2YEPF

Structure of an n-terminal nucleophile (ntn) hydrolase, oat2, in complex with glutamate
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
212
structure length
197
Chain Sequence
TLLTFFATDARLDPAEQDRLFRRVMDRTFNAVSIDTDTSTSDTAVLFANGLAGEVDAGEFEEALHTAALALVKDIASDGEGAAKLIEVQVTGARDDAQAKRVGKTVVNSPLVKTAVHGCDPNWGRVAMAIGKCSDDTDIDQERVTIRFGEVEVYPPAEHLRGDEVVIGIDLAIADGAFTVYGCDLTEGYVRLNSEYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAMATE N-ACETYLTRANSFERASE 2 ALPHA CHAIN
publication title Structural and Biochemical Analyses Reveal How Ornithine Acetyl Transferase Binds Acidic and Basic Amino Acid Substrates.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Transferase
total genus 74
structure length 197
sequence length 212
ec nomenclature ec 2.3.1.35: Glutamate N-acetyltransferase.
pdb deposition date 2011-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.340 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2yepF02
3.30.2330.10 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold arginine biosynthesis bifunctional protein suprefamily 2yepF01
3IT4B 3IT6B 2YEPF 1VZ6A 1VRAB 1VZ7A 2YEPB 2V4IB 2VZKB 1VZ8A 2VZKD
chains in the Genus database with same CATH superfamily
4B0EA 1J7AA 2WMGA 3KUDB 4MH8A 1SB3C 3FILA 2Z8LA 1WR6E 3QC8B 2RPQA 3NRZA 2LGXA 3TJPA 3PVLA 1FNVA 5FR3A 2L0TA 1BT0A 1QKZA 4GDLB 4W9LA 2REXA 3WAMA 1HQRD 2Q5WD 3MFGA 4ASWC 2HTME 4C00A 4MGKE 2WDVB 3AE3B 4RM8A 2XK5A 2WMIB 4OZCA 2IO2B 2M8SA 3SR6A 2ASQA 3ZVVA 3QA8A 3UQBA 2JT4B 3L4PA 1WH3A 3S2AA 4C56C 4HRSA 5EE9A 1QOFA 1P3QU 2KDEB 1NYRA 1IPGA 1PYWD 4LNIA 1NI3A 3AI5A 4TMAB 1E6EB 2BT6A 1PQSA 1DYQA 1E7UA 2N1VA 1NBFC 1E0ZA 2GI9A 4YTMB 4P7IA 1WXVA 2DYMA 1WFYA 1QOAA 1S3SG 3TIXA 2RPVA 1VD2A 3TEZA 1JWUD 2C7HA 3L17A 2KTRB 3HRDD 5EE3A 3BVZA 2LI5A 4KSLC 4MJSB 4NAMA 3NY5A 4AJWA 2X8XX 4D72A 4WQMA 4IM3A 2H88B 2MJDA 2V4LA 4XC2A 2LRWA 2L52A 4IDIA 1JRPA 2N7DA 4XYCA 1WJUA 5IP4D 2IO3B 3B08A 2MQJA 2MHJA 1EO6A 2CHZA 2FCNA 2ZNVB 4CO7A 2JRIB 2WXPA 1UD7A 2PVOD 2N0SB 2KJ6A 4J3OD 4D6IA 2BW2A 4QAYA 4RCOA 1BXTA 4K3BA 5CX3A 3D32A 1MFWA 2I2YA 3BINA 2K0PA 2O6VA 1GOZA 2WS3B 4KIKB 2G1EA 4YSZB 5AZHA 1EWYC 2YEPF 2FAZA 3OAWA 4BKSA 3HK0A 3ZKJC 1JRUA 2FCQA 3ML8A 2DNFA 4P16A 3M95A 5J18A 1JCKB 1K52A 4ANUA 1CMXB 1YX5B 2K6QA 3SFDB 2DHZA 4PS3A 4P1BC 3DPDA 3AH7A 3AU4A 4FN2A 2CR5A 5BO4B 2JPHA 4FA6A 3MHZA 4ANWA 2MWSB 1QLBB 4US8A 2NCNA 5BYRA 3BY4B 4E74A 1N5XA 2ZZPB 2QIEB 4KDLB 4PS7A 2KC2A 2KACA 1OEYJ 4K3CA 3MC0B 1V5TA 2RMMA 4DHZE 1YX6B 2GMIC 1Z5SB 2N4FA 2IZVB 2XNAC 4A90A 1E5WA 1EF5A 2BYTA 2I1JA 1I4XA 1D4BA 2G4DB 2KLGA 1SIJA 2C5LC 2BS2B 2JX5A 2RR9A 5I4DA 4HPLB 1FFVA 2PTLA 2UYZB 2JWZA 3W2DA 3KYCD 2J52A 2HJ8A 4IC7B 1WRDB 4LJOB 1RFAA 1HA5A 4A3OA 2M0XA 4IWOA 2VZKB 5D7GA 1E7PB 1UWMA 3H1UA 3QX1A 2IGGA 4RNAA 2INCC 2K6DB 4ANXA 4D2KA 2ZNVC 1V6EA 3DVNU 5HG2A 1AYFA 3RD2A 3GZNI 2MP2B 3RFZB 2WXGA 1C78A 2ZPYA 4ARIA 4HCPB 4KGTA 4TUUA 3RNCC 1ZGUB 1FMAD 2JXTA 4O1NA 5HHDG 2FBWB 2R61A 4RGTA 2G3QB 1NDDA 2LRUA 5AUKA 1XXGA 1DGJA 2EMSA 1P7FA 2IPKD 2KVRA 4XDCA 3AE2B 3KUCB 3H6NA 3VRAB 3BK2A 1CZPA 4EEWA 2Y3AA 3PLUA 4ZHPA 3B2FA 3TMPB 3P1MA 3ZUNA 1EU4A 5C3JB 3ABVB 2JZ3B 2D3GA 4CQNA 1TTNA 1QQRA 3O13A 2K1FA 2N9LA 2NS5A 3B9JA 2WXKA 2WXQA 2A4ZA 2JZZA 3TEXA 2KDBA 4IM2A 3L16A 2ZW1A 1C76A 1GC6A 3RYTA 4MDKE 3NOBA 1IBXB 1L4DB 2DAFA 1PFDA 3TBLD 4JPSA 2KYWA 2C7NB 2RDHA 4BZAA 2B3AA 1HZ6A 3IFWB 2EKIA 2ZCCA 5D94A 4ZRQA 3V05A 2JXXA 2MX2A 3QJZA 2NBWB 4D71A 1HZ5A 1FM0D 4BOSC 3AULA 1GJZA 4KSKC 4DK5A 1A70A 1GB1A 5MPOA 2VH2A 3PV1A 4HEA1 1E9MA 3ZJTA 1I4GA 5C2TB 1JWAD 1UNSA 4J6IA 2NR2A 1MHHE 3ZNID 1ZP0B 3P4QB 4REZA 4AUQC 2R2QA 1P7EA 1DOYA 2INPE 1V2YA 2O2VA 2M17A 3A9JA 4IG7B 3ZJVA 2WX1A 4TQ1A 3Q14C 4OVZA 1PUTA 1L0VB 2FUG1 2JY6A 3AE5B 5FKAC 1L4ZB 1PDXA 2GBNA 3PRPB 4FADA 2JU6X 2N9PC 4D6DA 2KFKB 2K8CA 3Q3NC 3HM3A 4M8NA 2FIFA 3AE6B 3BVGA 4NAWA 1UBQA 5BMGA 4FBJB 3A1QA 1WMHB 2DZJA 4C80A 4FULA 1LQBA 4ZRJA 1T0SC 3APFA 4MT5A 3C19A 4PYZA 4ACFA 1JW9D 2ZW0A 4FLHA 1JWSD 1VZ7A 4PK1A 3Q8FA 1WE7A 2PJHA 1L0XB 1KFYB 1FXAA 1R7SA 1ZXHA 4PYUA 3HUIA 4HJGE 2NTSA 2KLCA 3VAWA 4G11A 4BOZB 1C79A 4GU2A 2Z0DB 2WXJA 3A9KB 1HTOA 1FCCC 2N1WA 4ZYNA 4WWOA 4WQOB 2J0KA 1RLFA 2WX0A 2JWUA 3HHMA 2AQ3B 2NPTA 4DHJD 3W5VB 3AV8A 2OEDA 2Z59B 2CS4A 1MHXA 3MTNB 1KH0A 4D6HA 1P98A 2K25A 3ZLZA 2IYDB 3ZTCA 4IKGA 4N59A 1A5RA 2AL3A 1WY8A 1Q1OA 1JQ4A 5DPRA 2WQYB 2ZPNA 2XN9C 2KX3A 1T5XD 4AQ7A 2KDFB 4CYEA 2LFIA 3DBHB 3RNFC 4HDQA 4C4VA 2LVQA 4W9FA 1Q10A 3AN1A 4GSWA 4RGOS 4W9CA 3MC9A 3Q2AC 1F1HA 2DYBA 1WM3A 1ACCA 1WI0A 3RCZA 4UDUC 3NHEB 3BK1A 2LJ5A 2EMTA 4YSYB 3VTWA 3SHQA 4S0RA 1HE8A 1WSPA 2QMTA 1J19A 3H7PA 5LXHA 5IN7A 3NVZA 5LLIA 4MH0E 1N61A 5G55A 1PGXA 5LNK1 2PE6B 2FCSA 3MC8A 4EOYA 1MG8A 2AYOB 1HEZE 2J53A 4DXFA 2X38A 5HFYA 3N1XC 2GBJA 4M0WA 3I9V1 2MA9B 1OGWA 1SBBB 5G2NA 4H2AA 3VTVA 3MJ5A 4ICVA 4HK2A 1V1PA 4LNOA 1N6ZA 4DXAB 1L7YA 1C77A 5KHQA 4GXBA 2BWES 2D11A 4TV3A 1N5WA 3AE4B 1XLQA 3WAOA 3CSTA 1GAQB 2IGHA 3L54A 3ENEA 1YJJA 1GPXA 3VVWB 2WDQB 3T3NA 1E7VA 5D3DA 1V1OA 5CHVC 2WP9B 4G50A 2DZKA 1OQRA 1HXYD 1E8YA 1WYWB 3AE9B 1DOXA 1N63A 1F2RI 3Q3OC 4IM0A 1WXAA 4D6FA 1LFDA 2J0MA 4I6PA 4I6LB 5TR5A 3BIID 4GDKB 3UIOB 4ICUA 3DWMA 2INNE 1H4RA 3EFUA 4M8MA 3CIRB 3ZXRA 2N7JA 4IWPA 4WIPA 1E8ZA 1YN4A 3AMZA 3AEEB 1E8XA 2LHDA 1TJEA 1WYGA 1CQVA 2KAJA 4FHKA 1SXTA 1YQ4B 2L32A 1T0QC 2WMHA 2L83A 3DVGX 2KZRA 1GNUA 2LASA 3AE7B 4D6CA 4A20A 3NVWA 2LHEA 3L13A 3NZUA 3MJWA 1ZE3D 3Q3JA 1YIWA 1Y56A 1KTKA 1YD8U 3R8BA 2JUOA 3ZTDA 2BWFA 3LB8C 2MJEA 3VR9B 1TS5A 3LXFA 2NTTA 2N9KA 3KVFB 3WIMA 3RMKC 1PGAA 3NS1A 4A6QA 2BKRB 2KMMA 1YN5A 4MACA 4WJQA 3N9YC 2PW9A 4B9KA 1D5MC 4RH6A 3ZNGC 1V97A 3GOEA 4YT0B 4K81A 3EC8A 2DENB 3DBRI 2V0GA 1J0GA 1X1MA 4USAA 5BYQA 2L76A 3PTFC 1Q0WB 5FK9C 2KWDA 1RM6C 1L5PA 2KWUB 1QOBA 2M56B 2K39A 3T9LA 4JX1C 3APCA 4W9JA 3MHSD 4HKZE 4RFBA 3APDA 2L00B 3MP9A 1L6UA 1WRIA 3P63A 2CKHB 3ZGZA 2QDFA 4YSXB 3URYA 2K22A 2WXOA 3FILB 2JQRB 1WX7A 4I6NB 4WJOA 2K5PA 4WWPA 5CTRC 4W9EA 1WXQA 4EFOA 4FJYA 4S17A 5HKHA 2KX0A 1ZKHA 2MEKA 2HE7A 3PLVA 1TS2A 3C8YA 2GBKA 5EDSA 1GC7A 4FJVB 2MLBA 3U30A 5G5GA 2RGFA 4BBNC 3TCAA 3ECIA 2XK5B 2KFJA 3LJ3A 3NVYA 2QSDA 1J7CA 3QQ8B 2IGDA 3WA0A 2KC1A 1ZW7A 2GLSA 1TKGA 1K53A 1UBIA 3Q8AA 4NQLB 4KKIA 4ZRPA 4YTPB 1ZUD2 4W9DA 3L0WB 4XDDA 2A5UA 2LGYA 4LDTB 4WURA 3E56A 1P0RA 3QIJA 3GB1A 2PIAA 3RZFA 3SDLC 2UWQA 3NG0A 3B2GA 1Y8RC 3IAS1 2WHIA 3HIZA 4LNNA 2CJOA 1WXMA 3A4SC 5D6JB 4A9AA 3V60A 5AZFA 2LGSA 3LYYA 3KH0A 2DLBA 3CSFA 2J42A 5G5HA 4R3DA 2ZJDA 3RZWC 3VRBB 1NVID 4MM3A 2W9NA 1L6VA 3R2TA 3P4RB 3SEBA 2V3PA 1TZOA 2MJ3A 4JWUC 2NBUA 2WMJA 1JMLA 3PT2B 1ZDVA 2OJWA 1TIFA 2VRRB 4NJ7A 1RRBA 2GOWA 4OZBA 4A55A 4LNFA 2KQ7A 1YOVB 2VZKD 3QAQA 2KDMA 3B0AA 1SJHD 4KGRA 1NEKB 2JSVX 4ANVA 1J7BA 2BPSA 1U4AA 4OW0A 1QF6A 2BS4B 4HPMB 2B76B 4AOFA 3AU5A 4P6VF 5IAAC 2ZCBA 3EGRA 1XT9B 2O6VB 2LEKA 1G6JA 3Q8BA 3I3TB 4EKUA 2W55A 2WWZA 3ML9A 3FKYA 4AWJA 2WXIA 1K51A 2WMKA 2D10A 2JZPA 5JHBA 3WAPA 4MEMA 3BWUD 4XGAB 1FRRA 1C9FA 2E6XA 4HKQA 2KO3A 5IOIA 1ET6A 2DYOA 4AJYB 1E90A 5IA7A 2BBCA 1NYQA 4KZ0A 3RUIB 2BB6A 2WMFA 1D6EC 4NJ6A 2W82A 4NPNA 4XWWA 2D07B 1GUAB 3N30A 4ZDVA 1CJEA 3TEYA 2WGSA 1WX8A 2MBQA 1N60A 1Z2MA 2BQQA 1V81A 2PMVA 4WWMA 1L2NA 4BVUC 1IGDA 3QK0A 2JF5A 3KUZA 2KJHB 1NENB 2WXFA 4KX6B 3IHPC 3ZJUA 1MJDA 1R4MI 3U2SC 4L2YA 2J7QB 1MG4A 1YMHE 3E9SA 3JSVA 1WZ0A 3GZNB 5JH5C 1EUVB 3VHTC 1O0SA 3L10B 4WAFA 3VH4B 1OQYA 2CU1A 3RN9C 3AEDB 2LGIA 2OOBB 5E6OA 4K1RB 1E10A 1QILA 1SEBD 3BZDB 3VDZA 3OWEB 4LCDE 2C7MB 3U8ZA 4N58A 3NVVA 3DBLI 1T0RC 4LTUA 4YTNB 4WAAA 1XQQA 2K8BA 1IYFA 2C60A 4RF0A 3RNGC 1ZPSA 1IP9A 3LDZE 1XCQL 3CF6E 4MGZE 3DOWA 2FCMA 1CK1A 4LNKA 3P2BA 4JLCA 4DWFA 2KDIA 1D3ZA 2D3CA 2NVUI 1ET9A 3A4RA 1R4NI 3GS2A 2M19A 1WZ3A 2WLBA 1EU3A 1XLPA 3OJ4B 2E3TA 2VH1A 2YEPB 4RM9A 4LJPB 1J8CA 2IY0B 2N9EB 2QHOA 1WX9A 3P42A 1ZOYB 4JIOU 3Q3FA 3IXSA 1KF6B 3DHHC 4WH4A 2KMAA 4ZHOA 1UGMA 1H8CA 4ZOHC 2KWCA 2MBBB 5DCNA 3V6EB 1SJED 3ZO5B 4KGSA 3PPAA 4GDLA 2LD9A 2L3ZA 2D3AA 1UH6A 1ESFA 4K7SA 2QEJC 4D6JA 5AEKB 3AM9A 1SIFA 2V1YA 3IG3A 1YN3A 4DDGD 2WMIA 2RSUA 4W9IA 2XBBC 1TYGB 2CU3A 3ALBA 3ZIMA 3FC4A 1WWTA 2BKFA 1C4CA 2LWPA 3Q8CA 5E6NA 3I57A 5IKCM 2QC8A 2BS3B 1C3TA 3OLMD 2KNBA 2KKCA 1TS3A 4PT5A 2KTRA 2WDTB 2DX5B 3H9DA 2O2VB 1PGBA 3A9JB 2WU2B 4MJSA 1C1YB 3X0WA 4E71A 2WYQA 2N9XA 1C4AA 2L0FA 3W9CB 3KW5B 1MPEA 1FCLA 1KM7A 5JXVA 2JRHA 2IBIB 4X57B 4RMAA 1UZXB 4GIVA 2R2OA 1TT5B 1OFFA 3FAHA 5HI1A 2LUMA 1RYJA 1AARA 3DHIC 3KWLA 1XLOA 2LVOA 4NAWB 1GB4A 3KLSX 3A1QB 2KJRA 5JZEB 3DVGY 1KLGD 2ZVOA 4C7YA 3UQAA 1TBEA 4TQ0A 3DBSA 1I4HA 1SE2A 2LJIA 1SE9A 1OTRB 1YQBA 2K9XA 2BGFA 1TY0A 3P4SB 4MGIE 3W1YA 2Y5BB 2KTFA 4KIKA 5TSSA 4B95A 1VLBA 4XZ4A 3BYYB 1N62A 4GB9A 1D5ZC 3A33B 4ZRKA 1WIAA 2IY1B 4KV2A 4BFRA 2FIDA 1F0ZA 3VFKA 3IT4B 3RNEC 2IDYA 2CJNA 2RDBC 2FE8A 4WJPA 2UU7A 1WM2A 3P4PB 5E6PA 3R66C 3V61A 3UI3A 3X23A 2M4NA 2NPTB 4N6EB 2WU5B 1LXDA 2M0AA 2SAKA 5GMVA 5L95C 5JHAA 1S1QB 4XX5A 4M02A 1FO4A 2KT7A 1SGHA 2D3BA 2QCZA 2GRIA 3IBEA 4FHJA 3UIPB 1EWCA 1P1AA 4DQOC 1WGKA 3W1SC 3AEFB 1ENFA 4C4VB 1JALA 4ZRIA 2JYTA 2KN4A 2INDC 4HWIB 2W3RA 5FR6A 2H89B 4W9GA 2MW5A 3DWGC 4HROA 3AXCA 5J2RA 2BTEA 1SE4A 3TL5A 2RDGA 3QCAA 3PS6A 1NI2A 3ZW3A 2AEHA 3EUB2 4N9F4 3H7PB 4W9KA 4EZJA 2NMQA 3EECA 2M1MA 1WJNA 1SF0A 1KOTA 4B6WA 2AQ2B 2W54A 3HM6X 2AQ1B 1WGHA 1UUPA 2I1KA 3Q69A 2AX5A 1LLQA 4F7ZA 3GE3C 2D2QA 3N1YC 4HPPA 3AE1B 3AEBB 3H7SA 4EUTA 4OVUA 4M0WB 2QJLA 3WALA 4D6GA 2QILA 1FEHA 2MP2A 3R7RA 3M3JA 1V1PB 2WXMA 2BB5A 2WNMA 2I38A 1T3QA 2D5GA 1IGCA 4AP4C 2RD0A 5EE0A 3VUWA 1LO5D 2LXCA 1FXIA 4F8CB 1YQ3B 1V80A 1P9DU 1KJTA 2KMCA 1EF1A 4TSSA 4ITKA 4MELA 4GGQA 2PLPA 3N1ZC 5CHWA 4GMVA 4NJCA 2AL6A 3RPFC 1GG3A 3V6CB 1B9RA 1FIQA 3DCGA 5EE1A 1JWMD 2CHWA 1TGZB 2HJ1A 2OHFA 5DPSA 2LUEA 1VR9A 1FNWA 1LM8B 3WCQA 4HDOA 2Y5CA 4IW0A 3PO0A 1IBXA 1XCTL 3Q6BA 4KVGB 2G45B 1I7HA 3KQ4A 2V4IB 1FNUA 2NBVB 3GE8C 1HTQA 4MSMB 2KN5A 4RGNA 4G3XB 4URKA 1MVKA 3DBRB 3T8MA 1KRHA 1SE3A 2MH7A 4LDTD 4EZKA 3J9CA 3IT6B 3CMMB 3VUYA 2WXRA 3UINB 2AWTA 4KZCA 3RNBC 2WXLA 2GBMA 1I42A 3K9PB 4ZYSA 5DPWA 2K8HA 4MGYE 3SFEB 3VQIA 2SEBD 4OVVA 4LK0M 5DPTA 4A3PA 4JL9A 4Q2JA 2LZ6A 3PRZA 1MI0A 1WGDA 2WXNA 3JVZX 3PHXB 4II2B 4JWSC 2DZIA 3AEGB 3IAM1 4GOCA 3JW0X 1V86A 1VZ8A 2IO1B 2LXAA 2BYFA 3V62A 1V5OA 3VH3B 5LXIB 1BMLC 2KFKA 3RT3B 2DBYA 2XEWA 2FNJB 3M62B 2DWQA 3OG5A 5T8IA 3UGBB 2EELA 1QOGA 2N7EA 1I4PA 4MSQB 1XO3A 1K50A 4XE0A 1I4QA 4C7ZA 5L83A 1UWXA 1WMHA 3ZNZB 1F2RC 3PGEA 1WJ4A 2WDRB 3DDCB 3GP7A 3AB5A 4FXCA 3VXWA 1TKYA 2O6VD 1RWSA 1TY2A 3H8HA 4M01A 3B1LX 3ZRCA 3R2IA 4XWTA 5GXGB 1ZXIA 4K7WA 4EE2A 2BF8B 5E6JA 4KDIC 3HVZA 3QHTA 2Z0EB 1OQQA 2MBOA 1AW7A 1ROEA 2BVCA 3ZNHB 4YXDB 4BBNF 1DOIA 4BKSD 5J17A 4NNJB 1FFUA 1T0YA 3JYUA 3PZ7A 2ACZB 4YL8A 3R3MA 4HXDA 4US9A 1V49A 3A9KA 3NJTA 1BUIC 2L1AA 3I63C 1VCBA 2V3SA 2YLMA 4A8XC 2WXHA 2EKEC 3PRMB 1FD6A 2V9HA 4DBGA 1ISNA 2GBRA 1FXTB 3PHWB 1K8RB 1T6BX 3W1SA 4P1CC 1JWBD 3QARA 4ARCA 3NZ3A 1B1ZA 2W3SA 3VR8B 4L23A 4E3CA 4NQKE 2ZVNA 4NY0A 5H92C 3BVMA 4OHJA 2PPHA 1SSNA 2KD0A 4IUMB 4DHZB 5IO9A 3NZSA 2DAJA 1OEYA 1YJIA 5C23A 4HLEA 2ONQA 1UF0A 3I5JC 4OZAA 1AWDA 3TUOA 1WGRA 4MM3B 1TKEA 3C0RB 3UF8A 1C4PA 1TS4A 3EHVA 1YNTE 5AUIA 2JYEA 1RFKA 1JROA 4JE3B 3ZQ4A 2ICIA 3VTUA 3K9OB 3NUHB 2G4SA 1IUEA 5H8YE 2FUHB 5AZGA 1XEEA 2KQSA 3DQVA 1XD3B 1XLNA 2LGDA 2G9HD 1WGYA 2LMCA 4WJNA 2KK8A 5BMIA 5BMHA 4AS1A 3DBHI 1YJ1A 2L8JA 3AECB 1E8WA 2JVCA 1WE6A 2L7RA 3L08A 3AEAB 4LLGM 3V3XA 4M00A 3N32A 1EM7A 4HCNB 1RAXA 3RNAC 4TKNA 3Q8EA 1I4RA 5CHFA 1TZ1A 3R7QA 3PSEB 3ZDTA 1ZDXA 5D2MB 1VRAB 1WR1A 1VDVA 1D5XC 3KYDD 2KWVB 4II3B 3U7DA 1WF9A 2Y5PA 1WJ6A 3PZ8A 1WGGA 3OJ3A 1M94A 2ON8A 2IO0B 4DDID 1R4MB 2CHXA 3WANA 2HD5B 1F77A 4YWGG 2LVPA 3U7ZA 1VZ6A 1V9JA 2YVCA 1L0YB 2MBHA 2C9WB 1XF5L 3TEWA 2OJRA 3DVNV 4DHJB 3N3KB 1AN8A 2PE9A 3TSSA 4BKGA 3O65B 4GDKA 4K7UA 3AE8B 4WWNA 4BKTA 3EA6A 4FJZA 2J4XA 3SD5A 3ZRFA 3PREA 3EFCA 2V3NA 1VJKA 3IVFA 4GN1A 2KANA 3DBLB 2BYVE 2J0JA 4HJKA 1UELA 4B0MA 2MSED 1I35A 1M4VA 4PS8A 3Q3MC 3JSVB 3N20C 3ZXVA 2TSSA 3HVDA 4CHKA 4JGHB 4W9HA 1F52A 2KVZA 5KHOA 2ZEQA 3VUXA 1Q5WB 3M63B 1FRDA 1R4NB 1UGJA 4IWQA 4D6EA 1FPYA 2GB1A 4HVBA 3T3OA 4F1SA 4RF1A 1STEA 2PEAA 3U4EG 3W5UB 2KXJA 4GLSC 4JQWC 1LGRA 5BYSA 3ZYYX 2KQ4X 2BYEA 2KHWB 4NZLB 5D3IB 3ONSA 4L1BA 5C1ZA 3ETRA 1KLUD 3RI7C 1QT9A 1QZEA 4BAXA 1WXSA 3U52E 2PKOA 2HDEA 3PZDA 4EZLA 2MBEA 2KOXA 2PVGC 3RULA 1F9JA 1KLVA 3DHGC 3BYTB 3QWZB 2L05A 4IOIE 3CWIA 2DZMA 3KWVA 4G0NB 3NS8A 2MRPA 2K3UA 3SU8X 1V8CA 2MCNB 2HTHA 4KKJA 3ZDMC 2IJ0A 4DXGA 4RGMA
chains in the Genus database with same CATH topology
1L0XB 1KFYB 4B0EA 1J7AA 1FXAA 1R7SA 4MH8A 1SB3C 2JZPA 1ZXHA 3FILA 2Z8LA 3HUIA 2PLPA 4HJGE 3NRZA 4NJCA 3BWUD 3RPFC 1FRRA 2NTSA 1B9RA 1C9FA 1FIQA 1FNVA 5FR3A 1C79A 2E6XA 4HKQA 5EE1A 1QKZA 1JWMD 2OHFA 4GDLB 1ET6A 2DYOA 1HQRD 2Q5WD 2WXJA 3MFGA 1FCCC 2BBCA 2HTME 1NYQA 2BB6A 1VR9A 1FNWA 2WDVB 1D6EC 3AE3B 2W82A 4XWWA 4OZCA 2JWUA 2AQ3B 3WCQA 1CJEA 2Y5CA 3TEYA 3W5VB 3SR6A 3PO0A 3AV8A 1IBXA 2OEDA 1MHXA 1XCTL 3L4PA 1KH0A 4C56C 1N60A 4HRSA 5EE9A 1I7HA 1QOFA 2V4IB 3KQ4A 2PMVA 4WWMA 1FNUA 4IKGA 1NYRA 1IGDA 1PYWD 1NENB 4N59A 1NI3A 2WXFA 4KX6B 4TMAB 1E6EB 2BT6A 3ZJUA 4RGNA 1JQ4A 1DYQA 3U2SC 2WQYB 1E0ZA 4L2YA 1MVKA 2GI9A 2XN9C 4YTMB 1YMHE 1KRHA 1SE3A 2DYMA 1T5XD 2MH7A 4AQ7A 3J9CA 3IT6B 1QOAA 2LFIA 2RPVA 3E9SA 1Q10A 3TEZA 1JWUD 2WXRA 3AN1A 3HRDD 5EE3A 4RGOS 3BVZA 2WXLA 4NAMA 4WAFA 4WQMA 4ZYSA 2H88B 3AEDB 3SFEB 2LGIA 2MJDA 3VQIA 2SEBD 1ACCA 2L52A 4LK0M 4UDUC 4IDIA 1E10A 1QILA 3BK1A 1JRPA 1SEBD 3BZDB 4YSYB 3OWEB 4Q2JA 1MI0A 2WXNA 4N58A 3NVVA 1WSPA 2QMTA 4JWSC 4LTUA 4YTNB 2WXPA 2PVOD 3NVZA 1N61A 2N0SB 3AEGB 3IAM1 1PGXA 5LNK1 4RF0A 1VZ8A 1ZPSA 4J3OD 1XCQL 1BMLC 1HEZE 2BW2A 2DBYA 2J53A 4RCOA 1BXTA 1CK1A 2DWQA 5T8IA 4DXFA 2EELA 2X38A 5HFYA 1QOGA 1I4PA 4M0WA 1XO3A 3I9V1 1SBBB 1ET9A 1K50A 4XE0A 1I4QA 4C7ZA 2I2YA 4H2AA 1UWXA 3GS2A 2M19A 3MJ5A 2K0PA 1F2RC 1V1PA 2WLBA 1GOZA 1C77A 2WDRB 1EU3A 1XLPA 3GP7A 3AB5A 2WS3B 1N5WA 2E3TA 4FXCA 3AE4B 1TKYA 1RWSA 2G1EA 2YEPB 4YSZB 1XLQA 1TY2A 3H8HA 1EWYC 2YEPF 3P42A 1ZOYB 3R2IA 4XWTA 1GAQB 2IGHA 5GXGB 3IXSA 1KF6B 1YJJA 1ZXIA 4EE2A 1GPXA 4WH4A 5E6JA 2WDQB 3T3NA 3HVZA 5D3DA 1OQQA 1V1OA 4ZHOA 1AW7A 1ROEA 4YXDB 2WP9B 4ZOHC 1DOIA 1OQRA 1HXYD 1FFUA 3PZ7A 2ACZB 4P16A 3AE9B 1DOXA 1N63A 1F2RI 1SJED 4US9A 4KGSA 1JCKB 1K52A 3SFDB 1BUIC 1ESFA 2QEJC 3BIID 4GDKB 2L1AA 3DWMA 2INNE 3AH7A 3AM9A 3CIRB 4A8XC 2WXHA 1YN3A 3MHZA 2N7JA 1QLBB 4WIPA 1YN4A 3AMZA 3AEEB 1FD6A 4US8A 2LHDA 5BYRA 1TJEA 1WYGA 1N5XA 1TYGB 1CQVA 2KAJA 2CU3A 2QIEB 3FC4A 1WWTA 1C4CA 3Q8CA 2KACA 1SXTA 1T6BX 3I57A 3W1SA 1JWBD 1YQ4B 2L32A 3MC0B 4ARCA 3NZ3A 1B1ZA 2RMMA 2W3SA 3VR8B 4L23A 2L83A 2BS3B 3AE7B 3NVWA 2LHEA 5H92C 3BVMA 4OHJA 1TS3A 1SSNA 2XNAC 4A90A 1ZE3D 2BYTA 1Y56A 1YJIA 1I4XA 4PT5A 1D4BA 1KTKA 1SIJA 2BS2B 1PGBA 2JX5A 2WU2B 3R8BA 2ONQA 4OZAA 5I4DA 1AWDA 1FFVA 2MJEA 3LB8C 3TUOA 4MM3B 3VR9B 1TS5A 1C4AA 1TKEA 2PTLA 3W9CB 3W2DA 3LXFA 1C4PA 1TS4A 2J52A 1MPEA 2NTTA 1FCLA 1YNTE 2N9KA 5AUIA 2JYEA 1RFKA 1PGAA 3NS1A 1JROA 4A6QA 4JE3B 3ZQ4A 2ICIA 1HA5A 2KMMA 1YN5A 4MACA 5JXVA 3N9YC 2PW9A 3NUHB 1IUEA 2VZKB 1D5MC 5H8YE 1XEEA 4RH6A 5D7GA 1XLNA 1V97A 1E7PB 2G9HD 1UWMA 3FAHA 1OFFA 4YT0B 5HI1A 2LMCA 2IGGA 2LUMA 5BMIA 4RNAA 5BMHA 1RYJA 4D2KA 2V0GA 3KWLA 4USAA 1XLOA 5BYQA 4AS1A 5HG2A 1AYFA 4NAWB 1GB4A 3KLSX 3AECB 5FK9C 2KWDA 1RM6C 1L5PA 1KLGD 1QOBA 3AEAB 4LLGM 2M56B 4C7YA 3V3XA 3RFZB 2WXGA 4JX1C 1C78A 4HKZE 4ARIA 1EM7A 4TQ0A 4KGTA 4RFBA 3Q8EA 1FMAD 1I4HA 1I4RA 2JXTA 1SE2A 2LJIA 3MP9A 4O1NA 5HHDG 2FBWB 2R61A 1L6UA 4RGTA 5AUKA 1WRIA 1XXGA 3P63A 1ZDXA 2K9XA 1DGJA 1TY0A 1VRAB 1P7FA 1VDVA 1D5XC 2IPKD 3P4SB 4XDCA 3AE2B 3ZGZA 4YSXB 3URYA 3VRAB 2Y5PA 2K22A 5TSSA 2WXOA 3FILB 3PZ8A 2JQRB 3BK2A 1VLBA 3BYYB 1N62A 2K5PA 1D5ZC 2ON8A 1CZPA 1WXQA 2Y3AA 1F0ZA 2MEKA 1F77A 4YWGG 3IT4B 4ZHPA 3B2FA 3U7ZA 1VZ6A 2IDYA 3P1MA 1EU4A 2CJNA 5C3JB 3ABVB 1L0YB 1TS2A 3C8YA 2FE8A 4CQNA 1QQRA 1XF5L 3O13A 2N9LA 3TEWA 3P4PB 3B9JA 5G5GA 1AN8A 2WXKA 3TSSA 2WXQA 3UI3A 3NVYA 3TEXA 2QSDA 1J7CA 2IGDA 2ZW1A 1C76A 4N6EB 2WU5B 2M0AA 1IBXB 1TKGA 1L4DB 1K53A 2SAKA 3AE8B 1PFDA 3EA6A 2J4XA 3Q8AA 4JPSA 4KKIA 4ZRPA 2V3NA 4YTPB 1ZUD2 2RDHA 1VJKA 1HZ6A 1FO4A 4XDDA 2EKIA 2GRIA 4WURA 3E56A 1EWCA 4ZRQA 3V05A 4DQOC 4B0MA 1WGKA 3GB1A 2PIAA 3AEFB 1ENFA 1M4VA 1HZ5A 3B2GA 1FM0D 1JALA 1A70A 3IAS1 1GB1A 5MPOA 4HEA1 2JYTA 2KN4A 1E9MA 2TSSA 3HVDA 3ZJTA 2CJOA 1I4GA 5C2TB 1JWAD 1UNSA 4A9AA 1MHHE 2W3RA 3LYYA 1ZP0B 2H89B 3P4QB 4REZA 1P7EA 2DLBA 3DWGC 4HROA 1FRDA 1DOYA 2INPE 1UGJA 2J42A 5G5HA 4R3DA 2BTEA 2GB1A 1SE4A 3VRBB 1NVID 3ZJVA 2RDGA 4TQ1A 3T3OA 4RF1A 1STEA 1L6VA 3R2TA 3P4RB 4OVZA 2V3PA 1TZOA 2MJ3A 4JWUC 3SEBA 3U4EG 1PUTA 3W5UB 3EUB2 1JMLA 1L0VB 1ZDVA 2FUG1 2NMQA 4GLSC 3AE5B 1SF0A 5FKAC 1L4ZB 4OZBA 1PDXA 2AQ2B 2W54A 5BYSA 2AQ1B 2JU6X 1UUPA 4A55A 3ZYYX 2KQ4X 3Q69A 4NZLB 5D3IB 2AX5A 4L1BA 2VZKD 3ETRA 1KLUD 2KDMA 1SJHD 4KGRA 1QT9A 1NEKB 2JSVX 3AE1B 3AEBB 3AE6B 3U52E 1J7BA 2PKOA 2HDEA 3BVGA 4OW0A 2QJLA 1QF6A 2BS4B 5BMGA 2QILA 2B76B 1FEHA 4P6VF 2PVGC 3EGRA 1V1PB 2WXMA 3BYTB 2BB5A 2WNMA 4C80A 2LEKA 4IOIE 3CWIA 3KWVA 3Q8BA 2I38A 1T3QA 2D5GA 1IGCA 5EE0A 1LO5D 2W55A 4MT5A 2K3UA 1FXIA 1V8CA 1JW9D 2ZW0A 2WXIA 1K51A 1YQ3B 4KKJA 1JWSD 1VZ7A 2IJ0A 4DXGA 4TSSA 4RGMA 3Q8FA 4ITKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IT4 B;  3IT6 B;  2YEP F;  1VZ6 A;  1VRA B;  1VZ7 A;  2YEP B;  2V4I B;  2VZK B;  1VZ8 A;  2VZK D; 
#chains in the Genus database with same CATH topology
 4B0E A;  1J7A A;  2WMG A;  3KUD B;  4MH8 A;  1SB3 C;  3FIL A;  2Z8L A;  1WR6 E;  3QC8 B;  2RPQ A;  3NRZ A;  2LGX A;  3TJP A;  3PVL A;  1FNV A;  5FR3 A;  2L0T A;  1BT0 A;  1QKZ A;  4GDL B;  4W9L A;  2REX A;  3WAM A;  1HQR D;  2Q5W D;  3MFG A;  4ASW C;  2HTM E;  4C00 A;  4MGK E;  2WDV B;  3AE3 B;  4RM8 A;  2XK5 A;  2WMI B;  4OZC A;  2IO2 B;  2M8S A;  3SR6 A;  2ASQ A;  3ZVV A;  3QA8 A;  3UQB A;  2JT4 B;  3L4P A;  1WH3 A;  3S2A A;  4C56 C;  4HRS A;  5EE9 A;  1QOF A;  1P3Q U;  2KDE B;  1NYR A;  1IPG A;  1PYW D;  4LNI A;  1NI3 A;  3AI5 A;  4TMA B;  1E6E B;  2BT6 A;  1PQS A;  1DYQ A;  1E7U A;  2N1V A;  1NBF C;  1E0Z A;  2GI9 A;  4YTM B;  4P7I A;  1WXV A;  2DYM A;  1WFY A;  1QOA A;  1S3S G;  3TIX A;  2RPV A;  1VD2 A;  3TEZ A;  1JWU D;  2C7H A;  3L17 A;  2KTR B;  3HRD D;  5EE3 A;  3BVZ A;  2LI5 A;  4KSL C;  4MJS B;  4NAM A;  3NY5 A;  4AJW A;  2X8X X;  4D72 A;  4WQM A;  4IM3 A;  2H88 B;  2MJD A;  2V4L A;  4XC2 A;  2LRW A;  2L52 A;  4IDI A;  1JRP A;  2N7D A;  4XYC A;  1WJU A;  5IP4 D;  2IO3 B;  3B08 A;  2MQJ A;  2MHJ A;  1EO6 A;  2CHZ A;  2FCN A;  2ZNV B;  4CO7 A;  2JRI B;  2WXP A;  1UD7 A;  2PVO D;  2N0S B;  2KJ6 A;  4J3O D;  4D6I A;  2BW2 A;  4QAY A;  4RCO A;  1BXT A;  4K3B A;  5CX3 A;  3D32 A;  1MFW A;  2I2Y A;  3BIN A;  2K0P A;  2O6V A;  1GOZ A;  2WS3 B;  4KIK B;  2G1E A;  4YSZ B;  5AZH A;  1EWY C;  2YEP F;  2FAZ A;  3OAW A;  4BKS A;  3HK0 A;  3ZKJ C;  1JRU A;  2FCQ A;  3ML8 A;  2DNF A;  4P16 A;  3M95 A;  5J18 A;  1JCK B;  1K52 A;  4ANU A;  1CMX B;  1YX5 B;  2K6Q A;  3SFD B;  2DHZ A;  4PS3 A;  4P1B C;  3DPD A;  3AH7 A;  3AU4 A;  4FN2 A;  2CR5 A;  5BO4 B;  2JPH A;  4FA6 A;  3MHZ A;  4ANW A;  2MWS B;  1QLB B;  4US8 A;  2NCN A;  5BYR A;  3BY4 B;  4E74 A;  1N5X A;  2ZZP B;  2QIE B;  4KDL B;  4PS7 A;  2KC2 A;  2KAC A;  1OEY J;  4K3C A;  3MC0 B;  1V5T A;  2RMM A;  4DHZ E;  1YX6 B;  2GMI C;  1Z5S B;  2N4F A;  2IZV B;  2XNA C;  4A90 A;  1E5W A;  1EF5 A;  2BYT A;  2I1J A;  1I4X A;  1D4B A;  2G4D B;  2KLG A;  1SIJ A;  2C5L C;  2BS2 B;  2JX5 A;  2RR9 A;  5I4D A;  4HPL B;  1FFV A;  2PTL A;  2UYZ B;  2JWZ A;  3W2D A;  3KYC D;  2J52 A;  2HJ8 A;  4IC7 B;  1WRD B;  4LJO B;  1RFA A;  1HA5 A;  4A3O A;  2M0X A;  4IWO A;  2VZK B;  5D7G A;  1E7P B;  1UWM A;  3H1U A;  3QX1 A;  2IGG A;  4RNA A;  2INC C;  2K6D B;  4ANX A;  4D2K A;  2ZNV C;  1V6E A;  3DVN U;  5HG2 A;  1AYF A;  3RD2 A;  3GZN I;  2MP2 B;  3RFZ B;  2WXG A;  1C78 A;  2ZPY A;  4ARI A;  4HCP B;  4KGT A;  4TUU A;  3RNC C;  1ZGU B;  1FMA D;  2JXT A;  4O1N A;  5HHD G;  2FBW B;  2R61 A;  4RGT A;  2G3Q B;  1NDD A;  2LRU A;  5AUK A;  1XXG A;  1DGJ A;  2EMS A;  1P7F A;  2IPK D;  2KVR A;  4XDC A;  3AE2 B;  3KUC B;  3H6N A;  3VRA B;  3BK2 A;  1CZP A;  4EEW A;  2Y3A A;  3PLU A;  4ZHP A;  3B2F A;  3TMP B;  3P1M A;  3ZUN A;  1EU4 A;  5C3J B;  3ABV B;  2JZ3 B;  2D3G A;  4CQN A;  1TTN A;  1QQR A;  3O13 A;  2K1F A;  2N9L A;  2NS5 A;  3B9J A;  2WXK A;  2WXQ A;  2A4Z A;  2JZZ A;  3TEX A;  2KDB A;  4IM2 A;  3L16 A;  2ZW1 A;  1C76 A;  1GC6 A;  3RYT A;  4MDK E;  3NOB A;  1IBX B;  1L4D B;  2DAF A;  1PFD A;  3TBL D;  4JPS A;  2KYW A;  2C7N B;  2RDH A;  4BZA A;  2B3A A;  1HZ6 A;  3IFW B;  2EKI A;  2ZCC A;  5D94 A;  4ZRQ A;  3V05 A;  2JXX A;  2MX2 A;  3QJZ A;  2NBW B;  4D71 A;  1HZ5 A;  1FM0 D;  4BOS C;  3AUL A;  1GJZ A;  4KSK C;  4DK5 A;  1A70 A;  1GB1 A;  5MPO A;  2VH2 A;  3PV1 A;  4HEA 1;  1E9M A;  3ZJT A;  1I4G A;  5C2T B;  1JWA D;  1UNS A;  4J6I A;  2NR2 A;  1MHH E;  3ZNI D;  1ZP0 B;  3P4Q B;  4REZ A;  4AUQ C;  2R2Q A;  1P7E A;  1DOY A;  2INP E;  1V2Y A;  2O2V A;  2M17 A;  3A9J A;  4IG7 B;  3ZJV A;  2WX1 A;  4TQ1 A;  3Q14 C;  4OVZ A;  1PUT A;  1L0V B;  2FUG 1;  2JY6 A;  3AE5 B;  5FKA C;  1L4Z B;  1PDX A;  2GBN A;  3PRP B;  4FAD A;  2JU6 X;  2N9P C;  4D6D A;  2KFK B;  2K8C A;  3Q3N C;  3HM3 A;  4M8N A;  2FIF A;  3AE6 B;  3BVG A;  4NAW A;  1UBQ A;  5BMG A;  4FBJ B;  3A1Q A;  1WMH B;  2DZJ A;  4C80 A;  4FUL A;  1LQB A;  4ZRJ A;  1T0S C;  3APF A;  4MT5 A;  3C19 A;  4PYZ A;  4ACF A;  1JW9 D;  2ZW0 A;  4FLH A;  1JWS D;  1VZ7 A;  4PK1 A;  3Q8F A;  1WE7 A;  2PJH A;  1L0X B;  1KFY B;  1FXA A;  1R7S A;  1ZXH A;  4PYU A;  3HUI A;  4HJG E;  2NTS A;  2KLC A;  3VAW A;  4G11 A;  4BOZ B;  1C79 A;  4GU2 A;  2Z0D B;  2WXJ A;  3A9K B;  1HTO A;  1FCC C;  2N1W A;  4ZYN A;  4WWO A;  4WQO B;  2J0K A;  1RLF A;  2WX0 A;  2JWU A;  3HHM A;  2AQ3 B;  2NPT A;  4DHJ D;  3W5V B;  3AV8 A;  2OED A;  2Z59 B;  2CS4 A;  1MHX A;  3MTN B;  1KH0 A;  4D6H A;  1P98 A;  2K25 A;  3ZLZ A;  2IYD B;  3ZTC A;  4IKG A;  4N59 A;  1A5R A;  2AL3 A;  1WY8 A;  1Q1O A;  1JQ4 A;  5DPR A;  2WQY B;  2ZPN A;  2XN9 C;  2KX3 A;  1T5X D;  4AQ7 A;  2KDF B;  4CYE A;  2LFI A;  3DBH B;  3RNF C;  4HDQ A;  4C4V A;  2LVQ A;  4W9F A;  1Q10 A;  3AN1 A;  4GSW A;  4RGO S;  4W9C A;  3MC9 A;  3Q2A C;  1F1H A;  2DYB A;  1WM3 A;  1ACC A;  1WI0 A;  3RCZ A;  4UDU C;  3NHE B;  3BK1 A;  2LJ5 A;  2EMT A;  4YSY B;  3VTW A;  3SHQ A;  4S0R A;  1HE8 A;  1WSP A;  2QMT A;  1J19 A;  3H7P A;  5LXH A;  5IN7 A;  3NVZ A;  5LLI A;  4MH0 E;  1N61 A;  5G55 A;  1PGX A;  5LNK 1;  2PE6 B;  2FCS A;  3MC8 A;  4EOY A;  1MG8 A;  2AYO B;  1HEZ E;  2J53 A;  4DXF A;  2X38 A;  5HFY A;  3N1X C;  2GBJ A;  4M0W A;  3I9V 1;  2MA9 B;  1OGW A;  1SBB B;  5G2N A;  4H2A A;  3VTV A;  3MJ5 A;  4ICV A;  4HK2 A;  1V1P A;  4LNO A;  1N6Z A;  4DXA B;  1L7Y A;  1C77 A;  5KHQ A;  4GXB A;  2BWE S;  2D11 A;  4TV3 A;  1N5W A;  3AE4 B;  1XLQ A;  3WAO A;  3CST A;  1GAQ B;  2IGH A;  3L54 A;  3ENE A;  1YJJ A;  1GPX A;  3VVW B;  2WDQ B;  3T3N A;  1E7V A;  5D3D A;  1V1O A;  5CHV C;  2WP9 B;  4G50 A;  2DZK A;  1OQR A;  1HXY D;  1E8Y A;  1WYW B;  3AE9 B;  1DOX A;  1N63 A;  1F2R I;  3Q3O C;  4IM0 A;  1WXA A;  4D6F A;  1LFD A;  2J0M A;  4I6P A;  4I6L B;  5TR5 A;  3BII D;  4GDK B;  3UIO B;  4ICU A;  3DWM A;  2INN E;  1H4R A;  3EFU A;  4M8M A;  3CIR B;  3ZXR A;  2N7J A;  4IWP A;  4WIP A;  1E8Z A;  1YN4 A;  3AMZ A;  3AEE B;  1E8X A;  2LHD A;  1TJE A;  1WYG A;  1CQV A;  2KAJ A;  4FHK A;  1SXT A;  1YQ4 B;  2L32 A;  1T0Q C;  2WMH A;  2L83 A;  3DVG X;  2KZR A;  1GNU A;  2LAS A;  3AE7 B;  4D6C A;  4A20 A;  3NVW A;  2LHE A;  3L13 A;  3NZU A;  3MJW A;  1ZE3 D;  3Q3J A;  1YIW A;  1Y56 A;  1KTK A;  1YD8 U;  3R8B A;  2JUO A;  3ZTD A;  2BWF A;  3LB8 C;  2MJE A;  3VR9 B;  1TS5 A;  3LXF A;  2NTT A;  2N9K A;  3KVF B;  3WIM A;  3RMK C;  1PGA A;  3NS1 A;  4A6Q A;  2BKR B;  2KMM A;  1YN5 A;  4MAC A;  4WJQ A;  3N9Y C;  2PW9 A;  4B9K A;  1D5M C;  4RH6 A;  3ZNG C;  1V97 A;  3GOE A;  4YT0 B;  4K81 A;  3EC8 A;  2DEN B;  3DBR I;  2V0G A;  1J0G A;  1X1M A;  4USA A;  5BYQ A;  2L76 A;  3PTF C;  1Q0W B;  5FK9 C;  2KWD A;  1RM6 C;  1L5P A;  2KWU B;  1QOB A;  2M56 B;  2K39 A;  3T9L A;  4JX1 C;  3APC A;  4W9J A;  3MHS D;  4HKZ E;  4RFB A;  3APD A;  2L00 B;  3MP9 A;  1L6U A;  1WRI A;  3P63 A;  2CKH B;  3ZGZ A;  2QDF A;  4YSX B;  3URY A;  2K22 A;  2WXO A;  3FIL B;  2JQR B;  1WX7 A;  4I6N B;  4WJO A;  2K5P A;  4WWP A;  5CTR C;  4W9E A;  1WXQ A;  4EFO A;  4FJY A;  4S17 A;  5HKH A;  2KX0 A;  1ZKH A;  2MEK A;  2HE7 A;  3PLV A;  1TS2 A;  3C8Y A;  2GBK A;  5EDS A;  1GC7 A;  4FJV B;  2MLB A;  3U30 A;  5G5G A;  2RGF A;  4BBN C;  3TCA A;  3ECI A;  2XK5 B;  2KFJ A;  3LJ3 A;  3NVY A;  2QSD A;  1J7C A;  3QQ8 B;  2IGD A;  3WA0 A;  2KC1 A;  1ZW7 A;  2GLS A;  1TKG A;  1K53 A;  1UBI A;  3Q8A A;  4NQL B;  4KKI A;  4ZRP A;  4YTP B;  1ZUD 2;  4W9D A;  3L0W B;  4XDD A;  2A5U A;  2LGY A;  4LDT B;  4WUR A;  3E56 A;  1P0R A;  3QIJ A;  3GB1 A;  2PIA A;  3RZF A;  3SDL C;  2UWQ A;  3NG0 A;  3B2G A;  1Y8R C;  3IAS 1;  2WHI A;  3HIZ A;  4LNN A;  2CJO A;  1WXM A;  3A4S C;  5D6J B;  4A9A A;  3V60 A;  5AZF A;  2LGS A;  3LYY A;  3KH0 A;  2DLB A;  3CSF A;  2J42 A;  5G5H A;  4R3D A;  2ZJD A;  3RZW C;  3VRB B;  1NVI D;  4MM3 A;  2W9N A;  1L6V A;  3R2T A;  3P4R B;  3SEB A;  2V3P A;  1TZO A;  2MJ3 A;  4JWU C;  2NBU A;  2WMJ A;  1JML A;  3PT2 B;  1ZDV A;  2OJW A;  1TIF A;  2VRR B;  4NJ7 A;  1RRB A;  2GOW A;  4OZB A;  4A55 A;  4LNF A;  2KQ7 A;  1YOV B;  2VZK D;  3QAQ A;  2KDM A;  3B0A A;  1SJH D;  4KGR A;  1NEK B;  2JSV X;  4ANV A;  1J7B A;  2BPS A;  1U4A A;  4OW0 A;  1QF6 A;  2BS4 B;  4HPM B;  2B76 B;  4AOF A;  3AU5 A;  4P6V F;  5IAA C;  2ZCB A;  3EGR A;  1XT9 B;  2O6V B;  2LEK A;  1G6J A;  3Q8B A;  3I3T B;  4EKU A;  2W55 A;  2WWZ A;  3ML9 A;  3FKY A;  4AWJ A;  2WXI A;  1K51 A;  2WMK A;  2D10 A;  2JZP A;  5JHB A;  3WAP A;  4MEM A;  3BWU D;  4XGA B;  1FRR A;  1C9F A;  2E6X A;  4HKQ A;  2KO3 A;  5IOI A;  1ET6 A;  2DYO A;  4AJY B;  1E90 A;  5IA7 A;  2BBC A;  1NYQ A;  4KZ0 A;  3RUI B;  2BB6 A;  2WMF A;  1D6E C;  4NJ6 A;  2W82 A;  4NPN A;  4XWW A;  2D07 B;  1GUA B;  3N30 A;  4ZDV A;  1CJE A;  3TEY A;  2WGS A;  1WX8 A;  2MBQ A;  1N60 A;  1Z2M A;  2BQQ A;  1V81 A;  2PMV A;  4WWM A;  1L2N A;  4BVU C;  1IGD A;  3QK0 A;  2JF5 A;  3KUZ A;  2KJH B;  1NEN B;  2WXF A;  4KX6 B;  3IHP C;  3ZJU A;  1MJD A;  1R4M I;  3U2S C;  4L2Y A;  2J7Q B;  1MG4 A;  1YMH E;  3E9S A;  3JSV A;  1WZ0 A;  3GZN B;  5JH5 C;  1EUV B;  3VHT C;  1O0S A;  3L10 B;  4WAF A;  3VH4 B;  1OQY A;  2CU1 A;  3RN9 C;  3AED B;  2LGI A;  2OOB B;  5E6O A;  4K1R B;  1E10 A;  1QIL A;  1SEB D;  3BZD B;  3VDZ A;  3OWE B;  4LCD E;  2C7M B;  3U8Z A;  4N58 A;  3NVV A;  3DBL I;  1T0R C;  4LTU A;  4YTN B;  4WAA A;  1XQQ A;  2K8B A;  1IYF A;  2C60 A;  4RF0 A;  3RNG C;  1ZPS A;  1IP9 A;  3LDZ E;  1XCQ L;  3CF6 E;  4MGZ E;  3DOW A;  2FCM A;  1CK1 A;  4LNK A;  3P2B A;  4JLC A;  4DWF A;  2KDI A;  1D3Z A;  2D3C A;  2NVU I;  1ET9 A;  3A4R A;  1R4N I;  3GS2 A;  2M19 A;  1WZ3 A;  2WLB A;  1EU3 A;  1XLP A;  3OJ4 B;  2E3T A;  2VH1 A;  2YEP B;  4RM9 A;  4LJP B;  1J8C A;  2IY0 B;  2N9E B;  2QHO A;  1WX9 A;  3P42 A;  1ZOY B;  4JIO U;  3Q3F A;  3IXS A;  1KF6 B;  3DHH C;  4WH4 A;  2KMA A;  4ZHO A;  1UGM A;  1H8C A;  4ZOH C;  2KWC A;  2MBB B;  5DCN A;  3V6E B;  1SJE D;  3ZO5 B;  4KGS A;  3PPA A;  4GDL A;  2LD9 A;  2L3Z A;  2D3A A;  1UH6 A;  1ESF A;  4K7S A;  2QEJ C;  4D6J A;  5AEK B;  3AM9 A;  1SIF A;  2V1Y A;  3IG3 A;  1YN3 A;  4DDG D;  2WMI A;  2RSU A;  4W9I A;  2XBB C;  1TYG B;  2CU3 A;  3ALB A;  3ZIM A;  3FC4 A;  1WWT A;  2BKF A;  1C4C A;  2LWP A;  3Q8C A;  5E6N A;  3I57 A;  5IKC M;  2QC8 A;  2BS3 B;  1C3T A;  3OLM D;  2KNB A;  2KKC A;  1TS3 A;  4PT5 A;  2KTR A;  2WDT B;  2DX5 B;  3H9D A;  2O2V B;  1PGB A;  3A9J B;  2WU2 B;  4MJS A;  1C1Y B;  3X0W A;  4E71 A;  2WYQ A;  2N9X A;  1C4A A;  2L0F A;  3W9C B;  3KW5 B;  1MPE A;  1FCL A;  1KM7 A;  5JXV A;  2JRH A;  2IBI B;  4X57 B;  4RMA A;  1UZX B;  4GIV A;  2R2O A;  1TT5 B;  1OFF A;  3FAH A;  5HI1 A;  2LUM A;  1RYJ A;  1AAR A;  3DHI C;  3KWL A;  1XLO A;  2LVO A;  4NAW B;  1GB4 A;  3KLS X;  3A1Q B;  2KJR A;  5JZE B;  3DVG Y;  1KLG D;  2ZVO A;  4C7Y A;  3UQA A;  1TBE A;  4TQ0 A;  3DBS A;  1I4H A;  1SE2 A;  2LJI A;  1SE9 A;  1OTR B;  1YQB A;  2K9X A;  2BGF A;  1TY0 A;  3P4S B;  4MGI E;  3W1Y A;  2Y5B B;  2KTF A;  4KIK A;  5TSS A;  4B95 A;  1VLB A;  4XZ4 A;  3BYY B;  1N62 A;  4GB9 A;  1D5Z C;  3A33 B;  4ZRK A;  1WIA A;  2IY1 B;  4KV2 A;  4BFR A;  2FID A;  1F0Z A;  3VFK A;  3IT4 B;  3RNE C;  2IDY A;  2CJN A;  2RDB C;  2FE8 A;  4WJP A;  2UU7 A;  1WM2 A;  3P4P B;  5E6P A;  3R66 C;  3V61 A;  3UI3 A;  3X23 A;  2M4N A;  2NPT B;  4N6E B;  2WU5 B;  1LXD A;  2M0A A;  2SAK A;  5GMV A;  5L95 C;  5JHA A;  1S1Q B;  4XX5 A;  4M02 A;  1FO4 A;  2KT7 A;  1SGH A;  2D3B A;  2QCZ A;  2GRI A;  3IBE A;  4FHJ A;  3UIP B;  1EWC A;  1P1A A;  4DQO C;  1WGK A;  3W1S C;  3AEF B;  1ENF A;  4C4V B;  1JAL A;  4ZRI A;  2JYT A;  2KN4 A;  2IND C;  4HWI B;  2W3R A;  5FR6 A;  2H89 B;  4W9G A;  2MW5 A;  3DWG C;  4HRO A;  3AXC A;  5J2R A;  2BTE A;  1SE4 A;  3TL5 A;  2RDG A;  3QCA A;  3PS6 A;  1NI2 A;  3ZW3 A;  2AEH A;  3EUB 2;  4N9F 4;  3H7P B;  4W9K A;  4EZJ A;  2NMQ A;  3EEC A;  2M1M A;  1WJN A;  1SF0 A;  1KOT A;  4B6W A;  2AQ2 B;  2W54 A;  3HM6 X;  2AQ1 B;  1WGH A;  1UUP A;  2I1K A;  3Q69 A;  2AX5 A;  1LLQ A;  4F7Z A;  3GE3 C;  2D2Q A;  3N1Y C;  4HPP A;  3AE1 B;  3AEB B;  3H7S A;  4EUT A;  4OVU A;  4M0W B;  2QJL A;  3WAL A;  4D6G A;  2QIL A;  1FEH A;  2MP2 A;  3R7R A;  3M3J A;  1V1P B;  2WXM A;  2BB5 A;  2WNM A;  2I38 A;  1T3Q A;  2D5G A;  1IGC A;  4AP4 C;  2RD0 A;  5EE0 A;  3VUW A;  1LO5 D;  2LXC A;  1FXI A;  4F8C B;  1YQ3 B;  1V80 A;  1P9D U;  1KJT A;  2KMC A;  1EF1 A;  4TSS A;  4ITK A;  4MEL A;  4GGQ A;  2PLP A;  3N1Z C;  5CHW A;  4GMV A;  4NJC A;  2AL6 A;  3RPF C;  1GG3 A;  3V6C B;  1B9R A;  1FIQ A;  3DCG A;  5EE1 A;  1JWM D;  2CHW A;  1TGZ B;  2HJ1 A;  2OHF A;  5DPS A;  2LUE A;  1VR9 A;  1FNW A;  1LM8 B;  3WCQ A;  4HDO A;  2Y5C A;  4IW0 A;  3PO0 A;  1IBX A;  1XCT L;  3Q6B A;  4KVG B;  2G45 B;  1I7H A;  3KQ4 A;  2V4I B;  1FNU A;  2NBV B;  3GE8 C;  1HTQ A;  4MSM B;  2KN5 A;  4RGN A;  4G3X B;  4URK A;  1MVK A;  3DBR B;  3T8M A;  1KRH A;  1SE3 A;  2MH7 A;  4LDT D;  4EZK A;  3J9C A;  3IT6 B;  3CMM B;  3VUY A;  2WXR A;  3UIN B;  2AWT A;  4KZC A;  3RNB C;  2WXL A;  2GBM A;  1I42 A;  3K9P B;  4ZYS A;  5DPW A;  2K8H A;  4MGY E;  3SFE B;  3VQI A;  2SEB D;  4OVV A;  4LK0 M;  5DPT A;  4A3P A;  4JL9 A;  4Q2J A;  2LZ6 A;  3PRZ A;  1MI0 A;  1WGD A;  2WXN A;  3JVZ X;  3PHX B;  4II2 B;  4JWS C;  2DZI A;  3AEG B;  3IAM 1;  4GOC A;  3JW0 X;  1V86 A;  1VZ8 A;  2IO1 B;  2LXA A;  2BYF A;  3V62 A;  1V5O A;  3VH3 B;  5LXI B;  1BML C;  2KFK A;  3RT3 B;  2DBY A;  2XEW A;  2FNJ B;  3M62 B;  2DWQ A;  3OG5 A;  5T8I A;  3UGB B;  2EEL A;  1QOG A;  2N7E A;  1I4P A;  4MSQ B;  1XO3 A;  1K50 A;  4XE0 A;  1I4Q A;  4C7Z A;  5L83 A;  1UWX A;  1WMH A;  3ZNZ B;  1F2R C;  3PGE A;  1WJ4 A;  2WDR B;  3DDC B;  3GP7 A;  3AB5 A;  4FXC A;  3VXW A;  1TKY A;  2O6V D;  1RWS A;  1TY2 A;  3H8H A;  4M01 A;  3B1L X;  3ZRC A;  3R2I A;  4XWT A;  5GXG B;  1ZXI A;  4K7W A;  4EE2 A;  2BF8 B;  5E6J A;  4KDI C;  3HVZ A;  3QHT A;  2Z0E B;  1OQQ A;  2MBO A;  1AW7 A;  1ROE A;  2BVC A;  3ZNH B;  4YXD B;  4BBN F;  1DOI A;  4BKS D;  5J17 A;  4NNJ B;  1FFU A;  1T0Y A;  3JYU A;  3PZ7 A;  2ACZ B;  4YL8 A;  3R3M A;  4HXD A;  4US9 A;  1V49 A;  3A9K A;  3NJT A;  1BUI C;  2L1A A;  3I63 C;  1VCB A;  2V3S A;  2YLM A;  4A8X C;  2WXH A;  2EKE C;  3PRM B;  1FD6 A;  2V9H A;  4DBG A;  1ISN A;  2GBR A;  1FXT B;  3PHW B;  1K8R B;  1T6B X;  3W1S A;  4P1C C;  1JWB D;  3QAR A;  4ARC A;  3NZ3 A;  1B1Z A;  2W3S A;  3VR8 B;  4L23 A;  4E3C A;  4NQK E;  2ZVN A;  4NY0 A;  5H92 C;  3BVM A;  4OHJ A;  2PPH A;  1SSN A;  2KD0 A;  4IUM B;  4DHZ B;  5IO9 A;  3NZS A;  2DAJ A;  1OEY A;  1YJI A;  5C23 A;  4HLE A;  2ONQ A;  1UF0 A;  3I5J C;  4OZA A;  1AWD A;  3TUO A;  1WGR A;  4MM3 B;  1TKE A;  3C0R B;  3UF8 A;  1C4P A;  1TS4 A;  3EHV A;  1YNT E;  5AUI A;  2JYE A;  1RFK A;  1JRO A;  4JE3 B;  3ZQ4 A;  2ICI A;  3VTU A;  3K9O B;  3NUH B;  2G4S A;  1IUE A;  5H8Y E;  2FUH B;  5AZG A;  1XEE A;  2KQS A;  3DQV A;  1XD3 B;  1XLN A;  2LGD A;  2G9H D;  1WGY A;  2LMC A;  4WJN A;  2KK8 A;  5BMI A;  5BMH A;  4AS1 A;  3DBH I;  1YJ1 A;  2L8J A;  3AEC B;  1E8W A;  2JVC A;  1WE6 A;  2L7R A;  3L08 A;  3AEA B;  4LLG M;  3V3X A;  4M00 A;  3N32 A;  1EM7 A;  4HCN B;  1RAX A;  3RNA C;  4TKN A;  3Q8E A;  1I4R A;  5CHF A;  1TZ1 A;  3R7Q A;  3PSE B;  3ZDT A;  1ZDX A;  5D2M B;  1VRA B;  1WR1 A;  1VDV A;  1D5X C;  3KYD D;  2KWV B;  4II3 B;  3U7D A;  1WF9 A;  2Y5P A;  1WJ6 A;  3PZ8 A;  1WGG A;  3OJ3 A;  1M94 A;  2ON8 A;  2IO0 B;  4DDI D;  1R4M B;  2CHX A;  3WAN A;  2HD5 B;  1F77 A;  4YWG G;  2LVP A;  3U7Z A;  1VZ6 A;  1V9J A;  2YVC A;  1L0Y B;  2MBH A;  2C9W B;  1XF5 L;  3TEW A;  2OJR A;  3DVN V;  4DHJ B;  3N3K B;  1AN8 A;  2PE9 A;  3TSS A;  4BKG A;  3O65 B;  4GDK A;  4K7U A;  3AE8 B;  4WWN A;  4BKT A;  3EA6 A;  4FJZ A;  2J4X A;  3SD5 A;  3ZRF A;  3PRE A;  3EFC A;  2V3N A;  1VJK A;  3IVF A;  4GN1 A;  2KAN A;  3DBL B;  2BYV E;  2J0J A;  4HJK A;  1UEL A;  4B0M A;  2MSE D;  1I35 A;  1M4V A;  4PS8 A;  3Q3M C;  3JSV B;  3N20 C;  3ZXV A;  2TSS A;  3HVD A;  4CHK A;  4JGH B;  4W9H A;  1F52 A;  2KVZ A;  5KHO A;  2ZEQ A;  3VUX A;  1Q5W B;  3M63 B;  1FRD A;  1R4N B;  1UGJ A;  4IWQ A;  4D6E A;  1FPY A;  2GB1 A;  4HVB A;  3T3O A;  4F1S A;  4RF1 A;  1STE A;  2PEA A;  3U4E G;  3W5U B;  2KXJ A;  4GLS C;  4JQW C;  1LGR A;  5BYS A;  3ZYY X;  2KQ4 X;  2BYE A;  2KHW B;  4NZL B;  5D3I B;  3ONS A;  4L1B A;  5C1Z A;  3ETR A;  1KLU D;  3RI7 C;  1QT9 A;  1QZE A;  4BAX A;  1WXS A;  3U52 E;  2PKO A;  2HDE A;  3PZD A;  4EZL A;  2MBE A;  2KOX A;  2PVG C;  3RUL A;  1F9J A;  1KLV A;  3DHG C;  3BYT B;  3QWZ B;  2L05 A;  4IOI E;  3CWI A;  2DZM A;  3KWV A;  4G0N B;  3NS8 A;  2MRP A;  2K3U A;  3SU8 X;  1V8C A;  2MCN B;  2HTH A;  4KKJ A;  3ZDM C;  2IJ0 A;  4DXG A;  4RGM A; 
#chains in the Genus database with same CATH homology
 1L0X B;  1KFY B;  4B0E A;  1J7A A;  1FXA A;  1R7S A;  4MH8 A;  1SB3 C;  2JZP A;  1ZXH A;  3FIL A;  2Z8L A;  3HUI A;  2PLP A;  4HJG E;  3NRZ A;  4NJC A;  3BWU D;  3RPF C;  1FRR A;  2NTS A;  1B9R A;  1C9F A;  1FIQ A;  1FNV A;  5FR3 A;  1C79 A;  2E6X A;  4HKQ A;  5EE1 A;  1QKZ A;  1JWM D;  2OHF A;  4GDL B;  1ET6 A;  2DYO A;  1HQR D;  2Q5W D;  2WXJ A;  3MFG A;  1FCC C;  2BBC A;  2HTM E;  1NYQ A;  2BB6 A;  1VR9 A;  1FNW A;  2WDV B;  1D6E C;  3AE3 B;  2W82 A;  4XWW A;  4OZC A;  2JWU A;  2AQ3 B;  3WCQ A;  1CJE A;  2Y5C A;  3TEY A;  3W5V B;  3SR6 A;  3PO0 A;  3AV8 A;  1IBX A;  2OED A;  1MHX A;  1XCT L;  3L4P A;  1KH0 A;  4C56 C;  1N60 A;  4HRS A;  5EE9 A;  1I7H A;  1QOF A;  2V4I B;  3KQ4 A;  2PMV A;  4WWM A;  1FNU A;  4IKG A;  1NYR A;  1IGD A;  1PYW D;  1NEN B;  4N59 A;  1NI3 A;  2WXF A;  4KX6 B;  4TMA B;  1E6E B;  2BT6 A;  3ZJU A;  4RGN A;  1JQ4 A;  1DYQ A;  3U2S C;  2WQY B;  1E0Z A;  4L2Y A;  1MVK A;  2GI9 A;  2XN9 C;  4YTM B;  1YMH E;  1KRH A;  1SE3 A;  2DYM A;  1T5X D;  2MH7 A;  4AQ7 A;  3J9C A;  3IT6 B;  1QOA A;  2LFI A;  2RPV A;  3E9S A;  1Q10 A;  3TEZ A;  1JWU D;  2WXR A;  3AN1 A;  3HRD D;  5EE3 A;  4RGO S;  3BVZ A;  2WXL A;  4NAM A;  4WAF A;  4WQM A;  4ZYS A;  2H88 B;  3AED B;  3SFE B;  2LGI A;  2MJD A;  3VQI A;  2SEB D;  1ACC A;  2L52 A;  4LK0 M;  4UDU C;  4IDI A;  1E10 A;  1QIL A;  3BK1 A;  1JRP A;  1SEB D;  3BZD B;  4YSY B;  3OWE B;  4Q2J A;  1MI0 A;  2WXN A;  4N58 A;  3NVV A;  1WSP A;  2QMT A;  4JWS C;  4LTU A;  4YTN B;  2WXP A;  2PVO D;  3NVZ A;  1N61 A;  2N0S B;  3AEG B;  3IAM 1;  1PGX A;  5LNK 1;  4RF0 A;  1VZ8 A;  1ZPS A;  4J3O D;  1XCQ L;  1BML C;  1HEZ E;  2BW2 A;  2DBY A;  2J53 A;  4RCO A;  1BXT A;  1CK1 A;  2DWQ A;  5T8I A;  4DXF A;  2EEL A;  2X38 A;  5HFY A;  1QOG A;  1I4P A;  4M0W A;  1XO3 A;  3I9V 1;  1SBB B;  1ET9 A;  1K50 A;  4XE0 A;  1I4Q A;  4C7Z A;  2I2Y A;  4H2A A;  1UWX A;  3GS2 A;  2M19 A;  3MJ5 A;  2K0P A;  1F2R C;  1V1P A;  2WLB A;  1GOZ A;  1C77 A;  2WDR B;  1EU3 A;  1XLP A;  3GP7 A;  3AB5 A;  2WS3 B;  1N5W A;  2E3T A;  4FXC A;  3AE4 B;  1TKY A;  1RWS A;  2G1E A;  2YEP B;  4YSZ B;  1XLQ A;  1TY2 A;  3H8H A;  1EWY C;  2YEP F;  3P42 A;  1ZOY B;  3R2I A;  4XWT A;  1GAQ B;  2IGH A;  5GXG B;  3IXS A;  1KF6 B;  1YJJ A;  1ZXI A;  4EE2 A;  1GPX A;  4WH4 A;  5E6J A;  2WDQ B;  3T3N A;  3HVZ A;  5D3D A;  1OQQ A;  1V1O A;  4ZHO A;  1AW7 A;  1ROE A;  4YXD B;  2WP9 B;  4ZOH C;  1DOI A;  1OQR A;  1HXY D;  1FFU A;  3PZ7 A;  2ACZ B;  4P16 A;  3AE9 B;  1DOX A;  1N63 A;  1F2R I;  1SJE D;  4US9 A;  4KGS A;  1JCK B;  1K52 A;  3SFD B;  1BUI C;  1ESF A;  2QEJ C;  3BII D;  4GDK B;  2L1A A;  3DWM A;  2INN E;  3AH7 A;  3AM9 A;  3CIR B;  4A8X C;  2WXH A;  1YN3 A;  3MHZ A;  2N7J A;  1QLB B;  4WIP A;  1YN4 A;  3AMZ A;  3AEE B;  1FD6 A;  4US8 A;  2LHD A;  5BYR A;  1TJE A;  1WYG A;  1N5X A;  1TYG B;  1CQV A;  2KAJ A;  2CU3 A;  2QIE B;  3FC4 A;  1WWT A;  1C4C A;  3Q8C A;  2KAC A;  1SXT A;  1T6B X;  3I57 A;  3W1S A;  1JWB D;  1YQ4 B;  2L32 A;  3MC0 B;  4ARC A;  3NZ3 A;  1B1Z A;  2RMM A;  2W3S A;  3VR8 B;  4L23 A;  2L83 A;  2BS3 B;  3AE7 B;  3NVW A;  2LHE A;  5H92 C;  3BVM A;  4OHJ A;  1TS3 A;  1SSN A;  2XNA C;  4A90 A;  1ZE3 D;  2BYT A;  1Y56 A;  1YJI A;  1I4X A;  4PT5 A;  1D4B A;  1KTK A;  1SIJ A;  2BS2 B;  1PGB A;  2JX5 A;  2WU2 B;  3R8B A;  2ONQ A;  4OZA A;  5I4D A;  1AWD A;  1FFV A;  2MJE A;  3LB8 C;  3TUO A;  4MM3 B;  3VR9 B;  1TS5 A;  1C4A A;  1TKE A;  2PTL A;  3W9C B;  3W2D A;  3LXF A;  1C4P A;  1TS4 A;  2J52 A;  1MPE A;  2NTT A;  1FCL A;  1YNT E;  2N9K A;  5AUI A;  2JYE A;  1RFK A;  1PGA A;  3NS1 A;  1JRO A;  4A6Q A;  4JE3 B;  3ZQ4 A;  2ICI A;  1HA5 A;  2KMM A;  1YN5 A;  4MAC A;  5JXV A;  3N9Y C;  2PW9 A;  3NUH B;  1IUE A;  2VZK B;  1D5M C;  5H8Y E;  1XEE A;  4RH6 A;  5D7G A;  1XLN A;  1V97 A;  1E7P B;  2G9H D;  1UWM A;  3FAH A;  1OFF A;  4YT0 B;  5HI1 A;  2LMC A;  2IGG A;  2LUM A;  5BMI A;  4RNA A;  5BMH A;  1RYJ A;  4D2K A;  2V0G A;  3KWL A;  4USA A;  1XLO A;  5BYQ A;  4AS1 A;  5HG2 A;  1AYF A;  4NAW B;  1GB4 A;  3KLS X;  3AEC B;  5FK9 C;  2KWD A;  1RM6 C;  1L5P A;  1KLG D;  1QOB A;  3AEA B;  4LLG M;  2M56 B;  4C7Y A;  3V3X A;  3RFZ B;  2WXG A;  4JX1 C;  1C78 A;  4HKZ E;  4ARI A;  1EM7 A;  4TQ0 A;  4KGT A;  4RFB A;  3Q8E A;  1FMA D;  1I4H A;  1I4R A;  2JXT A;  1SE2 A;  2LJI A;  3MP9 A;  4O1N A;  5HHD G;  2FBW B;  2R61 A;  1L6U A;  4RGT A;  5AUK A;  1WRI A;  1XXG A;  3P63 A;  1ZDX A;  2K9X A;  1DGJ A;  1TY0 A;  1VRA B;  1P7F A;  1VDV A;  1D5X C;  2IPK D;  3P4S B;  4XDC A;  3AE2 B;  3ZGZ A;  4YSX B;  3URY A;  3VRA B;  2Y5P A;  2K22 A;  5TSS A;  2WXO A;  3FIL B;  3PZ8 A;  2JQR B;  3BK2 A;  1VLB A;  3BYY B;  1N62 A;  2K5P A;  1D5Z C;  2ON8 A;  1CZP A;  1WXQ A;  2Y3A A;  1F0Z A;  2MEK A;  1F77 A;  4YWG G;  3IT4 B;  4ZHP A;  3B2F A;  3U7Z A;  1VZ6 A;  2IDY A;  3P1M A;  1EU4 A;  2CJN A;  5C3J B;  3ABV B;  1L0Y B;  1TS2 A;  3C8Y A;  2FE8 A;  4CQN A;  1QQR A;  1XF5 L;  3O13 A;  2N9L A;  3TEW A;  3P4P B;  3B9J A;  5G5G A;  1AN8 A;  2WXK A;  3TSS A;  2WXQ A;  3UI3 A;  3NVY A;  3TEX A;  2QSD A;  1J7C A;  2IGD A;  2ZW1 A;  1C76 A;  4N6E B;  2WU5 B;  2M0A A;  1IBX B;  1TKG A;  1L4D B;  1K53 A;  2SAK A;  3AE8 B;  1PFD A;  3EA6 A;  2J4X A;  3Q8A A;  4JPS A;  4KKI A;  4ZRP A;  2V3N A;  4YTP B;  1ZUD 2;  2RDH A;  1VJK A;  1HZ6 A;  1FO4 A;  4XDD A;  2EKI A;  2GRI A;  4WUR A;  3E56 A;  1EWC A;  4ZRQ A;  3V05 A;  4DQO C;  4B0M A;  1WGK A;  3GB1 A;  2PIA A;  3AEF B;  1ENF A;  1M4V A;  1HZ5 A;  3B2G A;  1FM0 D;  1JAL A;  1A70 A;  3IAS 1;  1GB1 A;  5MPO A;  4HEA 1;  2JYT A;  2KN4 A;  1E9M A;  2TSS A;  3HVD A;  3ZJT A;  2CJO A;  1I4G A;  5C2T B;  1JWA D;  1UNS A;  4A9A A;  1MHH E;  2W3R A;  3LYY A;  1ZP0 B;  2H89 B;  3P4Q B;  4REZ A;  1P7E A;  2DLB A;  3DWG C;  4HRO A;  1FRD A;  1DOY A;  2INP E;  1UGJ A;  2J42 A;  5G5H A;  4R3D A;  2BTE A;  2GB1 A;  1SE4 A;  3VRB B;  1NVI D;  3ZJV A;  2RDG A;  4TQ1 A;  3T3O A;  4RF1 A;  1STE A;  1L6V A;  3R2T A;  3P4R B;  4OVZ A;  2V3P A;  1TZO A;  2MJ3 A;  4JWU C;  3SEB A;  3U4E G;  1PUT A;  3W5U B;  3EUB 2;  1JML A;  1L0V B;  1ZDV A;  2FUG 1;  2NMQ A;  4GLS C;  3AE5 B;  1SF0 A;  5FKA C;  1L4Z B;  4OZB A;  1PDX A;  2AQ2 B;  2W54 A;  5BYS A;  2AQ1 B;  2JU6 X;  1UUP A;  4A55 A;  3ZYY X;  2KQ4 X;  3Q69 A;  4NZL B;  5D3I B;  2AX5 A;  4L1B A;  2VZK D;  3ETR A;  1KLU D;  2KDM A;  1SJH D;  4KGR A;  1QT9 A;  1NEK B;  2JSV X;  3AE1 B;  3AEB B;  3AE6 B;  3U52 E;  1J7B A;  2PKO A;  2HDE A;  3BVG A;  4OW0 A;  2QJL A;  1QF6 A;  2BS4 B;  5BMG A;  2QIL A;  2B76 B;  1FEH A;  4P6V F;  2PVG C;  3EGR A;  1V1P B;  2WXM A;  3BYT B;  2BB5 A;  2WNM A;  4C80 A;  2LEK A;  4IOI E;  3CWI A;  3KWV A;  3Q8B A;  2I38 A;  1T3Q A;  2D5G A;  1IGC A;  5EE0 A;  1LO5 D;  2W55 A;  4MT5 A;  2K3U A;  1FXI A;  1V8C A;  1JW9 D;  2ZW0 A;  2WXI A;  1K51 A;  1YQ3 B;  4KKJ A;  1JWS D;  1VZ7 A;  2IJ0 A;  4DXG A;  4TSS A;  4RGM A;  3Q8F A;  4ITK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...