV3B 1ICIA 1MXFA 1AKWA 2RGNC 1OBFO 3LQKA 1SCAA 1QGAA 3TLCA 3SEQA 2UV8A 5JH7A 1YB1A 1T4CB 2CLIB 3RAJA 2WKPA 3WLJA 1XLTA 2H1HA 3GIWA 1ZOSA 4QT0A 1GRCA 3OTQA 4Q4CA 2CBXA 3LLUA 3MSXA 4G3XA 4ZQGA 5B1HA 4F1KA 1V37A 3GCWA 5A5FA 2W6ID 1ORTA 1UEJA 1VYTA 2B1JA 4LDNA 4QOIA 4TS4A 4ZANA 2CXUA 1G20B 5I7FA 2ZZMA 3R20A 2G0AA 3KEOA 4JB8A 1F7VA 4NNOA 4M9ZA 2BJWA 4GLLA 5ENDA 2WFLA 1NPDA 1Q0UA 2B21A 1GAQA 1U8AA 5L7YA 3NM6B 2CXQA 3VZSA 1NL3A 2GBIA 2W2OA 4DNFA 1YBFA 4DJDC 1SXQA 1XT6A 1H93A 4Y7CA 4A2WA 4CWAA 1KK3A 1OASA 4MGZR 5HTKA 4HGQA 3SBOA 1J9EA 1GQSA 1WUJS 1Y1PA 2HN9A 2G0NA 1CIVA 1RRKA 1WY5A 1GTMA 2FP4A 1KP2A 2OYRA 5IVPA 1HR0B 1C9YA 4MCIA 4BP1A 2HV8A 4IINA 2J0SA 2OD2A 2K2WA 3AUKA 3KZKA 3OKAA 2J41A 2X6RA 2PX3A 3QI7A 1Q57A 4LYHA 5EINA 4BNIA 4N8DA 5A06A 3KQKA 2X4IA 1HPLA 4UCQA 3OFKA 3BA1A 1TI7A 4XEHA 4B6EA 2ZDQA 1TQ2A 2WYOA 2R5FA 2X9QA 2I6UA 3O0DA 2YVAA 4F84A 4TLMB 3AFNA 4LTDA 1V6SA 4I6GA 2YJNA 3C8UA 3TH5A 4BLUA 3EBOA 4PRKA 4V02A 3U4QA 3NORA 2GASA 1J20A 3KQSA 5KMGA 5JMTA 1DKPA 3L04A 2ZCVA 3N5CA 1POXA 2OB1A 5I7WA 3CPSA 3OP1A 2X1LA 2G9RA 3WGQA 4NEGA 3LT0A 4S1PA 3DBHA 4A2PA 1UANA 3E70C 1SCIA 3IP3A 3LPDA 3ELUA 5F12A 3TUIC 5LU9A 2VXBA 3DMRA 3KTFA 2XUFA 3L0PA 3QFFA 1XVTA 4US0R 4GXRA 3TL3A 1RYBA 3JARA 3CLRC 1SIOA 4IVPA 4P8RA 4D74A 1R9JA 3RAGA 3FX2A 3KEFA 1SUAA 5FR1A 3C8DA 3IP9A 1FNMA 2H0QA 1B6TA 3L7NA 3NHKA 3RW9A 2MR6A 3K92A 2OAGA 5KDDA 1L7AA 3KJZA 2D3TA 3L93A 4F3TA 3LWNA 4YMTA 4N7RA 1PZHA 1Y4DE 4LMBA 4MRMB 3ITKA 5JXJA 1BS2A 3Q98A 3C3MA 3DBHB 2Q29A 4BAZA 1EHCA 1E3LA 5JXWA 1L7NA 1OLXA 1Z15A 2JFHA 4LRUA 1GU1A 4LJYA 3B53X 5D7NA 1SQ5A 2XYPA 5DWQA 5FI5A 1Y63A 5AKKA 5KTNA 1H1TA 2CLHB 2A7XA 4QUEA 4KDRA 5LXTB 2WKRA 1LFDB 4NS4A 3JPYA 3SDSA 3TLZA 2UYHA 4BVHA 3CMMA 3NOVA 4PIVA 2O5CA 1XHFA 4LXYA 2IZ6A 3OJWA 3HJFA 2BHTA 1LK5A 1BGXT 3TVTA 3ZI7A 1FK8A 5T7BA 4TLLB 3DR5A 3FHLA 2HA3A 2D1FA 5FL3A 1WDTA 2F9LA 2VK4A 3DZHA 5CXUA 2FZLA 1HGXA 4QXQA 5DSTA 3OCXA 4AKIA 4KV7A 4ID9A 3STUA 1WXXA 2CCJA 2HCRA 3T3HA 4YJ3F 2C59A 2Z5VA 4DKXA 4P32A 1T5OA 2IGTA 3IEVA 2VNJA 1WLYA 2W2MA 4Y0AA 2QROA 2ERYA 3JWIA 2JFVA 3QOYA 2B2XA 4Q9AA 1JXOA 4IZ6A 4K1XA 1I5EA 1NW4A 2FSVC 2V7VA 1GR0A 4WKOA 3S2SA 3VR5H 2J3EA 1PJZA 4FGJA 2D6FA 3N3AC 1F5NA 5JJLA 4RSHA 3RTAA 2IY7A 2IXAA 2Q5HA 2YWJA 3QTBA 2XOKD 2CUKA 1RM3A 2IOFK 1OXXK 2YWFA 3EGIA 3HFRA 1U8UA 3I6MA 3KWLA 3LZDA 3LYHA 4RZXA 5DGIA 3ESAA 4U63A 4RACA 2ONJA 2DBQA 3RO7A 1N34B 3I0MA 4NMMA 4I9UA 3VX3A 1DO8A 5EGNA 2D7JA 5NLLA 2WA2A 4II3A 3EDRA 2Q7XA 2OBYA 2PGLA 4FX2A 4NTZA 2FF7A 4NL4H 4DSUA 1T35A 4MOWA 4R0NA 1ZGHA 4JFAA 2DULA 2EKZA 2D74A 2YQZA 4ID3A 2A4MA 1H1LA 2EBUA 3DKIA 2QE7D 3L79A 1G6KA 3CUTA 1W19A 5ES4B 1ML3A 3Q7IA 1Q21A 3LNCA 4KQEA 5HKOA 4M76B 1SRRA 5KSPA 1E2BA 2CMGA 4I5GA 3WLOA 4OQZA 4UOQA 2DRIA 3MRVA 3C3XA 4FMBB 4BNJA 3WRVA 5DU2A 4CKBA 4ZQEA 3T4EA 3PUZA 3H17A 1V6CA 1N92A 3B1VA 4B7AA 2FPRA 2Q0XA 1Y8AA 3CQ9A 4LV8B 3TNJA 3ZVRA 4U2DA 1G2PA 4R68A 4EL5A 5JS8A 3LHDA 2GD2A 1QC5A 4RVSA 4YJFA 2VTBB 5JMOA 1R1DA 3DEYX 2WMDA 4GSKA 3PCTA 5EZYA 3DYIA 3TZLA 1FQOA 3WJ7A 1IL0A 1YT5A 5ARBA 2J33A 1WD7A 2EJWA 2QTZA 1DJLA 1P31A 3A9WA 1FMLA 3CBQA 1E6EA 2P9BA 1DOHA 4DA8A 3IV7A 1Z7GA 2GK7A 3MMPA 1TF5A 1YJXA 1DJNA 3GDFA 1NW5A 1J25A 1XWWA 1ZN9A 1ZMRA 3ETHA 3UUGA 4KHPB 2E4XA 2ZS7A 4ENPA 1UPAA 1X3SA 1XMXA 2WWFA 2ZSUA 4P1ZA 3WGZA 1OGIA 5BWLA 1FOEB 2Z8YA 3E3OA 4KH1A 4BVGA 4U7HA 3S2UA 1CIPA 5AO9A 4AMUA 5CDGA 5E6RB 1X1RA 2C29D 4G1FA 2IZ1A 2QLJA 3HDHA 3LBFA 4IIHA 4KXVA 5EFZA 5JAOA 1C2TA 1Z2EA 4J8PA 3EGWA 1RKVA 5C4IA 4EG6A 1NBWB 5JHGB 5JTTA 3BE4A 4IV0A 1JPVA 4LS3A 4MQ4A 3K9BA 2CHVA 2AC7A 3QXCA 4DXAA 1FU7A 1QHHA 4S0ZA 1QOQB 1MT0A 3UV3A 4E2WA 5JNRA 5J2UA 3F6BX 3KHSA 3A10A 1TJ4A 2YCLA 2NYRA 3UF0A 4H6PA 4MB0A 1ZZGA 1JU4A 2E18A 2KPOA 1C8BA 4GL4A 4RK0A 4J76A 4OQ4A 3B5EA 2BR5A 2AI3A 3W9YA 8ATCA 2X4LA 3X1MA 1WVGA 1DMRA 2P0EA 1CEXA 4FDAA 1UPCA 4N4AA 2PXAA 2XB2A 5LM3A 2NPFA 3IPYA 3KKZA 4GMKA 3IUYA 4MITA 2RC5A 1UPTA 1XVUA 2W0SA 4GMDA 4L6IA 1E96A 1M1ZA 1PWYE 3UJBA 3WDKA 2Z0MA 1ECGA 3CONA 3NGXA 2CHUA 2FZKA 3P2MA 2XNDA 5BN5A 2PUEA 3RBAA 1PN3A 5DFAA 2PA3A 3K0EA 4TUYB 2PGJA 2G9ZA 3BICA 5I4CA 3RS4A 1S4QA 1EUQA 2XWQA 4C7MA 1XA4A 1R50A 4ER6A 1FVOA 2ZIGA 4LRTB 2YMQA 5BRNA 3VBEA 3WVNA 1EWKA 1SH7A 3JX9A 3BJRA 3QMPA 5ILQA 5HQ3A 4R2JA 3CR8A 3CUKA 4E70A 1O03A 2REOA 3EC2A 4WLNA 4YJHA 5ALLA 2D1SA 1EGHA 4D1YA 4B3MB 3C8ZA 4V0MA 1E0AA 3PRYA 3O8OA 1RJDA 2D5LA 2RMKA 2HWXA 4CM9A 3ACCA 1UXOA 1VLLA 1YWGO 5HDBB 1YB2A 5IKXA 2GHQA 4P58A 4N3BA 3D7RA 4EWLA 1WOYA 3CYFA 1RI5A 2RSLA 3GFGA 4RMGA 3GLGA 1HEIA 1J8MF 1DTSA 3MOGA 2PMDA 1NVFA 4QBIA 3TQQA 4NCJA 3QU2A 5B4TA 5BWMA 1CF2O 4XFJA 1ECPA 4R40A 2MYUA 3HDJA 3DZ8A 5CDFE 3PXDA 1SUSA 4S04A 1R0WA 3FR7A 4NAHA 4UU1A 4GOXA 4BNDB 5BORA 2MYTA 2YIVX 1E7WA 3JZDA 6ADHA 1HQKA 4OKSA 5AW4A 2JASA 4NCHA 1NQAO 3LGAA 2Z3ZA 4K3UA 4TXJA 4DQUA 3K3PA 1YQTA 1FFAA 1I7DA 1AV6A 3QF4A 2C97A 1TPZA 1F0KA 2A9VA 1DAKA 1Y4SA 1E9SA 2FXIA 2VIIA 2WFAA 1EHYA 3NR2A 3ZK7A 5IDVA 1ZA1A 1YJQA 1ORHA 1V7QA 1V39A 2R4TA 3CSSA 3NV9A 1CY0A 4HTFB 5FO0A 4KUEA 3SZUA 4ZYVA 3D3EA 1BOOA 5HZHA 4HX5A 1KO8A 5EXPA 3LHIA 4ZT7A 1AE1A 1U2GA 3PNQA 1GFZA 3KELA 1MJ5A 2CXRA 2V6IA 3WY9A 1QDUA 3BJZA 5LNK6 3IPLA 4ATNA 3ESBA 5GWXA 5LU8A 1HNNA 3F8SA 1DRVA 1EFKA 4MWTA 5G1PA 2WIKA 2H8KA 4V0NA 1GCIA 1O57A 4BGDA 5LBIA 2DEUA 1KPIA 2QV0A 1ZK1A 4I9FA 3FYCA 1CETA 5DN6A 4L5BA 1TAQA 1D2GA 2H7YA 3CZRA 2AYXA 2ZI6A 1Z0AA 2MIIA 3ZZTA 1H5NA 3UANA 1HDIA 1HNWB 1LSOA 1WXHA 5F21A 3IT0A 3KYCA 4R2WA 4YRDA 3CMCO 3NHBA 5FWYB 3TQSA 4H7HA 2PWZA 1NHWA 1PIWA 2BF7A 1KI7A 5LQSA 3SX4A 4K9RA 4N49A 4Y2JA 2VAWA 5C7OO 5JBIA 3I9FA 2FY8A 2O7NA 2ET6A 2QVZX 2V4MA 3H16A 1NFRA 3QLEA 5TX7A 2GO1A 4V0LA 3SC6A 4QDTA 5IN4A 3STXA 2UAGA 3P26A 2D62A 3BMNA 5DHFA 1NJ2A 2XVZA 1LLUA 1FA9A 1ZS9A 1EI9A 1X7XB 3R6LA 1E5LA 1JQKA 3DTVD 1UM9A 1V96A 1A50B 3IVAA 1OH8A 3RSHA 1YE8A 4KX3A 2HZ7A 4NABA 5K3SA 1K7SN 2ZE5A 4BMSA 2R7MA 4LJKA 5EQTA 1T3LA 2O1XA 3O9MA 1EINA 2XTJA 5J2TF 3FYSA 3VNUA 3R5TA 1RHQA 4M0LA 1QDLB 1OYOA