2YDYA

Crystal structure of human s-adenosylmethionine synthetase 2, beta subunit in orthorhombic crystal form
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
297
structure length
260
Chain Sequence
NRRVLVTGATGLLGRAVHKEFQQNNWHAVGCGVHHIIHDFQPHVIVHCAVDASGNLAKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVMFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIADAFNLPSSHLRPITDSPVLGAQRPRNAQLDCSKLETLGIGQRTPFRIGIKESLWPFLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHIONINE ADENOSYLTRANSFERASE 2 SUBUNIT BETA
publication title Insight Into S-Adenosylmethionine Biosynthesis from the Crystal Structures of the Human Methionine Adenosyltransferase Catalytic and Regulatory Subunits.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 89
structure length 260
sequence length 297
ec nomenclature
pdb deposition date 2011-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04321 RmlD_sub_bind RmlD substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ydyA00
4E12A 1MGOA 2C5AA 1LDGA 1QLHA 2JJYA 1PJLA 2X58A 3QWAA 3GQVA 4MVJF 4U0KA 4WOKA 1EVYA 2UYYA 4H16A 4D3FA 3PJDA 4OJNA 3ENKA 4IZHA 5KOIA 1H6DA 2R6JA 3D7LA 3VVCA 4AICA 4DPMA 1X14A 2ZCUA 3GVIA 3D3WB 3JYLA 3KOUA 2IRWA 3Q1LA 3Q3CA 3Q9UA 4GLLA 4WUVA 4XGNA 5AXBA 5BT9A 3WQSB 2B4RO 3U4HA 1RKXA 1VSVA 3H9GA 4I9HA 4RVGA 4CM8A 1VI2A 1PZHA 3LC2O 1N9GA 5CEFA 3PTZA 1SO8A 3Q6IA 1T2AA 1DRUA 3JYNA 3TZ6A 1CJCA 1LSUA 2JHGA 4PLCA 1T24A 1YH3A 1H6AA 2PLAA 4KUGA 1LJ8A 1DXYA 3AM5A 4DLBA 2EHDA 1BW9A 1E3LA 3H2SA 3A1NA 2BRUA 1X1TA 3RD5A 4GKVA 3R0IA 1MLDA 1U8XX 3ZHXA 1HYEA 1B3BA 3WGTA 3OJLA 3MTGA 3INRA 3U9LA 4CMGA 3MJSA 4ALJA 1MC4A 4CLHA 4BNHA 5HRUA 1J49A 3GRKA 2X8LA 3W8FA 2YW9A 4DGSA 1Z82A 1UP7A 2YFHA 4NBTA 3AFMA 4AJ2A 2ZKLA 4DQVA 1ZK4A 1I32A 2A92A 4W4TA 3VZPA 1HDRA 1GDHA 4BNKA 1ZSYA 3WNQA 1YJQA 4YPOA 1ZUD1 5KVCA 2JFHA 4CLOB 3F5QA 3L77A 3TFQA 1U9JA 4PLGA 1LQUA 1R12A 2HDHA 4C7KA 4Z0HO 3G1UA 3L9XA 1MB4A 4Q3AA 4AJ4A 2WD7B 3DWFA 1E3IA 1EBFA 1RM3A 2EG9A 4E13A 4OSPA 1DIGA 1Z74A 2Q1WA 3NDRA 3VZSA 1VL8A 4ZHSA 4B79A 2EERA 3NYWA 3DBVO 2G0TA 1SBYA 3TZQA 4CM4B 4QFDA 1HE4A 3RC2A 2O50A 5HM8A 2GN8A 1G1AA 4J7UA 4D0SA 5BSHA 4J0EA 2DPHA 3FNEA 4FJ1A 4FGWA 2FR0A 4RLHA 8LDHA 5F1OA 1C0PA 4U0JA 1B8PA 3WB9A 1A5ZA 2NU7A 3PJEA 4IUYA 3RUEA 1N2SA 3GMSA 4B4WA 4BNXA 1UXJA 1O9BA 1E77A 2X23A 3QHAA 4YACA 3QVWA 4EUEA 5LDHA 3S1LA 3S55A 5JC8A 3X2EA 4FPXA 1X7DA 3WGZA 2Z95A 4NI5A 5G4LA 1AN9A 1TA4A 1IZ0A 3DZBA 1P1HA 3TDKA 3GVCA 4ROSA 3GNTA 3UCEA 1NPTO 1YQDA 3GVHA 5BSFA 3G1TA 2Y0EA 4L9RA 1Y7TA 3HG7A 4XB2A 4TZKA 4IJVA 3RWBA 3ZWBA 3M1LA 3HWRA 1EE9A 3H3JA 3D0OA 4OKNA 3H6KA 1VPDA 2E48A 3GGGA 4IDEA 3ZV6A 1BVUA 1GADO 1NAIA 4YJGA 2CFCA 2BLLA 2WE8A 3STHA 3EHEA 4Z9XA 4Y6RA 4RF4A 4A2CA 4JP2A 4JP3A 5G4KA 3BHIA 4NFHA 4EITA 2DPGA 4JCOA 1C14A 5A9SA 3RVDA 5T67A 1DB3A 3V1UA 1JVSA 4R9SA 1SEVA 5T64A 2CVQA 1P1IA 4W7IA 5JYDA 4UUOA 4Z6KA 3JCZA 4DQUA 4Q9NA 4AJIA 2Q4BA 3CMCO 4TVBA 4HFJA 4YJHA 4YJFB 4CLRA 1CYDA 2Q2VA 3UF0A 1Q2XA 3PQEA 3Q2KA 3K92A 4ALIA 2Y1DA 3QSGA 4BO1A 5T6BA 5T8KA 2GNAA 3BIOA 3RUAA 5IZ4A 1MA0A 1F8GA 2PZMA 2OP1A 5CDUA 4FN4A 2Q1SA 1YE3A 2E82A 4U8GA 3BMQA 4FS3A 1Y8RA 2W90A 1LXCA 3VHRA 3T7EA 5I8WA 4MP6A 1NVGA 3FWNA 4E5YA 3VC7A 1B14A 4RF3A 1WXDA 1LRKA 4LSWA 3BMOB 4DMMA 4WECA 2A4KA 2VZ9A 3RUCA 2G76A 2JKVA 4Z9YA 3INGA 4GSKA 4B7XA 2UUPA 2TMDA 4NPCA 4AJHA 1MC5A 3H2ZA 4IJWA 1A9ZA 1I3KA 4PG8A 1YWGO 2I5PO 5BNTA 3ZNQA 1L1FA 4QQRA 2A35A 1VJ1A 2X1HA 1A4IA 3AI2A 1XQ6A 2F00A 5JLAA 3OETA 4G81A 2G1UA 4YAJA 2VHZA 3ANLA 5T57A 1VC2A 4E21A 4P4GA 1ZXLA 4L73A 3LSYA 2EKQA 2FR8A 3ANNA 1V6AA 2ZTVA 3ZWPA 4QT0A 3E9NA 5CP8A 2BI7A 3UFXA 3I6QA 3QLJA 2ZJ0A 2NADA 1R16A 3OBBA 3GOHA 4OQZA 3JSAA 1NHWA 1HDZA 4JNKA 1KIFA 3KV3O 1QKIA 4IY1A 2Y0CA 4CODB 2Q1UA 4FFLA 1LA2A 1IZ9A 4ZA2A 3EVTA 4B4VA 3DBLB 3VH4A 2EGHA 4KP7A 2VZ8A 3JQEA 5JMPA 5KKAA 1WLYA 1Q7BA 5KJ1A 4JGBA 4BGIA 1LRLA 4XKJA 3I6IA 3VZRA 4E0BA 1EDOA 4GVLA 1GFSA 2V6FA 2V6BA 2VCYA 4JIGA 3DMTA 4CUZA 4ESOA 2DU8A 4XR9A 1O8CA 3FF4A 3LVFO 3M2PA 3COSA 3W8DA 4B8ZA 3PLNA 3HFGA 4BV8A 1NR7A 4YRAA 1A9YA 5HS6A 4O5OA 1Y8QA 3KYCA 1Q7CA 1H6CA 4J3FA 4A03A 3AOGA 3L4BC 1PJ2A 5U9CA 1YONA 1PS9A 3OIGA 4KMSA 4R3NA 3ZZNA 2DTEA 5FYDA 1ZEJA 3ZHYA 1K2WA 2D2IA 2DFDA 3DAPA 4FR5A 3NT2A 3PHLA 4CLDA 1DIBA 2W98A 1HLPA 1EQUA 1H6BA 2PZKA 1XYGA 3BMCB 3ZWYA 1CRWG 1EEHA 2OXIA 3PXXA 2J8ZA 3JQGB 3CH6A 3IL2A 2QX7A 3WS7A 4IM7A 2O7QA 1M6HA 2PK3A 3DXFA 3O38A 2W4QA 1YOVB 1SAYA 1PL8A 1NFRA 3PVZA 4NJOA 2QIOA 2HMTA 3DBRA 4Q39A 4QX6A 4AJKA 2BFPA 1PZEA 4ND5A 4DBZA 5MDHA 3WSVA 3WR5A 1SNYA 2Y1FA 4HNGA 4W6ZA 4O0LA 3GAZA 4KTVE 3ONFA 4WEOA 2NV6A 3UVEA 4U6QA 1KYQA 4BNVA 3QW2A 3MWEB 1H0KA 4L4SA 3FR7A 4R16A 5KVQA 2O3RA 3ORFA 3ZWCA 3BXXA 3JD1A 4B3HA 2JCXA 3OIFA 4Z0PA 5JBIA 3TZHA 4BL5A 3BAZA 5I7SA 3CXRA 1J0XO 3QVTA 3ZNNA 3U5TA 4I8XA 3KLMX 4CMAA 3C85A 2IEBA 2YJZA 2BGKA 1Q7GA 2AXQA 2X9GA 5KTKA 4RVFA 1GZ3A 1ZMTA 1DIRA 2NTNA 5JSFA 1D1TA 2BGLA 1PJQA 4FB5A 1A27A 4ND4A 3OFSA 1B15A 1C1DA 1IHXA 3NDIA 3PYXA 4PG4A 3ROQA 1E7RA 3MWDB 1Y9AA 4CV0A 4DMLA 1J5PA 2NQ8A 2Y66A 1R0KA 3I9OA 4M8SA 5K9ZA 1YKFA 4CJXA 4KUEA 3HHPA 3ABIA 3SBOA 3TSCA 1WAMA 1HE5A 3DTYA 3IKTA 2QW8A 5C7LO 1PIWA 2GO1A 5KJEA 1P45A 4FC7A 3I52A 1Z45A 3LC7O 4E5KA 4OOFA 3LT2A 1ULUA 4R68A 3TF5A 5A03A 3JQ8A 4D3DA 2EEZA 3VKVA 4BMNA 3KXDA 1Z73A 3HB5X 4GX2A 4JX8A 1RM4A 1EE2A 3TOXA 4OKIA 5BR7A 2JL1A 5CAEA 2VZ0A 2WTBA 3CEAA 4B4OA 5IDYA 1FMCA 1B16A 2Q46A 2C7VA 2EWMA 3EZLA 2DQ4A 3HNPA 4NFSA 1U28A 1T2EA 5EMHA 3RBZA 2Q49A 4BNWA 2Z1MA 5I9LA 3AY3A 1ZK0A 2DVMA 1FDWA 1GUZA 4HADA 4PLHA 4PZEA 3RIHA 5JW6A 2E4AA 1B26A 4H15A 3P7MA 3Q0EA 3V2GA 5CDGA 3KETA 4JLWA 2O3TA 3QIVA 3M2TA 1ZK2A 4J6FA 1BDBA 1RPNA 2ZK7A 4BB6A 1V35A 4OM8A 1R0LA 1HE2A 4F6LA 3QWFA 4PG6A 2GGSA 2O2YA 5EJ2A 1GYRA 1MP0A 3JQ9C 3ICCA 4R5MA 2A9FA 5HA5A 2NLOA 3E48A 4NBWA 4YJDA 4CM1A 4DXHA 1R4MB 4WLEA 2Y0DA 1G0NA 2X5OA 3EW7A 3JQFA 1XG5A 3ADOA 2LDBA 1BXGA 4BNGA 4BNTA 3PYMA 4RF5A 1XU7A 2FY8A 4OSOA 2JCVA 3W4KA 3NJ4A 2EV9A 3GAFA 1UP6A 3NTRA 1LC0A 2D5AA 4DIOA 2VHYA 3ETDA 3MJTA 1E7YA 4WEQA 1G0OA 5CHEA 1DPGA 2C20A 1KEPA 1ZJZA 3O8QA 3F9IA 3GT0A 1JDJA 3RC1A 3IP1A 4JROA 3RKUA 4CMCA 2QQ5A 3QWHA 4A10A 2Y68A 3QWBA 5LCXA 2AG8A 5C7OO 4NNJA 1ZKMA 3CMMA 1QMGA 5JFOA 5DOZA 4HFMA 2ZIZA 3WBFA 4BKRA 4BNNA 3DBHA 4E31A 3JQBC 5H83A 1SPXA 3V5NA 2ZTMA 3OH8A 3QRWA 4FJ0A 5HTOA 4E30A 1AXEA 4TKLA 2ZB3A 2EGGA 1KETA 2AA3A 1U7HA 5AOVA 3VOSA 1AE1A 3JTMA 1LSSA 3LQFA 2VYVD 1E1NA 2NWQA 1E5LA 1EFKA 3DONA 3AM4A 1U4SA 3QA9A 3ZHBA 1KVQA 3VH2A 1NFFA 1IUKA 1WVGA 5EQFA 3BTOA 3MZ0A 2VT3A 5LC1A 2GUGA 3JYOA 3VZQA 4BNLA 4U6SA 5FWNA 1QSGA 4KOAA 3PDJA 3ULKA 4MVJD 5TNXA 3KYDB 4ZN6A 3V1YA 1K6XA 4E5PA 4FFRA 4BMVA 3CIFA 4L0QA 1ISMA 1M6WA 3HQ4O 4IMPA 2BELA 2O3QA 1VL6A 4PRKA 4BKQA 1NTOA 1MV8A 1T1SA 4JJGA 1MX3A 4A27A 2CY0A 2ZCVA 2PWZA 2QRKA 4J4BA 5EIOA 3WFIA 1YBMA 4XD2A 4L76A 3ZU4A 3ROPA 3EVNA 4BNFA 4DQXA 4KQXA 3GFGA 4PG5A 4F6CA 2Q50A 5A5FA 5AVOA 3N7UA 3SC6A 5HWSA 1PJ4A 1EUDA 1LLDA 4CMIA 2EJVA 4EYEA 1EK6A 3KUXA 3ZGYA 3GR6A 3WGYA 1KEWA 3WNVA 1LC3A 3IDSA 1B3RA 1HLDA 2J5QA 4CM9D 2OOSA 4MINA 2W2LD 2J5KA 4BO4A 4XYBA 3ZU2A 2P5YA 5EINA 1EBUA 4FD3A 4XEHA 5AXAA 5KNLA 3ZWVA 4DPKA 1NQ5A 5K6AC 4R1SA 4LMRA 1T4DA 2YQ5A 1HETA 3SXPA 1YB4A 1ADFA 2DTDA 3A14A 3ONDA 5U1PA 4AJPA 1U5CA 5IXSA 4XIJA 1NPDA 6LDHA 3PZBA 2EW2A 1GYPA 1R4NB 1WNTA 4DLAA 3E6AA 1D3AA 1IB6A 5JCJA 5TGDA 1EVIA 3SLGA 2FZEA 4RDHA 2HK8A 1VRWA 3GG9A 4HV4A 3RASA 3AWDA 1H93A 2IXBA 2QYTA 3PEFA 2H9IA 1X7HA 4IDDA 2NVUB 4IGEA 1YB1A 4OXKA 3PQFA 3GEGA 3KB6A 5IJZA 2RHRA 4PFJA 2PFGA 2FWMX 4CM7A 3K30A 4WCDA 1ISJA 3WBBA 2IYOA 3JD4A 4CR7A 4NQZA 3AU9A 1ENZA 4P22A 4JXKA 4E6PA 1C3VA 2C07A 2QZZA 3I83A 2ZQZA 2FZWA 2HMVA 2WE7A 2EP5A 4URFA 2B5WA 1YDEA 4E5MA 3K6JA 5F1PA 4BO7A 5A9RA 4RVDA 3EGOA 3ON5A 4CM4A 3WGGA 5L40A 1RM5A 5L53A 4FFOA 4E32A 4I1IA 2ZJ1A 1IL0A 2WYUA 3GMDA 2C2XA 3F1LA 4MKXA 1OC4A 3I3OA 3BZUA 2GPTA 1JA9A 1ZIDA 2I66A 2Y1OA 3L0DA 4E33A 3GC6A 4GQAA 1QYDA 1IPFA 3L4BA 4E2YA 2B83A 3PHJA 1S6YA 1I8TA 3UH1A 1UXHA 4MKZA 4BNJA 3F46A 3DMYA 1BXKA 5JAIA 1S7CA 2UDPA 4O59O 5COBA 5BNFA 4R69A 3EZYA 3IUSA 3LLVA 3DZFA 2V7PA 5HS4A 1XWFA 2VTDA 1JKFA 4A7PA 1P74A 3DDNA 3GA0A 1T2DA 3HFSA 3OSUA 2YHUA 3I9JA 1UZLA 3PHIA 3S2GA 4BNMA 4L4RA 4NBVA 1A7KA 2YV3A 3ASUA 1EMDA 2NTJA 3FBGA 3FNHA 4MKRA 4PIVA 3TL2A 5CPFA 1NM5A 2GF2A 1P31A 2PGJA 3WX0A 4KWIA 1NQTA 5CEEA 3A06A 1ADCA 1ZFNA 3O03A 2ZQYA 3RBXA 1DFGA 2ZB7A 4AFNA 2H6EA 4NMHA 2AHRA 3RUIA 4TROA 5I8ZA 4FQ8A 4K9DA 5DULA 4BGVA 2B36A 5A4DA 1AHHA 4QO7A 5BNIA 4Z3DA 1I3NA 1B8UA 4YJFA 4MO2A 1LU9A 5ADHA 4MVJA 3SX2A 4ZQGA 3TZCA 4CUJA 4HWKA 4IDGA 2DC1A 3RCBA 3DZGA 2X0NA 4YAKA 1V3VA 3H8VA 4CL3A 4CMEA 2PY6A 1SB9A 1XIVA 3JQ7B 3UKOA 4YXFA 3BMNB 5I9NA 3TJRA 2GZ2A 3ROMA 3ZI0A 1WW8A 2FHSA 4DPLA 4K28A 4DVJA 4GI2A 3EAGA 3DOJA 5I9MA 3BMOA 1DC3A 4XDYA 1JN0A 1DRWA 2JHFA 3PJGA 2YV1A 1DC4A 3SJ7A 1V3UA 2D4AA 4M55A 3F6YA 4XIYA 4TMFA 1FXSA 5L45A 4CM9A 4LN1A 4ITUA 1V3TA 1U2DA 2W2LA 1EZ4A 5FFFA 5DDIP 1CERA 5JMWA 1TT5A 1QYVA 1BWSA 1E7MA 3DFUA 1UDBA 2WWRA 4J1SA 1FDTA 4R1NA 4R3WA 3UW3A 1HDXA 3VAZA 4N54A 2R00C 2RCYA 3ITDA 4D41A 4P4NA 3WMXA 3O9ZA 5GMOA 5A5EA 1O0SA 4DREA 1M66A 1ZJYA 1XU9A 4D42A 2NVBA 4CQLB 3LF2A 1AGNA 3D5QA 4K26A 1OI7A 1MUUA 3QVXA 3VH1A 4EGFA 4KWHA 2CMDA 1BGVA 4WLFA 3OA2A 4FOSA 1WPQA 1OFGA 2LDXA 4LCJA 4A26A 1VJTA 2GD1O 5EERA 5F5NA 3LU1A 1E3WB 3KRTA 1I2BA 3AU8A 1LUAA 4PCVA 4DIBA 4QXMA 1NNUA 3E8XA 3H9JA 3HUDA 3ANMA 3R6DA 2I6TA 4QECA 4AJNA 1ZO8A 3WGQA 3LF1A 1TVEA 3O4RA 4JBGA 4QUKA 1C0IA 4BKUA 1WZEA 4TZTA 5JPIA 3JQ9A 1K5HA 1K89A 1PGQA 1ZMOA 2GASA 1T25A 4D3SA 3DQPA 5DBFA 3RFVA 2FN7A 4WPGA 4CMHA 2HMSA 2NVWA 1C1XB 4XQCA 4CL8A 1A71A 2VWGA 4LCEA 1EK5A 1NVMB 1ONNA 5EL0A 4M54A 2YFQA 4XQEA 4BQRA 4CLEA 5H81A 5KJCA 2IEDA 3I5MA 4IZIA 2GDZA 5ICMA 3P2YA 3SLKA 4BGUA 4IIUA 4CR8A 2VRCD 4P8RA 4I5DA 3A28A 3ONEA 1D8AA 3H5AA 2CUKA 1E7SA 4DWVA 2DM6A 1BW9B 3FNGA 4RZHA 3HN2A 4U7WA 3SEFA 5TJ9A 2GLXA 3IQDB 3KSDO 3DAFA 1EFLA 3BMCA 2GZ3A 1HSOA 1LQTA 3JQGA 1UH5A 3PGXA 3H5RA 3JQBA 5CDSA 5L51A 1KVSA 1YOVA 3ZHZA 5KVVA 3TL3A 4NBRA 3GH3A 3KEOA 4PLVA 3FTNA 1XGKA 2P9CA 3TPCA 1EUZA 1T26A 2OFPA 4IQ0A 1X7GA 1U7TA 1YL5A 3K5PA 3D4NA 4Z3KA 4NHEA 1QV7A 3PK0A 1DIHA 5L7YA 4FFMA 4WCFB 4HUJA 4AJ1A 1YL6A 8ADHA 4CV3A 4PRLA 4YCAA 4IQGA 2IDZA 1JW9B 3R1IA 5GY7A 2YHIA 1Y6JA 3FHLA 3DZKA 3EUWA 3JQAB 5GZ6A 2TMGA 4TRMA 2JD2A 3NV9A 5ITVA 2JAHA 1R0SA 4MOWA 3SC4A 5IZCA 4D45A 2D5CA 4KTTE 4TWRA 3C1AA 2Q45A 2EIHA 4GX1A 3RFTA 1E6EA 2WEKA 5JNLA 5TIIA 3WGOA 5TLSA 3B20A 3L6DA 5TSDA 1WZIA 4M89A 4ALKA 2NQTA 1SEPA 1GUFA 3D5TA 3F1KA 2YUTA 1XELA 1ZZEA 3JQ6A 2JFFA 4MVJI 1PL7A 5C5IA 4XQGA 1DAOA 2VQ3A 4J0FA 2EJWA 3GZNB 2ZB8A 4XGKA 4TRNA 2VHVA 1FDVA 3I9MA 5B4TA 2NM0A 4FBGA 1JTVA 3P2OA 3ZW8A 1YGYA 4UUPA 4QEDA 5F21A 5IDQA 2JAPA 1PX0A 1QLJA 4NK4A 5L3ZA 4BO2A 1DHRA 1WP4A 3PHGA 4BB5A 2HQ1A 1YBAA 3OP4A 1VL0A 2IZ1A 3AFNA 5K6AA 4MVJE 4RPKA 2CDCA 4HX5A 1TI7A 4J1QA 3K73O 4JQCA 2UUOA 3P5SA 3U0BA 2RAFA 3WQRA 2D1YA 3GY0A 3UGKA 2OL4A 1ISIA 1CDOA 4N7RA 4D46A 3DOCA 2Q4EA 1GZ4A 2W2KA 2NTVA 4RCVA 3RJ9A 2V65A 1ORRA 3GHHA 3LK7A 3RSHA 4AJLA 3RJ5A 1YS4A 1I5RA 2C7GA 3IOYA 4D44A 1KBZA 1U5AA 1FDUA 1QP8A 5J23A 1D4FA 5KVSA 5A9SB 4WLOA 2X5KO 4J1TA 3MEQA 4DRYA 4R5HA 4OHUA 5CG1A 3EY4A 1Y81A 1GQQA 3KEQA 4B7CA 2Z1NA 1PTJA 2J3JA 4XRGA 3IP3A 4A73A 2DBVO 4II3A 1DAPA 4YJHB 1L7DA 3TN7A 4CLRB 2ET6A 4J9UE 3D1LA 5BSGA 1HDOA 3QE3A 2GERA 3NTQA 5DBIA 4CQMB 4YR9A 1GD1O 5L4SA 3T7CA 2NACA 2WMDA 3BMQB 3WGHA 3E82A 1JU9A 3I4FA 1R4MA 1NWHA 2PD3A 4C7JA 4DC1A 3BYZA 5DNAA 3AM3A 1UDAA 2ZYGA 3C7CB 4CV2A 4R01A 4YDRA 1P0FA 5DZSA 1JKJA 2G17A 3GG2A 3S2IA 1GCOA 2BD0A 3C7DB 4WOJA 1E92A 4CPDA 1Y9EA 1P77A 1JAXA 2DUWA 1NR1A 3VKUA 2AMFA 4O6VA 4NDNE 1JAYA 1VE9A 4ALMA 2HK9A 4GWGA 1GQYA 2FMUA 5A3VA 1U3TA 5KKCA 2AQHA 4ND3A 3K8ZA 4J43A 5A02A 3PHHA 5DN9A 3GZ4A 1BDMA 3KTDA 4NG5A 1X13A 3RUHA 4PLFA 4P4LA 3V8BA 3OA0A 3FTPA 3GUYA 1LNQA 1A7AA 4IDAA 5A05A 3DEYX 3WDSA 3H4VA 1GYQA 5L7WA 5EN4A 3CTMA 3U4CA 3HN7A 4UUMA 3TFOA 4DBVO 5KJ6A 1DJQA 2PZJA 4W82A 2DFVA 3PI7A 2OGUA 2AQKA 2J3IA 3LT0A 5B12A 1XKQA 4PLYA 2VOEA 1UJMA 1M76A 4AJJA 4AL4A 1SOVA 4WCFC 5JY6A 1QR6A 4HBGA 3LC1O 5CDYA 3AY6A 3FN4A 3HB4X 3NJ8A 1Y1PA 2DBZA 4N5MA 3ZWOA 2DUUA 4MPDA 3DHNA 3PLRA 1TLTA 3IJPA 4FFPA 4F3YA 2YZ7A 4J90A 4J9VA 3GEMA 4ZJUA 1DOHA 4MP3A 3RFXA 3UCFA 4GGOA 1HYHA 4K6FA 4YQZA 5TX7A 1B7GO 2I67A 3ZWNA 4JJIA 5AQ1A 1I2CA 2O3JA 3IAHA 3GK3A 4FGSA 3ZU5A 4E2XA 3PDUA 1BRMA 3CSDA 1JKIA 3ENNA 1HZJA 1NX6A 2J3HA 5JAQA 2HUNA 2QYSA 4MDHA 2NUAA 4LSMA 4TKMA 3EK2A 4XA8A 4BO0A 4PVDA 4D79A 3PWSA 4ZU3A 1QORA 4UAGA 3KVOA 1V0JA 3LT1A 2OUIA 1YXMA 3K96A 4EEZA 1Y8QB 2BFOA 4EUFA 1LDBA 1NAHA 4K1LA 1LDEA 4IPTA 4AVYA 5I7EA 3PQDA 1P44A 3OQBA 3GN1A 5IDXA 5B37A 4ZQEA 1ARZA 1RJWA 2XF8A 3DL2A 4FFNA 3BTVA 2OHXA 2C59A 1ZH8A 1DLJA 2CDBA 2OBNA 4NJMA 1ULSA 5KIAA 1ZEMA 3VDRA 3GDOA 4CV1A 4NIMA 2POQX 4IS2A 1DC5A 3V1TC 3WQQA 2WSBA 1YBVA 4UVHA 1UAGA 5L9AA 3I23A 2YDXA 4DUPA 3GVXA 3JV7A 4BNZA 4WASA 3C24A 3UOGA 1R66A 3O26A 4B4UA 3WYCA 2H5LA 3NUGA 3DBRB 4AG3A 1IYZA 4M86A 1N8KA 3LT4A 1R4NA 1ONPA 2FSSA 4YAEA 4EJ6A 2NU9A 4OH1A 1LSJA 1ENYA 2D59A 4ZICA 1JWBB 4RF2A 3WTBA 1JLLA 4YRDA 1IHYA 4YT4A 2PZLA 3BA1A 1SMKA 1EUCA 2X6TA 4WNIA 2HCTA 2B5VA 4PLPA 3QVOA 3I4CA 5JE8A 3Q9NA 1BHSA 4PLWA 2PTGA 5BSEA 2O7SA 3CZRA 3TWOA 2HO5A 1ZXBA 1IY8A 1ZSNA 1I3MA 1PL6A 3PWZA 4DYVA 4N5NA 4WE3A 4BOYA 3PJFA 3MOIA 1X1EA 4UEKA 3I9NA 4WNCA 2GN9A 2R2GA 5T8KC 1CF2O 3LYLA 3ETEA 1MXHA 4NR0A 4TRJA 1P1FA 2CSUA 2EF1A 2EXXA 3IC5A 2C5EA 3PGJA 1XCBA 4ZQHA 4ZRMA 2AG5A 5TF4A 1U3WA 1UAYA 1CETA 3GHYA 4RDIA 2NU6A 5ILGA 4YVFA 1U4OA 1DIAA 4TVOA 3I9LA 4J4TA 4PZDA 2HK7A 3LLSA 2CVOA 4FIZA 5TRTA 5ENDA 3ZV4A 4NBUA 5CFZA 2AE1A 4GWKA 2VHXA 4RVHA 1NASA 1KVUA 4CM6A 1TXGA 4L8VA 1GAEO 1LEHA 1W73A 3AJRA 4W7HA 1E1LA 4FOOA 4ILKA 1GZ6A 3PRJA 3GUCA 2WDZA 2YYYA 3VVBA 3D3WA 1T1RA 3JQ8B 1R37A 5ES3A 4YA6A 1J4AA 1GPDG 1UXIA 2GR9A 1BSVA 1NVTA 3RU7A 1QG6A 1U3UA 1OOEA 4IJKA 1PWZA 4JN6B 1PS8A 1E7QA 1V8BA 1GL3A 4LVUA 2O2SA 2NSDA 4IJUA 3KSZO 1SZJG 1QRRA 3C1TA 1A72A 1LLQA 3AOEC 5G0VA 2PR2A 2FOIA 2J5RA 1U8FO 1ZSVA 5C7IO 3RI3A 3RROA 4Q3EA 2O23A 4RORA 3MJVA 5HBRA 1QV6A 2CD9A 1TEHA 5A04A 2O3SA 4RPJA 1D7OA 3F47A 4E3ZA 5L7TA 4MP8A 5L4LA 4XR4A 4N5LA 5JDIC 5G0UA 3E9QA 4I9NA 5A3JA 3OJFA 3JQAD 1I24A 1U1IA 3E18A 4R1UA 3OM9A 2WJPA 3FWZA 4AJOA 1GUYA 4QFCA 2E6UX 2F1KA 3H5NA 2XOXA 4KUHA 4GLOA 5C3MA 5AXCA 4CR6A 1R6DA 1P3DA 1P1RA 1FK8A 7ADHA 5GZ1A 1KVRA 4CLOA 4Y9DA 4A5OA 4HFRA 1ML3A 1X0XA 4R4JA 3DMTC 4XQ9A 2NU8A 3F4BA 1E3EA 4OGWA 4E4YA 3WIEA 2J3KA 1LI4A 1W6UA 2WD7A 2WM3A 1H5QA 4FJ2A 5B4UA 4EZBA 3CZMA 1NQAO 5CDTA 3O8QB 1Q1NA 2PD4A 4NH4A 1ID1A 4IQ8A 3MJEA 4XRRA 4BMSA 5CEJA 3W4IA 4BO5A 2VN8A 1PJ3A 1N1GA 3HE3A 2HJRA 1KC3A 3MJCA 4KDFA 4BS9A 4INAA 4BV9A 4YAIA 4RJTA 4YYZA 1O95A 3NT4A 3OEWA 2GZ1A 2X9VA 1P9LA 2HAEA 1H9BA 4CQLA 1I33A 2Q2QA 1LRJA 5JDCC 5JO9A 3GNQA 2I65A 2QHXA 4XYGA 2X22A 4RVUA 5ER9A 1PR3A 4L74A 2ZATA 2GSDA 1UZMA 2Q1TA 4XGIA 4BQPA 1WWKA 1DFIA 1T2CA 3RKRA 4ZQBA 1FF9A 3KHUA 3PYLA 4BKOA 2RHCA 3NAQA 3IMFA 1NBOA 1ISGA 3D4PA 3PP8A 5TQVA 3G17A 4UULA 3W4JA 4D43A 4OL9A 2PD6A 2I76A 4PN3A 4BNIA 6ADHA 3OHSX 1DO8A 4XYLA 2DKNA 1H9AA 4CQMD 2VYVA 4IMRA 4LVCA 1Z75A 1M75A 3JQCA 3ZNOA 3WLEA 2O4CA 2Y05A 1PGNA 3AK4A 5IAAA 1C1XA 5A06A 4RVSA 3AY7A 2W8ZA 5G0TA 1F06A 1F14A 1SC6A 3E5MA 3ZWAA 3FSRA 1YQXA 5JYEA 1ADGA 3RU9A 4CMIB 3X2FA 3RAJA 5JS6A 4HY3A 4LRTB 5TJHA 1IULA 4Z0TA 1Y5MA 1GTMA 1YL7A 3BTUA 4CM3A 1E1KA 4RLSA 4M87A 3I1JA 4MVJG 3DTTA 3SJUA 2VWQA 3W8EA 2AQ8A 3F5SA 5F5LA 3D4OA 2V6GA 1YRLA 2NNLD 1W0CA 2GN6A 4BNYA 3ROKA 4IDBA 3WYBA 1XLTA 2D3TA 2PKRA 3VPHA 3DB2A 3JYPA 4OIMA 4ZD6A 2PH5A 4XB1A 4PG7A 3DFZA 4R9RA 5JXWA 1SOWA 1HYGA 3DAGA 1XR3A 4ZGWA 1SCUA 2C82A 1F8FA 1FDSA 5JCXA 4TRRA 1DC6A 4ND2A 3B1FA 2X5JO 3VTZA 3IKVA 5LDGA 3AUTA 4GPD1 4YTEA 4WCFA 3GDFA 4GAEA 3WSWA 2FPPA 2AEMA 3DZHA 1DFHA 3JD2A 4KDEA 1MXFA 1P33A 3CPSA 3GFBA 3W6UA 4CMBA 2FR1A 5JAMA 5H82A 3PPIA 1NXQA 3HADA 3TZKA 1HTBA 3IS3A 3JYQA 5FI3A 4YEDA 3UXYA 2AEJA 3JQAA 3H9EO 1YQGA 4W9NC 5C37A 2CNBA 4HKTA 4WLUA 4X54A 2BF7A 4IXWA 4I9UA 1HE3A 3G0OA 3FR8A 2I99A 5KWEA 4YBZA 3GLQA 4JBHA 1DRVA 1C0LA 4BGEA 4BHTA 3NT5A 4MIYA 1KEUA 1VKOA 1NPYA 5JAZA 2PA3A 1U2GA 4ONEA 2C2YA 1F12A 1HKUA 3JD0A 3K31A 2XXBA 4XX0A 1UUFA 3GZNA 3JQFC 3OJOA 3DBLA 4DC0A 3OJ0A 4D0RA 4IDFA 1E3SA 7MDHA 1NQOA 3AUSA 1H2BA 1T2FA 3NDJA 1Q0LA 4OYRA 4RV9A 2DBQA 4CMJA 2DAPA 4OMUA 4R54A 4BO6A 3U3XA 4I5EA 1GU7A 1RYDA 3OEYA 1AXGA 2VUTA 5DP1A 5I7VA 2IODA 1NP3A 4J91A 5TS3A 4CM8B 1NYTA 4F45A 1N9GB 2H1SA 3GGOA 4J2OA 4MIEA 3WTCA 2WYWA 2CVZA 3MTJA 1RM0A 3N58A 2DTXA 5IDWA 4UUNA 3WGIA 4YWJA 4J16A 1X15A 5B1YA 4HXYA 1QYXA 4II2A 3KO8A 4LW8A 1N1EA 3ZV3A 2CDAA 5MGBA 3OECA 2VYND 2ZTLA 4GGPA 3GPIA 3HSKA 4LRSB 4WJZA 2EW8A 5K0ZA 3AI1A 1YDWA 3V2HA 3R3SA 4J49A 4OQYA 1XA0A 3UCXA 1K3TA 4OO3A 1X0VA 3M1AA 5DP2A 2QRJA 2D8AA 2HLPA 3F4LA 3LZ6A 2B0JA 5BQFA 2X0JA 2Q2WA 3H7AA 2AE2A 3G3EA 2SCUA 3K9QO 1B2LA 2PGLA 4ZQFA 4BO9A 3AI3A 3OF2A 2XAAA 4FCCA 2VWHA 2IXAA 3PWKA 3GGPA 3TNLA 4TQGA 4N18A 4BUCA 4CQMA 3NGLA 1PJBA 4PZCA 4UVDA 1N7GA 4IDCA 2Y1EA 3GF4A 3MJ4A 1O5IA 1KOLA 3RQSA 2CF6A 2BKAA 1O6ZA 3K2BA 1I2ZA 1HWYA 1NFQA 2WD8A 3Q11A 5DCYA 4XYEA 4D7AA 4EJ0A 1PZGA 1BXZA 4CLXA 3E9MA 2G5CA 2VNAA 1HL3A 1QYWA 2CF5A 3L6EA 4R1TA 1VLLA 3FNFA 2Y99A 2YY7A 3PIIA 1O94A 2UVDA 1HEUA 1DJNA 1HDCA 1PGOA 4GL4A 2OORA 4M1QA 5ENVA 4RQUA 4B7UA 4GKBA 1HT0A 1N5DA 3QY9A 5JO0A 3E1KA 2FSVA 4LK3A 5L4NA 2RIRA 1BMDA 3QJ5A 3PFWO 4E2ZA 1G6KA 1PGPA 1K6IA 1TT5B 3FBTA 3WLFA 1L7EA 1ZK1A 2RH8A 3B6ZA 4Y8VA 4GX0A 3VDQA 2DLDA 3KM0A 3RBVA 3QWIA 4PLZA 4UVEA 2RH4A 2JFGA 1XSEA 5EPOA 1O89A 2HU2A 4NZ9A 1QYCA 4Q3DA 3OQ1A 1WDMA 3Q2IA 4OXNA 3AOEA 2P9GA 3GPDG 3ASVA 3ZW9A 4TSKA 1PEDA 4FSHA 1VM6A 1GCUA 1BVRA 1DSSG 1UR5A 3L07A 4XZ3A 2V6MA 4HNHA 3IUPA 1LX6A 1I10A 2VNSA 4O63O 5EQDA 4BKPA 1KVTA 5JDIA 1PJCA 3MOGA 3TRIA 1E6UA 1CWUA 2I9PA 4J4HA 2OBYA 2Y67A 3A9WA 2HMUA 3OQ6A 4K6CA 3ZU3A 1HDGO 4YJGB 1JQBA 1UP4A 2B4QA 1KC1A 4XCVA 4LISA 1E0DA 5B4VA 4Q3CA 3EC7A 1P0CA 2OMEA 3KBOA 3S2EA 2X7HA 3KLPX 5G4KB 1B0AA 2PV7A 4RL6A 2FPIA 3GN2A 3H9UA 4J2HA 3DHYA 3NKLA 3EDMA 3HJAA 3CINA 4OOEA 3RC9A 1PSDA 3OIDA 4WLNA 3FCOA 4YT5A 1B8VA 2VOJA 3CUKA 1HXHA 1PR9A 4WGGA 1H2HA 5TC4A 4YT2A 2AW5A 2BFAA 5ICSA 3FD8A 4FDAA 1DLIA 1RWBA 2QZ9A 2IZ0A 3AW9A 4EEXA 3UUWA 4Y6PA 3BHMA 1NWCA 3FI9A 1D1SA 1T4BA 1LLUA 1XDWA 2D0IA 2FRDA 4XJTA 4YRBA 1GY8A 2X9NA 4DYDA 3ZH2A 3U09A 2P4QA 2HRZA 1BTOA 1OMOA 3H65A 4YQYA 3QVSA 4R41A 2GCGA 3WJ7A 2XPCA 5IG2A 5A9TA 1Y8RB 4RZIA 3C8MA 5ITWA 3ETGA 1PWXA 4DTIA 1W4ZA 4RO0A 5A1TA 1ISFA 4RGBA 1LDMA 3UN1A 5FI5A 5AXDA 2X86A 1E1MA 1LTHR 2OO5A 3QP9A 4Y6SA 9LDTA 1ZW1A 1DEHA 3V2UA 1PS0A 1MG5A 4NU6A 4PGFA 5JDCA 2P5UA 3MCVA 1V9LA 2VRCA 2X0IA 2X0RA 4KQWA 2VYNA 1EQ2A 1ONOA 2IE0A 2EKLA 3W1VA 2VWPA 3NGXA 5JC1A 4PVCA 3UHAA 3ZWXA 2BH9A 1EDZA 1GV1A 2C29D 3OMLA 1I01A 1N7HA 4JK3A 4B8WA 4A0SA 1FJHA 1MFZA 2YHIB 4I5GA 2Z5LA 4JBIA 4P38A 2AQIA 4MVJH 5GZ3A 4S3MA 1EVJA 3P19A 4GBJA 1OBFO 2X4GA 1Z6ZA 3WWZA 1M67A 1UXGA 4Y98A 4FC6A 1HF3A 3OICA 1UXKA 1IE3A 1HZZA 4B3JA 3UAGA 4ZRNA 3KSUA 4OAQA 5JY1A 1C0KA 1TB4A 2PH3A 4UEJA 5FF9A 4CMEC 2XXJA 5THQA 5I7FA 2IZZA 5DF1A 1PQWA 3NTOA 2GYYA 1F17A 3VPGA 2ZB4A 1NHGA 1YO6A 4ZVVA 1I3LA 1CEQA 3ICPA 3NX4A 3KZVA 1VKNA 3VPFA 2O3UA 2OZPA 3HDYA 3W6ZA 3KYDA 1EVZA 2JD1A 2WYVA 4MVJP 4EDFA 3QQPA 1ZVMA 1Y5RA 5COQA 3L9WA 1I0ZA 3G79A 1E3JA 5L95A 3DC2A 5F1KA 3R3JA 4E5NA 2ZYAA 3HDJA 1M2WA 1KEVA 1LLCA 2OP0A 4UREA 4RPGA 4ALNA 2J6IA 2BHLA 4IXTA 3QV1A 1H94A 4DIFA 2W2KB 1YVEI 3KYCB 4XJSA 4YAGA 1CIVA 4R51A 1LDYA 2HMWA 1IOLA 1LDNA 3WXBA 3E5RA 1QXSA 3B1KA 2P9EA 4ND1A 3RUFA 4GH5A 4F46A 5JCJD 1UZNA 4QSMA 3GEDA 2HRBA 3FPCA 4G2NA 2R00A 3D3EA 4RQTA 4FW8A 3U4DA 3GVPA 2FPGA 4QTZA 4HP8A 1GPJA 2VUUA 2I3AA 1PJTA 4L75A 4HFNA 4BO3A 4W9NA 4EI2A 1Z7BA 2B37A 4QO8A 4RPLA 2BGMA 2Y1GA 2EP7A 2P4HX 4OXYA 4UEOA 3NRCA 2VTEA 3ZNPA 5EESA 3GRPA 5IXYA 3B1JA 1ZNQO 4EJMA 1YJ8A 2GN4A 1N92A 3DOOA 2Y1CA 2QG4A 4CM5A 2NVUA 2G82A 4L4XA 1BG6A 3DO5A 3FRJA 2H63A 4CMKA 3S8MA 3EYWA 2IYPA 5FEUA 4EW6A 2YQ4A 3WFJA 1JWAB 1PU2A 5ILOA 3H9QA 4H3VA 1E5QA 1VJ0A 2UAGA 4IBOA 1ZK3A 2VT2A 3CKYA 2Q99A 4NK5A 3JQDA 4I5FA 1R15A 2E49A 3I9KA 4YB8A 1DBVO 1HRDA 3ZWMA 4W99A 1VSUA 3HZZA 4MIOA 3BTSA 1A4UA 3WG9A 1GQ2A 1ZBQA 1RYEA 2PKQO 2AEFA 2EKPA 3LDHA 2BFMA 2C0CA 3VPXA 1DHTA 4LMPA 2O4UX 3A4VA 2YV2A 4GSLA 3PFFA 5KCZA 2P2SA 5DT9A 1XQ1A 1CQJA 1C1DB 2HJSA 3WICA 2DT5A 2HKIA 3ZWWA 3IIEA 3ZCXA 3IJRA 2PNFA 2VRBA 1IPEA 2GRAA 3FPLA 2PKQP 4XYMA 5TT0A 3DR3A 3C3XA 2B35A 1P1KA 3B70A 4I08A 4U5QA 4CUKA 3VTFA 2O48X 4DLLA 2A94A 1KS9A 1ADBA 3SVTA 1U3VA 1CQIA 3HDHA 4GVXA 5THKA 1SB8A 4RPHA 5IN5A 3WYEA 2UV8A 2VHWA 4UVIA 3ST7A 4M49A 4WKGA 1P1JA 1E7WA 5IN4A 2Q3EA 1KY4A 2YDYA 4BIIA 4IS3A 3ZV5A 1AUPA 1LBEA 1I36A 4GMFA 1LSOA 5DBGA 1OC2A 3WJAA 3ZDFA 2PGDA 3F3SA 3RUDA 3PIDA 5IZCC 1WMBA 3NEPX 1J6UA 3ZN2A 4IIVA 5U4QA 4XDZA 4G5HA 1AHIA 3EMKA 5DCUA 4KZPA 1XEAA 1ZCJA 3U4IA 4ALLA 1K0UA 3PZRA 1PGJA 4J7XA 5F3RA 5IF3A 2B69A 4WK6A 5DCWA 4LGVA 2JCYA 1KERA 2HSDA 2JD0A 4S1VA 3WWYA 3U49A 5KJFA 1PZFA 2Y93A 3M6IA 2ZTUA 4O1MA 3INTA 4GMGA 2BMAA 1GEGA 3VH3A 1HSZA 3N74A 4BO8A 3E03A 4C4OA 1F0YA 4MVJM 2C54A 1W8DA 1E6WA 3AUAA 4WLVA 4H7PA 3TOZA 5CPBA 3S2FA 3JQ7A 1TT7A 4BVAA 3BMNA 4NJMB 3RC7A 4Q3NA 1Q0QA 1PJSA 2VUSA 1I30A 4Z9FA 4EUHA 1Q0HA 3DHEA 1OZAA 5COAA 1BXGB 2QRLA 3WOHA 1YB5A 3U62A 1WMAA 3GDGA 1HDYA 1UDCA 2DBRA 3WMWA 3VPSA 4IINA 3D64A 2E37A 3KYBA 5G2OA 3ADPA 1K6JA 4AJEA 9LDBA 4J1NA 3K2EA 4GX5A 4DL9A 1GEEA 3T4EA 3T4XA 4EBFA 1MG0A 1PQPA 4PLTA 3AUUA 4G65A 5T5QA 5ER6A 3HDQA 5DOVA 3C7AA 1OAAA 1ENPA 3G49A 1GR0A 3L6OO 4NFYA 4E2WA 4Y67A 3ITKA 3CE6A 3OJEA 1WDKA 4Q3BA 4ID9A 4B3IA 3TQHA 5CG2A 4UVGA 1XHLA 2I3GA 3DBHB 3JD3A 1DDOA 4JJFA 4J7CA 5IFLA 5TT1A 1KY5A 3L4SO 4NU5A 1GV0A 1ENOA 2ILTA 4MJLA 3UICA 3DZIA 4IGFA 4BNUA 5G0WA 1E3WA 2P91A 1PQUA 3DZJA 2ZYDA 3H3FA 4XWYA 5G0SA 2P68A 3BHJA 2RBEA 1WDLA 1ISHA 3C1OA 1Z7EA 2BI8A 3WIDA 4YT8A 2CZCA 3GNSA 2FP4A 4DA9A 1JVBA 5AYVA 2B4TO 1MFPA
chains in the Genus database with same CATH superfamily
3CW8X 5KDLA 3JVVA 2C5AA 2H54A 1V5WA 4IX9A 1PJLA 2CL6X 5HKKA 2DULA 2H2WA 3GQVA 1EVYA 4H16A 4X92A 4D3FA 1ETUA 3QX8A 4Y18A 4DPMA 3UV3A 1CUAA 3IVRA 5KSZA 2Z5GA 1FFWA 3KOUA 2IRWA 5BT9A 4WUVA 5KDDA 2P1RA 5CFQA 1RKBA 3UKDA 2X8BA 3ZLJA 4UU0A 1GU1A 1O5TA 1VA4A 1E0JA 3IR6A 4RVGA 4R83A 3KHTA 1E2QA 4URVR 4N5IX 4MNTA 2VA8A 4G07A 1KFJB 1U5BB 1TYAE 1C4XA 4O8CA 5EKSA 4DUGD 4EF5A 1T2AA 1EWVA 2VA9A 3TZ6A 4NWIA 3DVSX 4TV9A 4M1SA 5JS1A 2JHGA 1YIDA 1UJBA 3BCSA 4GR9A 3LPLA 1DTEA 1YH3A 4X1KB 1KQPA 1H6AA 2EWWA 1BYIA 3DZCA 5CLJA 1S2LA 1LJ8A 1CY2A 3AM5A 3UQZA 1XAJA 2EHDA 4C0AC 3IIKA 2HR1A 2AFRA 3H11A 2MR6A 2VLIA 5DW3A 1CP2A 1BO6A 1MW8X 1L3BA 3EZXA 4C30A 1COWD 3R0IA 5SY4A 1MLDA 5HMMA 3EZNA 3ZHXA 2I4NA 4IFEA 1AQYA 1Y7IA 3MTGA 4EYSA 3U9LA 2ZUBA 5EXSA 5BUSA 2X5XA 1JQLB 3MJSA 1JKMA 1M8JA 1SG0A 4BFTA 2PO7A 4TS1A 1J49A 2X8LA 2ZIGA 4QEZA 3TZLA 1YZKA 2OECA 4NBTA 3SXUB 5IHPA 5ESRA 2CLEB 1EXWA 2ROQA 3N2GB 4DQVA 4LK2A 4ERNA 1I32A 4IG9A 5DSZA 2OBFA 1YZQA 3TEFA 1SBQA 2ZZKA 2QSZA 4W4TA 2Z2JA 4AXXA 3AIKA 3BJRA 3WNQA 3MD0A 2J07A 2Z6UA 2V1UA 1KMIY 5EWJA 1ZUD1 1IAVA 2H1WA 3L1KA 1M74A 2P69A 4IUCS 4PLGA 2PX2A 1LQUA 3CA8A 4QJ4A 5HSGA 4QODA 1NW7A 2FLKA 2WVJA 1LX7A 2OB2A 3G1UA 3L9XA 2PFSA 4Q3AA 4Z5XA 5E4JA 1WF3A 2X8JA 3C6QA 1ZBDA 1E3IA 2B0CA 2DE0X 5KQLA 2IYWA 1TYBE 3EXEA 3P20A 3HXTA 3VZSA 1HFKA 2F59A 4OGFA 3FGOA 2FDRA 2C5BA 4MQ5A 2C7BA 4IX1A 1IOZA 4CM4B 1QF6A 4ILEA 1E4YA 4QFDA 4ZO7A 4BLPA 4RTKA 5F2OA 3C45A 5EXXA 2GN8A 5HM8A 1IM8A 2O8VA 1G1AA 2D54A 4K7JA 4J0EA 1KK0A 3OPVA 4TKZA 1QQ7A 5K51A 3MUFA 3FNEA 3M70A 2OBMA 2FR0A 3MK31 4FGWA 4U3JA 2OCXA 2V5VA 1C3XA 3BWBA 5TMBA 4V3BA 3LKBA 4U0JA 1PD1A 1B8PA 1K6EA 1W6RA 4JAVC 5CNKA 3V4ZA 2WWYA 1A5ZA 4KAAA 2EATA 2NU7A 2DECA 1GSOA 3PJEA 1MHPA 4OHBA 4RTQA 5DTIA 1Y1QA 3E3LA 3GMSA 3TEJA 1UXJA 4HMOA 1WY5A 1E77A 2I55A 3QEJA 2V0NA 4YACA 3S1LA 1O8BA 2A1TS 3S55A 3KFXA 3DT9A 2Z95A 3BICA 5MGNA 3EUAA 2FOLA 3DZBA 4AF7A 4TUYF 2V7VA 4Z2AA 4ROSA 2EYQA 3GWGA 3GNTA 3ZXUB 4WZBB 1NPTO 1YQDA 3G7SA 1NE2A 4RZ3A 5M29A 3WP1B 4WZAA 4H1HA 4RK0A 4NG4A 1XMVA 3S29A 4Y9RA 2ATIA 4AZ0B 5KNDD 3KX2A 1AXRA 4TYYA 4OKNA 3A36A 2HQOA 2IHNA 3GGGA 4TWBA 2AN1A 3ZV6A 4YIHA 3GRAA 4YJGA 1YRWA 4IFIA 4ZAYA 2GARA 1UBNA 1WTAA 3B3FA 5LMNB 3T99A 1LVGA 5AI0A 4RZQA 5EJGA 1Z5GA 4QBTA 3JTEA 3RF6A 2XE8A 5G4KA 4JI5B 3M4JA 1N6LA 4EITA 2FJPA 4JCOA 3RVDA 5T67A 1XZGA 4IZ6A 4MQMA 1JVSA 4O4HB 4NYIQ 2UVQA 4L7VA 2JVJA 4DV1B 3JCZA 4DQUA 3DVAB 2IH2A 4L9AA 3F73A 4F1KA 3OEEA 4NX2A 2IW1A 2CE2X 4LXIA 2PUCA 3AY0A 3DM9B 4MYTA 3CMCO 3QXGA 4F12A 1LBIA 4I46A 3WWCA 5CCXA 5FNZA 1KGDA 3UF0A 1M2VB 1YF3A 4G09A 4GMHA 1L8XA 1UKEA 2NXJA 5T6BA 2NZ2A 2W6ZA 1PKXA 1FP4B 2PZMA 2Z09A 5CTAA 2Q1SA 3E22B 3JR3A 2OGTA 3PL5A 4FS3A 3U44A 3IKJA 4G01B 5I8WA 1TEVA 3WOVA 3FHOA 1NVGA 1PHPA 1JMVA 1EFCA 2ZIAA 2WFMA 4LTNA 5F4BA 4E5YA 3PEWA 3VC7A 1B14A 3A0UA 3DH0A 4UQPA 3U2QA 3JRNA 4BLUA 1LRKA 4LSWA 1ULAA 4C2AA 2A4KA 2R85A 2YYZA 2VZ9A 5HIIA 3ZXYA 4AMYA 5CUQA 4F60A 4Z9YA 5DW0A 2FZGA 2OWEA 3FG9A 2AVDA 1WY7A 1X7ZB 2TMDA 4NPCA 1HA3A 3RT1A 5EJFA 1MC5A 1TU4A 2F8MA 2Q3MA 2D7DA 3RTEA 1I3KA 3CQ9A 1ZIOA 2C84A 2J4DA 3DFIA 2E0IA 4U8HA 2L18A 3E2MA 4LDNA 2A35A 2X1HA 4QQRA 3GRFA 5B53A 2HPHA 4B3CA 4EW3A 4Z7OB 3ORRA 3AI2A 4PV7A 2F00A 2YNMC 3P2EA 3ETLA 2PZFA 4D9GA 5JLAA 4EELA 1H2YA 1ZRMA 5FPTA 3WTCA 5T57A 1VC2A 4JI3B 3HXOA 4P4GA 3GFOA 1XTPA 1BQ4A 3LSYA 3LUPA 1Z08A 1YQEA 3O2QB 2QX6A 1G7RA 1ZD4A 4QUHA 3R7SA 3T5PA 2B9EA 2FN9A 3KKQA 2EKQA 2NYVA 4MRVA 4F92B 1V6AA 3GL9A 4M1KA 2J45A 3FVQA 2P2LA 3JALB 1B23P 1FMJA 3L84A 5CP8A 2A9PA 3H9CA 4BWVA 4UJ5A 2GM5A 4OHVA 3FTDA 4B6PA 3JSAA 1Q11A 2FK7A 1Y1RA 3HJGA 1HDZA 4NARA 2QM0A 1KIFA 3KV3O 4G1MB 4LTMA 1QKIA 2ANCA 2HRRA 1QANA 3IO5A 2XUAA 2Y0CA 1ZM7A 2Q1UA 4RACA 2NXEA 4FFLA 3B7WA 1PLKA 2QTVA 4ZYVA 5DSTA 2CLKB 4B4VA 4TVKA 4KP7A 3A1EA 1LBHA 3FCXA 2QN7A 3R5JA 1XZIA 3DJFA 4HK4A 4X93A 5T3YA 1NBIA 4IGAA 3NM4A 4UAVA 2WKWA 2NP6A 1GUBA 4OFWA 4ZP1A 1OT5A 1WLYA 2EOAA 3L41A 1L5FA 4PYRA 2C00A 2ZJYA 4HQ6A 4M8KA 4H59A 4D44A 2K4MA 1LRLA 4XKJA 2BP7B 2VJYA 1ZH0A 4PIPA 4LBWA 5KWSA 4X44A 4M1ZA 5GJCA 2V6FA 4J0CA 1TAUA 2VCYA 3W79A 3IE0A 2IL1A 1O8CA 2Y0PA 3FF4A 4D98A 3LVFO 3V32A 5KTPA 1TCUA 4UBKA 3SN6A 3AR3A 3W8DA 4ENSA 3I04A 2OEPA 1E61A 1UBMS 4YK7A 4IEIA 3LHKA 3M4ZA 3BE4A 1H6CA 1QIJA 3L4BC 4HSGA 2XQKA 2EDAA 2Q4DA 1F2DA 2AGVA 2DH5A 3CUUA 3PEVA 4R3NA 5KBYA 3WRYA 1Z18A 4TUYB 4Y9SA 3ZHYA 5BV1A 1M1XB 2Q5CA 4G0WA 3PFGA 3MBOA 4BVLA 2ZVQX 2ZIVB 4EMUA 2QROA 1RKVA 1CZUA 4BMZA 4K9LA 1SVSA 1TO1E 1EQUA 1M6NA 3GUZA 521PA 4B84A 5GVRA 2OZLB 2I87A 2YX1A 4GOND 5CW1A 2OXIA 2XYVA 3JQGB 3ZDRA 5BN3B 2PJRA 3CH6A 5EHIA 3K0AA 4HDOB 1CRPA 3B6IA 2O7QA 1GGFA 4DR7B 3DNMA 3EFBA 2O8CA 3VU3A 5FADA 3LXMA 1FLNA 4QE3A 1RHKA 4AJKA 2AD1A 2BFPA 2LBPA 2AC7A 4ND5A 3WLKX 2B9VA 4DBZA 2ZIUB 1JFFA 1I7PA 1S2GA 2G77B 3TAHA 1U80A 3WSVA 3ESDA 4O0LA 4KTVE 4WEOA 3E4DA 3UVEA 5ARBA 5F73A 4G0QA 4L8LA 1NYRA 1R8YA 1RACA 3KQSA 5LYYA 4Z4IA 3WLMA 5HK8A 3LGAA 2JI9A 3MWEB 4XSGA 1NJFA 1F7UA 3ZVMA 3VUFA 1EDEA 1UKAA 3LWNA 1U0BB 4R16A 3S2SA 3OY2A 5M5BA 1GAQA 3ORFA 2JATA 1LS1A 1EGAA 1PR0A 4GEKA 5KYVA 2JCXA 4BX8A 1KI6A 1MORA 5JQGF 1JHVA 1JEYB 3ESAA 2A3RA 1FX0A 3GT3A 4PHGA 4UZEA 4WZAE 4I50A 5ECYA 1ESCA 3OQOA 2WJGA 2EFHB 3NIDB 4M22A 1FA9A 1V1MA 4P33A 4WK0B 3TW8B 4CMAA 2J08A 6CHYA 2BGKA 2DT8A 4FZRA 3BJMA 3RANA 3ZIUA 4H1VA 1JXMA 2G70A 1CJUC 1ZI6A 1GZ3A 4P3OA 4EEKA 1T8RA 5FTLA 1J8FA 1BFDA 2JLYA 2FPUA 1JLKA 1QGUB 5IYZA 2BGLA 4RTRA 1NKSA 1Z83A 2JIRA 4BAZA 1UBOS 1QBKC 3RLIA 4FB5A 1RZRA 1T2NA 5T6MA 3TH5A 1OBOA 4XUEA 1IM5A 1UM8A 3LL4A 1YZGA 3PYXA 2CDRA 5HE8A 2WMOB 1NOJA 2OHOA 5CA1F 5EZYA 4G0YA 4UMDA 4DMLA 2NQ8A 5D2CA 3BH6A 5AK4A 1XEFA 3I9OA 1WPRA 2FPMA 2BY4A 2PX6A 4KUEA 4AULA 3DKIA 3KQHA 3ABIA 3TSCA 5CIWA 2DWUA 2OPHA 4FC7A 1JV2B 2F9FA 4K05A 1E96A 3IP9A 3QPAA 4RANA 2KI5A 2WUEA 4Q9KA 4Q02A 4I55B 4BV2A 5A03A 3JQ8A 3MHPA 1KJZA 4K9PA 3M9XA 3TYXA 3H4MA 3B6KA 1ZH4A 4NBLA 1RM4A 1Q5PA 3BK1A 1N78A 1EE2A 1UBSB 1VCNA 4G5QA 3KFVA 2ZJAA 4IFBA 4EFNA 3OZVA 4MUGA 3MWYW 4AN4A 2WTBA 5IT5A 4WVLA 1RXIA 5IDYA 2BFWA 2I2CA 2WAMA 2H0RA 3AVVA 1FJ2A 1O58A 2QRGA 2HGSA 4G36A 5CBPB 4B3TB 3SMVA 2CEAA 1G8GA 2FW1A 4K3VA 1D09A 2JIPA 3O92A 1C1HA 4UBOA 3K9HA 1M1NB 4O3FA 2WHRA 1DAMA 1SOUA 1BEUB 1H1TA 3NXKA 5I9LA 5IULC 4YN3A 1U11A 1K6MA 4H9GA 3RSFA 3AY3A 1KFCB 1ZK0A 1FDWA 2LE0A 2YCLA 4HADA 4K86A 3A7DA 1PNTA 4MCAA 4TTIA 5AW5A 3CFYA 3RIHA 1U2GC 3W5JA 3GH1A 3IQWA 1WOYA 2BEVA 5GP1A 3P7MA 2ECPA 2Z5FA 3MBIA 2O14A 1V4NA 1E9DA 5D5QA 5HGXA 4HAOA 2P2GA 3FYSA 2RG7A 4GR4A 1BDBA 3HH8A 3S3TA 4ZOLF 4BAGA 1V35A 1CVRA 4OM8A 4F6LA 1GT91 4XOIA 1FLVA 2PDAA 4GM4A 3IA2A 1B2RA 3WZMA 4CKXA 7ABPA 1MP0A 4XH9B 5ULLA 4EPXA 5DN6A 4LHZA 1RJDA 1VYVA 2NLOA 5HA5A 1RFGE 3B7PA 3GJ4A 4DXHA 5ADWA 3Q7QA 3S5JA 4PYNA 4MB0A 1LJLA 1BAPA 2XUHA 1E8DA 3F7MA 1Y9ZA 3EW7A 3JQFA 1T35A 4HC4A 3W5VA 1F38A 1KI9A 1BXGA 2LDBA 1E2NA 1AS3A 2IYEA 1XU7A 3F71A 2FY8A 3EGEA 3KLNA 4OSOA 1UZUA 2QJFA 2EJCA 1JRLA 1R5OA 2G07A 3KPUA 3OD1A 1Z5NA 3PU6A 3GAFA 3W4KA 4DM4A 5BW5A 4XIFA 1OLUB 1GR1A 3FNBA 2CNWD 5UKDA 1N0UA 1H1DA 1Q3TA 4MW0A 5AJYA 5DEOA 3RKUA 3F9IA 2WM8A 1JDJA 2WC1A 2CLSA 3RC1A 1CZLA 1A95A 1WMEA 2Z9DA 2AZXA 2A9JA 3JY6A 3UEOA 4KQEA 1X7XB 1CHNA 4IIBA 2AG8A 4QJ3A 4MGHA 1WCYA 1HC7A 2F1OA 1M10A 1ZKMA 4H7FA 5I9BA 1F3LA 1E5DA 4HAZA 3SF0A 1HEIA 1JHDA 1U8TA 4V1CA 1YA6A 1IZYA 3L1UA 4EW2A 1U7UA 3LDUA 4BNNA 4QWMA 1QX4A 2JJ8A 4JA0A 5H83A 1ZCZA 4L15A 3V5NA 3OH8A 4EAQA 2GBCA 3I5YA 3G9QA 2FHPA 1MAUA 3IEUA 4HJRA 4TKLA 2N0SA 1PDVA 5FXMA 3IOCA 2WNHA 1TU3A 3VOSA 4LXHA 1CT9A 1TCVA 1G16A 2NWQA 1KBOA 1XP5A 3MRXA 4RQAA 1P6QA 3AM4A 1GTJ1 1MT3A 3QA9A 4P53A 3HJRA 1SKYB 5JECA 4NU0A 2C4VA 2CT8A 3O3OB 3VH2A 1USVA 3N7TA 1VMKA 2HY7A 4KI7A 3DV9A 1UT5A 1XC7A 2VH5R 3DEZA 5FWNA 1Y6RA 1Z4LA 3OE5A 4KOAA 2UUBB 3L1JA 3PDJA 2CHVA 4FYPA 1J1UA 3CLSC 1RRKA 5TNXA 3KYDB 1J25A 1K6XA 1MX9A 5BV7A 4FS8A 1Y5NA 3K8OE 4HB4A 4P3PA 3Q3EA 3CIFA 2XGMA 3ND6A 2WT8A 3Q0IA 1VL6A 4A6DA 4PRKA 1FC0A 3LBFA 1L5OA 2P90A 4FSDA 4GYWA 4XVUA 2IWHA 1N3LA 1MX3A 3IAS1 5LP6B 4A27A 1KH2A 2VAMA 3LPCA 1XMPA 4Z4CA 1OA1A 5CA1B 5B1EA 3X1JA 5ALZA 3WFIA 2ZQ5A 4AO8A 2GFHA 2GBGA 3K70C 5J2UB 1YKGA 4KN9S 2IBMA 3B8HA 1G8SA 1N7JA 4UARA 3FFAA 3QEOA 4FBMA 4DAEA 3SC6A 2YN2A 1NMSA 1EUDA 1LLDA 3CURA 3ITNA 1IUNA 4BCCA 3SKYA 4F96A 3AF5A 2Q62A 5LA6F 4FVTA 3WGYA 2G9QA 4O5AA 3E8SA 2ENUA 4MYCA 5FR1A 5DK4A 4F5ZA 3WNVA 1LC3A 1BS1A 1HLDA 2J5QA 2XMCA 3AUKA 1T43A 4JLBA 2W2LD 1L4MA 2IITA 3ZU2A 1ZR4A 1XVIA 2P5YA 4URXR 5CXQA 1T5HX 1ONSA 1VSQA 5IKXA 5KNLA 3RC8A 3LY5A 4ZODA 4DMKA 2OAGA 2XITA 4OK3A 2H65A 1RABA 4LMRA 1E2PA 2ZR8A 3R3XA 4KQCA 3SXPA 3UJ7A 4B40A 1YB4A 4NCKA 3ONDA 2DTDA 2OHFA 1RJGA 1U5CA 4RDCA 1KK1A 5EHZA 2N3ZA 3ZK8A 1T8UA 4FMPA 2QRHA 4ENTA 1E2JA 3O0DA 2P9BA 1Z28A 2XEXA 1MAHA 3E6AA 1D3AA 1IB6A 4UAJA 1L3IA 3SLGA 4F56A 3QPWA 1VB3A 3GRYA 3N8NA 2HK8A 3EA0A 3R6TA 3DPSA 5K2MA 1T34A 5AKYA 2L19A 1AZSC 4YMHA 1SY7A 2JIOA 4OA5A 2XTZA 4BEWA 1KO8A 1E6MA 1KY3A 3FMGA 4FE4A 4RA6B 4CM7A 1NRJB 4BVBA 3TNJA 1D5CA 3T12A 2D0OB 2YJ6A 3CRVA 1ISJA 5E6RA 1XFDA 2IYOA 3SYNA 4CR7A 4DR4B 2CUTA 1ENZA 1UM9B 2BHTA 2VATA 2WTNA 2QZZA 4ZOLB 3I83A 4E6PA 2HMVA 3SD7A 3M5CA 4NU8X 4TTQA 1W29A 3STVA 2EP5A 3TR0A 1J8QA 1WXEA 1YVDA 3JRWA 4PS0A 4LJ8A 1SVLA 3S5UA 2QLLA 3UMCA 3URKA 1YDEA 4WIAA 4BMOB 5F1PA 1V6SA 4GNKA 4H6XA 2OXEA 3ON5A 3ACDA 3EOBI 4CM4A 2R5FA 4JXJA 4CDMA 3EASA 3IELA 4KPUB 1A9RA 3WQHA 2TS1A 3RC3A 3T34A 2C4WA 1JLMA 1U81A 3GMDA 3NTUA 4PEVA 1F4LA 3FLAA 1OC4A 3I3OA 4G23A 2GBFA 1JA9A 2ZYHA 3HL4A 4L8YA 4CHGA 2NU6B 3R6WA 2RAVA 3ROEA 4BB0A 3OX1A 4JEMA 3IVXA 1HO3A 2B83A 1MT0A 3TSAA 2F55A 2JAXA 1DAFA 3EVAA 4C2UA 4CZ2A 1N6OA 4OM7A 5DLEA 4B9EA 4EI8A 1G20B 1BXKA 1IB0A 1QMPA 2WJZB 1S7CA 2OV2A 1FJXA 3HXKA 1T8WA 1TM3E 3A2LA 1JP7A 3LLVA 1PVDA 3O95A 4G63A 1XWFA 1WL8A 1SIBE 4XWWA 3DDNA 4GOOD 4WZBA 3HFSA 2IV3A 1CY6A 3MG9A 4X64B 5ALXA 1OFHA 1NSFA 4OA8A 2YV5A 4LWOA 4LV8B 3S2GA 5ED0A 3AB8A 4BNMA 4MEBA 4DS3A 4NBVA 1UK8A 5GWXA 3A05A 3FBGA 3FNHA 4GXQA 2XVYA 3H1FA 4B2PA 4TLDA 5GGXA 1FDRA 4MPPA 4NP6A 4X94A 1G3IA 2Q3DA 1IBKB 2GF2A 2WKQA 4ZT3A 1DPFA 3IBYA 4ETWA 3HKBB 2AOVA 3KQLA 2I9KA 1K7YA 3SG0A 4OHPA 3D3QA 2CXXA 2HV8A 1ADCA 3O03A 3Q0TA 2ZQYA 3ZD6A 1TO6A 3E2IA 4QPCA 2CFRA 1OXTA 1H3EA 4KAXA 1A9XB 3RABA 1G42A 4IR7A 5B6IA 4JKIA 1OGJA 2H6EA 4FYYA 4KXUA 1RNLA 4QAJA 3ZZ1A 4G0XA 4V1CI 4JWTA 3ZHSA 2NUTB 2VPYA 1OKKA 3CRZA 3DEHA 1PG2A 3K5HA 1Y89A 1SM4A 3ADKA 3OOJA 4HEA1 4K9DA 4Y6QA 4CIYA 4W5TA 3MHTA 1SQSA 5B2FA 1AC5A 1U31A 4S1WA 4QO7A 1PUIA 2C0QA 2IYNA 5BNIA 1I3NA 2G88A 3G7UA 3Q7SA 1B8UA 4FKMA 4I9FA 4V24A 2AOWA 3OOSA 3ZOZA 1K8RA 1AQIA 3MIZA 1FJGB 3SX2A 1BC5A 4I2NA 4AO6A 4HWKA 1HE1C 1O94D 3CXUA 1OLXB 1U98A 1WSDA 3JWIA 5T4BA 3ES9A 5LYJF 1FP4A 2FEAA 2M9MA 4CL3A 5EHNA 3E22A 4YXFA 3JQ7B 3UKOA 1QGOA 1AF4A 3BMNB 4MICA 4IIYA 5KTTA 5CCDA 3K16A 3S4YA 4BN5A 2FWIA 1LV7A 5I5GA 1WW8A 2AIRA 1CBUA 2X2FA 1KR2A 5TGZA 5KTMA 2RGNA 3S70A 3OCJA 3DOJA 3GRVA 1JN0A 1RYHA 2IPXA 2J9RA 1Z4MA 3E7WA 3N8HA 5LA6B 1T5IA 2BUCA 2F7SA 1DOAA 3SJ7A 3AL2A 1A8PA 4LIPD 5C1BA 1V3UA 3TZBA 1X7ZA 2D4AA 3E15A 4M55A 2C57A 2VJNA 1E8NA 1QHHB 4UHEA 5LLTA 3EW9A 4B43A 1UZAA 4HLUC 1OFIA 1OW3B 4IIJF 1YVPA 1U2DA 3EDYA 1QH0A 3NM5A 2G5TA 1DBSA 4MYDA 4X0EA 3BC1A 5I9IA 1BJKA 1BWSA 4A8JC 2WWRA 1HURA 1VLZA 2FZKA 3DTVA 3PD1A 3BWEA 1NDHA 2C4TA 3BFJA 4TMKA 2PO5A 4D8VA 2JCBA 3NUQA 3A3OA 2C1ZA 3ITDA 4URWR 3EYAA 3Q3GE 4EPWA 2YC4C 3IXQA 5G1PA 3LBHA 1SQ6A 4XJXA 4UDOA 4YWHA 4N03A 2H17A 4HGYA 4Z7QB 3F67A 3ED5A 4KVZA 1P2BA 5JWRA 1XU9A 3OKPA 3RYCA 4C0KA 3U81A 2QMEA 3JALA 2RHDA 2HNAA 2PPVA 3IURA 3RRBA 1PD0A 3QMPA 3PUZA 1ECJA 3QVXA 4DJDC 5JRZA 4QLAA 1XRMA 1RYZA 1Z2PX 1YCDA 4M8IA 4F5EA 5KU1A 3VR3A 3HABA 2YZNA 1VJTA 2GD1O 3Q8XB 5F5NA 1BEZA 3DAOA 1RYFA 3LUKA 4TS9A 5FTJA 1D2GA 1D2EA 2J48A 1KYXA 1NNUA 3AWIA 4AB1A 4YP5A 3G8CA 2XCTB 2FP4B 2Y1WA 3M4XA 1KTVA 3QLVC 5U4XA 3R7AA 3PUVA 2BTEA 5B1DA 1WZEA 4JR2A 3RFCA 3K09C 3L8HA 4TZTA 1J97A 4TZ6A 5HCIA 2DMRA 1SXJB 3JQ9A 2CFOA 3HYNA 1PGQA 1FSFA 3W5CA 3C6KA 4OU5A 5K4AA 3HZHA 1AK9A 1PFVA 2OILA 4NBNA 1MQSA 2FN7A 2H92A 3OM8A 3Q41A 3A6GA 2NVWA 1OAOC 2OYCA 1C1XB 4DXAA 2OD7A 2XNHA 4EJ2A 1E20A 1OXUA 2ORVA 1A71A 1VRVA 2ERXA 2PGAA 2UZ1B 2VWGA 3QQ5A 4MWZA 4M54A 2V3WA 2YFQA 3BDIA 1Z12A 4D99A 3WAJA 1M1ZA 2IEDA 1E1YA 2IEZA 2GDZA 2O8NA 2OM2A 4HQFA 1CS4C 4MYRA 3H19A 2Q6OA 3P2YA 5ABPA 5BURA 2WZQA 3NHAA 4BGUA 4X5OA 1WXXA 2ZAYA 1W19A 3H05A 2V7TA 5E9WA 4TUYA 2VRCD 5SY6A 3ZJYA 4CR8A 4I5DA 3NJRA 1D8AA 3H5AA 2GRJA 1A5AB 4HS4A 4PZ9A 4Q7MB 5IBRA 2WIKA 3T54A 5IKMA 5CCBA 1BW9B 1QK4A 3F8WA 3BGVA 1MH1A 3SEFA 1RU3A 1G2PA 4W5QA 1UWCA 2GLXA 4QWWA 1EFLA 1LK0A 1O0BA 3RRFA 1DWPA 2OZLA 4PGGA 3JQGA 5A2GA 3S2YA 5AVJA 1V7ZA 1R8XA 1RKQA 3IIMA 3T3HA 3AP3A 4HGQA 5CDSA 5KC9A 1KVSA 1TK9A 5KVVA 3MPOA 4QXPA 6PFKA 5BW8A 3L1VA 3NOOA 4JD5A 4GF5A 3KOXA 4NBRA 1NF3A 5A4JA 1Q84A 3PA8A 3LAWA 1XGKA 3EZGA 1Y34E 5ELXA 4LY0A 4H3KB 1FRFS 2V45A 5KINB 1N2XA 2LCIA 4KXQA 3T7SA 3PX3A 1H1LB 1SC4A 3OLQA 5EJ8A 5GONA 3ADBA 3P8ZA 1NQUA 5EJMA 1DIHA 2Z3WA 4RIEA 3ESQA 3IP6A 2DR3A 4HUJA 1MTZA 1JNXX 3EFHA 1IY1A 1YL6A 3HYRA 1AX9A 3GAAA 1A8UA 4GS5A 4JASB 4E1BA 4YCAA 5B58C 3M6LA 3DULA 1EGVB 2FJUA 3PV0A 5CT4A 4YAFA 3VGPA 4ZQIA 4DSNA 5K0CA 1P5ZB 3AJAA 4M0KA 3FVVA 4JVLA 1GHTA 1K63A 1FFXB 1L8OA 1N5MA 2ZREA 3I73A 5EZSA 1Y3FE 2C3MA 4MQLA 1AGPA 1S1MA 1Y6JA 2RARA 5J3JA 3EUWA 4B33A 3FUXA 2AFIB 4ND6A 4QDOA 1OWMA 5FBZA 1JEYA 2VO1A 3JQAB 4JU9A 5GZ6A 5EKUA 5LYJB 5K3FA 2JAHA 1EE1A 4MOWA 1XDZA 1ESMA 1RI4A 2W6JD 1E3DA 1N9ZA 4GX1A 3U31A 2K2QB 2VCHA 1E6EA 5JNLA 1OROA 3FCCA 4H77A 1UDWA 5TSDA 4L02A 2IK8A 2H8GA 1G5TA 4QUGA 4M89A 2NQTA 4NEQA 1UKCA 1L4YA 3PNLA 1JEEA 3AT1A 1TKBA 3KQNA 2WJVA 1XELA 1ZCAA 2YUTA 5H59A 4BMPB 4JQYA 2ID9A 5A3RA 1PL7A 2XW6A 4XQGA 3UHFA 4EJSA 2VQ3A 2VYCA 3A70A 2FSHA 1H2XA 4J0FA 3PGA1 2EJWA 1NL3A 1T3TA 2JFPA 4ZMBA 1W581 1SUWA 2XYRA 2WUGA 4O3MA 3AI7A 3REOA 4JT4A 4FBGA 3OHPA 3KZNA 1NI4B 2P9QA 3P2OA 4ZO8A 1YGYA 5F21A 5IDQA 2UZ4A 1T2UA 3IT2A 1WP4A 2WA2A 2QLJA 1UBLS 2HBRA 4EYKA 1N6IA 2QJOA 4E5VA 4RPKA 2QQEA 1TI7A 2C9YA 3K73O 4BZPA 4G1BA 3REFA 1ODTC 2I6FA 3N7AA 1P91A 3BCHA 3UK7A 2DUMA 2JVIA 3GY0A 4TKVA 3EIEA 1VG8A 3ANTA 1ISIA 2OHJA 1GXSA 4B5LA 4V2UA 3WL3A 1T10A 1TQ8A 1LH0A 3PFCA 4U7DA 2H16A 4MTCA 4MS3B 2MINB 2DB3A 1ORRA 3LQ4A 3UMBA 1GTL1 2YMQA 5CBPA 1I5RA 2C7GA 5LQNA 3HKEB 3DD1A 4LECA 4COOA 1KBZA 4DT1B 4F93B 1D4FA 5I6DA 4Y1FA 4LF8B 5KVSA 1KMCA 5IJ0A 4NAVA 2WAAA 4I1OA 5IUNC 1JDSA 4J1TA 2XA1A 3NPMA 3NQ41 4OHUA 1OHHD 3O4VA 4X63A 1G8KA 4JUBA 4RW0A 3DFKA 3CVVA 2VBFA 2XOKA 3CCFA 1S4QA 4OBWA 2XIQA 4A73A 2DBVO 3HLKA 4G5RA 4II3A 2WWVD 3IUEA 4EIWA 1J2TA 2V54A 4NH0A 3TN7A 4BFCA 2ZJ2A 2W0SA 3TUJC 4AU1A 4C87A 4CLRB 1E69A 1WQ4A 4H4EA 4CKCA 4PSKA 2QAJA 4J9UE 2YWDA 4EO9A 2VDOB 3B85A 2GEFA 4BX0A 5EJ7A 4R8MA 3ZDXB 4AECA 3DQZA 5HF9A 4OP2A 4BN0A 2VEOA 4B35A 2XX3A 5D3MA 4WKCA 2WMDA 1TPYA 3I30X 1WVMA 4FLMA 2WYOA 1H3FA 2IZ5A 3I4FA 5CVVA 3ZY5A 4D4LA 3BD6A 2GHQA 3P4XA 3T5MA 1JE0A 4QU5A 4DM3A 2II6A 5KWJA 4CV2A 3RT7A 2HQSA 3QBVA 1KOGA 5JH7B 1DKPA 1GCOA 2VZEA 3SDBA 3CVYA 4YCSA 2I71A 5KTSA 4Y7CA 4C7BA 2N9UA 3MJHA 4TYPA 1OLUA 1NU6A 4HH3C 5HFJA 3AF4A 4PF1A 4BJHB 4KR6A 4NDNE 1JR4A 3KT3A 1JHAA 1PLLA 1VE9A 3E3MA 3NUZA 1GQYA 2AXEA 2FMUA 1NXTA 3R5XA 3CY6A 4Q15A 1JEJA 2ACVA 2CLOB 2Z0MA 1N2GA 2X6QA 3K8ZA 4ND3A 5A02A 1X7XA 3F78A 3GZ4A 1KHHA 4NPAA 3B9QA 4NG5A 2XNJA 1JSRA 3LP5A 2UYHA 1Y6GA 4YUWA 1HNZB 4UE3S 3GUYA 3PQCA 5EHGA 3U7HB 2GWRA 3DEYX 1Y82A 3NTLA 3BX1A 3EQZA 2H18A 2H1VA 3VJMA 2WHPA 4C0LA 4EWLA 1GYQA 1G7SA 2BMDA 2QY6A 3CUSA 5EN4A 3ROZA 3U4CA 3HN7A 4UUMA 5FT9A 2ZJFA 2C7PA 1PT5A 2PMBA 4HQKA 1UBJS 1ZICA 1IBMB 1FPQA 4QGBA 4P1ZA 4JZYA 5B64A 1DJQA 1BU5A 3UG6A 3UT0A 2HA5A 2PZJA 3AEYA 2GAJA 3JVDA 1P6UA 2J3IA 5B12A 3SQWA 4X45A 3SZLA 2CXRA 1IOVA 4OJTA 3SQMA 5ALHA 5E4TA 4REMA 3CRQA 4MJ7A 4WXRA 3H6GA 1QR6A 1F20A 5JQGA 5GJWC 3LC1O 5DI3A 5CDYA 4Z4FA 3FN4A 3HB4X 1UT8A 5C80A 4E70A 2JKYA 4YRTA 4N82A 3UYLA 1XDUA 3DCIA 3DHNA 4PNHA 3I1FA 2NZYA 3KDPA 1K27A 1OFUX 4F3YA 2GUWA 3H2GA 3GEMA 5TPWB 4KPYA 1DOHA 4MP3A 3RFXA 4ES6A 3UCFA 1TJNA 2Y1XA 4QPJC 1HYHA 3ORQA 1B8OA 4WESB 2YVKA 2O3JA 1KQNA 4O0MA 3ICQB 3PGKA 1FP1D 4N7JA 3CSDA 3CPHA 4DLSA 1CD5A 5D00A 1NX6A 4AXBA 2DSTA 2HXGA 5DGXA 2HUNA 3D59A 4PWZA 4LSMA 5CA1A 2A1TR 3M4NA 4PVDA 3STUA 1J06A 4L78A 4ZU3A 3VZDA 1QORA 4E5DA 1MCZA 1L6IA 5GINE 3MM4A 2R5NA 4FWBA 1E4VA 2MSNA 2P75A 3GBPA 3LVBA 2R8EA 3CX8A 4MKGA 5BSMA 2IP2A 2VJLA 5LZ7A 4EUFA 5EAIA 4IPTA 4WBXC 1E1QD 3OQBA 3GN1A 4AUKA 2J87A 1NULA 1WB5A 4WBSA 3VHXB 4ZQEA 1RE1A 2FWRA 3AB3A 1RJWA 2H4XA 1DO0A 3DNFA 4FFNA 2O2DA 2B8WA 2G5PA 3UMFA 2F4VB 3RQIA 2P62A 4XTCS 3PDIB 1GVHA 2CE7A 4UM8B 1DLJA 2OBNA 3MLEA 3VDRA 1DG1G 1KAMA 1W5BA 4UW9A 4HB3A 5IAEA 4NIMA 4Q4DA 5K5EA 1DC5A 4N48A 3WQQA 2WSBA 4UVHA 5L9AA 2GM3A 2OCIA 2YDXA 5I4IA 1JJFA 4BNZA 3TRKA 4CFZA 1AKNA 3T1YB 3E81A 3O26A 4FHEA 1AMOA 2H5LA 1Z06A 1K7SN 4YV1A 2FP3A 4A0RA 1O95D 1IYZA 4WRRA 4ZOEA 5AKHA 1FRZA 2FSSA 1CJSA 1GKUB 1P1CA 2HA6A 2NU9A 1J09A 3G0HA 1LSJA 1ENYA 1RW4A 1JWBB 4RF2A 3BWCA 1D1PA 1GTG1 5EE9A 3O6VA 1JLLA 4Z1MD 7YASA 1IHYA 2XYGA 3R3ZA 3C3JA 2B7LA 4JVNA 4UJ3A 3KB8A 3ZJ5A 4EHNA 3R7WA 4PLPA 4RA6A 5HVNA 3MB8A 5JEDA 2MYUA 4OI2A 1G4HA 1Y9JA 5JE8A 2BHRA 1VL5A 1GQSA 1RWVA 2LW7A 5TPZA 1BHSA 4CF3A 2ONKA 1C30A 1UM9A 4ZOLA 4JI7B 4S2EA 3ORHA 4BUZA 2A0XA 2HJGA 1RPJA 3WWOA 3K71B 3UMJA 3GMIA 3U1TA 3WRVA 5CLLA 5LOVF 4FN5A 4QXOA 3GP8A 1SXIA 4IIFA 4MV4A 3R9XA 1CY8A 2ZE7A 4PNPA 3NCTA 4WINA 3IKLA 3M4YA 5HKKD 3I9NA 3P32A 3CW2A 5T8KC 4Q1AA 4KPUA 3NWOA 4X7RA 3ETEA 3R5SA 1XLUA 3QXJA 1WR8A 4FYHA 3PGJA 4TRJA 221PA 2P40A 2IUTA 4MMZB 4B6SA 5IZ4A 1U3WA 3PXCX 4HTFB 1CETA 1PNQA 2CHEA 3GHYA 2NU6A 3PT9A 1PVVA 3IALA 1U4OA 4YJKA 2HHLA 3I9LA 1UC8A 3KEFA 1VB5A 4J4TA 2G72A 1J00A 1P19A 3KXLA 3HFRA 2R4TA 2QAIA 3AYXB 1M8GA 2Q8QA 3T5TA 3STWA 5ENDA 1Z4PX 2AJDA 4GWKA 2VHXA 3SEZA 2R97A 1NASA 2OV3A 3PS9A 1SVOA 1TXGA 4L4ZA 4L8VA 1PF7E 1M2JA 5FA6A 2XB4A 1Q57A 3AJRA 3QKTA 4PTZA 3F7NA 4FOOA 2VNIA 4B83A 2A5JA 3DLPX 5JH7F 2FSVC 1Q21A 3OQVA 3SHVA 2P6UA 4RYLA 3QUTA 1DVRA 1BKDR 1X2BA 3E7PA 3SVLA 1TIPA 4ZU6X 3RAPR 1JIIA 5FTNA 4IHJF 4HXFB 2LZ0A 4K8OA 4YA6A 3AHDA 1Z6XA 1V5GA 4R0VA 1Q7TA 2BJHA 1UXIA 5FPPA 1WUJS 1BSVA 1JEOA 4FEAA 4ZGGA 4QT4A 3OIWA 4PPQA 3RU7A 2H0QA 2FSPA 3HU2A 3U3ZA 1DX9A 5DM1A 1GTZA 3DAHA 3N86A 4GMXA 4UBMA 1JIVA 3HKBA 1NLYA 2VTVA 4MV0A 5E9JA 4LVUA 1GL3A 1PT7A 4MA5A 4RIGA 2O2SA 1RYNA 4IJUA 2KJQA 5BNWA 4CKWA 4EG7A 3G5AA 3IUJA 4UQLA 4WJLA 1QRRA 1RQRA 4G0NA 1Z2NX 1LLQA 2O0JA 4I3FA 2W6MA 1N32B 4BEVA 3WGUA 1ZSVA 4TTPA 4MCHA 2KWIA 2O23A 3HB7A 3AF1A 2NUTA 3MJVA 5HBRA 1QV6A 3H8JA 4JT9A 1TEHA 4DF3A 3IVCA 1TEZA 1N8NA 1THTA 5HGJA 5H3LA 1C5KA 3BH0A 2OQVA 4ECEA 2QM8A 5DTJA 1GZ7A 4DIEA 5JFGA 2YOGA 3GBVA 3PC4A 4MP8A 4HNSA 2HU8A 4LZJA 4XR4A 4GKAA 3X44A 5JDIC 4XM2A 5L4LA 2BFBB 5CM8B 4X66B 3AZQA 1KEZA 3MUNA 4B4DA 3OJFA 1E2UA 3AJ8A 2BBSA 3NKVA 4Y2TA 2CK3D 1UINA 4L22A 6GPBA 5HPYB 2I62A 4BB9A 4CXMA 4AJOA 4FYXA 3H5NA 4L3VA 4GI1A 1L5KA 2F3SA 2NN3C 2CNLA 1CTQA 2XOXA 1YS7A 4KUHA 1KA9H 3SZ3A 1TW2A 4HDKB 4AS2A 2JJ2D 1ZMRA 2BWJA 4NICA 1P3DA 1SCKA 2XDQB 1JJVA 1LTKA 1KVRA 3NHZA 1WMSA 5F76A 4CLOA 2LNDA 1G63A 2RGAA 2P6OA 2FK8A 4R4JA 3ZI4A 3C3CA 3LMKA 4E4YA 1A7JA 1U6KA 2J3KA 5F1YA 2IHKA 5LA6A 1W6UA 1XX6A 4QXAA 3TIXB 4ER5A 1WETA 3SX0A 1YK0A 2CNOA 2W2NA 1SKYE 4F71A 1QHHA 2E21A 1P8AA 1G3MA 2PT9A 2R62A 2WY2D 1T0UA 1NQAO 3LP8A 1TJ3A 3O8QB 4MCIA 3FVWA 1NBEA 3EGXA 3C8ZA 3PEUA 1MV5A