2YEPF

Structure of an n-terminal nucleophile (ntn) hydrolase, oat2, in complex with glutamate
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
212
structure length
197
Chain Sequence
TLLTFFATDARLDPAEQDRLFRRVMDRTFNAVSIDTDTSTSDTAVLFANGLAGEVDAGEFEEALHTAALALVKDIASDGEGAAKLIEVQVTGARDDAQAKRVGKTVVNSPLVKTAVHGCDPNWGRVAMAIGKCSDDTDIDQERVTIRFGEVEVYPPAEHLRGDEVVIGIDLAIADGAFTVYGCDLTEGYVRLNSEYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biochemical Analyses Reveal How Ornithine Acetyl Transferase Binds Acidic and Basic Amino Acid Substrates.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Transferase
molecule keywords GLUTAMATE N-ACETYLTRANSFERASE 2 ALPHA CHAIN
total genus 74
structure length 197
sequence length 212
ec nomenclature ec 2.3.1.35: Glutamate N-acetyltransferase.
pdb deposition date 2011-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.340 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2yepF02
3.30.2330.10 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold arginine biosynthesis bifunctional protein suprefamily 2yepF01
3IT6B 3IT4B 2VZKB 2YEPB 2VZKD 2V4IB 1VZ7A 1VZ6A 1VRAB 2YEPF 1VZ8A
chains in the Genus database with same CATH superfamily
4A9AA 3WAMA 2WXJA 2D11A 4MDKE 3KQ4A 1EU4A 3ZLZA 3QA8A 1WMHA 4HJGE 5IP4D 3MTNB 5E6OA 3ZVVA 5DCNA 1YOVB 2LRWA 3WA0A 2VZKB 3NS1A 3PRMB 5HG2A 3TEWA 2NMQA 1SE9A 1LXDA 1V81A 2DZKA 2L7RA 2Q5WD 1WSPA 3ZDMC 5JZEB 2KWVB 3MJWA 2IO2B 1C1YB 4EZKA 2DYOA 4ASWC 1PUTA 3AECB 2Z0EB 3L4PA 4KSKC 4M01A 2AL6A 2BBCA 4MH0E 4QAYA 3ZTDA 4NAMA 4I6LB 1L2NA 4UDUC 1OEYA 1FIQA 4MELA 3ECIA 4L23A 2PEAA 3AU4A 3U2SC 3HM3A 2N7EA 5AUKA 1YJ1A 4II2B 4KKJA 4IOIE 2J52A 4K7WA 2X38A 1T5XD 3L10B 2BYTA 2RDHA 1WZ3A 2V3NA 5EE9A 4S0RA 4M0WA 3AEEB 2JPHA 3L17A 3R66C 1WF9A 4YSYB 2KDFB 4WWOA 2EMTA 2ZJDA 3I57A 4OVZA 2IYDB 3Q3MC 1VZ8A 1FXIA 1YN4A 2MW5A 2X8XX 4W9DA 3T3NA 5G55A 1WGYA 4ZHOA 2ON8A 1JWBD 4JL9A 2M19A 2NR2A 1XXGA 1AN8A 2JXXA 3HHMA 4EZJA 2H89B 3Q3FA 2KQSA 3TMPB 4LTUA 3FAHA 2K6QA 3EA6A 1STEA 2BF8B 1IGDA 4K3CA 2FUG1 2SEBD 2M8SA 4G50A 4E71A 1V1PA 3RYTA 2INDC 4LLGM 1ZUD2 2JU6X 1ISNA 3WALA 4I6NB 3RULA 1WFYA 1UF0A 2FCMA 3ZUNA 2WLBA 2WYQA 1L0XB 3Q3JA 3AMZA 2W82A 3ML9A 4RGTA 1M94A 1WXVA 3ZKJC 2XEWA 2AL3A 5IA7A 1E8XA 3KYCD 3DBRB 2QSDA 3ZRCA 1J8CA 1WYGA 3QQ8B 5G2NA 1YD8U 1C78A 4MGIE 2N1VA 2RR9A 1WJNA 2PE9A 1UELA 2I2YA 2KO3A 2KD0A 1ZPSA 3AM9A 3RN9C 4RGNA 3ZXRA 4Q2JA 2RPQA 3CF6E 4FXCA 3VUWA 4IM0A 1TT5B 3ZJUA 2D2QA 2Y5BB 4MGYE 1E9MA 5HHDG 4W9GA 4D6EA 3N9YC 3DPDA 4BOSC 1QOAA 1GC7A 2KN4A 2BVCA 2IBIB 4KSLC 3VR8B 2MJEA 4ZRIA 2LD9A 2XK5B 2INNE 2JUOA 1VZ7A 4D6JA 2LHEA 3KUCB 3U7ZA 1C3TA 3A1QB 3U8ZA 4G3XB 2I38A 3BVGA 3Q6BA 1GG3A 2IGHA 1WMHB 1AYFA 4ZRJA 3FILA 1QILA 3PZ8A 5HI1A 3MHSD 4EE2A 1RLFA 2ZNVC 2IO3B 1RFKA 3ZNHB 3RMKC 4M00A 2PIAA 1EWCA 4ANVA 2LFIA 2WXRA 4EEWA 1A5RA 3W9CB 1LO5D 1N63A 2IY0B 3I9V1 2QILA 4FN2A 3B0AA 3BY4B 2MBEA 2L8JA 1UUPA 2VRRB 4DHZE 1FEHA 3IAS1 3MFGA 1YX5B 4TQ1A 2GBNA 2LVQA 2RDGA 3H1UA 3AE9B 2GMIC 1QOFA 1ZGUB 2L83A 4BZAA 3H8HA 1TY0A 3RNAC 4J3OD 2N4FA 1C4PA 2ZW1A 4MSQB 1ZDVA 2INCC 4CHKA 4KDLB 2BTEA 2KJ6A 4K7SA 1PDXA 1Q5WB 3KWVA 1HXYD 3SEBA 2FUHB 3NRZA 2Z59B 2DWQA 2VZKD 5CHVC 2KX0A 2KT7A 1RM6C 2ZVNA 3FC4A 1VLBA 1PGBA 3NVZA 3VUYA 1OQRA 1YJIA 5BMHA 2JWZA 3Q8EA 1QT9A 2KOXA 3MC0B 1MJDA 2WDRB 2QJLA 1K52A 1TS2A 3EFUA 3PS6A 3DCGA 1AWDA 1E8ZA 1WRIA 2EELA 2IO1B 2HTHA 5FR6A 4RF1A 4A55A 2LGYA 5LXHA 3Q8CA 3GE3C 4P1BC 3E56A 1Z2MA 3Q3OC 1R4MI 4IWOA 1QOBA 1TY2A 3IXSA 3LYYA 4GDKB 3URYA 4IM3A 3NZUA 2JRIB 1Y56A 1ZDXA 1I4GA 3N32A 2LEKA 2M0XA 3DBLB 2W9NA 2WGSA 4YSXB 3DVGX 2L3ZA 1V1PB 4LCDE 3GZNI 3OG5A 4C00A 2N9XA 1KJTA 2LUEA 2SAKA 4C4VB 1WRDB 4LJOB 2YEPF 1KM7A 4BKGA 1IUEA 1HE8A 2QMTA 1MI0A 2ZPYA 3RNBC 3CSTA 4KGSA 3P4PB 4W9CA 3ABVB 4FJYA 1C77A 4RH6A 1CJEA 2G4SA 1CQVA 2WDTB 1ZE3D 3PHXB 4WIPA 3VAWA 4HPLB 4JX1C 3P42A 3D32A 2NPTB 2MJ3A 2JZPA 2KFKB 3DOWA 3IFWB 2GLSA 1ET9A 3PPAA 3APCA 3QC8B 3T8MA 3UQBA 5BO4B 1FCCC 1B1ZA 5C1ZA 3Q8FA 4JWSC 2KDEB 1CK1A 3RPFC 3GOEA 3GS2A 4W9LA 3VVWB 1WGDA 3UQAA 3V61A 1VCBA 2FIFA 4NAWA 1WI0A 4JQWC 2IPKD 2WP9B 2KKCA 3A9JB 3AE8B 2G9HD 3B1LX 4WJQA 3OWEB 4OHJA 4MEMA 1TS5A 4AS1A 1GPXA 1JCKB 2GRIA 2L05A 3N3KB 4HLEA 2NBVB 2K5PA 2N9EB 2WXNA 2CHZA 1FFUA 1V80A 4PYZA 3PREA 4GXBA 4WJPA 3AU5A 2INPE 4MSMB 4TKNA 4DQOC 2FAZA 3UINB 1I4RA 2W3RA 4CYEA 1VRAB 4MJSA 2KC1A 5J17A 3OJ4B 1LGRA 5FR3A 2JX5A 3BVMA 3QCAA 3RZWC 4GGQA 2QIEB 2IJ0A 1D5XC 4M0WB 3BIID 3MJ5A 1ZXIA 2BYVE 1EM7A 2VH2A 1F2RI 2KJRA 2LVOA 2OJWA 2MBBB 2IO0B 4R3DA 2KAJA 2RD0A 5TR5A 3L13A 3VTVA 2LUMA 3N30A 3A9KB 2EMSA 1XLNA 2HD5B 3Q2AC 2D07B 4NQLB 1MHHE 4DXAB 1UZXB 3UI3A 2W3SA 3Q3NC 5BMIA 4HROA 4MM3A 2RMMA 1OGWA 3BINA 2CS4A 3IG3A 2KVZA 1XD3B 1L4DB 3PSEB 3RZFA 4CQNA 1MPEA 1WR6E 2JSVX 2LGIA 1FNUA 2LGDA 2WQYB 1GNUA 1GC6A 4GN1A 1WJUA 2K22A 1NI2A 1NVID 1I4XA 1UH6A 4MGKE 3AEGB 2KTRB 1Q1OA 2BWES 2J42A 3H7PB 3N20C 1J19A 4URKA 4I6PA 2J4XA 2ZVOA 1YJJA 4S17A 4RGMA 2E3TA 3AEDB 4X57B 4PS3A 4NZLB 3NOBA 3DBLI 5G5HA 4RM9A 3ZDTA 1VR9A 2WXIA 2M17A 2KDIA 2PTLA 4PYUA 3UIOB 4YL8A 2L0FA 3CMMB 3C19A 3V6EB 4N6EB 5JHAA 3A4SC 1UNSA 2KC2A 2KLCA 1V5OA 3NVWA 1QOGA 2J7QB 3NG0A 3RI7C 4PS8A 2O2VB 2PLPA 1SJED 3AXCA 3I5JC 2FE8A 1L6UA 3AB5A 4HPPA 3QK0A 3DHIC 4A6QA 4MT5A 4YXDB 3L08A 3VRAB 2B76B 3X23A 3HRDD 2LMCA 3SDLC 3LB8C 3EUB2 2N9LA 2EKIA 4KGRA 2MQJA 3KW5B 2HJ8A 4GIVA 3TJPA 1P1AA 4N59A 4DHJD 1UD7A 4US8A 2K3UA 4WH4A 2V4IB 4IC7B 4M8NA 4N9F4 2KQ7A 2WU5B 5IN7A 3DWGC 1WE7A 1DOXA 1R4NI 3IT6B 2RDBC 1P98A 1FFVA 5H8YE 1LQBA 3ZNID 1L6VA 2BKRB 1VDVA 1ZXHA 2GBJA 4MACA 2DAJA 3PV1A 2BS4B 1RYJA 3UIPB 1JWSD 2MSED 3PZDA 5D3DA 1BUIC 1G6JA 1Q0WB 3IAM1 3ZRFA 3TBLD 1SIJA 2L76A 3NHEB 5E6NA 4C56C 4F1SA 2LHDA 2W55A 3FILB 3WIMA 4TUUA 3P2BA 4EZLA 3VTWA 4BKSD 2ZZPB 2DENB 2MH7A 2KNBA 5MPOA 2KLGA 3EHVA 3DVGY 1TYGB 1WXSA 3AE5B 1YN5A 4AQ7A 4BBNC 3VXWA 2KYWA 4TSSA 3Q8BA 1J7BA 2DLBA 3B2GA 3MP9A 2L0TA 2QDFA 4DBGA 4E74A 1YN3A 1WY8A 2WNMA 2TSSA 1AARA 2GBRA 2WXLA 1WR1A 4DWFA 1HQRD 1YQBA 1FNWA 1I4PA 1SE4A 1PYWD 3AH7A 4L1BA 3AE4B 2Y5PA 3U4EG 2B3AA 5EE3A 5C23A 4GOCA 2D10A 3MHZA 1LLQA 4FBJB 3BYTB 4D6HA 1S3SG 2D3BA 2KWCA 4OW0A 4LDTD 3NS8A 4ZRQA 3C0RB 3TCAA 2BB5A 1LM8B 4D71A 1TS3A 2FCSA 2UU7A 4IDIA 2ASQA 4HEA1 1TKEA 3RNCC 2YEPB 2LRUA 4NPNA 4G11A 2V3PA 2AQ2B 4J6IA 1DGJA 4IM2A 1ZKHA 3TEXA 3KWLA 3WAOA 1JWAD 5AEKB 3DBSA 2KFKA 2E6XA 1PQSA 2RGFA 3TEZA 4PK1A 2NTSA 3LJ3A 3SFDB 2J0MA 2YLMA 2JZZA 4P16A 1WWTA 2MA9B 4LNFA 1E8YA 2MEKA 1NYRA 1L0VB 1FO4A 3R7RA 2MRPA 1V8CA 3ZGZA 1C76A 2WXPA 2L1AA 2GBKA 3CSFA 5G5GA 2WHIA 3ENEA 3HVDA 3HIZA 2WMIA 1V6EA 1OFFA 4WAFA 1FRDA 1V97A 1BMLC 2L52A 1B9RA 4EOYA 1KH0A 1GUAB 2KACA 2PKOA 4KZ0A 2DHZA 3O13A 3EC8A 1EWYC 2KMCA 1MFWA 2K6DB 1L7YA 1TZOA 3IBEA 2WX1A 2WX0A 1CZPA 3M62B 4IUMB 1E8WA 2XN9C 1SE3A 1KLVA 2Y3AA 1T0SC 5CHFA 4LNOA 1WJ6A 1N6ZA 4ANUA 4GLSC 2WMGA 1V5TA 4RNAA 4KZCA 5BMGA 4H2AA 3QIJA 2C60A 1FCLA 3X0WA 4HK2A 3TEYA 5BYSA 2ZCCA 4YT0B 4HXDA 3JSVA 3V6CB 1WXQA 4AJYB 4DHJB 3PLVA 3B2FA 2ZPNA 3U30A 3AN1A 1XLQA 4RGOS 4A90A 2ACZB 2D5GA 3W5VB 1IBXB 1L4ZB 2ZNVB 4MM3B 3RT3B 1I4HA 4P7IA 1IYFA 3NUHB 2RSUA 2MCNB 1A70A 4E3CA 2V3SA 3BZDB 2CJOA 2MLBA 3P1MA 5HKHA 1WX7A 4W9IA 2AEHA 2KZRA 1TKGA 4YTMB 1GAQB 3JVZX 1FD6A 2UYZB 4K81A 4DXFA 1OTRB 1Y8RC 3GB1A 4WJNA 4KIKA 1C9FA 2Z8LA 4AWJA 1GOZA 5D94A 4A3OA 2BQQA 2KDMA 2MBQA 3EECA 2KHWB 2KX3A 3PVLA 4M8MA 1I4QA 2BW2A 2OJRA 3WCQA 1JRUA 1MG4A 4XGAB 4OZAA 3VH3B 2LJ5A 3AV8A 4BVUC 1WE6A 5HFYA 1QQRA 4YSZB 5IKCM 1N60A 2GOWA 1SIFA 3KUZA 4FULA 1QKZA 2R61A 1EU3A 3ZIMA 3N1YC 2KANA 1IGCA 1BXTA 3AE1B 3PRPB 3R2TA 2PVOD 4NJCA 1RWSA 3AEBB 3M3JA 1EF5A 2MP2A 3DBHB 3BYYB 2G45B 3PRZA 1LFDA 2N7JA 3DWMA 2R2OA 4JLCA 4NQKE 2KVRA 1OQQA 2JQRB 4ITKA 4XWTA 4W9KA 3AI5A 3I3TB 2DYMA 1I35A 1E7VA 3QHTA 5EE1A 3SHQA 2ICIA 2QHOA 1RFAA 1IPGA 3A9JA 2OHFA 4YTNB 4L2YA 1ET6A 3RNFC 3TL5A 2L32A 1UWXA 3ZTCA 1E5WA 2WXHA 3RCZA 5C2TB 4ZYNA 3SD5A 1JW9D 1MVKA 4RFBA 4WWMA 4US9A 2DZMA 2OEDA 1AW7A 1EO6A 3RFZB 4LDTB 3HK0A 5BYRA 1OQYA 2D3AA 2BYFA 3CWIA 2NPTA 3ZW3A 4W9EA 3VQIA 3HUIA 2N7DA 1WIAA 3ALBA 2NBWB 3VRBB 4NJ6A 2IGGA 3V62A 2WXFA 4BOZB 3L54A 1R7SA 4PT5A 3V60A 3BVZA 4HCPB 2PMVA 1TKYA 3DHHC 2N9PC 2C7HA 3UGBB 4P1CC 3KYDD 4EKUA 3V3XA 2AWTA 2WU2B 4IWQA 4D6IA 3C8YA 5JHBA 4HDQA 1ACCA 1WZ0A 4K3BA 5DPSA 4AOFA 4BBNF 1C4AA 3W1YA 3OLMD 2LGSA 3HM6X 2MX2A 5L95C 4GDLA 2KXJA 2HTME 1T0YA 1V49A 4IW0A 3P4SB 2FIDA 1NDDA 2WS3B 4JGHB 2K8HA 2HE7A 2BKFA 2XK5A 4D2KA 1J0GA 2AQ1B 2WMJA 1K50A 4W9JA 4JE3B 3PTFC 1GB1A 4FADA 4HWIB 2KJHB 3VHTC 2PPHA 3OJ3A 3NVVA 3LXFA 3U7DA 2V0GA 2J53A 4IWPA 1JWMD 3AE7B 4P6VF 2V9HA 2WMIB 2MHJA 3JYUA 4MGZE 4D6DA 2GB1A 2W54A 2FCQA 3TIXA 3A9KA 2GBMA 3QAQA 4JPSA 2KK8A 4ANWA 2ZEQA 1KLUD 2QEJC 4DHZB 3FKYA 1SB3C 4HKQA 2WXMA 1M4VA 2NBUA 4G0NB 2JYEA 4KX6B 4GMVA 4F7ZA 3AEAB 1BT0A 1E0ZA 3E9SA 3RUIB 3N1XC 1XQQA 2BT6A 2WXOA 4WWNA 1U4AA 2BS2B 2DX5B 3L0WB 5AZGA 3IT4B 3TSSA 1HTOA 2M0AA 2PVGC 4K7UA 4LNIA 4BKSA 2G3QB 1NENB 2KTFA 2IGDA 4LJPB 4USAA 2LASA 4NY0A 2K9XA 1L5PA 5FK9C 1Z5SB 2H88B 1JQ4A 3A1QA 4WQMA 1T0QC 1E6EB 1XCTL 4A8XC 2C5LC 1P7EA 1KF6B 2D3GA 2PE6B 4YTPB 1KOTA 1P7FA 3T3OA 1JMLA 5GXGB 4KV2A 3W1SC 1R4MB 1IBXA 1N62A 4GB9A 2EKEC 3QARA 1DYQA 2ZW0A 1F0ZA 3K9OB 1KTKA 3ZO5B 1PFDA 1V1OA 1F1HA 4FJZA 2KN5A 2NTTA 4GU2A 1WJ4A 2O6VA 3KLSX 1ZW7A 1YQ3B 4XDCA 2A4ZA 1F77A 2ZCBA 2N9KA 4K1RB 3ZYYX 1JWUD 4TMAB 2C7MB 2A5UA 3JW0X 4LNKA 1HTQA 3NY5A 4YWGG 3SU8X 1VZ6A 2QC8A 3P4QB 4XX5A 1QLBB 1QZEA 5J2RA 2M1MA 1X1MA 1D5MC 1CMXB 2KWUB 2CU3A 3HVZA 1FNVA 4XE0A 2JF5A 2LVPA 3ETRA 1XT9B 4TV3A 3VFKA 5EDSA 2Y5CA 3AE3B 3V05A 3CIRB 1ZOYB 5E6PA 1WX8A 2DZJA 1GB4A 1HZ5A 1KLGD 4BFRA 4RM8A 1EF1A 2K8CA 4ARCA 1TGZB 1SJHD 4ARIA 4LNNA 2LWPA 3RNEC 1PGXA 4RF0A 2K25A 1EUVB 4D72A 2BYEA 4WJOA 3WANA 1P0RA 2DNFA 1XCQL 5IOIA 4ZRPA 1UGMA 4C7YA 4MH8A 1C4CA 1UBIA 1E7UA 1XEEA 1JROA 3DHGC 2N1WA 4F8CB 4TQ0A 3APDA 4II3B 2IY1B 4D6GA 3Q8AA 3WAPA 4HJKA 4XYCA 4B0MA 3IHPC 3PT2B 1SE2A 3ZNGC 2N0SB 1TBEA 1WYWB 4GSWA 4HVBA 2WWZA 2QCZA 3QX1A 3A33B 1WGGA 1UBQA 4AJWA 1UWMA 5D7GA 1N5XA 1F9JA 2AQ3B 4OVVA 3DQVA 3KUDB 2VH1A 3B9JA 1SF0A 2MBOA 4FHKA 4DK5A 2KMAA 3ZJTA 3DBRI 2LXCA 2LXAA 2ONQA 1V2YA 2BWFA 1WX9A 1T3QA 3DVNV 4ZHPA 3VH4B 3N1ZC 2I1KA 5DPTA 4REZA 2LGXA 1XLPA 2LI5A 4LK0M 3ZXVA 2GI9A 4WURA 2WXGA 1NYQA 1VJKA 1J7AA 1YX6B 1TZ1A 1N5WA 3H7SA 4M02A 1IP9A 5H92C 2XBBC 1HZ6A 3L16A 3RD2A 3I63C 3B08A 3VDZA 1I7HA 2JWUA 3H9DA 2MWSB 1RRBA 4EUTA 4BKTA 4FHJA 5DPRA 2C7NB 2BB6A 5CTRC 1WGKA 4EFOA 4HDOA 4ACFA 2LJIA 3W5UB 2KQ4X 2UWQA 4WWPA 2AYOB 5LXIB 1XO3A 3SR6A 5JH5C 4XWWA 1K8RB 1WM3A 4CO7A 2CHXA 2O2VA 4W9FA 2CU1A 5CHWA 2KDBA 1C79A 1JRPA 2D3CA 5D3IB 4ZYSA 3O65B 5D2MB 5EE0A 2JXTA 4HKZE 2J0JA 4D6FA 2O6VB 1GJZA 1F2RC 3PHWB 1XF5L 5KHOA 3Q14C 4OZCA 1J7CA 3EGRA 5I4DA 1V86A 3AE2B 5KHQA 1SXTA 4B0EA 2MP2B 3QWZB 1FM0D 4KKIA 1F52A 5CX3A 1DOIA 3M63B 2DYBA 1E7PB 2NS5A 4O1NA 2L00B 1FXAA 1ESFA 2JY6A 3U52E 2NCNA 2PW9A 4C7ZA 3SFEB 3W2DA 1HEZE 4NNJB 3BK2A 1TJEA 3AULA 1D4BA 3P4RB 3BWUD 3A4RA 2BGFA 4RMAA 2KWDA 4ZRKA 3TUOA 5LLIA 1QF6A 4ZDVA 1R4NB 2V4LA 4KIKB 2LZ6A 4DDGD 3R8BA 2MJDA 1H8CA 1WXMA 2WMKA 3R3MA 2DZIA 3ML8A 4ZOHC 3NZ3A 1KFYB 1O0SA 2KFJA 3IVFA 2V1YA 3ZNZB 1WGRA 2YVCA 1HA5A 3DVNU 5IAAC 1I42A 3ONSA 3R7QA 3R2IA 1YIWA 2HDEA 3JSVB 3NZSA 1D5ZC 2Z0DB 3DDCB 4B95A 2C9WB 4MJSB 1FXTB 3H7PA 2WMHA 1KRHA 2JT4B 2AX5A 4AP4C 5D6JB 4C4VA 3T9LA 2REXA 1ZP0B 2WDVB 2OOBB 3VR9B 2MBHA 4BAXA 4FLHA 4A3PA 1MG8A 3S2AA 1TS4A 5IO9A 3BK1A 4GDLB 4FJVB 2BS3B 1K51A 3KH0A 3KVFB 5TSSA 1S1QB 2NVUI 3ZQ4A 3AE6B 3UF8A 1XLOA 1OEYJ 2WDQB 3W1SA 3NVYA 3PO0A 4ICVA 4AUQC 2CHWA 4WAAA 5E6JA 5AZHA 4JWUC 2CJNA 2JRHA 3DBHI 1T0RC 3J9CA 4KDIC 1L0YB 1ROEA 1VD2A 4ICUA 1FRRA 2DAFA 1DOYA 4N58A 1NBFC 3VTUA 4DDID 4D6CA 4KGTA 4B6WA 2RPVA 1PGAA 2G4DB 2KMMA 4GDKA 1YMHE 4NAWB 1Q10A 2G1EA 1FPYA 3QJZA 1D6EC 5AZFA 3GE8C 2M4NA 1YQ4B 3P63A 2CR5A 4B9KA 3GP7A 5T8IA 1WXAA 1NI3A 4FA6A 2FCNA 3MC8A 2CKHB 2J0KA 5BYQA 4OZBA 3Q69A 4IG7B 2WXKA 4XC2A 4XDDA 2JYTA 3ZJVA 2M56B 4IKGA 1TTNA 1N61A 3AEFB 3OAWA 4WQOB 3LDZE 1E90A 3VUXA 5AUIA 3PGEA 1V9JA 1WGHA 4PS7A 4A20A 2K1FA 3MC9A 4HPMB 3APFA 1SGHA 5LNK1 2JZ3B 5L83A 4ANXA 1E10A 4HRSA 4OVUA 2HJ1A 2JVCA 2R2QA 1RAXA 5GMVA 5DPWA 4XZ4A 5FKAC 1JALA 4RCOA 3K9PB 1SSNA 2IDYA 1H4RA 2BPSA 4KVGB 2K39A 4NJ7A 3NJTA 2IZVB 3H6NA 1SBBB 5J18A 1ENFA 1K53A 3PZ7A 1WH3A 2PJHA 1UGJA 5JXVA 2FBWB 3M95A 2WXQA 2FNJB 3GZNB 1WM2A 5C3JB 2WMFA 4DXGA 2O6VD 1T6BX 3RNGC 1MHXA 2K0PA 4JIOU 1P3QU 4C80A 4W9HA 1FMAD 1YNTE 2XNAC 1SEBD 1TIFA 1P9DU 2KTRA 2DBYA 1D3ZA 3PLUA 4HCNB 1NEKB 2K8BA 2I1JA 3EFCA
chains in the Genus database with same CATH topology
1JCKB 4A9AA 2GRIA 1XCQL 2WXJA 4GLSC 4ZRPA 3KQ4A 4C7YA 4MH8A 1C4CA 1EU4A 2K5PA 2WXNA 4RNAA 5BMGA 1XEEA 1JROA 4HJGE 1FFUA 4H2AA 4TQ0A 1FCLA 3TEYA 3Q8AA 5BYSA 2INPE 4DQOC 4YT0B 2VZKB 3NS1A 1I4RA 2W3RA 1WXQA 5HG2A 3TEWA 2NMQA 1VRAB 4B0MA 3B2FA 3AN1A 1SE2A 1XLQA 4RGOS 2ACZB 2D5GA 3W5VB 4A90A 1IBXB 5FR3A 2JX5A 2Q5WD 1WSPA 2N0SB 1L4ZB 3BVMA 4MM3B 2QIEB 1I4HA 2IJ0A 1D5XC 3BIID 3NUHB 3MJ5A 1A70A 1ZXIA 2DYOA 3BZDB 1EM7A 1UWMA 1PUTA 2CJOA 3P1MA 1N5XA 1F2RI 2AQ3B 3AECB 5D7GA 1TKGA 4YTMB 3B9JA 3L4PA 1SF0A 4R3DA 1GAQB 1FD6A 3ZJTA 2KAJA 2BBCA 4NAMA 2LUMA 2ONQA 4UDUC 1FIQA 4DXFA 1T3QA 3GB1A 4L23A 4ZHPA 1XLNA 1C9FA 2Z8LA 3U2SC 1GOZA 4REZA 5AUKA 4KKJA 1MHHE 1XLPA 4IOIE 1GPXA 2J52A 2KDMA 2X38A 3UI3A 1T5XD 2W3SA 5BMIA 4HROA 2RDHA 4LK0M 2BYTA 2V3NA 2GI9A 2RMMA 5EE9A 4WURA 1I4QA 2BW2A 2WXGA 3WCQA 4M0WA 1NYQA 3AEEB 1VJKA 4OZAA 1J7AA 1L4DB 3AV8A 4YSYB 4CQNA 1N5WA 5HFYA 1QQRA 4YSZB 1MPEA 5H92C 1N60A 2JSVX 3I57A 1HZ6A 4OVZA 2LGIA 1FNUA 2WQYB 1VZ8A 1I7HA 1FXIA 2JWUA 1YN4A 1QKZA 3T3NA 2R61A 1EU3A 4ZHOA 2K22A 2ON8A 1JWBD 1IGCA 1BXTA 2M19A 2BB6A 1WGKA 3AE1B 1NVID 1XXGA 1I4XA 1AN8A 2LJIA 3AEGB 3R2TA 2H89B 3W5UB 2J42A 2PVOD 4NJCA 2KQ4X 1RWSA 3AEBB 2J4XA 1YJJA 4LTUA 1XO3A 3SR6A 3FAHA 4RGMA 2E3TA 3EA6A 3AEDB 3BYYB 4NZLB 1STEA 4XWWA 2N7JA 1IGDA 3DWMA 5G5HA 2FUG1 1OQQA 2JQRB 2SEBD 4ITKA 1V1PA 1VR9A 4XWTA 2DYMA 2WXIA 1C79A 4LLGM 1JRPA 1ZUD2 2JU6X 5D3IB 4ZYSA 5EE0A 2PTLA 2JXTA 4HKZE 5EE1A 2ICIA 1F2RC 2WLBA 1L0XB 2OHFA 4YTNB 4L2YA 1XF5L 1ET6A 3AMZA 4OZCA 2W82A 4RGTA 4N6EB 2L32A 1UWXA 1J7CA 2WXHA 3EGRA 5I4DA 5C2TB 3AE2B 1SXTA 1JW9D 1MVKA 1UNSA 4RFBA 4B0EA 2QSDA 3NVWA 4WWMA 1QOGA 4US9A 1WYGA 2OEDA 1FM0D 4KKIA 1AW7A 3RFZB 1C78A 1DOIA 1E7PB 5BYRA 2PLPA 4O1NA 1SJED 3CWIA 2I2YA 1ZPSA 3AM9A 1FXAA 1ESFA 4RGNA 4Q2JA 2FE8A 3VQIA 1L6UA 3AB5A 4FXCA 3HUIA 3U52E 4A6QA 4MT5A 3VRBB 2PW9A 4YXDB 3ZJUA 3VRAB 2IGGA 2B76B 2WXFA 1E9MA 3HRDD 4C7ZA 5HHDG 2LMCA 3SFEB 3W2DA 1R7SA 3N9YC 4PT5A 1HEZE 1QOAA 3BVZA 3LB8C 3EUB2 2KN4A 2N9LA 2PMVA 3BK2A 1TKYA 2EKIA 1TJEA 4KGRA 3VR8B 1D4BA 2MJEA 3P4RB 3BWUD 4N59A 2INNE 1VZ7A 2KWDA 2LHEA 3V3XA 4US8A 3U7ZA 2K3UA 2WU2B 3TUOA 4WH4A 3C8YA 2V4IB 1QF6A 2WU5B 1ACCA 3DWGC 2I38A 3BVGA 3R8BA 1C4AA 2MJDA 2IGHA 1DOXA 4ZOHC 3IT6B 1KFYB 1AYFA 3NZ3A 3FILA 1QILA 2HTME 3PZ8A 3P4SB 1FFVA 5H8YE 5HI1A 4EE2A 1HA5A 1L6VA 1VDVA 1ZXHA 2WS3B 4MACA 1RFKA 3R2IA 2HDEA 2PIAA 1EWCA 1D5ZC 4D2KA 2LFIA 2BS4B 2WXRA 1RYJA 2AQ1B 1JWSD 1KRHA 1K50A 1LO5D 3W9CB 1N63A 3I9V1 2QILA 2AX5A 4JE3B 1GB1A 5D3DA 1BUIC 3NVVA 1ZP0B 1UUPA 2WDVB 3LXFA 1FEHA 2V0GA 3IAS1 3MFGA 3VR9B 3IAM1 2J53A 4TQ1A 2RDGA 1JWMD 3AE7B 1SIJA 4P6VF 1TS4A 4C56C 3BK1A 3AE9B 2LHDA 2W55A 3FILB 4GDLB 2BS3B 1QOFA 1K51A 2L83A 3H8HA 2GB1A 5TSSA 2W54A 1TY0A 4J3OD 1C4PA 2MH7A 2ZW1A 1ZDVA 3AE6B 3ZQ4A 1XLOA 5MPOA 2BTEA 2WDQB 1PDXA 3W1SA 3NVYA 3PO0A 4JPSA 1TYGB 3AE5B 1YN5A 3KWVA 4AQ7A 1HXYD 1KLUD 5E6JA 2QEJC 1SB3C 4TSSA 3Q8BA 4HKQA 2WXMA 2CJNA 4JWUC 1J7BA 2DLBA 3B2GA 3MP9A 1M4VA 3SEBA 2JYEA 3J9CA 3NRZA 1YN3A 2DWQA 2VZKD 4KX6B 1L0YB 1ROEA 1FRRA 2TSSA 2WNMA 3AEAB 1DOYA 4N58A 1RM6C 1E0ZA 3E9SA 3FC4A 4KGTA 1VLBA 2RPVA 1PGAA 1PGBA 2WXLA 3NVZA 1OQRA 1YJIA 2KMMA 5BMHA 1YMHE 1HQRD 2BT6A 2WXOA 3Q8EA 1QT9A 4NAWB 1Q10A 2G1EA 2BS2B 3IT4B 1FNWA 3MC0B 3TSSA 1I4PA 2WDRB 2QJLA 2M0AA 2PVGC 1D6EC 1K52A 1PYWD 1SE4A 3AH7A 4L1BA 3AE4B 2Y5PA 1TS2A 3U4EG 1NENB 1YQ4B 2IGDA 1AWDA 3P63A 1WRIA 2EELA 5EE3A 3MHZA 4USAA 3GP7A 5T8IA 3BYTB 1NI3A 4RF1A 2K9XA 1L5PA 4A55A 5FK9C 5BYQA 2H88B 4OZBA 4OW0A 3Q69A 3Q8CA 1JQ4A 4WQMA 3E56A 4ZRQA 1E6EB 2WXKA 4XDDA 2JYTA 3ZJVA 2M56B 1XCTL 4IKGA 2BB5A 1QOBA 4A8XC 1TY2A 1N61A 3AEFB 1P7EA 3IXSA 1KF6B 1TS3A 3LYYA 4YTPB 1P7FA 4GDKB 4IDIA 3URYA 1JMLA 5GXGB 3T3OA 4HEA1 1TKEA 2YEPB 5AUIA 1Y56A 1IBXA 1ZDXA 1I4GA 1N62A 2LEKA 2V3PA 2AQ2B 1DYQA 1DGJA 3TEXA 2ZW0A 3KWLA 1F0ZA 1JWAD 1KTKA 4YSXB 1V1PB 1PFDA 1V1OA 5LNK1 2E6XA 3TEZA 1E10A 2SAKA 4HRSA 2NTTA 2NTSA 2YEPF 3KLSX 1IUEA 2QMTA 1MI0A 1YQ3B 5FKAC 4XDCA 1JALA 4RCOA 1F77A 1SSNA 2IDYA 4KGSA 3SFDB 3P4PB 2N9KA 3ZYYX 1JWUD 4TMAB 3ABVB 4P16A 1C77A 1WWTA 4YWGG 4RH6A 1CJEA 1VZ6A 1SBBB 3P4QB 1QLBB 1CQVA 2MEKA 1ZE3D 1NYRA 1L0VB 4WIPA 1FO4A 4JX1C 1ENFA 1V8CA 1D5MC 1C76A 2WXPA 1K53A 3ZGZA 3P42A 3PZ7A 1UGJA 5JXVA 2CU3A 2FBWB 2L1AA 3HVZA 1FNVA 2MJ3A 2JZPA 4XE0A 2WXQA 3ETRA 1ET9A 5G5GA 2Y5CA 3AE3B 3HVDA 3V05A 5C3JB 1FCCC 3CIRB 1ZOYB 4DXGA 1B1ZA 1T6BX 1MHXA 2K0PA 3Q8FA 1OFFA 4WAFA 1FRDA 1V97A 1GB4A 1BMLC 2L52A 4JWSC 1B9RA 1CK1A 4C80A 1HZ5A 1KLGD 3RPFC 1KH0A 2KACA 4ARCA 3GS2A 2PKOA 1SJHD 1FMAD 4ARIA 1YNTE 3O13A 2XNAC 1EWYC 1PGXA 1SEBD 1TZOA 2IPKD 2WP9B 4RF0A 1CZPA 2DBYA 1NEKB 2XN9C 1SE3A 3AE8B 2G9HD 2Y3AA 3OWEB 4OHJA 4AS1A 1TS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IT6 B;  3IT4 B;  2VZK B;  2YEP B;  2VZK D;  2V4I B;  1VZ7 A;  1VZ6 A;  1VRA B;  2YEP F;  1VZ8 A; 
#chains in the Genus database with same CATH topology
 4A9A A;  3WAM A;  2WXJ A;  2D11 A;  4MDK E;  3KQ4 A;  1EU4 A;  3ZLZ A;  3QA8 A;  1WMH A;  4HJG E;  5IP4 D;  3MTN B;  5E6O A;  3ZVV A;  5DCN A;  1YOV B;  2LRW A;  3WA0 A;  2VZK B;  3NS1 A;  3PRM B;  5HG2 A;  3TEW A;  2NMQ A;  1SE9 A;  1LXD A;  1V81 A;  2DZK A;  2L7R A;  2Q5W D;  1WSP A;  3ZDM C;  5JZE B;  2KWV B;  3MJW A;  2IO2 B;  1C1Y B;  4EZK A;  2DYO A;  4ASW C;  1PUT A;  3AEC B;  2Z0E B;  3L4P A;  4KSK C;  4M01 A;  2AL6 A;  2BBC A;  4MH0 E;  4QAY A;  3ZTD A;  4NAM A;  4I6L B;  1L2N A;  4UDU C;  1OEY A;  1FIQ A;  4MEL A;  3ECI A;  4L23 A;  2PEA A;  3AU4 A;  3U2S C;  3HM3 A;  2N7E A;  5AUK A;  1YJ1 A;  4II2 B;  4KKJ A;  4IOI E;  2J52 A;  4K7W A;  2X38 A;  1T5X D;  3L10 B;  2BYT A;  2RDH A;  1WZ3 A;  2V3N A;  5EE9 A;  4S0R A;  4M0W A;  3AEE B;  2JPH A;  3L17 A;  3R66 C;  1WF9 A;  4YSY B;  2KDF B;  4WWO A;  2EMT A;  2ZJD A;  3I57 A;  4OVZ A;  2IYD B;  3Q3M C;  1VZ8 A;  1FXI A;  1YN4 A;  2MW5 A;  2X8X X;  4W9D A;  3T3N A;  5G55 A;  1WGY A;  4ZHO A;  2ON8 A;  1JWB D;  4JL9 A;  2M19 A;  2NR2 A;  1XXG A;  1AN8 A;  2JXX A;  3HHM A;  4EZJ A;  2H89 B;  3Q3F A;  2KQS A;  3TMP B;  4LTU A;  3FAH A;  2K6Q A;  3EA6 A;  1STE A;  2BF8 B;  1IGD A;  4K3C A;  2FUG 1;  2SEB D;  2M8S A;  4G50 A;  4E71 A;  1V1P A;  3RYT A;  2IND C;  4LLG M;  1ZUD 2;  2JU6 X;  1ISN A;  3WAL A;  4I6N B;  3RUL A;  1WFY A;  1UF0 A;  2FCM A;  3ZUN A;  2WLB A;  2WYQ A;  1L0X B;  3Q3J A;  3AMZ A;  2W82 A;  3ML9 A;  4RGT A;  1M94 A;  1WXV A;  3ZKJ C;  2XEW A;  2AL3 A;  5IA7 A;  1E8X A;  3KYC D;  3DBR B;  2QSD A;  3ZRC A;  1J8C A;  1WYG A;  3QQ8 B;  5G2N A;  1YD8 U;  1C78 A;  4MGI E;  2N1V A;  2RR9 A;  1WJN A;  2PE9 A;  1UEL A;  2I2Y A;  2KO3 A;  2KD0 A;  1ZPS A;  3AM9 A;  3RN9 C;  4RGN A;  3ZXR A;  4Q2J A;  2RPQ A;  3CF6 E;  4FXC A;  3VUW A;  4IM0 A;  1TT5 B;  3ZJU A;  2D2Q A;  2Y5B B;  4MGY E;  1E9M A;  5HHD G;  4W9G A;  4D6E A;  3N9Y C;  3DPD A;  4BOS C;  1QOA A;  1GC7 A;  2KN4 A;  2BVC A;  2IBI B;  4KSL C;  3VR8 B;  2MJE A;  4ZRI A;  2LD9 A;  2XK5 B;  2INN E;  2JUO A;  1VZ7 A;  4D6J A;  2LHE A;  3KUC B;  3U7Z A;  1C3T A;  3A1Q B;  3U8Z A;  4G3X B;  2I38 A;  3BVG A;  3Q6B A;  1GG3 A;  2IGH A;  1WMH B;  1AYF A;  4ZRJ A;  3FIL A;  1QIL A;  3PZ8 A;  5HI1 A;  3MHS D;  4EE2 A;  1RLF A;  2ZNV C;  2IO3 B;  1RFK A;  3ZNH B;  3RMK C;  4M00 A;  2PIA A;  1EWC A;  4ANV A;  2LFI A;  2WXR A;  4EEW A;  1A5R A;  3W9C B;  1LO5 D;  1N63 A;  2IY0 B;  3I9V 1;  2QIL A;  4FN2 A;  3B0A A;  3BY4 B;  2MBE A;  2L8J A;  1UUP A;  2VRR B;  4DHZ E;  1FEH A;  3IAS 1;  3MFG A;  1YX5 B;  4TQ1 A;  2GBN A;  2LVQ A;  2RDG A;  3H1U A;  3AE9 B;  2GMI C;  1QOF A;  1ZGU B;  2L83 A;  4BZA A;  3H8H A;  1TY0 A;  3RNA C;  4J3O D;  2N4F A;  1C4P A;  2ZW1 A;  4MSQ B;  1ZDV A;  2INC C;  4CHK A;  4KDL B;  2BTE A;  2KJ6 A;  4K7S A;  1PDX A;  1Q5W B;  3KWV A;  1HXY D;  3SEB A;  2FUH B;  3NRZ A;  2Z59 B;  2DWQ A;  2VZK D;  5CHV C;  2KX0 A;  2KT7 A;  1RM6 C;  2ZVN A;  3FC4 A;  1VLB A;  1PGB A;  3NVZ A;  3VUY A;  1OQR A;  1YJI A;  5BMH A;  2JWZ A;  3Q8E A;  1QT9 A;  2KOX A;  3MC0 B;  1MJD A;  2WDR B;  2QJL A;  1K52 A;  1TS2 A;  3EFU A;  3PS6 A;  3DCG A;  1AWD A;  1E8Z A;  1WRI A;  2EEL A;  2IO1 B;  2HTH A;  5FR6 A;  4RF1 A;  4A55 A;  2LGY A;  5LXH A;  3Q8C A;  3GE3 C;  4P1B C;  3E56 A;  1Z2M A;  3Q3O C;  1R4M I;  4IWO A;  1QOB A;  1TY2 A;  3IXS A;  3LYY A;  4GDK B;  3URY A;  4IM3 A;  3NZU A;  2JRI B;  1Y56 A;  1ZDX A;  1I4G A;  3N32 A;  2LEK A;  2M0X A;  3DBL B;  2W9N A;  2WGS A;  4YSX B;  3DVG X;  2L3Z A;  1V1P B;  4LCD E;  3GZN I;  3OG5 A;  4C00 A;  2N9X A;  1KJT A;  2LUE A;  2SAK A;  4C4V B;  1WRD B;  4LJO B;  2YEP F;  1KM7 A;  4BKG A;  1IUE A;  1HE8 A;  2QMT A;  1MI0 A;  2ZPY A;  3RNB C;  3CST A;  4KGS A;  3P4P B;  4W9C A;  3ABV B;  4FJY A;  1C77 A;  4RH6 A;  1CJE A;  2G4S A;  1CQV A;  2WDT B;  1ZE3 D;  3PHX B;  4WIP A;  3VAW A;  4HPL B;  4JX1 C;  3P42 A;  3D32 A;  2NPT B;  2MJ3 A;  2JZP A;  2KFK B;  3DOW A;  3IFW B;  2GLS A;  1ET9 A;  3PPA A;  3APC A;  3QC8 B;  3T8M A;  3UQB A;  5BO4 B;  1FCC C;  1B1Z A;  5C1Z A;  3Q8F A;  4JWS C;  2KDE B;  1CK1 A;  3RPF C;  3GOE A;  3GS2 A;  4W9L A;  3VVW B;  1WGD A;  3UQA A;  3V61 A;  1VCB A;  2FIF A;  4NAW A;  1WI0 A;  4JQW C;  2IPK D;  2WP9 B;  2KKC A;  3A9J B;  3AE8 B;  2G9H D;  3B1L X;  4WJQ A;  3OWE B;  4OHJ A;  4MEM A;  1TS5 A;  4AS1 A;  1GPX A;  1JCK B;  2GRI A;  2L05 A;  3N3K B;  4HLE A;  2NBV B;  2K5P A;  2N9E B;  2WXN A;  2CHZ A;  1FFU A;  1V80 A;  4PYZ A;  3PRE A;  4GXB A;  4WJP A;  3AU5 A;  2INP E;  4MSM B;  4TKN A;  4DQO C;  2FAZ A;  3UIN B;  1I4R A;  2W3R A;  4CYE A;  1VRA B;  4MJS A;  2KC1 A;  5J17 A;  3OJ4 B;  1LGR A;  5FR3 A;  2JX5 A;  3BVM A;  3QCA A;  3RZW C;  4GGQ A;  2QIE B;  2IJ0 A;  1D5X C;  4M0W B;  3BII D;  3MJ5 A;  1ZXI A;  2BYV E;  1EM7 A;  2VH2 A;  1F2R I;  2KJR A;  2LVO A;  2OJW A;  2MBB B;  2IO0 B;  4R3D A;  2KAJ A;  2RD0 A;  5TR5 A;  3L13 A;  3VTV A;  2LUM A;  3N30 A;  3A9K B;  2EMS A;  1XLN A;  2HD5 B;  3Q2A C;  2D07 B;  4NQL B;  1MHH E;  4DXA B;  1UZX B;  3UI3 A;  2W3S A;  3Q3N C;  5BMI A;  4HRO A;  4MM3 A;  2RMM A;  1OGW A;  3BIN A;  2CS4 A;  3IG3 A;  2KVZ A;  1XD3 B;  1L4D B;  3PSE B;  3RZF A;  4CQN A;  1MPE A;  1WR6 E;  2JSV X;  2LGI A;  1FNU A;  2LGD A;  2WQY B;  1GNU A;  1GC6 A;  4GN1 A;  1WJU A;  2K22 A;  1NI2 A;  1NVI D;  1I4X A;  1UH6 A;  4MGK E;  3AEG B;  2KTR B;  1Q1O A;  2BWE S;  2J42 A;  3H7P B;  3N20 C;  1J19 A;  4URK A;  4I6P A;  2J4X A;  2ZVO A;  1YJJ A;  4S17 A;  4RGM A;  2E3T A;  3AED B;  4X57 B;  4PS3 A;  4NZL B;  3NOB A;  3DBL I;  5G5H A;  4RM9 A;  3ZDT A;  1VR9 A;  2WXI A;  2M17 A;  2KDI A;  2PTL A;  4PYU A;  3UIO B;  4YL8 A;  2L0F A;  3CMM B;  3C19 A;  3V6E B;  4N6E B;  5JHA A;  3A4S C;  1UNS A;  2KC2 A;  2KLC A;  1V5O A;  3NVW A;  1QOG A;  2J7Q B;  3NG0 A;  3RI7 C;  4PS8 A;  2O2V B;  2PLP A;  1SJE D;  3AXC A;  3I5J C;  2FE8 A;  1L6U A;  3AB5 A;  4HPP A;  3QK0 A;  3DHI C;  4A6Q A;  4MT5 A;  4YXD B;  3L08 A;  3VRA B;  2B76 B;  3X23 A;  3HRD D;  2LMC A;  3SDL C;  3LB8 C;  3EUB 2;  2N9L A;  2EKI A;  4KGR A;  2MQJ A;  3KW5 B;  2HJ8 A;  4GIV A;  3TJP A;  1P1A A;  4N59 A;  4DHJ D;  1UD7 A;  4US8 A;  2K3U A;  4WH4 A;  2V4I B;  4IC7 B;  4M8N A;  4N9F 4;  2KQ7 A;  2WU5 B;  5IN7 A;  3DWG C;  1WE7 A;  1DOX A;  1R4N I;  3IT6 B;  2RDB C;  1P98 A;  1FFV A;  5H8Y E;  1LQB A;  3ZNI D;  1L6V A;  2BKR B;  1VDV A;  1ZXH A;  2GBJ A;  4MAC A;  2DAJ A;  3PV1 A;  2BS4 B;  1RYJ A;  3UIP B;  1JWS D;  2MSE D;  3PZD A;  5D3D A;  1BUI C;  1G6J A;  1Q0W B;  3IAM 1;  3ZRF A;  3TBL D;  1SIJ A;  2L76 A;  3NHE B;  5E6N A;  4C56 C;  4F1S A;  2LHD A;  2W55 A;  3FIL B;  3WIM A;  4TUU A;  3P2B A;  4EZL A;  3VTW A;  4BKS D;  2ZZP B;  2DEN B;  2MH7 A;  2KNB A;  5MPO A;  2KLG A;  3EHV A;  3DVG Y;  1TYG B;  1WXS A;  3AE5 B;  1YN5 A;  4AQ7 A;  4BBN C;  3VXW A;  2KYW A;  4TSS A;  3Q8B A;  1J7B A;  2DLB A;  3B2G A;  3MP9 A;  2L0T A;  2QDF A;  4DBG A;  4E74 A;  1YN3 A;  1WY8 A;  2WNM A;  2TSS A;  1AAR A;  2GBR A;  2WXL A;  1WR1 A;  4DWF A;  1HQR D;  1YQB A;  1FNW A;  1I4P A;  1SE4 A;  1PYW D;  3AH7 A;  4L1B A;  3AE4 B;  2Y5P A;  3U4E G;  2B3A A;  5EE3 A;  5C23 A;  4GOC A;  2D10 A;  3MHZ A;  1LLQ A;  4FBJ B;  3BYT B;  4D6H A;  1S3S G;  2D3B A;  2KWC A;  4OW0 A;  4LDT D;  3NS8 A;  4ZRQ A;  3C0R B;  3TCA A;  2BB5 A;  1LM8 B;  4D71 A;  1TS3 A;  2FCS A;  2UU7 A;  4IDI A;  2ASQ A;  4HEA 1;  1TKE A;  3RNC C;  2YEP B;  2LRU A;  4NPN A;  4G11 A;  2V3P A;  2AQ2 B;  4J6I A;  1DGJ A;  4IM2 A;  1ZKH A;  3TEX A;  3KWL A;  3WAO A;  1JWA D;  5AEK B;  3DBS A;  2KFK A;  2E6X A;  1PQS A;  2RGF A;  3TEZ A;  4PK1 A;  2NTS A;  3LJ3 A;  3SFD B;  2J0M A;  2YLM A;  2JZZ A;  4P16 A;  1WWT A;  2MA9 B;  4LNF A;  1E8Y A;  2MEK A;  1NYR A;  1L0V B;  1FO4 A;  3R7R A;  2MRP A;  1V8C A;  3ZGZ A;  1C76 A;  2WXP A;  2L1A A;  2GBK A;  3CSF A;  5G5G A;  2WHI A;  3ENE A;  3HVD A;  3HIZ A;  2WMI A;  1V6E A;  1OFF A;  4WAF A;  1FRD A;  1V97 A;  1BML C;  2L52 A;  1B9R A;  4EOY A;  1KH0 A;  1GUA B;  2KAC A;  2PKO A;  4KZ0 A;  2DHZ A;  3O13 A;  3EC8 A;  1EWY C;  2KMC A;  1MFW A;  2K6D B;  1L7Y A;  1TZO A;  3IBE A;  2WX1 A;  2WX0 A;  1CZP A;  3M62 B;  4IUM B;  1E8W A;  2XN9 C;  1SE3 A;  1KLV A;  2Y3A A;  1T0S C;  5CHF A;  4LNO A;  1WJ6 A;  1N6Z A;  4ANU A;  4GLS C;  2WMG A;  1V5T A;  4RNA A;  4KZC A;  5BMG A;  4H2A A;  3QIJ A;  2C60 A;  1FCL A;  3X0W A;  4HK2 A;  3TEY A;  5BYS A;  2ZCC A;  4YT0 B;  4HXD A;  3JSV A;  3V6C B;  1WXQ A;  4AJY B;  4DHJ B;  3PLV A;  3B2F A;  2ZPN A;  3U30 A;  3AN1 A;  1XLQ A;  4RGO S;  4A90 A;  2ACZ B;  2D5G A;  3W5V B;  1IBX B;  1L4Z B;  2ZNV B;  4MM3 B;  3RT3 B;  1I4H A;  4P7I A;  1IYF A;  3NUH B;  2RSU A;  2MCN B;  1A70 A;  4E3C A;  2V3S A;  3BZD B;  2CJO A;  2MLB A;  3P1M A;  5HKH A;  1WX7 A;  4W9I A;  2AEH A;  2KZR A;  1TKG A;  4YTM B;  1GAQ B;  3JVZ X;  1FD6 A;  2UYZ B;  4K81 A;  4DXF A;  1OTR B;  1Y8R C;  3GB1 A;  4WJN A;  4KIK A;  1C9F A;  2Z8L A;  4AWJ A;  1GOZ A;  5D94 A;  4A3O A;  2BQQ A;  2KDM A;  2MBQ A;  3EEC A;  2KHW B;  2KX3 A;  3PVL A;  4M8M A;  1I4Q A;  2BW2 A;  2OJR A;  3WCQ A;  1JRU A;  1MG4 A;  4XGA B;  4OZA A;  3VH3 B;  2LJ5 A;  3AV8 A;  4BVU C;  1WE6 A;  5HFY A;  1QQR A;  4YSZ B;  5IKC M;  1N60 A;  2GOW A;  1SIF A;  3KUZ A;  4FUL A;  1QKZ A;  2R61 A;  1EU3 A;  3ZIM A;  3N1Y C;  2KAN A;  1IGC A;  1BXT A;  3AE1 B;  3PRP B;  3R2T A;  2PVO D;  4NJC A;  1RWS A;  3AEB B;  3M3J A;  1EF5 A;  2MP2 A;  3DBH B;  3BYY B;  2G45 B;  3PRZ A;  1LFD A;  2N7J A;  3DWM A;  2R2O A;  4JLC A;  4NQK E;  2KVR A;  1OQQ A;  2JQR B;  4ITK A;  4XWT A;  4W9K A;  3AI5 A;  3I3T B;  2DYM A;  1I35 A;  1E7V A;  3QHT A;  5EE1 A;  3SHQ A;  2ICI A;  2QHO A;  1RFA A;  1IPG A;  3A9J A;  2OHF A;  4YTN B;  4L2Y A;  1ET6 A;  3RNF C;  3TL5 A;  2L32 A;  1UWX A;  3ZTC A;  1E5W A;  2WXH A;  3RCZ A;  5C2T B;  4ZYN A;  3SD5 A;  1JW9 D;  1MVK A;  4RFB A;  4WWM A;  4US9 A;  2DZM A;  2OED A;  1AW7 A;  1EO6 A;  3RFZ B;  4LDT B;  3HK0 A;  5BYR A;  1OQY A;  2D3A A;  2BYF A;  3CWI A;  2NPT A;  3ZW3 A;  4W9E A;  3VQI A;  3HUI A;  2N7D A;  1WIA A;  3ALB A;  2NBW B;  3VRB B;  4NJ6 A;  2IGG A;  3V62 A;  2WXF A;  4BOZ B;  3L54 A;  1R7S A;  4PT5 A;  3V60 A;  3BVZ A;  4HCP B;  2PMV A;  1TKY A;  3DHH C;  2N9P C;  2C7H A;  3UGB B;  4P1C C;  3KYD D;  4EKU A;  3V3X A;  2AWT A;  2WU2 B;  4IWQ A;  4D6I A;  3C8Y A;  5JHB A;  4HDQ A;  1ACC A;  1WZ0 A;  4K3B A;  5DPS A;  4AOF A;  4BBN F;  1C4A A;  3W1Y A;  3OLM D;  2LGS A;  3HM6 X;  2MX2 A;  5L95 C;  4GDL A;  2KXJ A;  2HTM E;  1T0Y A;  1V49 A;  4IW0 A;  3P4S B;  2FID A;  1NDD A;  2WS3 B;  4JGH B;  2K8H A;  2HE7 A;  2BKF A;  2XK5 A;  4D2K A;  1J0G A;  2AQ1 B;  2WMJ A;  1K50 A;  4W9J A;  4JE3 B;  3PTF C;  1GB1 A;  4FAD A;  4HWI B;  2KJH B;  3VHT C;  2PPH A;  3OJ3 A;  3NVV A;  3LXF A;  3U7D A;  2V0G A;  2J53 A;  4IWP A;  1JWM D;  3AE7 B;  4P6V F;  2V9H A;  2WMI B;  2MHJ A;  3JYU A;  4MGZ E;  4D6D A;  2GB1 A;  2W54 A;  2FCQ A;  3TIX A;  3A9K A;  2GBM A;  3QAQ A;  4JPS A;  2KK8 A;  4ANW A;  2ZEQ A;  1KLU D;  2QEJ C;  4DHZ B;  3FKY A;  1SB3 C;  4HKQ A;  2WXM A;  1M4V A;  2NBU A;  4G0N B;  2JYE A;  4KX6 B;  4GMV A;  4F7Z A;  3AEA B;  1BT0 A;  1E0Z A;  3E9S A;  3RUI B;  3N1X C;  1XQQ A;  2BT6 A;  2WXO A;  4WWN A;  1U4A A;  2BS2 B;  2DX5 B;  3L0W B;  5AZG A;  3IT4 B;  3TSS A;  1HTO A;  2M0A A;  2PVG C;  4K7U A;  4LNI A;  4BKS A;  2G3Q B;  1NEN B;  2KTF A;  2IGD A;  4LJP B;  4USA A;  2LAS A;  4NY0 A;  2K9X A;  1L5P A;  5FK9 C;  1Z5S B;  2H88 B;  1JQ4 A;  3A1Q A;  4WQM A;  1T0Q C;  1E6E B;  1XCT L;  4A8X C;  2C5L C;  1P7E A;  1KF6 B;  2D3G A;  2PE6 B;  4YTP B;  1KOT A;  1P7F A;  3T3O A;  1JML A;  5GXG B;  4KV2 A;  3W1S C;  1R4M B;  1IBX A;  1N62 A;  4GB9 A;  2EKE C;  3QAR A;  1DYQ A;  2ZW0 A;  1F0Z A;  3K9O B;  1KTK A;  3ZO5 B;  1PFD A;  1V1O A;  1F1H A;  4FJZ A;  2KN5 A;  2NTT A;  4GU2 A;  1WJ4 A;  2O6V A;  3KLS X;  1ZW7 A;  1YQ3 B;  4XDC A;  2A4Z A;  1F77 A;  2ZCB A;  2N9K A;  4K1R B;  3ZYY X;  1JWU D;  4TMA B;  2C7M B;  2A5U A;  3JW0 X;  4LNK A;  1HTQ A;  3NY5 A;  4YWG G;  3SU8 X;  1VZ6 A;  2QC8 A;  3P4Q B;  4XX5 A;  1QLB B;  1QZE A;  5J2R A;  2M1M A;  1X1M A;  1D5M C;  1CMX B;  2KWU B;  2CU3 A;  3HVZ A;  1FNV A;  4XE0 A;  2JF5 A;  2LVP A;  3ETR A;  1XT9 B;  4TV3 A;  3VFK A;  5EDS A;  2Y5C A;  3AE3 B;  3V05 A;  3CIR B;  1ZOY B;  5E6P A;  1WX8 A;  2DZJ A;  1GB4 A;  1HZ5 A;  1KLG D;  4BFR A;  4RM8 A;  1EF1 A;  2K8C A;  4ARC A;  1TGZ B;  1SJH D;  4ARI A;  4LNN A;  2LWP A;  3RNE C;  1PGX A;  4RF0 A;  2K25 A;  1EUV B;  4D72 A;  2BYE A;  4WJO A;  3WAN A;  1P0R A;  2DNF A;  1XCQ L;  5IOI A;  4ZRP A;  1UGM A;  4C7Y A;  4MH8 A;  1C4C A;  1UBI A;  1E7U A;  1XEE A;  1JRO A;  3DHG C;  2N1W A;  4F8C B;  4TQ0 A;  3APD A;  4II3 B;  2IY1 B;  4D6G A;  3Q8A A;  3WAP A;  4HJK A;  4XYC A;  4B0M A;  3IHP C;  3PT2 B;  1SE2 A;  3ZNG C;  2N0S B;  1TBE A;  1WYW B;  4GSW A;  4HVB A;  2WWZ A;  2QCZ A;  3QX1 A;  3A33 B;  1WGG A;  1UBQ A;  4AJW A;  1UWM A;  5D7G A;  1N5X A;  1F9J A;  2AQ3 B;  4OVV A;  3DQV A;  3KUD B;  2VH1 A;  3B9J A;  1SF0 A;  2MBO A;  4FHK A;  4DK5 A;  2KMA A;  3ZJT A;  3DBR I;  2LXC A;  2LXA A;  2ONQ A;  1V2Y A;  2BWF A;  1WX9 A;  1T3Q A;  3DVN V;  4ZHP A;  3VH4 B;  3N1Z C;  2I1K A;  5DPT A;  4REZ A;  2LGX A;  1XLP A;  2LI5 A;  4LK0 M;  3ZXV A;  2GI9 A;  4WUR A;  2WXG A;  1NYQ A;  1VJK A;  1J7A A;  1YX6 B;  1TZ1 A;  1N5W A;  3H7S A;  4M02 A;  1IP9 A;  5H92 C;  2XBB C;  1HZ6 A;  3L16 A;  3RD2 A;  3I63 C;  3B08 A;  3VDZ A;  1I7H A;  2JWU A;  3H9D A;  2MWS B;  1RRB A;  4EUT A;  4BKT A;  4FHJ A;  5DPR A;  2C7N B;  2BB6 A;  5CTR C;  1WGK A;  4EFO A;  4HDO A;  4ACF A;  2LJI A;  3W5U B;  2KQ4 X;  2UWQ A;  4WWP A;  2AYO B;  5LXI B;  1XO3 A;  3SR6 A;  5JH5 C;  4XWW A;  1K8R B;  1WM3 A;  4CO7 A;  2CHX A;  2O2V A;  4W9F A;  2CU1 A;  5CHW A;  2KDB A;  1C79 A;  1JRP A;  2D3C A;  5D3I B;  4ZYS A;  3O65 B;  5D2M B;  5EE0 A;  2JXT A;  4HKZ E;  2J0J A;  4D6F A;  2O6V B;  1GJZ A;  1F2R C;  3PHW B;  1XF5 L;  5KHO A;  3Q14 C;  4OZC A;  1J7C A;  3EGR A;  5I4D A;  1V86 A;  3AE2 B;  5KHQ A;  1SXT A;  4B0E A;  2MP2 B;  3QWZ B;  1FM0 D;  4KKI A;  1F52 A;  5CX3 A;  1DOI A;  3M63 B;  2DYB A;  1E7P B;  2NS5 A;  4O1N A;  2L00 B;  1FXA A;  1ESF A;  2JY6 A;  3U52 E;  2NCN A;  2PW9 A;  4C7Z A;  3SFE B;  3W2D A;  1HEZ E;  4NNJ B;  3BK2 A;  1TJE A;  3AUL A;  1D4B A;  3P4R B;  3BWU D;  3A4R A;  2BGF A;  4RMA A;  2KWD A;  4ZRK A;  3TUO A;  5LLI A;  1QF6 A;  4ZDV A;  1R4N B;  2V4L A;  4KIK B;  2LZ6 A;  4DDG D;  3R8B A;  2MJD A;  1H8C A;  1WXM A;  2WMK A;  3R3M A;  2DZI A;  3ML8 A;  4ZOH C;  3NZ3 A;  1KFY B;  1O0S A;  2KFJ A;  3IVF A;  2V1Y A;  3ZNZ B;  1WGR A;  2YVC A;  1HA5 A;  3DVN U;  5IAA C;  1I42 A;  3ONS A;  3R7Q A;  3R2I A;  1YIW A;  2HDE A;  3JSV B;  3NZS A;  1D5Z C;  2Z0D B;  3DDC B;  4B95 A;  2C9W B;  4MJS B;  1FXT B;  3H7P A;  2WMH A;  1KRH A;  2JT4 B;  2AX5 A;  4AP4 C;  5D6J B;  4C4V A;  3T9L A;  2REX A;  1ZP0 B;  2WDV B;  2OOB B;  3VR9 B;  2MBH A;  4BAX A;  4FLH A;  4A3P A;  1MG8 A;  3S2A A;  1TS4 A;  5IO9 A;  3BK1 A;  4GDL B;  4FJV B;  2BS3 B;  1K51 A;  3KH0 A;  3KVF B;  5TSS A;  1S1Q B;  2NVU I;  3ZQ4 A;  3AE6 B;  3UF8 A;  1XLO A;  1OEY J;  2WDQ B;  3W1S A;  3NVY A;  3PO0 A;  4ICV A;  4AUQ C;  2CHW A;  4WAA A;  5E6J A;  5AZH A;  4JWU C;  2CJN A;  2JRH A;  3DBH I;  1T0R C;  3J9C A;  4KDI C;  1L0Y B;  1ROE A;  1VD2 A;  4ICU A;  1FRR A;  2DAF A;  1DOY A;  4N58 A;  1NBF C;  3VTU A;  4DDI D;  4D6C A;  4KGT A;  4B6W A;  2RPV A;  1PGA A;  2G4D B;  2KMM A;  4GDK A;  1YMH E;  4NAW B;  1Q10 A;  2G1E A;  1FPY A;  3QJZ A;  1D6E C;  5AZF A;  3GE8 C;  2M4N A;  1YQ4 B;  3P63 A;  2CR5 A;  4B9K A;  3GP7 A;  5T8I A;  1WXA A;  1NI3 A;  4FA6 A;  2FCN A;  3MC8 A;  2CKH B;  2J0K A;  5BYQ A;  4OZB A;  3Q69 A;  4IG7 B;  2WXK A;  4XC2 A;  4XDD A;  2JYT A;  3ZJV A;  2M56 B;  4IKG A;  1TTN A;  1N61 A;  3AEF B;  3OAW A;  4WQO B;  3LDZ E;  1E90 A;  3VUX A;  5AUI A;  3PGE A;  1V9J A;  1WGH A;  4PS7 A;  4A20 A;  2K1F A;  3MC9 A;  4HPM B;  3APF A;  1SGH A;  5LNK 1;  2JZ3 B;  5L83 A;  4ANX A;  1E10 A;  4HRS A;  4OVU A;  2HJ1 A;  2JVC A;  2R2Q A;  1RAX A;  5GMV A;  5DPW A;  4XZ4 A;  5FKA C;  1JAL A;  4RCO A;  3K9P B;  1SSN A;  2IDY A;  1H4R A;  2BPS A;  4KVG B;  2K39 A;  4NJ7 A;  3NJT A;  2IZV B;  3H6N A;  1SBB B;  5J18 A;  1ENF A;  1K53 A;  3PZ7 A;  1WH3 A;  2PJH A;  1UGJ A;  5JXV A;  2FBW B;  3M95 A;  2WXQ A;  2FNJ B;  3GZN B;  1WM2 A;  5C3J B;  2WMF A;  4DXG A;  2O6V D;  1T6B X;  3RNG C;  1MHX A;  2K0P A;  4JIO U;  1P3Q U;  4C80 A;  4W9H A;  1FMA D;  1YNT E;  2XNA C;  1SEB D;  1TIF A;  1P9D U;  2KTR A;  2DBY A;  1D3Z A;  3PLU A;  4HCN B;  1NEK B;  2K8B A;  2I1J A;  3EFC A; 
#chains in the Genus database with same CATH homology
 1JCK B;  4A9A A;  2GRI A;  1XCQ L;  2WXJ A;  4GLS C;  4ZRP A;  3KQ4 A;  4C7Y A;  4MH8 A;  1C4C A;  1EU4 A;  2K5P A;  2WXN A;  4RNA A;  5BMG A;  1XEE A;  1JRO A;  4HJG E;  1FFU A;  4H2A A;  4TQ0 A;  1FCL A;  3TEY A;  3Q8A A;  5BYS A;  2INP E;  4DQO C;  4YT0 B;  2VZK B;  3NS1 A;  1I4R A;  2W3R A;  1WXQ A;  5HG2 A;  3TEW A;  2NMQ A;  1VRA B;  4B0M A;  3B2F A;  3AN1 A;  1SE2 A;  1XLQ A;  4RGO S;  2ACZ B;  2D5G A;  3W5V B;  4A90 A;  1IBX B;  5FR3 A;  2JX5 A;  2Q5W D;  1WSP A;  2N0S B;  1L4Z B;  3BVM A;  4MM3 B;  2QIE B;  1I4H A;  2IJ0 A;  1D5X C;  3BII D;  3NUH B;  3MJ5 A;  1A70 A;  1ZXI A;  2DYO A;  3BZD B;  1EM7 A;  1UWM A;  1PUT A;  2CJO A;  3P1M A;  1N5X A;  1F2R I;  2AQ3 B;  3AEC B;  5D7G A;  1TKG A;  4YTM B;  3B9J A;  3L4P A;  1SF0 A;  4R3D A;  1GAQ B;  1FD6 A;  3ZJT A;  2KAJ A;  2BBC A;  4NAM A;  2LUM A;  2ONQ A;  4UDU C;  1FIQ A;  4DXF A;  1T3Q A;  3GB1 A;  4L23 A;  4ZHP A;  1XLN A;  1C9F A;  2Z8L A;  3U2S C;  1GOZ A;  4REZ A;  5AUK A;  4KKJ A;  1MHH E;  1XLP A;  4IOI E;  1GPX A;  2J52 A;  2KDM A;  2X38 A;  3UI3 A;  1T5X D;  2W3S A;  5BMI A;  4HRO A;  2RDH A;  4LK0 M;  2BYT A;  2V3N A;  2GI9 A;  2RMM A;  5EE9 A;  4WUR A;  1I4Q A;  2BW2 A;  2WXG A;  3WCQ A;  4M0W A;  1NYQ A;  3AEE B;  1VJK A;  4OZA A;  1J7A A;  1L4D B;  3AV8 A;  4YSY B;  4CQN A;  1N5W A;  5HFY A;  1QQR A;  4YSZ B;  1MPE A;  5H92 C;  1N60 A;  2JSV X;  3I57 A;  1HZ6 A;  4OVZ A;  2LGI A;  1FNU A;  2WQY B;  1VZ8 A;  1I7H A;  1FXI A;  2JWU A;  1YN4 A;  1QKZ A;  3T3N A;  2R61 A;  1EU3 A;  4ZHO A;  2K22 A;  2ON8 A;  1JWB D;  1IGC A;  1BXT A;  2M19 A;  2BB6 A;  1WGK A;  3AE1 B;  1NVI D;  1XXG A;  1I4X A;  1AN8 A;  2LJI A;  3AEG B;  3R2T A;  2H89 B;  3W5U B;  2J42 A;  2PVO D;  4NJC A;  2KQ4 X;  1RWS A;  3AEB B;  2J4X A;  1YJJ A;  4LTU A;  1XO3 A;  3SR6 A;  3FAH A;  4RGM A;  2E3T A;  3EA6 A;  3AED B;  3BYY B;  4NZL B;  1STE A;  4XWW A;  2N7J A;  1IGD A;  3DWM A;  5G5H A;  2FUG 1;  1OQQ A;  2JQR B;  2SEB D;  4ITK A;  1V1P A;  1VR9 A;  4XWT A;  2DYM A;  2WXI A;  1C79 A;  4LLG M;  1JRP A;  1ZUD 2;  2JU6 X;  5D3I B;  4ZYS A;  5EE0 A;  2PTL A;  2JXT A;  4HKZ E;  5EE1 A;  2ICI A;  1F2R C;  2WLB A;  1L0X B;  2OHF A;  4YTN B;  4L2Y A;  1XF5 L;  1ET6 A;  3AMZ A;  4OZC A;  2W82 A;  4RGT A;  4N6E B;  2L32 A;  1UWX A;  1J7C A;  2WXH A;  3EGR A;  5I4D A;  5C2T B;  3AE2 B;  1SXT A;  1JW9 D;  1MVK A;  1UNS A;  4RFB A;  4B0E A;  2QSD A;  3NVW A;  4WWM A;  1QOG A;  4US9 A;  1WYG A;  2OED A;  1FM0 D;  4KKI A;  1AW7 A;  3RFZ B;  1C78 A;  1DOI A;  1E7P B;  5BYR A;  2PLP A;  4O1N A;  1SJE D;  3CWI A;  2I2Y A;  1ZPS A;  3AM9 A;  1FXA A;  1ESF A;  4RGN A;  4Q2J A;  2FE8 A;  3VQI A;  1L6U A;  3AB5 A;  4FXC A;  3HUI A;  3U52 E;  4A6Q A;  4MT5 A;  3VRB B;  2PW9 A;  4YXD B;  3ZJU A;  3VRA B;  2IGG A;  2B76 B;  2WXF A;  1E9M A;  3HRD D;  4C7Z A;  5HHD G;  2LMC A;  3SFE B;  3W2D A;  1R7S A;  3N9Y C;  4PT5 A;  1HEZ E;  1QOA A;  3BVZ A;  3LB8 C;  3EUB 2;  2KN4 A;  2N9L A;  2PMV A;  3BK2 A;  1TKY A;  2EKI A;  1TJE A;  4KGR A;  3VR8 B;  1D4B A;  2MJE A;  3P4R B;  3BWU D;  4N59 A;  2INN E;  1VZ7 A;  2KWD A;  2LHE A;  3V3X A;  4US8 A;  3U7Z A;  2K3U A;  2WU2 B;  3TUO A;  4WH4 A;  3C8Y A;  2V4I B;  1QF6 A;  2WU5 B;  1ACC A;  3DWG C;  2I38 A;  3BVG A;  3R8B A;  1C4A A;  2MJD A;  2IGH A;  1DOX A;  4ZOH C;  3IT6 B;  1KFY B;  1AYF A;  3NZ3 A;  3FIL A;  1QIL A;  2HTM E;  3PZ8 A;  3P4S B;  1FFV A;  5H8Y E;  5HI1 A;  4EE2 A;  1HA5 A;  1L6V A;  1VDV A;  1ZXH A;  2WS3 B;  4MAC A;  1RFK A;  3R2I A;  2HDE A;  2PIA A;  1EWC A;  1D5Z C;  4D2K A;  2LFI A;  2BS4 B;  2WXR A;  1RYJ A;  2AQ1 B;  1JWS D;  1KRH A;  1K50 A;  1LO5 D;  3W9C B;  1N63 A;  3I9V 1;  2QIL A;  2AX5 A;  4JE3 B;  1GB1 A;  5D3D A;  1BUI C;  3NVV A;  1ZP0 B;  1UUP A;  2WDV B;  3LXF A;  1FEH A;  2V0G A;  3IAS 1;  3MFG A;  3VR9 B;  3IAM 1;  2J53 A;  4TQ1 A;  2RDG A;  1JWM D;  3AE7 B;  1SIJ A;  4P6V F;  1TS4 A;  4C56 C;  3BK1 A;  3AE9 B;  2LHD A;  2W55 A;  3FIL B;  4GDL B;  2BS3 B;  1QOF A;  1K51 A;  2L83 A;  3H8H A;  2GB1 A;  5TSS A;  2W54 A;  1TY0 A;  4J3O D;  1C4P A;  2MH7 A;  2ZW1 A;  1ZDV A;  3AE6 B;  3ZQ4 A;  1XLO A;  5MPO A;  2BTE A;  2WDQ B;  1PDX A;  3W1S A;  3NVY A;  3PO0 A;  4JPS A;  1TYG B;  3AE5 B;  1YN5 A;  3KWV A;  4AQ7 A;  1HXY D;  1KLU D;  5E6J A;  2QEJ C;  1SB3 C;  4TSS A;  3Q8B A;  4HKQ A;  2WXM A;  2CJN A;  4JWU C;  1J7B A;  2DLB A;  3B2G A;  3MP9 A;  1M4V A;  3SEB A;  2JYE A;  3J9C A;  3NRZ A;  1YN3 A;  2DWQ A;  2VZK D;  4KX6 B;  1L0Y B;  1ROE A;  1FRR A;  2TSS A;  2WNM A;  3AEA B;  1DOY A;  4N58 A;  1RM6 C;  1E0Z A;  3E9S A;  3FC4 A;  4KGT A;  1VLB A;  2RPV A;  1PGA A;  1PGB A;  2WXL A;  3NVZ A;  1OQR A;  1YJI A;  2KMM A;  5BMH A;  1YMH E;  1HQR D;  2BT6 A;  2WXO A;  3Q8E A;  1QT9 A;  4NAW B;  1Q10 A;  2G1E A;  2BS2 B;  3IT4 B;  1FNW A;  3MC0 B;  3TSS A;  1I4P A;  2WDR B;  2QJL A;  2M0A A;  2PVG C;  1D6E C;  1K52 A;  1PYW D;  1SE4 A;  3AH7 A;  4L1B A;  3AE4 B;  2Y5P A;  1TS2 A;  3U4E G;  1NEN B;  1YQ4 B;  2IGD A;  1AWD A;  3P63 A;  1WRI A;  2EEL A;  5EE3 A;  3MHZ A;  4USA A;  3GP7 A;  5T8I A;  3BYT B;  1NI3 A;  4RF1 A;  2K9X A;  1L5P A;  4A55 A;  5FK9 C;  5BYQ A;  2H88 B;  4OZB A;  4OW0 A;  3Q69 A;  3Q8C A;  1JQ4 A;  4WQM A;  3E56 A;  4ZRQ A;  1E6E B;  2WXK A;  4XDD A;  2JYT A;  3ZJV A;  2M56 B;  1XCT L;  4IKG A;  2BB5 A;  1QOB A;  4A8X C;  1TY2 A;  1N61 A;  3AEF B;  1P7E A;  3IXS A;  1KF6 B;  1TS3 A;  3LYY A;  4YTP B;  1P7F A;  4GDK B;  4IDI A;  3URY A;  1JML A;  5GXG B;  3T3O A;  4HEA 1;  1TKE A;  2YEP B;  5AUI A;  1Y56 A;  1IBX A;  1ZDX A;  1I4G A;  1N62 A;  2LEK A;  2V3P A;  2AQ2 B;  1DYQ A;  1DGJ A;  3TEX A;  2ZW0 A;  3KWL A;  1F0Z A;  1JWA D;  1KTK A;  4YSX B;  1V1P B;  1PFD A;  1V1O A;  5LNK 1;  2E6X A;  3TEZ A;  1E10 A;  2SAK A;  4HRS A;  2NTT A;  2NTS A;  2YEP F;  3KLS X;  1IUE A;  2QMT A;  1MI0 A;  1YQ3 B;  5FKA C;  4XDC A;  1JAL A;  4RCO A;  1F77 A;  1SSN A;  2IDY A;  4KGS A;  3SFD B;  3P4P B;  2N9K A;  3ZYY X;  1JWU D;  4TMA B;  3ABV B;  4P16 A;  1C77 A;  1WWT A;  4YWG G;  4RH6 A;  1CJE A;  1VZ6 A;  1SBB B;  3P4Q B;  1QLB B;  1CQV A;  2MEK A;  1ZE3 D;  1NYR A;  1L0V B;  4WIP A;  1FO4 A;  4JX1 C;  1ENF A;  1V8C A;  1D5M C;  1C76 A;  2WXP A;  1K53 A;  3ZGZ A;  3P42 A;  3PZ7 A;  1UGJ A;  5JXV A;  2CU3 A;  2FBW B;  2L1A A;  3HVZ A;  1FNV A;  2MJ3 A;  2JZP A;  4XE0 A;  2WXQ A;  3ETR A;  1ET9 A;  5G5G A;  2Y5C A;  3AE3 B;  3HVD A;  3V05 A;  5C3J B;  1FCC C;  3CIR B;  1ZOY B;  4DXG A;  1B1Z A;  1T6B X;  1MHX A;  2K0P A;  3Q8F A;  1OFF A;  4WAF A;  1FRD A;  1V97 A;  1GB4 A;  1BML C;  2L52 A;  4JWS C;  1B9R A;  1CK1 A;  4C80 A;  1HZ5 A;  1KLG D;  3RPF C;  1KH0 A;  2KAC A;  4ARC A;  3GS2 A;  2PKO A;  1SJH D;  1FMA D;  4ARI A;  1YNT E;  3O13 A;  2XNA C;  1EWY C;  1PGX A;  1SEB D;  1TZO A;  2IPK D;  2WP9 B;  4RF0 A;  1CZP A;  2DBY A;  1NEK B;  2XN9 C;  1SE3 A;  3AE8 B;  2G9H D;  2Y3A A;  3OWE B;  4OHJ A;  4AS1 A;  1TS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...