2YEVC

Structure of caa3-type cytochrome oxidase
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
63
structure length
63
Chain Sequence
VYIALFALGAALVTLFFYLILNPRVLTTEGETFDLRFVLFMLLLILLAAGTVALMLLIGKAHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE POLYPEPTIDE I+III
publication title Structural Insights Into Electron Transfer in Caa3-Type Cytochrome Oxidases.
pubmed doi rcsb
molecule tags Electron transport
total genus 23
structure length 63
sequence length 63
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1350 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2yevC00
2YEVC
chains in the Genus database with same CATH superfamily
4CQIA 2CHOA 3HA4A 3OTOT 4HWFA 2WU2A 4JEUB 1KNPA 4I4TE 5HEJA 1HCIA 1U4QA 3BK9A 4DV1T 2FJAA 3CQCB 4DVDA 4EGWA 4H9RC 2XTLA 2K9AA 4XBFB 3K1SA 2LHNA 4EEDA 3LK2B 5M4YA 4V1Av 3TLWA 5JDMA 2ZM8A 2WWVA 3C4XA 4KBMB 1VCTA 1QLBA 2JQKA 2CCQA 4QHOA 2N2NA 2VASA 5AQJB 3CQXC 3C64A 4YHJA 3IA3A 3O1IA 2BKPA 3HI2A 3D0TA 1CHUA 2IIUA 3PUWF 4ILCA 2IDOB 4JI5T 5CJ5A 4EIWA 2C5JA 2V5CA 3RIUC 3FXDB 3G06A 4XAXB 2J62A 4H9SE 3B13A 2LRKA 4ILAA 5CB4E 3FZFB 5KXJA 3FZLB 2M6BA 2FJEA 4EXTA 4CI3B 2JQQA 4I0UA 3OPCA 2HH7A 2OA5A 3LDQB 3N9PA 1U5PA 4U7IA 1KF6A 1M7KA 2W4XA 2PTFA 5JVDE 3JADA 4DR1T 2LKGA 1I94T 2F4VT 3GMIA 2QVAA 4EZ4A 4QH4A 2V7IA 1OEDE 2H3RA 2Y6XA 2V7JA 4ILUA 2E5LT 2ZMAA 3PE0A 3ZT6A 4H9QC 2IW5B 1FIOA 2A3DA 3NWIA 3PUYF 1WFDA 3RQWA 3JCFA 4JLEA 3P4PA 3PUSA 3MKDA 3RYFE 3Q5EA 1MNEA 3CX8B 2KINB 1UK5A 1O3XA 4IE6A 4KHZF 4YTPA 4U72A 3LJCA 2CWOA 3B5MA 2V6XA 4YTNA 5DQVA 4HWHA 2LT3A 4HFCA 2BS3A 2M6IA 3AA7B 4ZZBA 2LLYA 5CA0E 3C4ZA 1VCSA 1HR0T 3DTOA 4EB6E 4IL4A 3JAEA 4O4LE 2XAGB 1G8XA 4HFEA 2XM1A 5AQTB 1KFYA 3HR0A 3A5XA 5AQPB 1LKXA 1W09A 2WZHA 2CRBA 4CXYA 4JI1T 5LP6E 2A9UA 2WAUA 5H6QB 3ZCIA 1S35A 4JI8T 3PU3A 2G0UA 3SRZA 4ZI2C 4NXMT 4AKLA 2KMFA 2CLYC 4DR5T 4PK6A 1DU2A 4HGAA 4LMLA 2W0GA 1XDPA 2XQAA 5LGUB 2X66A 2CMRA 3X1DA 4ASKA 2VL0A 3VKHA 2WZIA 2FUPA 4TUYE 3RRCA 3AEBA 2V26A 3EVYA 2XAFB 4HFBA 2PFVA 2WU5A 4HFDA 3PUGA 2K48A 1T98A 5FY1A 3UFGA 5CA1E 3PUZF 3RHWA 3MJXA 4HTEA 4JI3T 2W63A 3I0QA 4KMCA 1XMQT 5HEGA 3PURA 3PDYA 2YKSA 2LOSA 1HNXT 2JQ9A 1MIWA 2CXDA 3AAIA 4IHJE 3WAJA 4LF5T 4QXHB 4WNKA 5FVLA 3LK3B 1UGOA 2V7MA 3H37A 4HE8A 3E0ZA 2CWYA 2VWAA 3AVSA 4DV6T 4JI2T 5ABHA 3N2GE 3ANWA 4YSXA 2K3WA 1UX5A 2X0YA 3L09A 2V6YB 5LJMA 4IT4A 2YEVC 4Q25A 3I9WA 2BG9C 5L3DB 2BS4A 2ACXA 2PBIA 4N78D 1XNQT 5LHGB 4X62T 4AXPA 1D0XA 2I6HA 3RRWA 2WDQA 4FI5A 3ZT5A 2V1DB 3OYXA 5HXRA 2DNXA 4HFVA 3DP7A 3CQGB 4I55E 2L8KA 4O8SA 4PJJA 4QXCB 1YQ4A 2D2SA 4DUYT 5JR9A 2MTQA 5AQMB 4WW0A 3SFDA 2E5VA 4NXNT 1NENA 1HTJF 2VK9A 3AEFA 1X9BA 3CK6A 3OVUA 1QUUA 2Q9QB 3KV9A 2MYSA 3UUXB 4IE4A 5C3JA 3CWZB 3RC3A 2B1EA 2OV9A 3QB5K 4JI6T 2WSSV 4OYJA 3RYHE 3N9MA 5C8YE 4B3MT 2NOXA 3CKDA 3V5SA 2WS3A 3VRAA 4DO0A 1ZKEA 4H9OC 5EK3A 4E7ZA 4MHCA 4OHFA 4Z8XA 1N32T 2ODUA 3QC9A 3ZMTB 3TLUA 5AQOB 3BQIA 4DR6T 2YDRA 2X0HA 3HKDE 2E2AA 5E0OA 3MA9A 4DR3T 3AA0B 3K3OA 4DMVA 1SHZC 2NR4A 3UUNA 4TNWA 4DNDA 4P0AA 3AEEA 3AA1B 2VKHA 2E9XD 1N36T 1G73A 3VRBA 3NRXA 2QA7A 2CM0A 4TV8E 5L4HA 4YY3T 4EEBA 1IAPA 3AXJA 3FZMB 1MNDA 2UXXB 3UUMA 3PUVF 1SUMB 4U74A 2M67A 3ZN1B 1HNZT 2JIWA 3RKOA 3Q5WA 3KV5A 2BBHA 2XQ7A 3Q9DA 4EZHA 3N2OA 2WQYA 3L39A 2LE8A 2YDQA 3AEAA 5JDNA 4AKHA 3ZC1A 3P4WA 5AQGB 3EDUA 3IBPA 5ABEA 3JC6D 5LJNA 4LFCT 1Z8UA 5CFBA 5LYJE 4CXWA 3N9QA 1BR0A 2D0TA 3ESLA 4QH5A 1WCRA 3LBXA 1T7SA 2BKNA 4DV4T 2NWBA 4AQFA 3U3IA 4X65T 3ONLC 2XQ3A 3AE5A 3KBUA 4AKRB 3ZMZB 2VL8A 3TLSA 1KEYA 2XQ9A 2YN6A 2C5IT 2MPKA 2W2UA 1UURA 4JUYA 4Z90A 1NEKA 3J7Yq 4X1KE 2J47A 3N2KE 3F57A 1IZNB 4AQYT 1GQEA 4C90A 2LKHA 3Q5XA 3OBVE 3A7MA 2YK0A 3FZKB 3JAFA 5HYAA 4JBWF 3ZJ2A 2LSIA 4J2CA 4ANJA 2FJBA 3TLVA 5IHYA 4ZHQE 2KWIB 3F2EA 1BR4A 2BVMA 4TV9E 3NBXX 4UV9B 3CMLA 2C0SA 4IL9A 5HEUA 3P4RA 3NKZA 4G2AA 4NPPA 5JREA 1YD8G 3HKEE 2DWGA 3RI5A 4PAGA 3PUAA 4HKAA 3O1HA 3UU3A 5FY0A 2LJLA 1WR0A 2W61A 1E2AA 4L5GA 4EAHA 2DI4A 2XASB 2NP9A 2DCFA 4UR9A 5AQHB 5JRCA 2KNDA 3I0OA 3KVAA 2WDVA 3OYZA 4ISTA 1ZP0A 2IHR1 4YJ2E 4LFBT 5DJQC 4ZS2A 3AECA 5ABFA 2GK9A 2IAKA 3EHZA 2YOEA 4YLHA 2UXDT 3SFEA 2ES0A 2RPAA 3ZMSB 5HWYA 3C50A 2E8IA 3N9LA 3RGLA 2VB6A 3KFWX 2MAWA 2XQ6A 3SS1A 1VOMA 4O2BE 2D0UA 2XY8B 4DIDB 2N1GA 5L47A 4OX9T 4U3CA 2CLYB 3PU8A 3RF1A 2UU9T 3H3MA 2WDRA 5DABA 2UXCT 5AQIB 5BMVE 3ZC0A 4A98A 1VRBA 4HFIA 2I59A 4O2AE 4HEAA 4QKNA 4LF4T 3RC8A 2Y48B 1D1AA 3CVRA 1J5ET 5LMUT 4IDOA 3AE1A 5HCMA 4X64T 2AE9A 2SPCA 5JR9B 2X68A 4ZZCA 1HG2A 1YW0A 3Q5DA 4TX5A 4U33A 5LHHB 2LM2A 4HWCA 2IMLA 2E9XA 5GONE 2UUCT 5FYMA 1IBKT 3P4SA 5FXZA 2XM2A 5AQKB 2FBWA 2ODVA 2KSRA 2X9XA 4I50E 4IE0A 4B3RT 1HX8A 4M1PA 1KK7A 5JR9C 4XZCA 4EV6A 4UF0A 2LHRA 4DV5T 4GIWA 5EZYE 2FJDA 5EK2A 4B3TT 4BJMA 2ACZA 5FL0A 1IBMT 4ZXLA 4ZOLE 2Z6EA 2LOPA 5JDLA 4QX8B 4DR7T 2HPLA 2V8SV 4X1IE 2XHEB 3F31A 2K5BB 5FNVE 3LK42 3AE4A 5LXTE 3ZN0B 5JH7E 2N9DA 1EZ3A 4O4JE 5J1GA 2X67A 1MMAA 3FB2A 3AE6A 4COFA 2EHOD 4IGUA 5LG3A 3LSVA 3AAEB 3FXEB 4EYYR 3EABA 4AISA 2BG9B 3UU5A 4IDZA 1IJ5A 2NW8A 4OK0A 5ABGA 1US7B 3ZMUB 3C4WA 3HL6A 5LBMA 4X1YE 4LF6T 4ZS3A 5HEHA 2HN1A 4JEHB 3UU4A 3IHRA 3N9OA 1J1JA 1NWMX 3QOFA 1WR6A 2VKDA 1N34T 2JMHA 3KVBA 3AXJB 2XAJB 3PTRB 4KUMB 1M62A 3MZKB 3W15B 3NZQA 3ZEFB 2NTXA 5FXXA 4ZI7E 3NVOA 5FY7A 3ZT7A 4YTMA 2VVNA 5FXWA 4CI1B 3V5UA 1HG5A 3E22E 5LCYA 4LF9T 2BKOA 1J5WA 4CZZB 4ZI3D 4WZXA 1S94A 5L4EA 5HXCA 3TLTA 4C91A 2IUBA 4DMWA 5H6RB 2XUEA 4DV7T 5LB7B 4IIJE 2W00A 2VURA 4YSYA 2DL1A 2BDEA 3PUXF 5L2LA 2DLRA 1SE7A 5L3EB 2A2FX 3CIRA 4YFSA 5AQRB 3AA6B 1FMVA 3UU6A 3RX6A 1Z0PA 4ERRA 2ZLYA 2X0LB 2L9QA 4O4HE 1L0VA 4UVAB 2VKOA 4H63H 4PK4A 1LRZA 4TWHA 4GOUA 1W0BA 3ZCJA 5JDGA 3LG7A 4AQFC 2LRLA 3RKGA 3NZPA 5LA6E 5IUXA 3AVRA 4WBNE 3FBLA 3VHLA 4H9NC 1ZV4X 2WMNA 2CHNA 5AFUL 3N5LA 5BR8T 2XAQB 4YJ3E 4TWFA 5ETWA 3R84B 4HWDA 3ZLIA 4PW8A 4IDNA 2XQYA 4TWDA 2BG9E 3RIAA 3ZYMA 5FP3A 2MBGA 4X20E 2BS2A 2HPJA 2UXNB 2LSKA 4PK5A 1UUSA 4B6XA 3SOLA 2V6YA 4IREA 3EUHA 2XQ5A 2Y8DA 2NTYA 1OWAA 2D9DA 3PJAJ 2IC6A 4PJLA 4JI0T 5FVKA 4MALA 3N9NA 3AEGA 2YDSA 2J4GA 4KHPT 4K0UA 2BVLA 3EDVA 2YU2A 4DR4T 3BQKA 2CXFA 2LSJA 3GA8A 1D1CA 4CN1A 5ABFB 3I1AA 3L8RA 3RH3A 2QGSA 2LEHA 4ZI3C 4OFZA 4YXDA 4X5TA 4IDQA 2VKJA 2P9BA 4FJOA 4ILBA 2H89A 4JYAT 3KV4A 4CXXA 3J9X1 5JDFA 2QRXA 3EI0A 2XSBA 4L0RA 3VKGA 3UTKA 4PJMA 1E1HB 5LOVE 2YINA 2UUBT 1UCUA 3WAKA 1N33T 4NUVA 4BJNA 2XSAA 3P7IA 5HXEA 2PG8A 2IC9A 4JI7T 2Q9QA 3M3ZB 2DWKA 3ONJA 3K3QC 2EHOA 2X51A 5KMGP 2J1DG 3C51A 4TN7B 1OXZA 1W0AA 4UIGA 2MOZA 4QH1A 5A1LA 4PFPA 4QWNB 4ZI2D 4GK5E 2KLQA 3CPZA 3P4QA 5AQNB 1FMWA 3KBTA 1HX1B 5LMNT 3M65A 4QXBB 2E9XB 4HN9A 5AQUB 1NAFA 5JDHA 3A8YC 3IF8B 5J0ZA 4ADZA 4ISSA 4GKKT 3VU7H 2VVSA 5C2TA 3ZPOA 1XDOA 4UF0B 5EK4A 3SWHA 3QUJA 5FMNA 1WYCA 2E9XC 5LG4A 1KNRA 4U2YA 4CN6A 1QSDA 4UV8B 5F5WA 1YKHB 1OEDA 3P8CD 1MIYA 3T1HT 1HF8A 5AQVB 1ZEEA 3GN5A 1MIVA 3O1JA 5LBQB 4DV0T 4HWIB 2ZM2A 3ZMVB 2VQET 1YQ3A 3S4UA 4L9IA 1HNWT 3R6NA 4G63A 4Z91A 3UULA 4KX6A 2WMOA 3RQUA 3K3NA 4U2ZA 4K0KT 1V9DA 4LMKA 2XQ8A 3CX7B 1WRDA 2KT9A 4CN4A 5L3BB 4A56A 3ZYLA 2PJQA 3AE8A 5LNKA 3ETVA 3AE3A 3ANWB 3KINB 4MLKA 4AIUA 4UEMA 4F6RC 3UFEA 4EYUA 4AKIA 5AQSB 4TZ4C 2V7LA 1LVKA 1R8IA 3RYCE 4DR2T 1IJ6A 4DV3T 3JC6C 4AQGA 5KDMC 2YU1A 5F8PA 5HWXA 3EAMA 3QK6A 1JNRA 3H3AA 3B57A 3WI3A 2WM9A 2AXDS 2XPKA 2OLTA 3ZYKA 3MK7C 1T8BA 3P50A 2LSGA 5LGNB 1T72A 3RIUA 2W66A 4QX7B 4MFRA 2XQ4A 3ZSTA 3O9XA 4A97A 1KNZA 1XNRT 4O4IE 4GYSA 3MACA 3RPUA 2X9WA 3RLFF 3GWHA 3ONXA 5J2UE 5L3GB 5AQFB 4UELA 1MMNA 3CX6B 4F8HA 2UUAT 3AE9A 2CPTA 2NW9A 4ZEYA 2XZEA 4DUZT 2C5KT 2BZBA 3VR8A 3BQLA 1HFAA 1E7PA 3PJAA 1AJ3A 4BAYB 5L3CB 1XZYA 3AB3B 2CE7A 3ETUA 2Q9QD 3ABVA 1WYBA 3K8PC 4JI4T 2CBIA 4UXNB 1X79A 2JQHA 2I0MA 3AE2A 2RA1A 4OYKA 4KP3C 5ADXL 1YKEB 3Q2MA 4YSZA 4H9PC 5HXSA 5FKYA 1Y64B 2A72A 4LF7T 2LM9A 3PUQA 4NUUA 4WBOA 3U78A 1Y01A 4EOZB 3E08A 1CUNA 3QNUA 4MBQA 3C98B 5IWAT 2WY2A 4A5XA 2JPFA 2X9YA 5FL1A 2JMKA 3NRYA 4PNIA 1MMDA 4KI0F 5J2TE 1IBLT 3ZKRA 4P0BA 3UUBA 1WLXA 3OKQA 4B3ST 4X66T 2B76A 4DBQA 2ZM6T 2HHHT 4I43B 2CEAA 1D1BA 1H7CA 3ZJ1A 5JQGE 5TAOA 3FZHB 2KWHA 2W62A 4JV5T 4GK0E 2R6GF 2JRKA 5CGMA 4CI2B 4PJNA 5KX5E 3RIFA 2KXPB 4BA9A 2H7OA 1MMGA 2W67A 4LF8T 4E7SA 5L3FB 1UX4A 4LMJA 2X9HA 3UQ4A 4U31A 1XWMA 1BR1A 2LSYA 2WCAA 4GKJT 2ZM0A 1D0YA 3LBXB 5HEOA 3L3PA 1D0ZA 3AAAB 2WBLA 4P09A 1YXRA 2DHRA 1XMOT 2V5DA 5HXHA 4IE5A 2L3LA 4UVCB 2WWUA 5AQLB 3AEDA 2WB5A 1HS7A 3T1YT 4TNVA 2EHOB 2VQFT 2NW7A 3UU8A 1ZOYA 5LGTB 1W9RA 4DV2T 3RYIE 5AQQB 3TKLB 3DJBA 3IEEA 2CXLA 2RP4A 3T8OA 2Q9QC 2K24A 5HAXA 2H7VC 2H88A 3ZSSA 4H63V 4YHHT 5HCJA 1FJGT 2EHOC 2V7KA 5IYZE 2QYWA 1I6ZA 1ZHCA 4GYRA 4P1NA 1JNZA 3OJAA 5LHIB 4IDPA 2UXBT 3HKCE 2CA5A 3KDSE 1B7TA 5JTGA 3O4XE 1SA0E 2BG9A 5DQWA 2JJ9A 4U7YA 5FXVA 4WYVA 3HKBE 1OEDB 3MXZA 3FHNA 3GN5B 4PFOA 4YT0A 2XAHB 3KV6A 3UT5E 3I9YA 3FBZA 4NIQA 2KZ7B 4AI6A 5JDQA 1LVFA 1OEDC 2XJ7A 3PV0F 4AKGA 1BR2A 1FEWA 5JRCB 3VR9A 2HN2A 4UVBB 3QB5A 2WP9A 3UQ7A 2BBJA 5F3JA 4IE7A 4LFAT 4HFHA 3AE7A 4DBRA 2CBJA 2D5UA 3LFMA
chains in the Genus database with same CATH topology
2HPLA 4CQIA 1QUUA 4X1IE 2XHEB 3F31A 2Q9QB 1V9DA 2K5BB 3CX7B 1WRDA 2KT9A 5L3BB 3HA4A 3KV9A 5FNVE 2MYSA 3LK42 3UUXB 4IE4A 5LXTE 4A56A 3CWZB 4JEUB 3ZYLA 2PJQA 3ZN0B 5JH7E 4I4TE 3RC3A 2N9DA 1EZ3A 2B1EA 4O4JE 2WSSV 5J1GA 1HCIA 1U4QA 3BK9A 4OYJA 5LNKA 3CQCB 4DVDA 3ETVA 3RYHE 4H9RC 3N9MA 5C8YE 2XTLA 2X67A 2K9AA 3ANWB 1MMAA 4XBFB 2NOXA 3KINB 4MLKA 3FB2A 3CKDA 4UEMA 4F6RC 3V5SA 2EHOD 3UFEA 4IGUA 4EYUA 4DO0A 4AKIA 1ZKEA 2LHNA 4TZ4C 2V7LA 3LK2B 4H9OC 4V1Av 1LVKA 3AAEB 5JDMA 2ZM8A 3RYCE 3FXEB 5EK3A 4E7ZA 3C4XA 4MHCA 4EYYR 1IJ6A 4KBMB 3JC6C 4OHFA 4IDZA 4AQGA 4Z8XA 1IJ5A 2NW8A 4OK0A 5KDMC 2YU1A 5F8PA 5HWXA 1US7B 3ZMUB 3C4WA 3HL6A 2ODUA 3QC9A 3ZMTB 2CCQA 3QK6A 5LBMA 3H3AA 3B57A 4QHOA 2N2NA 2VASA 3BQIA 3WI3A 2WM9A 4X1YE 3HKDE 3CQXC 3C64A 4YHJA 3O1IA 4ZS3A 4JEHB 3HI2A 3MA9A 5E0OA 3IHRA 3N9OA 1NWMX 3D0TA 3ZYKA 1WR6A 3AA0B 2VKDA 3K3OA 2JMHA 4DMVA 3MK7C 1SHZC 3KVBA 3UUNA 2XAJB 4DNDA 4P0AA 2LSGA 5LGNB 3AA1B 4EIWA 2VKHA 2C5JA 3PTRB 4KUMB 2E9XD 3FXDB 3MZKB 4QX7B 1G73A 4MFRA 3W15B 4XAXB 4H9SE 3NZQA 3ZEFB 2NTXA 3B13A 5FXXA 4ZI7E 5FY7A 3O9XA 3NRXA 5CB4E 2QA7A 1KNZA 4O4IE 4GYSA 2CM0A 3MACA 4TV8E 2X9WA 3RPUA 3GWHA 3ONXA 4EXTA 5J2UE 5FXWA 4CI3B 5L3GB 4CI1B 1IAPA 3V5UA 1MNDA 2JQQA 4UELA 1HG5A 2UXXB 3E22E 2HH7A 2OA5A 5LCYA 3UUMA 1MMNA 4CZZB 3CX6B 3N9PA 1U5PA 4ZI3D 4U74A 2M67A 3ZN1B 1S94A 5HXCA 5M4YA 3RKOA 2NW9A 3Q5WA 3KV5A 5JVDE 3Q9DA 4EZHA 4C91A 3N2OA 4DMWA 5H6RB 2XUEA 3GMIA 4EZ4A 2LE8A 2C5KT 2BZBA 2V7IA 5JDNA 3BQLA 2H3RA 1HFAA 2Y6XA 4IIJE 2V7JA 1AJ3A 4AKHA 2W00A 4BAYB 5L3CB 4ILUA 2ZMAA 3AB3B 3PE0A 3ZC1A 4H9QC 2IW5B 2CE7A 2BDEA 3ETUA 1FIOA 5L2LA 2A3DA 2Q9QD 3EDUA 3K8PC 1WYBA 2DLRA 3IBPA 5L3EB 2A2FX 4UXNB 1X79A 4YFSA 3JC6D 4JLEA 3PUSA 3AA6B 3MKDA 1FMVA 5LJNA 3RYFE 2RA1A 4OYKA 1MNEA 3CX8B 3RX6A 4KP3C 2KINB 5ADXL 5LYJE 1YKEB 1Z0PA 1O3XA 3Q2MA 4CXWA 4ERRA 2ZLYA 3N9QA 4H9PC 2X0LB 4IE6A 1BR0A 5HXSA 2D0TA 2L9QA 4U72A 3ESLA 4O4HE 3LJCA 2CWOA 3LBXA 4UVAB 1Y64B 2VKOA 4H63H 4PK4A 2A72A 1LRZA 5DQVA 4GOUA 2LT3A 2LM9A 3ZCJA 3PUQA 3AA7B 5JDGA 2NWBA 4NUUA 5CA0E 3LG7A 3C4ZA 4WBOA 4AQFC 3U78A 4AQFA 3U3IA 3NZPA 5LA6E 3DTOA 4EB6E 4EOZB 4AKRB 3KBUA 4O4LE 3ZMZB 2XAGB 3E08A 2VL8A 1CUNA 1G8XA 4MBQA 3C98B 3AVRA 3HR0A 3A5XA 2C5IT 4WBNE 3FBLA 1LKXA 3VHLA 4H9NC 4CXYA 5LP6E 2JPFA 1ZV4X 2WAUA 4JUYA 2X9YA 5H6QB 3ZCIA 2WMNA 3J7Yq 2JMKA 1S35A 5AFUL 3N5LA 3NRYA 4PNIA 4X1KE 2XAQB 4YJ3E 3R84B 5ETWA 3PU3A 1MMDA 3N2KE 5J2TE 3ZLIA 3F57A 1IZNB 2G0UA 4PW8A 3SRZA 2XQYA 4P0BA 4C90A 1WLXA 4ZI2C 3OKQA 4AKLA 4DBQA 2KMFA 2CLYC 3Q5XA 3OBVE 3ZYMA 4PK6A 4I43B 2CEAA 5FP3A 1D1BA 1H7CA 2YK0A 2MBGA 3ZJ1A 4X20E 4HGAA 2HPJA 2UXNB 4PK5A 2LSKA 5HYAA 2W0GA 3ZJ2A 5JQGE 2LSIA 5TAOA 4B6XA 4J2CA 3SOLA 4ANJA 2KWHA 3EUHA 2W62A 5LGUB 5IHYA 4GK0E 2JRKA 4ZHQE 2KWIB 2X66A 3F2EA 1BR4A 2BVMA 4PJNA 4TV9E 4CI2B 2CMRA 3NBXX 2Y8DA 4UV9B 5KX5E 3CMLA 2C0SA 2NTYA 2KXPB 4BA9A 1OWAA 4ASKA 2H7OA 1MMGA 2IC6A 3VKHA 4PJLA 4E7SA 5L3FB 1UX4A 4MALA 2X9HA 3N9NA 4G2AA 4TUYE 5JREA 1YD8G 3HKEE 3RRCA 2DWGA 2V26A 4K0UA 3EVYA 2BVLA 4PAGA 3EDVA 2XAFB 2PFVA 2YU2A 3PUAA 4HKAA 3O1HA 3BQKA 5FY0A 3PUGA 2CXFA 2LJLA 1BR1A 2LSJA 2LSYA 1D1CA 3GA8A 2K48A 1T98A 5FY1A 5CA1E 3I1AA 2W61A 3RH3A 2ZM0A 2QGSA 2LEHA 4ZI3C 4L5GA 1D0YA 4EAHA 4OFZA 2DI4A 2XASB 3LBXB 2NP9A 3L3PA 1D0ZA 3AAAB 2DCFA 2WBLA 3MJXA 4P09A 2DHRA 4HTEA 2VKJA 2W63A 3I0QA 2P9BA 4KMCA 5HXHA 4FJOA 5JRCA 2KNDA 3I0OA 3KV4A 4CXXA 3J9X1 4IE5A 2L3LA 3KVAA 2WWUA 4UVCB 3PURA 3OYZA 4ISTA 5JDFA 4L0RA 3VKGA 3PDYA 3UTKA 4YJ2E 1HS7A 5DJQC 4ZS2A 2LOSA 2EHOB 4PJMA 1E1HB 5LOVE 1MIWA 2GK9A 2CXDA 3AAIA 2NW7A 2IAKA 4IHJE 2YINA 3WAJA 1UCUA 4QXHB 4YLHA 5LGTB 4WNKA 3WAKA 3LK3B 3RYIE 2ES0A 4NUVA 3ZMSB 5HWYA 3DJBA 3C50A 3TKLB 3IEEA 4BJNA 2E8IA 2CXLA 3N9LA 3P7IA 5HXEA 2RP4A 2PG8A 3T8OA 2V7MA 2IC9A 2Q9QC 2Q9QA 2K24A 3H37A 2VB6A 3KFWX 5HAXA 2H7VC 2DWKA 4H63V 3SS1A 1VOMA 4O2BE 2D0UA 4HE8A 3K3QC 3E0ZA 2EHOC 2N1GA 2EHOA 2V7KA 5IYZE 2X51A 2CWYA 5KMGP 2VWAA 3AVSA 2J1DG 2CLYB 3C51A 4TN7B 1OXZA 4UIGA 2MOZA 3PU8A 1ZHCA 3ANWA 3N2GE 4GYRA 5A1LA 4PFPA 1UX5A 3OJAA 4QWNB 4ZI2D 5LHIB 4GK5E 5DABA 2KLQA 3CPZA 3HKCE 3L09A 2CA5A 3KDSE 5LJMA 2YEVC 5BMVE 1B7TA 1FMWA 3KBTA 3ZC0A 1VRBA 3I9WA 3M65A 3O4XE 2I59A 4O2AE 1SA0E 4QXBB 5DQWA 5L3DB 2E9XB 2ACXA 4HN9A 2JJ9A 2PBIA 4HEAA 4QKNA 3RC8A 4N78D 2Y48B 1D1AA 1NAFA 3CVRA 5FXVA 5JDHA 3IF8B 4ADZA 4ISSA 3HKBE 5LHGB 3VU7H 3MXZA 4AXPA 2SPCA 3FHNA 3GN5B 5JR9B 2X68A 3ZPOA 4PFOA 1HG2A 1D0XA 2XAHB 4UF0B 1YW0A 5EK4A 3KV6A 3SWHA 3RRWA 4FI5A 3QUJA 2V1DB 4TX5A 3OYXA 5FMNA 1WYCA 5HXRA 3I9YA 3UT5E 5LHHB 3FBZA 2E9XC 2E9XA 5GONE 5LG4A 5FYMA 2KZ7B 2DNXA 4HFVA 3DP7A 3CQGB 4AI6A 5FXZA 5JDQA 1LVFA 1QSDA 4UV8B 2ODVA 1YKHB 4I55E 2X9XA 2L8KA 3P8CD 4O8SA 1MIYA 4PJJA 1BR2A 4I50E 4IE0A 4AKGA 1FEWA 1HX8A 4M1PA 4QXCB 1KK7A 2D2SA 1HF8A 5JRCB 1ZEEA 5JR9C 3GN5A 5JR9A 2MTQA 1MIVA 3O1JA 4XZCA 4UVBB 4UF0A 5LBQB 2LHRA 2ZM2A 4GIWA 3ZMVB 5EZYE 5EK2A 4WW0A 3S4UA 4BJMA 5F3JA 4IE7A 4L9IA 3R6NA 4G63A 3UULA 2WMOA 4ZOLE 1HTJF 2VK9A 2Z6EA 2LOPA 5JDLA 4DBRA 2D5UA 3LFMA 3K3NA 4QX8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YEV C; 
#chains in the Genus database with same CATH topology
 4CQI A;  2CHO A;  3HA4 A;  3OTO T;  4HWF A;  2WU2 A;  4JEU B;  1KNP A;  4I4T E;  5HEJ A;  1HCI A;  1U4Q A;  3BK9 A;  4DV1 T;  2FJA A;  3CQC B;  4DVD A;  4EGW A;  4H9R C;  2XTL A;  2K9A A;  4XBF B;  3K1S A;  2LHN A;  4EED A;  3LK2 B;  5M4Y A;  4V1A v;  3TLW A;  5JDM A;  2ZM8 A;  2WWV A;  3C4X A;  4KBM B;  1VCT A;  1QLB A;  2JQK A;  2CCQ A;  4QHO A;  2N2N A;  2VAS A;  5AQJ B;  3CQX C;  3C64 A;  4YHJ A;  3IA3 A;  3O1I A;  2BKP A;  3HI2 A;  3D0T A;  1CHU A;  2IIU A;  3PUW F;  4ILC A;  2IDO B;  4JI5 T;  5CJ5 A;  4EIW A;  2C5J A;  2V5C A;  3RIU C;  3FXD B;  3G06 A;  4XAX B;  2J62 A;  4H9S E;  3B13 A;  2LRK A;  4ILA A;  5CB4 E;  3FZF B;  5KXJ A;  3FZL B;  2M6B A;  2FJE A;  4EXT A;  4CI3 B;  2JQQ A;  4I0U A;  3OPC A;  2HH7 A;  2OA5 A;  3LDQ B;  3N9P A;  1U5P A;  4U7I A;  1KF6 A;  1M7K A;  2W4X A;  2PTF A;  5JVD E;  3JAD A;  4DR1 T;  2LKG A;  1I94 T;  2F4V T;  3GMI A;  2QVA A;  4EZ4 A;  4QH4 A;  2V7I A;  1OED E;  2H3R A;  2Y6X A;  2V7J A;  4ILU A;  2E5L T;  2ZMA A;  3PE0 A;  3ZT6 A;  4H9Q C;  2IW5 B;  1FIO A;  2A3D A;  3NWI A;  3PUY F;  1WFD A;  3RQW A;  3JCF A;  4JLE A;  3P4P A;  3PUS A;  3MKD A;  3RYF E;  3Q5E A;  1MNE A;  3CX8 B;  2KIN B;  1UK5 A;  1O3X A;  4IE6 A;  4KHZ F;  4YTP A;  4U72 A;  3LJC A;  2CWO A;  3B5M A;  2V6X A;  4YTN A;  5DQV A;  4HWH A;  2LT3 A;  4HFC A;  2BS3 A;  2M6I A;  3AA7 B;  4ZZB A;  2LLY A;  5CA0 E;  3C4Z A;  1VCS A;  1HR0 T;  3DTO A;  4EB6 E;  4IL4 A;  3JAE A;  4O4L E;  2XAG B;  1G8X A;  4HFE A;  2XM1 A;  5AQT B;  1KFY A;  3HR0 A;  3A5X A;  5AQP B;  1LKX A;  1W09 A;  2WZH A;  2CRB A;  4CXY A;  4JI1 T;  5LP6 E;  2A9U A;  2WAU A;  5H6Q B;  3ZCI A;  1S35 A;  4JI8 T;  3PU3 A;  2G0U A;  3SRZ A;  4ZI2 C;  4NXM T;  4AKL A;  2KMF A;  2CLY C;  4DR5 T;  4PK6 A;  1DU2 A;  4HGA A;  4LML A;  2W0G A;  1XDP A;  2XQA A;  5LGU B;  2X66 A;  2CMR A;  3X1D A;  4ASK A;  2VL0 A;  3VKH A;  2WZI A;  2FUP A;  4TUY E;  3RRC A;  3AEB A;  2V26 A;  3EVY A;  2XAF B;  4HFB A;  2PFV A;  2WU5 A;  4HFD A;  3PUG A;  2K48 A;  1T98 A;  5FY1 A;  3UFG A;  5CA1 E;  3PUZ F;  3RHW A;  3MJX A;  4HTE A;  4JI3 T;  2W63 A;  3I0Q A;  4KMC A;  1XMQ T;  5HEG A;  3PUR A;  3PDY A;  2YKS A;  2LOS A;  1HNX T;  2JQ9 A;  1MIW A;  2CXD A;  3AAI A;  4IHJ E;  3WAJ A;  4LF5 T;  4QXH B;  4WNK A;  5FVL A;  3LK3 B;  1UGO A;  2V7M A;  3H37 A;  4HE8 A;  3E0Z A;  2CWY A;  2VWA A;  3AVS A;  4DV6 T;  4JI2 T;  5ABH A;  3N2G E;  3ANW A;  4YSX A;  2K3W A;  1UX5 A;  2X0Y A;  3L09 A;  2V6Y B;  5LJM A;  4IT4 A;  2YEV C;  4Q25 A;  3I9W A;  2BG9 C;  5L3D B;  2BS4 A;  2ACX A;  2PBI A;  4N78 D;  1XNQ T;  5LHG B;  4X62 T;  4AXP A;  1D0X A;  2I6H A;  3RRW A;  2WDQ A;  4FI5 A;  3ZT5 A;  2V1D B;  3OYX A;  5HXR A;  2DNX A;  4HFV A;  3DP7 A;  3CQG B;  4I55 E;  2L8K A;  4O8S A;  4PJJ A;  4QXC B;  1YQ4 A;  2D2S A;  4DUY T;  5JR9 A;  2MTQ A;  5AQM B;  4WW0 A;  3SFD A;  2E5V A;  4NXN T;  1NEN A;  1HTJ F;  2VK9 A;  3AEF A;  1X9B A;  3CK6 A;  3OVU A;  1QUU A;  2Q9Q B;  3KV9 A;  2MYS A;  3UUX B;  4IE4 A;  5C3J A;  3CWZ B;  3RC3 A;  2B1E A;  2OV9 A;  3QB5 K;  4JI6 T;  2WSS V;  4OYJ A;  3RYH E;  3N9M A;  5C8Y E;  4B3M T;  2NOX A;  3CKD A;  3V5S A;  2WS3 A;  3VRA A;  4DO0 A;  1ZKE A;  4H9O C;  5EK3 A;  4E7Z A;  4MHC A;  4OHF A;  4Z8X A;  1N32 T;  2ODU A;  3QC9 A;  3ZMT B;  3TLU A;  5AQO B;  3BQI A;  4DR6 T;  2YDR A;  2X0H A;  3HKD E;  2E2A A;  5E0O A;  3MA9 A;  4DR3 T;  3AA0 B;  3K3O A;  4DMV A;  1SHZ C;  2NR4 A;  3UUN A;  4TNW A;  4DND A;  4P0A A;  3AEE A;  3AA1 B;  2VKH A;  2E9X D;  1N36 T;  1G73 A;  3VRB A;  3NRX A;  2QA7 A;  2CM0 A;  4TV8 E;  5L4H A;  4YY3 T;  4EEB A;  1IAP A;  3AXJ A;  3FZM B;  1MND A;  2UXX B;  3UUM A;  3PUV F;  1SUM B;  4U74 A;  2M67 A;  3ZN1 B;  1HNZ T;  2JIW A;  3RKO A;  3Q5W A;  3KV5 A;  2BBH A;  2XQ7 A;  3Q9D A;  4EZH A;  3N2O A;  2WQY A;  3L39 A;  2LE8 A;  2YDQ A;  3AEA A;  5JDN A;  4AKH A;  3ZC1 A;  3P4W A;  5AQG B;  3EDU A;  3IBP A;  5ABE A;  3JC6 D;  5LJN A;  4LFC T;  1Z8U A;  5CFB A;  5LYJ E;  4CXW A;  3N9Q A;  1BR0 A;  2D0T A;  3ESL A;  4QH5 A;  1WCR A;  3LBX A;  1T7S A;  2BKN A;  4DV4 T;  2NWB A;  4AQF A;  3U3I A;  4X65 T;  3ONL C;  2XQ3 A;  3AE5 A;  3KBU A;  4AKR B;  3ZMZ B;  2VL8 A;  3TLS A;  1KEY A;  2XQ9 A;  2YN6 A;  2C5I T;  2MPK A;  2W2U A;  1UUR A;  4JUY A;  4Z90 A;  1NEK A;  3J7Y q;  4X1K E;  2J47 A;  3N2K E;  3F57 A;  1IZN B;  4AQY T;  1GQE A;  4C90 A;  2LKH A;  3Q5X A;  3OBV E;  3A7M A;  2YK0 A;  3FZK B;  3JAF A;  5HYA A;  4JBW F;  3ZJ2 A;  2LSI A;  4J2C A;  4ANJ A;  2FJB A;  3TLV A;  5IHY A;  4ZHQ E;  2KWI B;  3F2E A;  1BR4 A;  2BVM A;  4TV9 E;  3NBX X;  4UV9 B;  3CML A;  2C0S A;  4IL9 A;  5HEU A;  3P4R A;  3NKZ A;  4G2A A;  4NPP A;  5JRE A;  1YD8 G;  3HKE E;  2DWG A;  3RI5 A;  4PAG A;  3PUA A;  4HKA A;  3O1H A;  3UU3 A;  5FY0 A;  2LJL A;  1WR0 A;  2W61 A;  1E2A A;  4L5G A;  4EAH A;  2DI4 A;  2XAS B;  2NP9 A;  2DCF A;  4UR9 A;  5AQH B;  5JRC A;  2KND A;  3I0O A;  3KVA A;  2WDV A;  3OYZ A;  4IST A;  1ZP0 A;  2IHR 1;  4YJ2 E;  4LFB T;  5DJQ C;  4ZS2 A;  3AEC A;  5ABF A;  2GK9 A;  2IAK A;  3EHZ A;  2YOE A;  4YLH A;  2UXD T;  3SFE A;  2ES0 A;  2RPA A;  3ZMS B;  5HWY A;  3C50 A;  2E8I A;  3N9L A;  3RGL A;  2VB6 A;  3KFW X;  2MAW A;  2XQ6 A;  3SS1 A;  1VOM A;  4O2B E;  2D0U A;  2XY8 B;  4DID B;  2N1G A;  5L47 A;  4OX9 T;  4U3C A;  2CLY B;  3PU8 A;  3RF1 A;  2UU9 T;  3H3M A;  2WDR A;  5DAB A;  2UXC T;  5AQI B;  5BMV E;  3ZC0 A;  4A98 A;  1VRB A;  4HFI A;  2I59 A;  4O2A E;  4HEA A;  4QKN A;  4LF4 T;  3RC8 A;  2Y48 B;  1D1A A;  3CVR A;  1J5E T;  5LMU T;  4IDO A;  3AE1 A;  5HCM A;  4X64 T;  2AE9 A;  2SPC A;  5JR9 B;  2X68 A;  4ZZC A;  1HG2 A;  1YW0 A;  3Q5D A;  4TX5 A;  4U33 A;  5LHH B;  2LM2 A;  4HWC A;  2IML A;  2E9X A;  5GON E;  2UUC T;  5FYM A;  1IBK T;  3P4S A;  5FXZ A;  2XM2 A;  5AQK B;  2FBW A;  2ODV A;  2KSR A;  2X9X A;  4I50 E;  4IE0 A;  4B3R T;  1HX8 A;  4M1P A;  1KK7 A;  5JR9 C;  4XZC A;  4EV6 A;  4UF0 A;  2LHR A;  4DV5 T;  4GIW A;  5EZY E;  2FJD A;  5EK2 A;  4B3T T;  4BJM A;  2ACZ A;  5FL0 A;  1IBM T;  4ZXL A;  4ZOL E;  2Z6E A;  2LOP A;  5JDL A;  4QX8 B;  4DR7 T;  2HPL A;  2V8S V;  4X1I E;  2XHE B;  3F31 A;  2K5B B;  5FNV E;  3LK4 2;  3AE4 A;  5LXT E;  3ZN0 B;  5JH7 E;  2N9D A;  1EZ3 A;  4O4J E;  5J1G A;  2X67 A;  1MMA A;  3FB2 A;  3AE6 A;  4COF A;  2EHO D;  4IGU A;  5LG3 A;  3LSV A;  3AAE B;  3FXE B;  4EYY R;  3EAB A;  4AIS A;  2BG9 B;  3UU5 A;  4IDZ A;  1IJ5 A;  2NW8 A;  4OK0 A;  5ABG A;  1US7 B;  3ZMU B;  3C4W A;  3HL6 A;  5LBM A;  4X1Y E;  4LF6 T;  4ZS3 A;  5HEH A;  2HN1 A;  4JEH B;  3UU4 A;  3IHR A;  3N9O A;  1J1J A;  1NWM X;  3QOF A;  1WR6 A;  2VKD A;  1N34 T;  2JMH A;  3KVB A;  3AXJ B;  2XAJ B;  3PTR B;  4KUM B;  1M62 A;  3MZK B;  3W15 B;  3NZQ A;  3ZEF B;  2NTX A;  5FXX A;  4ZI7 E;  3NVO A;  5FY7 A;  3ZT7 A;  4YTM A;  2VVN A;  5FXW A;  4CI1 B;  3V5U A;  1HG5 A;  3E22 E;  5LCY A;  4LF9 T;  2BKO A;  1J5W A;  4CZZ B;  4ZI3 D;  4WZX A;  1S94 A;  5L4E A;  5HXC A;  3TLT A;  4C91 A;  2IUB A;  4DMW A;  5H6R B;  2XUE A;  4DV7 T;  5LB7 B;  4IIJ E;  2W00 A;  2VUR A;  4YSY A;  2DL1 A;  2BDE A;  3PUX F;  5L2L A;  2DLR A;  1SE7 A;  5L3E B;  2A2F X;  3CIR A;  4YFS A;  5AQR B;  3AA6 B;  1FMV A;  3UU6 A;  3RX6 A;  1Z0P A;  4ERR A;  2ZLY A;  2X0L B;  2L9Q A;  4O4H E;  1L0V A;  4UVA B;  2VKO A;  4H63 H;  4PK4 A;  1LRZ A;  4TWH A;  4GOU A;  1W0B A;  3ZCJ A;  5JDG A;  3LG7 A;  4AQF C;  2LRL A;  3RKG A;  3NZP A;  5LA6 E;  5IUX A;  3AVR A;  4WBN E;  3FBL A;  3VHL A;  4H9N C;  1ZV4 X;  2WMN A;  2CHN A;  5AFU L;  3N5L A;  5BR8 T;  2XAQ B;  4YJ3 E;  4TWF A;  5ETW A;  3R84 B;  4HWD A;  3ZLI A;  4PW8 A;  4IDN A;  2XQY A;  4TWD A;  2BG9 E;  3RIA A;  3ZYM A;  5FP3 A;  2MBG A;  4X20 E;  2BS2 A;  2HPJ A;  2UXN B;  2LSK A;  4PK5 A;  1UUS A;  4B6X A;  3SOL A;  2V6Y A;  4IRE A;  3EUH A;  2XQ5 A;  2Y8D A;  2NTY A;  1OWA A;  2D9D A;  3PJA J;  2IC6 A;  4PJL A;  4JI0 T;  5FVK A;  4MAL A;  3N9N A;  3AEG A;  2YDS A;  2J4G A;  4KHP T;  4K0U A;  2BVL A;  3EDV A;  2YU2 A;  4DR4 T;  3BQK A;  2CXF A;  2LSJ A;  3GA8 A;  1D1C A;  4CN1 A;  5ABF B;  3I1A A;  3L8R A;  3RH3 A;  2QGS A;  2LEH A;  4ZI3 C;  4OFZ A;  4YXD A;  4X5T A;  4IDQ A;  2VKJ A;  2P9B A;  4FJO A;  4ILB A;  2H89 A;  4JYA T;  3KV4 A;  4CXX A;  3J9X 1;  5JDF A;  2QRX A;  3EI0 A;  2XSB A;  4L0R A;  3VKG A;  3UTK A;  4PJM A;  1E1H B;  5LOV E;  2YIN A;  2UUB T;  1UCU A;  3WAK A;  1N33 T;  4NUV A;  4BJN A;  2XSA A;  3P7I A;  5HXE A;  2PG8 A;  2IC9 A;  4JI7 T;  2Q9Q A;  3M3Z B;  2DWK A;  3ONJ A;  3K3Q C;  2EHO A;  2X51 A;  5KMG P;  2J1D G;  3C51 A;  4TN7 B;  1OXZ A;  1W0A A;  4UIG A;  2MOZ A;  4QH1 A;  5A1L A;  4PFP A;  4QWN B;  4ZI2 D;  4GK5 E;  2KLQ A;  3CPZ A;  3P4Q A;  5AQN B;  1FMW A;  3KBT A;  1HX1 B;  5LMN T;  3M65 A;  4QXB B;  2E9X B;  4HN9 A;  5AQU B;  1NAF A;  5JDH A;  3A8Y C;  3IF8 B;  5J0Z A;  4ADZ A;  4ISS A;  4GKK T;  3VU7 H;  2VVS A;  5C2T A;  3ZPO A;  1XDO A;  4UF0 B;  5EK4 A;  3SWH A;  3QUJ A;  5FMN A;  1WYC A;  2E9X C;  5LG4 A;  1KNR A;  4U2Y A;  4CN6 A;  1QSD A;  4UV8 B;  5F5W A;  1YKH B;  1OED A;  3P8C D;  1MIY A;  3T1H T;  1HF8 A;  5AQV B;  1ZEE A;  3GN5 A;  1MIV A;  3O1J A;  5LBQ B;  4DV0 T;  4HWI B;  2ZM2 A;  3ZMV B;  2VQE T;  1YQ3 A;  3S4U A;  4L9I A;  1HNW T;  3R6N A;  4G63 A;  4Z91 A;  3UUL A;  4KX6 A;  2WMO A;  3RQU A;  3K3N A;  4U2Z A;  4K0K T;  1V9D A;  4LMK A;  2XQ8 A;  3CX7 B;  1WRD A;  2KT9 A;  4CN4 A;  5L3B B;  4A56 A;  3ZYL A;  2PJQ A;  3AE8 A;  5LNK A;  3ETV A;  3AE3 A;  3ANW B;  3KIN B;  4MLK A;  4AIU A;  4UEM A;  4F6R C;  3UFE A;  4EYU A;  4AKI A;  5AQS B;  4TZ4 C;  2V7L A;  1LVK A;  1R8I A;  3RYC E;  4DR2 T;  1IJ6 A;  4DV3 T;  3JC6 C;  4AQG A;  5KDM C;  2YU1 A;  5F8P A;  5HWX A;  3EAM A;  3QK6 A;  1JNR A;  3H3A A;  3B57 A;  3WI3 A;  2WM9 A;  2AXD S;  2XPK A;  2OLT A;  3ZYK A;  3MK7 C;  1T8B A;  3P50 A;  2LSG A;  5LGN B;  1T72 A;  3RIU A;  2W66 A;  4QX7 B;  4MFR A;  2XQ4 A;  3ZST A;  3O9X A;  4A97 A;  1KNZ A;  1XNR T;  4O4I E;  4GYS A;  3MAC A;  3RPU A;  2X9W A;  3RLF F;  3GWH A;  3ONX A;  5J2U E;  5L3G B;  5AQF B;  4UEL A;  1MMN A;  3CX6 B;  4F8H A;  2UUA T;  3AE9 A;  2CPT A;  2NW9 A;  4ZEY A;  2XZE A;  4DUZ T;  2C5K T;  2BZB A;  3VR8 A;  3BQL A;  1HFA A;  1E7P A;  3PJA A;  1AJ3 A;  4BAY B;  5L3C B;  1XZY A;  3AB3 B;  2CE7 A;  3ETU A;  2Q9Q D;  3ABV A;  1WYB A;  3K8P C;  4JI4 T;  2CBI A;  4UXN B;  1X79 A;  2JQH A;  2I0M A;  3AE2 A;  2RA1 A;  4OYK A;  4KP3 C;  5ADX L;  1YKE B;  3Q2M A;  4YSZ A;  4H9P C;  5HXS A;  5FKY A;  1Y64 B;  2A72 A;  4LF7 T;  2LM9 A;  3PUQ A;  4NUU A;  4WBO A;  3U78 A;  1Y01 A;  4EOZ B;  3E08 A;  1CUN A;  3QNU A;  4MBQ A;  3C98 B;  5IWA T;  2WY2 A;  4A5X A;  2JPF A;  2X9Y A;  5FL1 A;  2JMK A;  3NRY A;  4PNI A;  1MMD A;  4KI0 F;  5J2T E;  1IBL T;  3ZKR A;  4P0B A;  3UUB A;  1WLX A;  3OKQ A;  4B3S T;  4X66 T;  2B76 A;  4DBQ A;  2ZM6 T;  2HHH T;  4I43 B;  2CEA A;  1D1B A;  1H7C A;  3ZJ1 A;  5JQG E;  5TAO A;  3FZH B;  2KWH A;  2W62 A;  4JV5 T;  4GK0 E;  2R6G F;  2JRK A;  5CGM A;  4CI2 B;  4PJN A;  5KX5 E;  3RIF A;  2KXP B;  4BA9 A;  2H7O A;  1MMG A;  2W67 A;  4LF8 T;  4E7S A;  5L3F B;  1UX4 A;  4LMJ A;  2X9H A;  3UQ4 A;  4U31 A;  1XWM A;  1BR1 A;  2LSY A;  2WCA A;  4GKJ T;  2ZM0 A;  1D0Y A;  3LBX B;  5HEO A;  3L3P A;  1D0Z A;  3AAA B;  2WBL A;  4P09 A;  1YXR A;  2DHR A;  1XMO T;  2V5D A;  5HXH A;  4IE5 A;  2L3L A;  4UVC B;  2WWU A;  5AQL B;  3AED A;  2WB5 A;  1HS7 A;  3T1Y T;  4TNV A;  2EHO B;  2VQF T;  2NW7 A;  3UU8 A;  1ZOY A;  5LGT B;  1W9R A;  4DV2 T;  3RYI E;  5AQQ B;  3TKL B;  3DJB A;  3IEE A;  2CXL A;  2RP4 A;  3T8O A;  2Q9Q C;  2K24 A;  5HAX A;  2H7V C;  2H88 A;  3ZSS A;  4H63 V;  4YHH T;  5HCJ A;  1FJG T;  2EHO C;  2V7K A;  5IYZ E;  2QYW A;  1I6Z A;  1ZHC A;  4GYR A;  4P1N A;  1JNZ A;  3OJA A;  5LHI B;  4IDP A;  2UXB T;  3HKC E;  2CA5 A;  3KDS E;  1B7T A;  5JTG A;  3O4X E;  1SA0 E;  2BG9 A;  5DQW A;  2JJ9 A;  4U7Y A;  5FXV A;  4WYV A;  3HKB E;  1OED B;  3MXZ A;  3FHN A;  3GN5 B;  4PFO A;  4YT0 A;  2XAH B;  3KV6 A;  3UT5 E;  3I9Y A;  3FBZ A;  4NIQ A;  2KZ7 B;  4AI6 A;  5JDQ A;  1LVF A;  1OED C;  2XJ7 A;  3PV0 F;  4AKG A;  1BR2 A;  1FEW A;  5JRC B;  3VR9 A;  2HN2 A;  4UVB B;  3QB5 A;  2WP9 A;  3UQ7 A;  2BBJ A;  5F3J A;  4IE7 A;  4LFA T;  4HFH A;  3AE7 A;  4DBR A;  2CBJ A;  2D5U A;  3LFM A; 
#chains in the Genus database with same CATH homology
 2HPL A;  4CQI A;  1QUU A;  4X1I E;  2XHE B;  3F31 A;  2Q9Q B;  1V9D A;  2K5B B;  3CX7 B;  1WRD A;  2KT9 A;  5L3B B;  3HA4 A;  3KV9 A;  5FNV E;  2MYS A;  3LK4 2;  3UUX B;  4IE4 A;  5LXT E;  4A56 A;  3CWZ B;  4JEU B;  3ZYL A;  2PJQ A;  3ZN0 B;  5JH7 E;  4I4T E;  3RC3 A;  2N9D A;  1EZ3 A;  2B1E A;  4O4J E;  2WSS V;  5J1G A;  1HCI A;  1U4Q A;  3BK9 A;  4OYJ A;  5LNK A;  3CQC B;  4DVD A;  3ETV A;  3RYH E;  4H9R C;  3N9M A;  5C8Y E;  2XTL A;  2X67 A;  2K9A A;  3ANW B;  1MMA A;  4XBF B;  2NOX A;  3KIN B;  4MLK A;  3FB2 A;  3CKD A;  4UEM A;  4F6R C;  3V5S A;  2EHO D;  3UFE A;  4IGU A;  4EYU A;  4DO0 A;  4AKI A;  1ZKE A;  2LHN A;  4TZ4 C;  2V7L A;  3LK2 B;  4H9O C;  4V1A v;  1LVK A;  3AAE B;  5JDM A;  2ZM8 A;  3RYC E;  3FXE B;  5EK3 A;  4E7Z A;  3C4X A;  4MHC A;  4EYY R;  1IJ6 A;  4KBM B;  3JC6 C;  4OHF A;  4IDZ A;  4AQG A;  4Z8X A;  1IJ5 A;  2NW8 A;  4OK0 A;  5KDM C;  2YU1 A;  5F8P A;  5HWX A;  1US7 B;  3ZMU B;  3C4W A;  3HL6 A;  2ODU A;  3QC9 A;  3ZMT B;  2CCQ A;  3QK6 A;  5LBM A;  3H3A A;  3B57 A;  4QHO A;  2N2N A;  2VAS A;  3BQI A;  3WI3 A;  2WM9 A;  4X1Y E;  3HKD E;  3CQX C;  3C64 A;  4YHJ A;  3O1I A;  4ZS3 A;  4JEH B;  3HI2 A;  3MA9 A;  5E0O A;  3IHR A;  3N9O A;  1NWM X;  3D0T A;  3ZYK A;  1WR6 A;  3AA0 B;  2VKD A;  3K3O A;  2JMH A;  4DMV A;  3MK7 C;  1SHZ C;  3KVB A;  3UUN A;  2XAJ B;  4DND A;  4P0A A;  2LSG A;  5LGN B;  3AA1 B;  4EIW A;  2VKH A;  2C5J A;  3PTR B;  4KUM B;  2E9X D;  3FXD B;  3MZK B;  4QX7 B;  1G73 A;  4MFR A;  3W15 B;  4XAX B;  4H9S E;  3NZQ A;  3ZEF B;  2NTX A;  3B13 A;  5FXX A;  4ZI7 E;  5FY7 A;  3O9X A;  3NRX A;  5CB4 E;  2QA7 A;  1KNZ A;  4O4I E;  4GYS A;  2CM0 A;  3MAC A;  4TV8 E;  2X9W A;  3RPU A;  3GWH A;  3ONX A;  4EXT A;  5J2U E;  5FXW A;  4CI3 B;  5L3G B;  4CI1 B;  1IAP A;  3V5U A;  1MND A;  2JQQ A;  4UEL A;  1HG5 A;  2UXX B;  3E22 E;  2HH7 A;  2OA5 A;  5LCY A;  3UUM A;  1MMN A;  4CZZ B;  3CX6 B;  3N9P A;  1U5P A;  4ZI3 D;  4U74 A;  2M67 A;  3ZN1 B;  1S94 A;  5HXC A;  5M4Y A;  3RKO A;  2NW9 A;  3Q5W A;  3KV5 A;  5JVD E;  3Q9D A;  4EZH A;  4C91 A;  3N2O A;  4DMW A;  5H6R B;  2XUE A;  3GMI A;  4EZ4 A;  2LE8 A;  2C5K T;  2BZB A;  2V7I A;  5JDN A;  3BQL A;  2H3R A;  1HFA A;  2Y6X A;  4IIJ E;  2V7J A;  1AJ3 A;  4AKH A;  2W00 A;  4BAY B;  5L3C B;  4ILU A;  2ZMA A;  3AB3 B;  3PE0 A;  3ZC1 A;  4H9Q C;  2IW5 B;  2CE7 A;  2BDE A;  3ETU A;  1FIO A;  5L2L A;  2A3D A;  2Q9Q D;  3EDU A;  3K8P C;  1WYB A;  2DLR A;  3IBP A;  5L3E B;  2A2F X;  4UXN B;  1X79 A;  4YFS A;  3JC6 D;  4JLE A;  3PUS A;  3AA6 B;  3MKD A;  1FMV A;  5LJN A;  3RYF E;  2RA1 A;  4OYK A;  1MNE A;  3CX8 B;  3RX6 A;  4KP3 C;  2KIN B;  5ADX L;  5LYJ E;  1YKE B;  1Z0P A;  1O3X A;  3Q2M A;  4CXW A;  4ERR A;  2ZLY A;  3N9Q A;  4H9P C;  2X0L B;  4IE6 A;  1BR0 A;  5HXS A;  2D0T A;  2L9Q A;  4U72 A;  3ESL A;  4O4H E;  3LJC A;  2CWO A;  3LBX A;  4UVA B;  1Y64 B;  2VKO A;  4H63 H;  4PK4 A;  2A72 A;  1LRZ A;  5DQV A;  4GOU A;  2LT3 A;  2LM9 A;  3ZCJ A;  3PUQ A;  3AA7 B;  5JDG A;  2NWB A;  4NUU A;  5CA0 E;  3LG7 A;  3C4Z A;  4WBO A;  4AQF C;  3U78 A;  4AQF A;  3U3I A;  3NZP A;  5LA6 E;  3DTO A;  4EB6 E;  4EOZ B;  4AKR B;  3KBU A;  4O4L E;  3ZMZ B;  2XAG B;  3E08 A;  2VL8 A;  1CUN A;  1G8X A;  4MBQ A;  3C98 B;  3AVR A;  3HR0 A;  3A5X A;  2C5I T;  4WBN E;  3FBL A;  1LKX A;  3VHL A;  4H9N C;  4CXY A;  5LP6 E;  2JPF A;  1ZV4 X;  2WAU A;  4JUY A;  2X9Y A;  5H6Q B;  3ZCI A;  2WMN A;  3J7Y q;  2JMK A;  1S35 A;  5AFU L;  3N5L A;  3NRY A;  4PNI A;  4X1K E;  2XAQ B;  4YJ3 E;  3R84 B;  5ETW A;  3PU3 A;  1MMD A;  3N2K E;  5J2T E;  3ZLI A;  3F57 A;  1IZN B;  2G0U A;  4PW8 A;  3SRZ A;  2XQY A;  4P0B A;  4C90 A;  1WLX A;  4ZI2 C;  3OKQ A;  4AKL A;  4DBQ A;  2KMF A;  2CLY C;  3Q5X A;  3OBV E;  3ZYM A;  4PK6 A;  4I43 B;  2CEA A;  5FP3 A;  1D1B A;  1H7C A;  2YK0 A;  2MBG A;  3ZJ1 A;  4X20 E;  4HGA A;  2HPJ A;  2UXN B;  4PK5 A;  2LSK A;  5HYA A;  2W0G A;  3ZJ2 A;  5JQG E;  2LSI A;  5TAO A;  4B6X A;  4J2C A;  3SOL A;  4ANJ A;  2KWH A;  3EUH A;  2W62 A;  5LGU B;  5IHY A;  4GK0 E;  2JRK A;  4ZHQ E;  2KWI B;  2X66 A;  3F2E A;  1BR4 A;  2BVM A;  4PJN A;  4TV9 E;  4CI2 B;  2CMR A;  3NBX X;  2Y8D A;  4UV9 B;  5KX5 E;  3CML A;  2C0S A;  2NTY A;  2KXP B;  4BA9 A;  1OWA A;  4ASK A;  2H7O A;  1MMG A;  2IC6 A;  3VKH A;  4PJL A;  4E7S A;  5L3F B;  1UX4 A;  4MAL A;  2X9H A;  3N9N A;  4G2A A;  4TUY E;  5JRE A;  1YD8 G;  3HKE E;  3RRC A;  2DWG A;  2V26 A;  4K0U A;  3EVY A;  2BVL A;  4PAG A;  3EDV A;  2XAF B;  2PFV A;  2YU2 A;  3PUA A;  4HKA A;  3O1H A;  3BQK A;  5FY0 A;  3PUG A;  2CXF A;  2LJL A;  1BR1 A;  2LSJ A;  2LSY A;  1D1C A;  3GA8 A;  2K48 A;  1T98 A;  5FY1 A;  5CA1 E;  3I1A A;  2W61 A;  3RH3 A;  2ZM0 A;  2QGS A;  2LEH A;  4ZI3 C;  4L5G A;  1D0Y A;  4EAH A;  4OFZ A;  2DI4 A;  2XAS B;  3LBX B;  2NP9 A;  3L3P A;  1D0Z A;  3AAA B;  2DCF A;  2WBL A;  3MJX A;  4P09 A;  2DHR A;  4HTE A;  2VKJ A;  2W63 A;  3I0Q A;  2P9B A;  4KMC A;  5HXH A;  4FJO A;  5JRC A;  2KND A;  3I0O A;  3KV4 A;  4CXX A;  3J9X 1;  4IE5 A;  2L3L A;  3KVA A;  2WWU A;  4UVC B;  3PUR A;  3OYZ A;  4IST A;  5JDF A;  4L0R A;  3VKG A;  3PDY A;  3UTK A;  4YJ2 E;  1HS7 A;  5DJQ C;  4ZS2 A;  2LOS A;  2EHO B;  4PJM A;  1E1H B;  5LOV E;  1MIW A;  2GK9 A;  2CXD A;  3AAI A;  2NW7 A;  2IAK A;  4IHJ E;  2YIN A;  3WAJ A;  1UCU A;  4QXH B;  4YLH A;  5LGT B;  4WNK A;  3WAK A;  3LK3 B;  3RYI E;  2ES0 A;  4NUV A;  3ZMS B;  5HWY A;  3DJB A;  3C50 A;  3TKL B;  3IEE A;  4BJN A;  2E8I A;  2CXL A;  3N9L A;  3P7I A;  5HXE A;  2RP4 A;  2PG8 A;  3T8O A;  2V7M A;  2IC9 A;  2Q9Q C;  2Q9Q A;  2K24 A;  3H37 A;  2VB6 A;  3KFW X;  5HAX A;  2H7V C;  2DWK A;  4H63 V;  3SS1 A;  1VOM A;  4O2B E;  2D0U A;  4HE8 A;  3K3Q C;  3E0Z A;  2EHO C;  2N1G A;  2EHO A;  2V7K A;  5IYZ E;  2X51 A;  2CWY A;  5KMG P;  2VWA A;  3AVS A;  2J1D G;  2CLY B;  3C51 A;  4TN7 B;  1OXZ A;  4UIG A;  2MOZ A;  3PU8 A;  1ZHC A;  3ANW A;  3N2G E;  4GYR A;  5A1L A;  4PFP A;  1UX5 A;  3OJA A;  4QWN B;  4ZI2 D;  5LHI B;  4GK5 E;  5DAB A;  2KLQ A;  3CPZ A;  3HKC E;  3L09 A;  2CA5 A;  3KDS E;  5LJM A;  2YEV C;  5BMV E;  1B7T A;  1FMW A;  3KBT A;  3ZC0 A;  1VRB A;  3I9W A;  3M65 A;  3O4X E;  2I59 A;  4O2A E;  1SA0 E;  4QXB B;  5DQW A;  5L3D B;  2E9X B;  2ACX A;  4HN9 A;  2JJ9 A;  2PBI A;  4HEA A;  4QKN A;  3RC8 A;  4N78 D;  2Y48 B;  1D1A A;  1NAF A;  3CVR A;  5FXV A;  5JDH A;  3IF8 B;  4ADZ A;  4ISS A;  3HKB E;  5LHG B;  3VU7 H;  3MXZ A;  4AXP A;  2SPC A;  3FHN A;  3GN5 B;  5JR9 B;  2X68 A;  3ZPO A;  4PFO A;  1HG2 A;  1D0X A;  2XAH B;  4UF0 B;  1YW0 A;  5EK4 A;  3KV6 A;  3SWH A;  3RRW A;  4FI5 A;  3QUJ A;  2V1D B;  4TX5 A;  3OYX A;  5FMN A;  1WYC A;  5HXR A;  3I9Y A;  3UT5 E;  5LHH B;  3FBZ A;  2E9X C;  2E9X A;  5GON E;  5LG4 A;  5FYM A;  2KZ7 B;  2DNX A;  4HFV A;  3DP7 A;  3CQG B;  4AI6 A;  5FXZ A;  5JDQ A;  1LVF A;  1QSD A;  4UV8 B;  2ODV A;  1YKH B;  4I55 E;  2X9X A;  2L8K A;  3P8C D;  4O8S A;  1MIY A;  4PJJ A;  1BR2 A;  4I50 E;  4IE0 A;  4AKG A;  1FEW A;  1HX8 A;  4M1P A;  4QXC B;  1KK7 A;  2D2S A;  1HF8 A;  5JRC B;  1ZEE A;  5JR9 C;  3GN5 A;  5JR9 A;  2MTQ A;  1MIV A;  3O1J A;  4XZC A;  4UVB B;  4UF0 A;  5LBQ B;  2LHR A;  2ZM2 A;  4GIW A;  3ZMV B;  5EZY E;  5EK2 A;  4WW0 A;  3S4U A;  4BJM A;  5F3J A;  4IE7 A;  4L9I A;  3R6N A;  4G63 A;  3UUL A;  2WMO A;  4ZOL E;  1HTJ F;  2VK9 A;  2Z6E A;  2LOP A;  5JDL A;  4DBR A;  2D5U A;  3LFM A;  3K3N A;  4QX8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...