2YEKA

Crystal structure of the first bromodomain of human brd2 with the inhibitor gsk525762 (ibet)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
114
structure length
114
Chain Sequence
RVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BROMODOMAIN-CONTAINING PROTEIN 2
publication title Discovery and Characterization of Small Molecule Inhibitors of the Bet Family Bromodomains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 39
structure length 114
sequence length 114
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2yekA00
3P1CA 3UV2A 4DONA 2R0YA 4TQNA 4CURA 3MULA 5K29A 4MR6A 5FFWA 4O75A 4OGJA 5F62A 3AADA 4HXNA 4NR9A 4A9KA 4Z1SA 5FFVA 5L98A 5L99A 4YH4A 5FE6A 3UVWA 5EWHA 4BW1A 4LZ2A 5ENGA 2E7NA 2H60A 3JVLA 4PCIA 3QZSA 3G0JA 2OO1A 1EQFA 5EK9A 5EWVA 2WP1A 3I3JA 3RCWA 4LYWA 4ZW1A 5LJ0A 5DKDA 4QSRA 5F25A 5FG4A 3O37A 3FKMX 5CZGA 5DY7A 5II2A 5I86A 4YH3A 4QSTA 4NR8A 5D3HA 5EVAA 5C7NA 5EV9A 4YY4A 3MB4A 4YYKA 4HXOA 5FE7A 3IU6A 4TS8A 2E3KA 4UYGA 4MR3A 5F1LA 5ENEA 1WUGA 3UV4A 2GRCA 4NYWA 5BT5A 4NYVA 4YYNA 4BJXA 3AQAA 5CGPA 4LZSA 4IR3A 4TZ2A 4O74A 5ETBA 4A9OA 1JM4B 4Y03A 5CQ4A 4KV1A 4HBXA 5I40A 5EGUA 4NRCA 5IG6A 5D3PA 4QR4A 3Q2EA 3DWYA 4WHUA 5CRZA 5D3SA 5DYXA 5EQ1A 4O7FA 3P1FA 4NUDA 4C66A 4O7BA 5AD3A 4QZSA 5FB1A 4QC1A 5DKCA 4CLBA 4IR5A 5A5OA 5FE2A 4A9FA 4C67A 4BW4A 5F5ZA 5I88A 5CRMA 4MEOA 4QB3A 5F1HA 5II1A 5FH7A 5A7CA 4CUTA 4YABA 3UVYA 4BHWA 5CUCA 3U5JA 2YELA 5A5SA 4UIYA 5I29A 5CTLA 3MQMA 4TU4A 5IBNA 5LVQA 4Z93A 3P5OA 4NR6A 3Q2FA 4MR5A 4NUCA 3D7CA 2RNYA 3SVHA 4KV4A 4MENA 4NS5A 4NUEA 5A82A 5EWCA 4BW2A 5HEMA 4LC2A 4QSPA 5EWWA 4A9JA 5L8TA 3S91A 5F3AA 2MJVB 5LKTA 5DYUA 4AKNA 4N3WA 4CUSA 4O77A 4QR3A 4YY6A 2D9EA 5LVRA 2R10A 2F6JA 5CPEA 5D3TA 4HBVA 4CUPA 4WHWA 5CQ8A 5E74A 3LQIA 4A9MA 5DFDA 5EP7A 4BW3A 4UYFA 5HRXA 5CY9A 5HLSA 4TT6A 5COIA 2G4AA 5F63A 5G4RA 4YYGA 4XYAA 5DW1A 3MB3A 3LQJA 5DLZA 5HQ6A 1JSPB 5EWDA 1ZS5A 4CUQA 5D0CA 2R0SA 4N4HA 5EISA 5EPSA 5FG5A 2YQDA 5DLXA 5FH8A 5EA1A 4A9EA 5D25A 4PTBA 5I7XA 4YBSA 4XUAA 4O78A 4QSQA 5CU8A 5FE5A 4O7CA 4YBMA 5ENBA 5FFYA 4PCEA 2YW5A 2WP2A 5CUBA 3O36A 2YYNA 5TCMA 4YBTA 5CQAA 2LSPB 3O33A 4NQMA 4RVRA 4CFKA 4J0SA 3S92A 4NXJA 4QC3A 5E9MA 4UYHA 4YYDA 4LDFA 3U5OA 5KU3A 4QSUA 4UYEA 5HQ5A 4GPJA 5CS8A 4O7EA 5D7XA 3K2JA 4UIVA 2NXBA 4QY4A 3QZVA 5HRVA 3O35A 5FE9A 5CFWA 4N4IA 5J0DA 5LJ2A 3TLPA 1N72A 5D26A 3GG3A 2OUOA 4HXLA 5LUUA 5IGNA 5FE0A 4QEUA 3HMFA 4NYXA 4ZQLA 4F3IA 5E7DA 4XY9A 2DWWA 4UIWA 2F6NA 5FG6A 1E6IA 5D3NA 5H85A 4YYJA 5H1TA 5FB0A 1X0JA 4HXSA 3LXJA 4NR7A 5HJCA 4X2IA 4MEQA 5IIDA 4WIVA 5F36A 4J0RA 4NR5A 4LYIA 4IORA 4N4FA 3JVJA 3ONIA 5A5NA 1F68A 2DVVA 2RNWA 5EU1A 4TU6A 4MEPA 4TZ8A 4A9NA 3P1EA 2D82A 5HFRA 5CQ6A 4QNSA 5FH6A 3SVGA 2I8NA 5AMFA 5HENA 2R0VA 3LQHA 2I7KA 5EPBA 4CFLA 2RO1A 4A9IA 4HXMA 5A83A 4LZRA 4IR6A 4UYFB 4QSSA 4TT2A 5G4SA 3HMEA 5C4QA 2YEKA 4YYIA 5ENCA 5F61A 5HM0A 5CQ5A 5BT3A 5I83A 4FLPA 4J1PA 4Z1QA 5I1QA 5BT4A 5I7YA 5A85A 3G0LA 4UYDA 4YYMA 3U5MA 3SVFA 3ZYUA 4A9HA 5E9KA 4MR4A 5FE1A 5CQTA 2L84A 5E9IA 2N9GA 5DYAA 4QUUA 4QBMA 2RFJA 5IGKA 5E73A 5E9YA 5E0RA 5KTUA 5HELA 5HFQA 5DFBA 4Z6IA 3IU5A 5KTWA 5LJ1A 4XUBA 3NXBA 4Q0OA 4YYHA 4QSVA 4QYLA 5ENIA 5A5RA 4NRAA 4TYLA 4J3IA 5H1VA 3JVMA 4A9LA 5HCLA 3O34A 4O7AA 5HQ7A 5CUDA 3P1DA 4OGIA 5H1UA 4ALGA 4O70A 5JWMA 4KCXA 2L85A 4UIZA 5F2PA 4HBWA 2RI7A 3MXFA 5KO4A 2OSSA 5EM3A 4O71A 5E9LA 5A5PA 4UIUA 4LYSA 5LKXA 5ENHA 4O76A 3MUKA 4YATA 5ENFA 5TB6A 5C89A 3QZTA 2RS9B 5I89A 5FDZA 4PS5A 5DYCA 5FE8A 4TT4A 5EI4A 5A5QA 5C87A 4HXRA 4PY6A 4OUFA 4ALHA 4QYDA 4CL9A 5D3RA 4QEWA 4QR5A 4LRGA 5AMEA 5D3LA 3UW9A 4N4GA 3UVXA 5EICA 5A81A 5L97A 2FSAA 2KTBB 2DVQA 5DBMA 1WUMA 4NRBA 5D3JA 3U5KA 5CP5A 5ENJA 5I80A 3UVDA 5E3GA 4PKLA 4QUTA 5KHMA 4YK0A 4CUUA 2DVRA 2DKWA 5DKHA 5F60A 2DATA 5L96A 4TTEA 4ZC9A 2E7OA 2L5EA 5KTXA 4NQNA 5ACYA 3JVKA 3DAIA 4IOOA 5IGLA 4HXPA 5ETDA 3HMHA 5CQ3A 2YEMA 4Q0NA 4QSXA 4YC9A 5CUEA 4IR4A 5DFCA 2RNXA 5DX4A 4E96A 5FE3A 5E9VA 5LKUA 4Z6HA 4QEVA 5C8GA 3U5NA 4HBYA 4YAXA 4XY8A 5CUAA 5FE4A 5HRWA 5L8UA 4HXKA 3U5LA 5CQ7A 5C85A 4YADA 5DW2A 3U5PA 4NR4A 4LR6A 2YDWA 5D24A 5IGMA 5E3DA 5LKZA 3UV5A 3LJWA 5CUGA 4UITA 4UIXA 5FBXA 5JI8A 4IOQA 4QSWA 4O72A 5EPRA 2DVSA 5AD2A
chains in the Genus database with same CATH superfamily
3P1CA 3UV2A 4DONA 2R0YA 4TQNA 4CURA 4AI6A 3MULA 5K29A 4MR6A 5FFWA 4O75A 4OGJA 5F62A 3AADA 4HXNA 4NR9A 4A9KA 4Z1SA 5FFVA 5L98A 5L99A 4YH4A 5FE6A 3UVWA 5EWHA 4BW1A 4LZ2A 5ENGA 2E7NA 2H60A 3JVLA 4PCIA 3QZSA 3G0JA 2OO1A 1EQFA 5EK9A 5EWVA 2WP1A 3I3JA 3RCWA 4LYWA 4ZW1A 5LJ0A 5DKDA 4QSRA 5F25A 5FG4A 3O37A 3FKMX 5CZGA 5DY7A 5II2A 5I86A 4YH3A 4QSTA 4NR8A 5D3HA 5EVAA 5C7NA 5EV9A 4YY4A 3MB4A 4YYKA 4HXOA 5FE7A 3IU6A 4TS8A 2E3KA 4UYGA 4MR3A 5F1LA 5ENEA 1WUGA 3UV4A 2GRCA 4NYWA 5BT5A 4NYVA 4YYNA 4BJXA 3AQAA 5CGPA 4LZSA 4IR3A 4TZ2A 4O74A 5ETBA 4A9OA 1JM4B 4Y03A 5CQ4A 4KV1A 4HBXA 5I40A 5EGUA 4NRCA 5IG6A 5D3PA 4QR4A 3Q2EA 3DWYA 4WHUA 5CRZA 5D3SA 5DYXA 5EQ1A 4O7FA 3P1FA 4NUDA 4C66A 4O7BA 5AD3A 4QZSA 5FB1A 4QC1A 5DKCA 4CLBA 4IR5A 5A5OA 5FE2A 4A9FA 4C67A 4BW4A 5F5ZA 5I88A 5CRMA 4MEOA 4QB3A 5F1HA 5II1A 5FH7A 5A7CA 4CUTA 4YABA 3UVYA 4BHWA 5CUCA 3U5JA 2YELA 5A5SA 4UIYA 5I29A 5CTLA 3MQMA 4TU4A 5IBNA 5LVQA 4Z93A 3P5OA 4NR6A 3Q2FA 4MR5A 4NUCA 3D7CA 2RNYA 3SVHA 4KV4A 4MENA 4NS5A 4NUEA 5A82A 5EWCA 4BW2A 5HEMA 4LC2A 4QSPA 5EWWA 4A9JA 5L8TA 3S91A 5F3AA 4AKIA 2MJVB 5LKTA 5DYUA 4AKNA 4N3WA 4CUSA 4O77A 4QR3A 4YY6A 2D9EA 5LVRA 2R10A 2F6JA 5CPEA 5D3TA 4HBVA 4CUPA 4WHWA 5CQ8A 3D1BA 5E74A 3LQIA 4A9MA 5DFDA 5EP7A 4BW3A 4UYFA 5HRXA 5CY9A 5HLSA 4TT6A 5COIA 2G4AA 5F63A 5G4RA 4YYGA 4XYAA 5DW1A 3MB3A 3LQJA 5DLZA 5HQ6A 1JSPB 5EWDA 1ZS5A 4CUQA 5D0CA 2R0SA 4N4HA 5EISA 5EPSA 5FG5A 2YQDA 5DLXA 5FH8A 5EA1A 4A9EA 5D25A 4AKHA 4PTBA 5I7XA 4YBSA 4XUAA 4O78A 4QSQA 5CU8A 5FE5A 4O7CA 4YBMA 5ENBA 5FFYA 4PCEA 2YW5A 2WP2A 3D1DA 5CUBA 3O36A 2YYNA 5TCMA 4YBTA 5CQAA 2LSPB 3O33A 4NQMA 4RVRA 4CFKA 4J0SA 3S92A 4NXJA 4QC3A 5E9MA 4UYHA 4YYDA 4LDFA 3U5OA 5KU3A 4QSUA 4UYEA 5HQ5A 4GPJA 5CS8A 4O7EA 5D7XA 3K2JA 4UIVA 2NXBA 4QY4A 3QZVA 5HRVA 3O35A 5FE9A 5CFWA 4N4IA 5J0DA 5LJ2A 3TLPA 1N72A 5D26A 3GG3A 2OUOA 4HXLA 5LUUA 5IGNA 5FE0A 4QEUA 3HMFA 4NYXA 4ZQLA 4F3IA 5E7DA 4XY9A 2DWWA 4UIWA 2F6NA 5FG6A 1E6IA 5D3NA 5H85A 4YYJA 5H1TA 5FB0A 1X0JA 4HXSA 3LXJA 4NR7A 5HJCA 4X2IA 4MEQA 5IIDA 4WIVA 5F36A 4J0RA 3VKHA 4NR5A 4LYIA 4IORA 4N4FA 3JVJA 3ONIA 5A5NA 1F68A 2DVVA 2RNWA 5EU1A 4TU6A 4MEPA 4TZ8A 4A9NA 3P1EA 2D82A 5HFRA 5CQ6A 4QNSA 5FH6A 3SVGA 2I8NA 5AMFA 5HENA 2R0VA 3LQHA 2I7KA 5EPBA 4CFLA 2RO1A 4A9IA 4HXMA 5A83A 4LZRA 4IR6A 4UYFB 4QSSA 4TT2A 5G4SA 3HMEA 5C4QA 2YEKA 4YYIA 5ENCA 5F61A 5HM0A 5CQ5A 5BT3A 5I83A 4FLPA 4J1PA 4Z1QA 5I1QA 5BT4A 5I7YA 5A85A 3G0LA 4UYDA 4YYMA 3U5MA 3SVFA 3ZYUA 4A9HA 5E9KA 4MR4A 5FE1A 5CQTA 2L84A 5E9IA 2N9GA 5DYAA 4QUUA 4QBMA 1ZKRA 2RFJA 5IGKA 5E73A 5E9YA 5E0RA 5KTUA 5HELA 5HFQA 5DFBA 4Z6IA 3IU5A 5KTWA 5LJ1A 4XUBA 3NXBA 4Q0OA 4YYHA 4QSVA 4QYLA 3ERRA 5ENIA 5A5RA 4NRAA 4TYLA 4J3IA 5H1VA 3JVMA 4A9LA 5HCLA 3O34A 4O7AA 5HQ7A 5CUDA 3P1DA 4OGIA 5H1UA 4ALGA 4O70A 5JWMA 4KCXA 2L85A 4UIZA 5F2PA 4HBWA 2RI7A 3MXFA 5KO4A 2OSSA 5EM3A 4O71A 5E9LA 5A5PA 4UIUA 4LYSA 5LKXA 5ENHA 4O76A 3MUKA 4YATA 5ENFA 5TB6A 5C89A 3QZTA 2RS9B 5I89A 5FDZA 4PS5A 5DYCA 5FE8A 4TT4A 5EI4A 5A5QA 5C87A 4HXRA 4PY6A 4OUFA 4ALHA 4QYDA 4CL9A 5D3RA 4QEWA 4QR5A 4LRGA 5AMEA 5D3LA 3UW9A 1PUOA 4N4GA 3UVXA 5EICA 5A81A 5L97A 2FSAA 2KTBB 2DVQA 5DBMA 2EJNA 1WUMA 4NRBA 5D3JA 3U5KA 5CP5A 5ENJA 5I80A 3UVDA 5E3GA 4PKLA 4QUTA 5KHMA 4YK0A 4CUUA 2DVRA 2DKWA 5DKHA 5F60A 2DATA 5L96A 4TTEA 4ZC9A 2E7OA 2L5EA 5KTXA 4NQNA 5ACYA 3JVKA 3DAIA 4IOOA 5IGLA 4HXPA 5ETDA 3HMHA 5CQ3A 2YEMA 4Q0NA 4QSXA 4YC9A 5CUEA 4IR4A 5DFCA 2RNXA 5DX4A 4E96A 5FE3A 5E9VA 5LKUA 4Z6HA 4QEVA 5C8GA 3U5NA 4HBYA 4YAXA 4XY8A 5CUAA 5FE4A 5HRWA 5L8UA 4HXKA 3U5LA 5CQ7A 5C85A 3VKGA 4YADA 5DW2A 3U5PA 4NR4A 4LR6A 2YDWA 5D24A 5IGMA 5E3DA 5LKZA 3UV5A 3LJWA 5CUGA 4UITA 4AKGA 4UIXA 5FBXA 5JI8A 4IOQA 4QSWA 4O72A 5EPRA 2DVSA 5AD2A
chains in the Genus database with same CATH topology
3P1CA 3UV2A 4DONA 2R0YA 4TQNA 4CURA 3MULA 5K29A 4MR6A 5FFWA 4O75A 4OGJA 5F62A 3AADA 4HXNA 4NR9A 4A9KA 4Z1SA 5FFVA 5L98A 5L99A 4YH4A 5FE6A 3UVWA 5EWHA 4BW1A 4LZ2A 5ENGA 2E7NA 2H60A 3JVLA 4PCIA 3QZSA 3G0JA 2OO1A 1EQFA 5EK9A 5EWVA 2WP1A 3I3JA 3RCWA 4LYWA 4ZW1A 5LJ0A 5DKDA 4QSRA 5F25A 5FG4A 3O37A 3FKMX 5CZGA 5DY7A 5II2A 5I86A 4YH3A 4QSTA 4NR8A 5D3HA 5EVAA 5C7NA 5EV9A 4YY4A 3MB4A 4YYKA 4HXOA 5FE7A 3IU6A 4TS8A 2E3KA 4UYGA 4MR3A 5F1LA 5ENEA 1WUGA 3UV4A 2GRCA 4NYWA 5BT5A 4NYVA 4YYNA 4BJXA 3AQAA 5CGPA 4LZSA 4IR3A 4TZ2A 4O74A 5ETBA 4A9OA 1JM4B 4Y03A 5CQ4A 4KV1A 4HBXA 5I40A 5EGUA 4NRCA 5IG6A 5D3PA 4QR4A 3Q2EA 3DWYA 4WHUA 5CRZA 5D3SA 5DYXA 5EQ1A 4O7FA 3P1FA 4NUDA 4C66A 4O7BA 5AD3A 4QZSA 5FB1A 4QC1A 5DKCA 4CLBA 4IR5A 5A5OA 5FE2A 4A9FA 4C67A 4BW4A 5F5ZA 5I88A 5CRMA 4MEOA 4QB3A 5F1HA 5II1A 5FH7A 5A7CA 4CUTA 4YABA 3UVYA 4BHWA 5CUCA 3U5JA 2YELA 5A5SA 4UIYA 5I29A 5CTLA 3MQMA 4TU4A 5IBNA 5LVQA 4Z93A 3P5OA 4NR6A 3Q2FA 4MR5A 4NUCA 3D7CA 2RNYA 3SVHA 4KV4A 4MENA 4NS5A 4NUEA 5A82A 5EWCA 4BW2A 5HEMA 4LC2A 4QSPA 5EWWA 4A9JA 5L8TA 3S91A 5F3AA 2MJVB 5LKTA 5DYUA 4AKNA 4N3WA 4CUSA 4O77A 4QR3A 4YY6A 2D9EA 5LVRA 2R10A 2F6JA 5CPEA 5D3TA 4HBVA 4CUPA 4WHWA 5CQ8A 5E74A 3LQIA 4A9MA 5DFDA 5EP7A 4BW3A 4UYFA 5HRXA 5CY9A 5HLSA 4TT6A 5COIA 2G4AA 5F63A 5G4RA 4YYGA 4XYAA 5DW1A 3MB3A 3LQJA 5DLZA 5HQ6A 1JSPB 5EWDA 1ZS5A 4CUQA 5D0CA 2R0SA 4N4HA 5EISA 5EPSA 5FG5A 2YQDA 5DLXA 5FH8A 5EA1A 4A9EA 5D25A 4PTBA 5I7XA 4YBSA 4XUAA 4O78A 4QSQA 5CU8A 5FE5A 4O7CA 4YBMA 5ENBA 5FFYA 4PCEA 2YW5A 2WP2A 5CUBA 3O36A 2YYNA 5TCMA 4YBTA 5CQAA 2LSPB 3O33A 4NQMA 4RVRA 4CFKA 4J0SA 3S92A 4NXJA 4QC3A 5E9MA 4UYHA 4YYDA 4LDFA 3U5OA 5KU3A 4QSUA 4UYEA 5HQ5A 4GPJA 5CS8A 4O7EA 5D7XA 3K2JA 4UIVA 2NXBA 4QY4A 3QZVA 5HRVA 3O35A 5FE9A 5CFWA 4N4IA 5J0DA 5LJ2A 3TLPA 1N72A 5D26A 3GG3A 2OUOA 4HXLA 5LUUA 5IGNA 5FE0A 4QEUA 3HMFA 4NYXA 4ZQLA 4F3IA 5E7DA 4XY9A 2DWWA 4UIWA 2F6NA 5FG6A 1E6IA 5D3NA 5H85A 4YYJA 5H1TA 5FB0A 1X0JA 4HXSA 3LXJA 4NR7A 5HJCA 4X2IA 4MEQA 5IIDA 4WIVA 5F36A 4J0RA 4NR5A 4LYIA 4IORA 4N4FA 3JVJA 3ONIA 5A5NA 1F68A 2DVVA 2RNWA 5EU1A 4TU6A 4MEPA 4TZ8A 4A9NA 3P1EA 2D82A 5HFRA 5CQ6A 4QNSA 5FH6A 3SVGA 2I8NA 5AMFA 5HENA 2R0VA 3LQHA 2I7KA 5EPBA 4CFLA 2RO1A 4A9IA 4HXMA 5A83A 4LZRA 4IR6A 4UYFB 4QSSA 4TT2A 5G4SA 3HMEA 5C4QA 2YEKA 4YYIA 5ENCA 5F61A 5HM0A 5CQ5A 5BT3A 5I83A 4FLPA 4J1PA 4Z1QA 5I1QA 5BT4A 5I7YA 5A85A 3G0LA 4UYDA 4YYMA 3U5MA 3SVFA 3ZYUA 4A9HA 5E9KA 4MR4A 5FE1A 5CQTA 2L84A 5E9IA 2N9GA 5DYAA 4QUUA 4QBMA 2RFJA 5IGKA 5E73A 5E9YA 5E0RA 5KTUA 5HELA 5HFQA 5DFBA 4Z6IA 3IU5A 5KTWA 5LJ1A 4XUBA 3NXBA 4Q0OA 4YYHA 4QSVA 4QYLA 5ENIA 5A5RA 4NRAA 4TYLA 4J3IA 5H1VA 3JVMA 4A9LA 5HCLA 3O34A 4O7AA 5HQ7A 5CUDA 3P1DA 4OGIA 5H1UA 4ALGA 4O70A 5JWMA 4KCXA 2L85A 4UIZA 5F2PA 4HBWA 2RI7A 3MXFA 5KO4A 2OSSA 5EM3A 4O71A 5E9LA 5A5PA 4UIUA 4LYSA 5LKXA 5ENHA 4O76A 3MUKA 4YATA 5ENFA 5TB6A 5C89A 3QZTA 2RS9B 5I89A 5FDZA 4PS5A 5DYCA 5FE8A 4TT4A 5EI4A 5A5QA 5C87A 4HXRA 4PY6A 4OUFA 4ALHA 4QYDA 4CL9A 5D3RA 4QEWA 4QR5A 4LRGA 5AMEA 5D3LA 3UW9A 4N4GA 3UVXA 5EICA 5A81A 5L97A 2FSAA 2KTBB 2DVQA 5DBMA 1WUMA 4NRBA 5D3JA 3U5KA 5CP5A 5ENJA 5I80A 3UVDA 5E3GA 4PKLA 4QUTA 5KHMA 4YK0A 4CUUA 2DVRA 2DKWA 5DKHA 5F60A 2DATA 5L96A 4TTEA 4ZC9A 2E7OA 2L5EA 5KTXA 4NQNA 5ACYA 3JVKA 3DAIA 4IOOA 5IGLA 4HXPA 5ETDA 3HMHA 5CQ3A 2YEMA 4Q0NA 4QSXA 4YC9A 5CUEA 4IR4A 5DFCA 2RNXA 5DX4A 4E96A 5FE3A 5E9VA 5LKUA 4Z6HA 4QEVA 5C8GA 3U5NA 4HBYA 4YAXA 4XY8A 5CUAA 5FE4A 5HRWA 5L8UA 4HXKA 3U5LA 5CQ7A 5C85A 4YADA 5DW2A 3U5PA 4NR4A 4LR6A 2YDWA 5D24A 5IGMA 5E3DA 5LKZA 3UV5A 3LJWA 5CUGA 4UITA 4UIXA 5FBXA 5JI8A 4IOQA 4QSWA 4O72A 5EPRA 2DVSA 5AD2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P1C A;  3UV2 A;  4DON A;  2R0Y A;  4TQN A;  4CUR A;  3MUL A;  5K29 A;  4MR6 A;  5FFW A;  4O75 A;  4OGJ A;  5F62 A;  3AAD A;  4HXN A;  4NR9 A;  4A9K A;  4Z1S A;  5FFV A;  5L98 A;  5L99 A;  4YH4 A;  5FE6 A;  3UVW A;  5EWH A;  4BW1 A;  4LZ2 A;  5ENG A;  2E7N A;  2H60 A;  3JVL A;  4PCI A;  3QZS A;  3G0J A;  2OO1 A;  1EQF A;  5EK9 A;  5EWV A;  2WP1 A;  3I3J A;  3RCW A;  4LYW A;  4ZW1 A;  5LJ0 A;  5DKD A;  4QSR A;  5F25 A;  5FG4 A;  3O37 A;  3FKM X;  5CZG A;  5DY7 A;  5II2 A;  5I86 A;  4YH3 A;  4QST A;  4NR8 A;  5D3H A;  5EVA A;  5C7N A;  5EV9 A;  4YY4 A;  3MB4 A;  4YYK A;  4HXO A;  5FE7 A;  3IU6 A;  4TS8 A;  2E3K A;  4UYG A;  4MR3 A;  5F1L A;  5ENE A;  1WUG A;  3UV4 A;  2GRC A;  4NYW A;  5BT5 A;  4NYV A;  4YYN A;  4BJX A;  3AQA A;  5CGP A;  4LZS A;  4IR3 A;  4TZ2 A;  4O74 A;  5ETB A;  4A9O A;  1JM4 B;  4Y03 A;  5CQ4 A;  4KV1 A;  4HBX A;  5I40 A;  5EGU A;  4NRC A;  5IG6 A;  5D3P A;  4QR4 A;  3Q2E A;  3DWY A;  4WHU A;  5CRZ A;  5D3S A;  5DYX A;  5EQ1 A;  4O7F A;  3P1F A;  4NUD A;  4C66 A;  4O7B A;  5AD3 A;  4QZS A;  5FB1 A;  4QC1 A;  5DKC A;  4CLB A;  4IR5 A;  5A5O A;  5FE2 A;  4A9F A;  4C67 A;  4BW4 A;  5F5Z A;  5I88 A;  5CRM A;  4MEO A;  4QB3 A;  5F1H A;  5II1 A;  5FH7 A;  5A7C A;  4CUT A;  4YAB A;  3UVY A;  4BHW A;  5CUC A;  3U5J A;  2YEL A;  5A5S A;  4UIY A;  5I29 A;  5CTL A;  3MQM A;  4TU4 A;  5IBN A;  5LVQ A;  4Z93 A;  3P5O A;  4NR6 A;  3Q2F A;  4MR5 A;  4NUC A;  3D7C A;  2RNY A;  3SVH A;  4KV4 A;  4MEN A;  4NS5 A;  4NUE A;  5A82 A;  5EWC A;  4BW2 A;  5HEM A;  4LC2 A;  4QSP A;  5EWW A;  4A9J A;  5L8T A;  3S91 A;  5F3A A;  2MJV B;  5LKT A;  5DYU A;  4AKN A;  4N3W A;  4CUS A;  4O77 A;  4QR3 A;  4YY6 A;  2D9E A;  5LVR A;  2R10 A;  2F6J A;  5CPE A;  5D3T A;  4HBV A;  4CUP A;  4WHW A;  5CQ8 A;  5E74 A;  3LQI A;  4A9M A;  5DFD A;  5EP7 A;  4BW3 A;  4UYF A;  5HRX A;  5CY9 A;  5HLS A;  4TT6 A;  5COI A;  2G4A A;  5F63 A;  5G4R A;  4YYG A;  4XYA A;  5DW1 A;  3MB3 A;  3LQJ A;  5DLZ A;  5HQ6 A;  1JSP B;  5EWD A;  1ZS5 A;  4CUQ A;  5D0C A;  2R0S A;  4N4H A;  5EIS A;  5EPS A;  5FG5 A;  2YQD A;  5DLX A;  5FH8 A;  5EA1 A;  4A9E A;  5D25 A;  4PTB A;  5I7X A;  4YBS A;  4XUA A;  4O78 A;  4QSQ A;  5CU8 A;  5FE5 A;  4O7C A;  4YBM A;  5ENB A;  5FFY A;  4PCE A;  2YW5 A;  2WP2 A;  5CUB A;  3O36 A;  2YYN A;  5TCM A;  4YBT A;  5CQA A;  2LSP B;  3O33 A;  4NQM A;  4RVR A;  4CFK A;  4J0S A;  3S92 A;  4NXJ A;  4QC3 A;  5E9M A;  4UYH A;  4YYD A;  4LDF A;  3U5O A;  5KU3 A;  4QSU A;  4UYE A;  5HQ5 A;  4GPJ A;  5CS8 A;  4O7E A;  5D7X A;  3K2J A;  4UIV A;  2NXB A;  4QY4 A;  3QZV A;  5HRV A;  3O35 A;  5FE9 A;  5CFW A;  4N4I A;  5J0D A;  5LJ2 A;  3TLP A;  1N72 A;  5D26 A;  3GG3 A;  2OUO A;  4HXL A;  5LUU A;  5IGN A;  5FE0 A;  4QEU A;  3HMF A;  4NYX A;  4ZQL A;  4F3I A;  5E7D A;  4XY9 A;  2DWW A;  4UIW A;  2F6N A;  5FG6 A;  1E6I A;  5D3N A;  5H85 A;  4YYJ A;  5H1T A;  5FB0 A;  1X0J A;  4HXS A;  3LXJ A;  4NR7 A;  5HJC A;  4X2I A;  4MEQ A;  5IID A;  4WIV A;  5F36 A;  4J0R A;  4NR5 A;  4LYI A;  4IOR A;  4N4F A;  3JVJ A;  3ONI A;  5A5N A;  1F68 A;  2DVV A;  2RNW A;  5EU1 A;  4TU6 A;  4MEP A;  4TZ8 A;  4A9N A;  3P1E A;  2D82 A;  5HFR A;  5CQ6 A;  4QNS A;  5FH6 A;  3SVG A;  2I8N A;  5AMF A;  5HEN A;  2R0V A;  3LQH A;  2I7K A;  5EPB A;  4CFL A;  2RO1 A;  4A9I A;  4HXM A;  5A83 A;  4LZR A;  4IR6 A;  4UYF B;  4QSS A;  4TT2 A;  5G4S A;  3HME A;  5C4Q A;  2YEK A;  4YYI A;  5ENC A;  5F61 A;  5HM0 A;  5CQ5 A;  5BT3 A;  5I83 A;  4FLP A;  4J1P A;  4Z1Q A;  5I1Q A;  5BT4 A;  5I7Y A;  5A85 A;  3G0L A;  4UYD A;  4YYM A;  3U5M A;  3SVF A;  3ZYU A;  4A9H A;  5E9K A;  4MR4 A;  5FE1 A;  5CQT A;  2L84 A;  5E9I A;  2N9G A;  5DYA A;  4QUU A;  4QBM A;  2RFJ A;  5IGK A;  5E73 A;  5E9Y A;  5E0R A;  5KTU A;  5HEL A;  5HFQ A;  5DFB A;  4Z6I A;  3IU5 A;  5KTW A;  5LJ1 A;  4XUB A;  3NXB A;  4Q0O A;  4YYH A;  4QSV A;  4QYL A;  5ENI A;  5A5R A;  4NRA A;  4TYL A;  4J3I A;  5H1V A;  3JVM A;  4A9L A;  5HCL A;  3O34 A;  4O7A A;  5HQ7 A;  5CUD A;  3P1D A;  4OGI A;  5H1U A;  4ALG A;  4O70 A;  5JWM A;  4KCX A;  2L85 A;  4UIZ A;  5F2P A;  4HBW A;  2RI7 A;  3MXF A;  5KO4 A;  2OSS A;  5EM3 A;  4O71 A;  5E9L A;  5A5P A;  4UIU A;  4LYS A;  5LKX A;  5ENH A;  4O76 A;  3MUK A;  4YAT A;  5ENF A;  5TB6 A;  5C89 A;  3QZT A;  2RS9 B;  5I89 A;  5FDZ A;  4PS5 A;  5DYC A;  5FE8 A;  4TT4 A;  5EI4 A;  5A5Q A;  5C87 A;  4HXR A;  4PY6 A;  4OUF A;  4ALH A;  4QYD A;  4CL9 A;  5D3R A;  4QEW A;  4QR5 A;  4LRG A;  5AME A;  5D3L A;  3UW9 A;  4N4G A;  3UVX A;  5EIC A;  5A81 A;  5L97 A;  2FSA A;  2KTB B;  2DVQ A;  5DBM A;  1WUM A;  4NRB A;  5D3J A;  3U5K A;  5CP5 A;  5ENJ A;  5I80 A;  3UVD A;  5E3G A;  4PKL A;  4QUT A;  5KHM A;  4YK0 A;  4CUU A;  2DVR A;  2DKW A;  5DKH A;  5F60 A;  2DAT A;  5L96 A;  4TTE A;  4ZC9 A;  2E7O A;  2L5E A;  5KTX A;  4NQN A;  5ACY A;  3JVK A;  3DAI A;  4IOO A;  5IGL A;  4HXP A;  5ETD A;  3HMH A;  5CQ3 A;  2YEM A;  4Q0N A;  4QSX A;  4YC9 A;  5CUE A;  4IR4 A;  5DFC A;  2RNX A;  5DX4 A;  4E96 A;  5FE3 A;  5E9V A;  5LKU A;  4Z6H A;  4QEV A;  5C8G A;  3U5N A;  4HBY A;  4YAX A;  4XY8 A;  5CUA A;  5FE4 A;  5HRW A;  5L8U A;  4HXK A;  3U5L A;  5CQ7 A;  5C85 A;  4YAD A;  5DW2 A;  3U5P A;  4NR4 A;  4LR6 A;  2YDW A;  5D24 A;  5IGM A;  5E3D A;  5LKZ A;  3UV5 A;  3LJW A;  5CUG A;  4UIT A;  4UIX A;  5FBX A;  5JI8 A;  4IOQ A;  4QSW A;  4O72 A;  5EPR A;  2DVS A;  5AD2 A; 
#chains in the Genus database with same CATH topology
 3P1C A;  3UV2 A;  4DON A;  2R0Y A;  4TQN A;  4CUR A;  4AI6 A;  3MUL A;  5K29 A;  4MR6 A;  5FFW A;  4O75 A;  4OGJ A;  5F62 A;  3AAD A;  4HXN A;  4NR9 A;  4A9K A;  4Z1S A;  5FFV A;  5L98 A;  5L99 A;  4YH4 A;  5FE6 A;  3UVW A;  5EWH A;  4BW1 A;  4LZ2 A;  5ENG A;  2E7N A;  2H60 A;  3JVL A;  4PCI A;  3QZS A;  3G0J A;  2OO1 A;  1EQF A;  5EK9 A;  5EWV A;  2WP1 A;  3I3J A;  3RCW A;  4LYW A;  4ZW1 A;  5LJ0 A;  5DKD A;  4QSR A;  5F25 A;  5FG4 A;  3O37 A;  3FKM X;  5CZG A;  5DY7 A;  5II2 A;  5I86 A;  4YH3 A;  4QST A;  4NR8 A;  5D3H A;  5EVA A;  5C7N A;  5EV9 A;  4YY4 A;  3MB4 A;  4YYK A;  4HXO A;  5FE7 A;  3IU6 A;  4TS8 A;  2E3K A;  4UYG A;  4MR3 A;  5F1L A;  5ENE A;  1WUG A;  3UV4 A;  2GRC A;  4NYW A;  5BT5 A;  4NYV A;  4YYN A;  4BJX A;  3AQA A;  5CGP A;  4LZS A;  4IR3 A;  4TZ2 A;  4O74 A;  5ETB A;  4A9O A;  1JM4 B;  4Y03 A;  5CQ4 A;  4KV1 A;  4HBX A;  5I40 A;  5EGU A;  4NRC A;  5IG6 A;  5D3P A;  4QR4 A;  3Q2E A;  3DWY A;  4WHU A;  5CRZ A;  5D3S A;  5DYX A;  5EQ1 A;  4O7F A;  3P1F A;  4NUD A;  4C66 A;  4O7B A;  5AD3 A;  4QZS A;  5FB1 A;  4QC1 A;  5DKC A;  4CLB A;  4IR5 A;  5A5O A;  5FE2 A;  4A9F A;  4C67 A;  4BW4 A;  5F5Z A;  5I88 A;  5CRM A;  4MEO A;  4QB3 A;  5F1H A;  5II1 A;  5FH7 A;  5A7C A;  4CUT A;  4YAB A;  3UVY A;  4BHW A;  5CUC A;  3U5J A;  2YEL A;  5A5S A;  4UIY A;  5I29 A;  5CTL A;  3MQM A;  4TU4 A;  5IBN A;  5LVQ A;  4Z93 A;  3P5O A;  4NR6 A;  3Q2F A;  4MR5 A;  4NUC A;  3D7C A;  2RNY A;  3SVH A;  4KV4 A;  4MEN A;  4NS5 A;  4NUE A;  5A82 A;  5EWC A;  4BW2 A;  5HEM A;  4LC2 A;  4QSP A;  5EWW A;  4A9J A;  5L8T A;  3S91 A;  5F3A A;  4AKI A;  2MJV B;  5LKT A;  5DYU A;  4AKN A;  4N3W A;  4CUS A;  4O77 A;  4QR3 A;  4YY6 A;  2D9E A;  5LVR A;  2R10 A;  2F6J A;  5CPE A;  5D3T A;  4HBV A;  4CUP A;  4WHW A;  5CQ8 A;  3D1B A;  5E74 A;  3LQI A;  4A9M A;  5DFD A;  5EP7 A;  4BW3 A;  4UYF A;  5HRX A;  5CY9 A;  5HLS A;  4TT6 A;  5COI A;  2G4A A;  5F63 A;  5G4R A;  4YYG A;  4XYA A;  5DW1 A;  3MB3 A;  3LQJ A;  5DLZ A;  5HQ6 A;  1JSP B;  5EWD A;  1ZS5 A;  4CUQ A;  5D0C A;  2R0S A;  4N4H A;  5EIS A;  5EPS A;  5FG5 A;  2YQD A;  5DLX A;  5FH8 A;  5EA1 A;  4A9E A;  5D25 A;  4AKH A;  4PTB A;  5I7X A;  4YBS A;  4XUA A;  4O78 A;  4QSQ A;  5CU8 A;  5FE5 A;  4O7C A;  4YBM A;  5ENB A;  5FFY A;  4PCE A;  2YW5 A;  2WP2 A;  3D1D A;  5CUB A;  3O36 A;  2YYN A;  5TCM A;  4YBT A;  5CQA A;  2LSP B;  3O33 A;  4NQM A;  4RVR A;  4CFK A;  4J0S A;  3S92 A;  4NXJ A;  4QC3 A;  5E9M A;  4UYH A;  4YYD A;  4LDF A;  3U5O A;  5KU3 A;  4QSU A;  4UYE A;  5HQ5 A;  4GPJ A;  5CS8 A;  4O7E A;  5D7X A;  3K2J A;  4UIV A;  2NXB A;  4QY4 A;  3QZV A;  5HRV A;  3O35 A;  5FE9 A;  5CFW A;  4N4I A;  5J0D A;  5LJ2 A;  3TLP A;  1N72 A;  5D26 A;  3GG3 A;  2OUO A;  4HXL A;  5LUU A;  5IGN A;  5FE0 A;  4QEU A;  3HMF A;  4NYX A;  4ZQL A;  4F3I A;  5E7D A;  4XY9 A;  2DWW A;  4UIW A;  2F6N A;  5FG6 A;  1E6I A;  5D3N A;  5H85 A;  4YYJ A;  5H1T A;  5FB0 A;  1X0J A;  4HXS A;  3LXJ A;  4NR7 A;  5HJC A;  4X2I A;  4MEQ A;  5IID A;  4WIV A;  5F36 A;  4J0R A;  3VKH A;  4NR5 A;  4LYI A;  4IOR A;  4N4F A;  3JVJ A;  3ONI A;  5A5N A;  1F68 A;  2DVV A;  2RNW A;  5EU1 A;  4TU6 A;  4MEP A;  4TZ8 A;  4A9N A;  3P1E A;  2D82 A;  5HFR A;  5CQ6 A;  4QNS A;  5FH6 A;  3SVG A;  2I8N A;  5AMF A;  5HEN A;  2R0V A;  3LQH A;  2I7K A;  5EPB A;  4CFL A;  2RO1 A;  4A9I A;  4HXM A;  5A83 A;  4LZR A;  4IR6 A;  4UYF B;  4QSS A;  4TT2 A;  5G4S A;  3HME A;  5C4Q A;  2YEK A;  4YYI A;  5ENC A;  5F61 A;  5HM0 A;  5CQ5 A;  5BT3 A;  5I83 A;  4FLP A;  4J1P A;  4Z1Q A;  5I1Q A;  5BT4 A;  5I7Y A;  5A85 A;  3G0L A;  4UYD A;  4YYM A;  3U5M A;  3SVF A;  3ZYU A;  4A9H A;  5E9K A;  4MR4 A;  5FE1 A;  5CQT A;  2L84 A;  5E9I A;  2N9G A;  5DYA A;  4QUU A;  4QBM A;  1ZKR A;  2RFJ A;  5IGK A;  5E73 A;  5E9Y A;  5E0R A;  5KTU A;  5HEL A;  5HFQ A;  5DFB A;  4Z6I A;  3IU5 A;  5KTW A;  5LJ1 A;  4XUB A;  3NXB A;  4Q0O A;  4YYH A;  4QSV A;  4QYL A;  3ERR A;  5ENI A;  5A5R A;  4NRA A;  4TYL A;  4J3I A;  5H1V A;  3JVM A;  4A9L A;  5HCL A;  3O34 A;  4O7A A;  5HQ7 A;  5CUD A;  3P1D A;  4OGI A;  5H1U A;  4ALG A;  4O70 A;  5JWM A;  4KCX A;  2L85 A;  4UIZ A;  5F2P A;  4HBW A;  2RI7 A;  3MXF A;  5KO4 A;  2OSS A;  5EM3 A;  4O71 A;  5E9L A;  5A5P A;  4UIU A;  4LYS A;  5LKX A;  5ENH A;  4O76 A;  3MUK A;  4YAT A;  5ENF A;  5TB6 A;  5C89 A;  3QZT A;  2RS9 B;  5I89 A;  5FDZ A;  4PS5 A;  5DYC A;  5FE8 A;  4TT4 A;  5EI4 A;  5A5Q A;  5C87 A;  4HXR A;  4PY6 A;  4OUF A;  4ALH A;  4QYD A;  4CL9 A;  5D3R A;  4QEW A;  4QR5 A;  4LRG A;  5AME A;  5D3L A;  3UW9 A;  1PUO A;  4N4G A;  3UVX A;  5EIC A;  5A81 A;  5L97 A;  2FSA A;  2KTB B;  2DVQ A;  5DBM A;  2EJN A;  1WUM A;  4NRB A;  5D3J A;  3U5K A;  5CP5 A;  5ENJ A;  5I80 A;  3UVD A;  5E3G A;  4PKL A;  4QUT A;  5KHM A;  4YK0 A;  4CUU A;  2DVR A;  2DKW A;  5DKH A;  5F60 A;  2DAT A;  5L96 A;  4TTE A;  4ZC9 A;  2E7O A;  2L5E A;  5KTX A;  4NQN A;  5ACY A;  3JVK A;  3DAI A;  4IOO A;  5IGL A;  4HXP A;  5ETD A;  3HMH A;  5CQ3 A;  2YEM A;  4Q0N A;  4QSX A;  4YC9 A;  5CUE A;  4IR4 A;  5DFC A;  2RNX A;  5DX4 A;  4E96 A;  5FE3 A;  5E9V A;  5LKU A;  4Z6H A;  4QEV A;  5C8G A;  3U5N A;  4HBY A;  4YAX A;  4XY8 A;  5CUA A;  5FE4 A;  5HRW A;  5L8U A;  4HXK A;  3U5L A;  5CQ7 A;  5C85 A;  3VKG A;  4YAD A;  5DW2 A;  3U5P A;  4NR4 A;  4LR6 A;  2YDW A;  5D24 A;  5IGM A;  5E3D A;  5LKZ A;  3UV5 A;  3LJW A;  5CUG A;  4UIT A;  4AKG A;  4UIX A;  5FBX A;  5JI8 A;  4IOQ A;  4QSW A;  4O72 A;  5EPR A;  2DVS A;  5AD2 A; 
#chains in the Genus database with same CATH homology
 3P1C A;  3UV2 A;  4DON A;  2R0Y A;  4TQN A;  4CUR A;  3MUL A;  5K29 A;  4MR6 A;  5FFW A;  4O75 A;  4OGJ A;  5F62 A;  3AAD A;  4HXN A;  4NR9 A;  4A9K A;  4Z1S A;  5FFV A;  5L98 A;  5L99 A;  4YH4 A;  5FE6 A;  3UVW A;  5EWH A;  4BW1 A;  4LZ2 A;  5ENG A;  2E7N A;  2H60 A;  3JVL A;  4PCI A;  3QZS A;  3G0J A;  2OO1 A;  1EQF A;  5EK9 A;  5EWV A;  2WP1 A;  3I3J A;  3RCW A;  4LYW A;  4ZW1 A;  5LJ0 A;  5DKD A;  4QSR A;  5F25 A;  5FG4 A;  3O37 A;  3FKM X;  5CZG A;  5DY7 A;  5II2 A;  5I86 A;  4YH3 A;  4QST A;  4NR8 A;  5D3H A;  5EVA A;  5C7N A;  5EV9 A;  4YY4 A;  3MB4 A;  4YYK A;  4HXO A;  5FE7 A;  3IU6 A;  4TS8 A;  2E3K A;  4UYG A;  4MR3 A;  5F1L A;  5ENE A;  1WUG A;  3UV4 A;  2GRC A;  4NYW A;  5BT5 A;  4NYV A;  4YYN A;  4BJX A;  3AQA A;  5CGP A;  4LZS A;  4IR3 A;  4TZ2 A;  4O74 A;  5ETB A;  4A9O A;  1JM4 B;  4Y03 A;  5CQ4 A;  4KV1 A;  4HBX A;  5I40 A;  5EGU A;  4NRC A;  5IG6 A;  5D3P A;  4QR4 A;  3Q2E A;  3DWY A;  4WHU A;  5CRZ A;  5D3S A;  5DYX A;  5EQ1 A;  4O7F A;  3P1F A;  4NUD A;  4C66 A;  4O7B A;  5AD3 A;  4QZS A;  5FB1 A;  4QC1 A;  5DKC A;  4CLB A;  4IR5 A;  5A5O A;  5FE2 A;  4A9F A;  4C67 A;  4BW4 A;  5F5Z A;  5I88 A;  5CRM A;  4MEO A;  4QB3 A;  5F1H A;  5II1 A;  5FH7 A;  5A7C A;  4CUT A;  4YAB A;  3UVY A;  4BHW A;  5CUC A;  3U5J A;  2YEL A;  5A5S A;  4UIY A;  5I29 A;  5CTL A;  3MQM A;  4TU4 A;  5IBN A;  5LVQ A;  4Z93 A;  3P5O A;  4NR6 A;  3Q2F A;  4MR5 A;  4NUC A;  3D7C A;  2RNY A;  3SVH A;  4KV4 A;  4MEN A;  4NS5 A;  4NUE A;  5A82 A;  5EWC A;  4BW2 A;  5HEM A;  4LC2 A;  4QSP A;  5EWW A;  4A9J A;  5L8T A;  3S91 A;  5F3A A;  2MJV B;  5LKT A;  5DYU A;  4AKN A;  4N3W A;  4CUS A;  4O77 A;  4QR3 A;  4YY6 A;  2D9E A;  5LVR A;  2R10 A;  2F6J A;  5CPE A;  5D3T A;  4HBV A;  4CUP A;  4WHW A;  5CQ8 A;  5E74 A;  3LQI A;  4A9M A;  5DFD A;  5EP7 A;  4BW3 A;  4UYF A;  5HRX A;  5CY9 A;  5HLS A;  4TT6 A;  5COI A;  2G4A A;  5F63 A;  5G4R A;  4YYG A;  4XYA A;  5DW1 A;  3MB3 A;  3LQJ A;  5DLZ A;  5HQ6 A;  1JSP B;  5EWD A;  1ZS5 A;  4CUQ A;  5D0C A;  2R0S A;  4N4H A;  5EIS A;  5EPS A;  5FG5 A;  2YQD A;  5DLX A;  5FH8 A;  5EA1 A;  4A9E A;  5D25 A;  4PTB A;  5I7X A;  4YBS A;  4XUA A;  4O78 A;  4QSQ A;  5CU8 A;  5FE5 A;  4O7C A;  4YBM A;  5ENB A;  5FFY A;  4PCE A;  2YW5 A;  2WP2 A;  5CUB A;  3O36 A;  2YYN A;  5TCM A;  4YBT A;  5CQA A;  2LSP B;  3O33 A;  4NQM A;  4RVR A;  4CFK A;  4J0S A;  3S92 A;  4NXJ A;  4QC3 A;  5E9M A;  4UYH A;  4YYD A;  4LDF A;  3U5O A;  5KU3 A;  4QSU A;  4UYE A;  5HQ5 A;  4GPJ A;  5CS8 A;  4O7E A;  5D7X A;  3K2J A;  4UIV A;  2NXB A;  4QY4 A;  3QZV A;  5HRV A;  3O35 A;  5FE9 A;  5CFW A;  4N4I A;  5J0D A;  5LJ2 A;  3TLP A;  1N72 A;  5D26 A;  3GG3 A;  2OUO A;  4HXL A;  5LUU A;  5IGN A;  5FE0 A;  4QEU A;  3HMF A;  4NYX A;  4ZQL A;  4F3I A;  5E7D A;  4XY9 A;  2DWW A;  4UIW A;  2F6N A;  5FG6 A;  1E6I A;  5D3N A;  5H85 A;  4YYJ A;  5H1T A;  5FB0 A;  1X0J A;  4HXS A;  3LXJ A;  4NR7 A;  5HJC A;  4X2I A;  4MEQ A;  5IID A;  4WIV A;  5F36 A;  4J0R A;  4NR5 A;  4LYI A;  4IOR A;  4N4F A;  3JVJ A;  3ONI A;  5A5N A;  1F68 A;  2DVV A;  2RNW A;  5EU1 A;  4TU6 A;  4MEP A;  4TZ8 A;  4A9N A;  3P1E A;  2D82 A;  5HFR A;  5CQ6 A;  4QNS A;  5FH6 A;  3SVG A;  2I8N A;  5AMF A;  5HEN A;  2R0V A;  3LQH A;  2I7K A;  5EPB A;  4CFL A;  2RO1 A;  4A9I A;  4HXM A;  5A83 A;  4LZR A;  4IR6 A;  4UYF B;  4QSS A;  4TT2 A;  5G4S A;  3HME A;  5C4Q A;  2YEK A;  4YYI A;  5ENC A;  5F61 A;  5HM0 A;  5CQ5 A;  5BT3 A;  5I83 A;  4FLP A;  4J1P A;  4Z1Q A;  5I1Q A;  5BT4 A;  5I7Y A;  5A85 A;  3G0L A;  4UYD A;  4YYM A;  3U5M A;  3SVF A;  3ZYU A;  4A9H A;  5E9K A;  4MR4 A;  5FE1 A;  5CQT A;  2L84 A;  5E9I A;  2N9G A;  5DYA A;  4QUU A;  4QBM A;  2RFJ A;  5IGK A;  5E73 A;  5E9Y A;  5E0R A;  5KTU A;  5HEL A;  5HFQ A;  5DFB A;  4Z6I A;  3IU5 A;  5KTW A;  5LJ1 A;  4XUB A;  3NXB A;  4Q0O A;  4YYH A;  4QSV A;  4QYL A;  5ENI A;  5A5R A;  4NRA A;  4TYL A;  4J3I A;  5H1V A;  3JVM A;  4A9L A;  5HCL A;  3O34 A;  4O7A A;  5HQ7 A;  5CUD A;  3P1D A;  4OGI A;  5H1U A;  4ALG A;  4O70 A;  5JWM A;  4KCX A;  2L85 A;  4UIZ A;  5F2P A;  4HBW A;  2RI7 A;  3MXF A;  5KO4 A;  2OSS A;  5EM3 A;  4O71 A;  5E9L A;  5A5P A;  4UIU A;  4LYS A;  5LKX A;  5ENH A;  4O76 A;  3MUK A;  4YAT A;  5ENF A;  5TB6 A;  5C89 A;  3QZT A;  2RS9 B;  5I89 A;  5FDZ A;  4PS5 A;  5DYC A;  5FE8 A;  4TT4 A;  5EI4 A;  5A5Q A;  5C87 A;  4HXR A;  4PY6 A;  4OUF A;  4ALH A;  4QYD A;  4CL9 A;  5D3R A;  4QEW A;  4QR5 A;  4LRG A;  5AME A;  5D3L A;  3UW9 A;  4N4G A;  3UVX A;  5EIC A;  5A81 A;  5L97 A;  2FSA A;  2KTB B;  2DVQ A;  5DBM A;  1WUM A;  4NRB A;  5D3J A;  3U5K A;  5CP5 A;  5ENJ A;  5I80 A;  3UVD A;  5E3G A;  4PKL A;  4QUT A;  5KHM A;  4YK0 A;  4CUU A;  2DVR A;  2DKW A;  5DKH A;  5F60 A;  2DAT A;  5L96 A;  4TTE A;  4ZC9 A;  2E7O A;  2L5E A;  5KTX A;  4NQN A;  5ACY A;  3JVK A;  3DAI A;  4IOO A;  5IGL A;  4HXP A;  5ETD A;  3HMH A;  5CQ3 A;  2YEM A;  4Q0N A;  4QSX A;  4YC9 A;  5CUE A;  4IR4 A;  5DFC A;  2RNX A;  5DX4 A;  4E96 A;  5FE3 A;  5E9V A;  5LKU A;  4Z6H A;  4QEV A;  5C8G A;  3U5N A;  4HBY A;  4YAX A;  4XY8 A;  5CUA A;  5FE4 A;  5HRW A;  5L8U A;  4HXK A;  3U5L A;  5CQ7 A;  5C85 A;  4YAD A;  5DW2 A;  3U5P A;  4NR4 A;  4LR6 A;  2YDW A;  5D24 A;  5IGM A;  5E3D A;  5LKZ A;  3UV5 A;  3LJW A;  5CUG A;  4UIT A;  4UIX A;  5FBX A;  5JI8 A;  4IOQ A;  4QSW A;  4O72 A;  5EPR A;  2DVS A;  5AD2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...