2YEVC

Structure of caa3-type cytochrome oxidase
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
63
structure length
63
Chain Sequence
b'VYIALFALGAALVTLFFYLILNPRVLTTEGETFDLRFVLFMLLLILLAAGTVALMLLIGKAHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE POLYPEPTIDE I+III
publication title Structural Insights Into Electron Transfer in Caa3-Type Cytochrome Oxidases.
pubmed doi rcsb
molecule tags Electron transport
total genus 23
structure length 63
sequence length 63
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1350 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2yevC00
2YEVC
chains in the Genus database with same CATH superfamily
2G0UA 3LBXB 5FP3A 4NPPA 2M67A 1IBMT 5LHGB 1YXRA 3E08A 4J2CA 3K1SA 1U5PA 4L5GA 4EZHA 3NRYA 2PJQA 3AB3B 3UU6A 3O1IA 2X66A 2KLQA 2L9QA 2SPCA 4IE4A 3N2OA 2X9WA 3K8PC 3PUXF 4BJNA 3Q9DA 2MYSA 1YKHB 3LJCA 4Z90A 4EXTA 1BR4A 2NR4A 3VR9A 1FMVA 1O3XA 3KBTA 5LMNT 3WAJA 1HX8A 5C2TA 1ZKEA 4JI4T 2BS3A 5HEGA 3O9XA 2MTQA 2I6HA 5LGNB 1WRDA 2W0GA 2I59A 2MOZA 3SRZA 2CPTA 4GK5E 2WWVA 2ZM2A 4AKGA 2YU1A 2PBIA 2R6GF 1KK7A 3L3PA 3C51A 4MLKA 3B57A 4HEAA 2WM9A 3PJAJ 2WCAA 3WI3A 2XSBA 2IW5B 3FBLA 3QNUA 3KVBA 3PDYA 2ACZA 4ILAA 4CN6A 2LOPA 4A5XA 1UUSA 2V7MA 1E7PA 4DR1T 5L3BB 4YSYA 4ZI7E 3R6NA 2E9XC 2KWHA 2LSKA 5E0OA 3N5LA 5CGMA 2LSYA 1JNZA 4GYSA 4PK5A 5IWAT 5LHHB 3QB5K 5HEUA 4I55E 3RIUC 2D9DA 2BBJA 3CX7B 1D1AA 2ZLYA 1I94T 2KWIB 4IGUA 3KV4A 3D0TA 1XMOT 3N9OA 2CWOA 4O4LE 5LYJE 4B3MT 4YT0A 2E2AA 3UU5A 5LOVE 2X68A 5AQOB 3W15B 3IF8B 5AQFB 5AQQB 3AAAB 3NZPA 2FUPA 2BBHA 3K3NA 4IDQA 2KINB 1Y64B 5JDLA 1SUMB 2VL0A 5J2UE 3RYCE 4CI1B 4X66T 5JR9B 2CM0A 1D0YA 2WSSV 4QXHB 4CN4A 2XZEA 5FL0A 2FJAA 4O4HE 1XDPA 4EYYR 3RIAA 2Z6EA 4NXNT 2LHNA 5M4YA 5CA1E 1WR0A 5EK2A 2IIUA 2LSJA 2XQ9A 3AA0B 1OEDB 4IL4A 3EVYA 1FJGT 2BG9E 4TWHA 4B3ST 1R8IA 5JREA 5ABHA 4E7SA 4YLHA 5BR8T 2H89A 3ONXA 5HXSA 4C90A 1VOMA 5HWXA 3RQUA 1WCRA 3E22E 3UUXB 3ZSTA 5KX5E 2XTLA 2JPFA 4ERRA 3OBVE 1ZEEA 2V8SV 4DIDB 2XQ5A 4ZI2C 4QHOA 4JI3T 4IREA 3U78A 2C5JA 1XZYA 4U2ZA 2YKSA 3NKZA 2IHR1 3RHWA 3KINB 1FEWA 3TLTA 1M7KA 5CB4E 2YINA 4OYKA 4JV5T 4GK0E 2YDRA 5TAOA 3BQKA 3HI2A 2X0YA 1CHUA 5FL1A 2RP4A 3UFGA 2NW7A 2XAGB 2KXPB 4TNVA 5FVKA 3OVUA 4ASKA 2H3RA 1NWMX 2CXFA 3AEFA 3HR0A 2DI4A 5L3GB 1HX1B 4UIGA 4DR7T 3TKLB 2WB5A 2L8KA 3PJAA 3T8OA 2YDSA 3AEEA 2E9XD 4H9OC 4IE7A 3PE0A 4X1KE 2M6BA 4AQGA 4U2YA 3DP7A 1QUUA 3CWZB 2BG9A 4LMJA 2ZM8A 4PFOA 3TLSA 2XAFB 4X1IE 2IDOB 3BK9A 3VRBA 5EK4A 4DBQA 1XMQT 1BR2A 3QUJA 4EAHA 2Q9QA 4CXYA 1OWAA 3L39A 4P0BA 3ZMUB 4IT4A 4U72A 4OHFA 4B6XA 3HKEE 3JAFA 4UVCB 4P1NA 1M62A 1YW0A 4DR4T 1T8BA 4P0AA 2UXCT 3ZMTB 3F31A 3K3OA 2YDQA 2PTFA 3MACA 2PG8A 3FZMB 3UUBA 3RC3A 1HG5A 4H9RC 4PJLA 4H9SE 3C4XA 2WDRA 4AQYT 4L9IA 4KX6A 2WZHA 3P4PA 4U31A 2XAQB 3AVRA 4YSZA 4TV9E 4TWDA 5AQKB 5HCJA 3RX6A 1MNDA 2XASB 5HXCA 4UR9A 3O1HA 4DR2T 4JEUB 5LA6E 2LSGA 3J7Yq 3TLUA 4LMKA 3IBPA 1W0AA 3M3ZB 1LKXA 1N32T 4AQFC 2WDQA 5LMUT 2B1EA 3Q5DA 4L0RA 1EZ3A 4NIQA 4IDNA 4AKIA 2UUAT 2CEAA 2B76A 4XBFB 4DMWA 3S4UA 3H3MA 4QXBB 2ODVA 3RPUA 4A56A 3B5MA 2X0LB 3GWHA 4ZI2D 2BKPA 3BQLA 4KBMB 3KBUA 4YSXA 4JI1T 3P4QA 2BVLA 5JRCA 1HNXT 4HFDA 3EAMA 4KHPT 1UX5A 4JI8T 3AVSA 5EZYE 4KMCA 1MMDA 3CKDA 4YHHT 3ONJA 5AQLB 3MK7C 4UF0A 3RGLA 5KXJA 1ZOYA 3HA4A 3ZT6A 3CX8B 4ISTA 5AQMB 3HKDE 2ES0A 5JDNA 5AQVB 4BJMA 3N2KE 2KZ7B 4ADZA 3FXDB 4IHJE 2V7KA 3WAKA 3ZKRA 4UEMA 2LRLA 1E2AA 1D1BA 1FIOA 3AE2A 2NWBA 5IHYA 2LKGA 2AE9A 3AEGA 4EOZB 5DQVA 2QA7A 1XDOA 2EHOB 2LJLA 2D5UA 4H63H 4NUUA 2A9UA 3FZHB 3P7IA 2OA5A 4LF4T 4YTNA 4WW0A 3AE7A 4CI3B 2XAJB 2KMFA 2RA1A 5HEHA 2XQ6A 3ZSSA 2XQYA 4HWCA 5FMNA 3DTOA 1L0VA 2E8IA 4WYVA 2YK0A 5LB7B 1AJ3A 5J1GA 5HEOA 4DV6T 2ZM6T 3JAEA 2VQET 3LDQB 2NTXA 2KNDA 3FB2A 3UU4A 4ZEYA 2BKNA 2WP9A 2CLYC 3RLFF 2QVAA 3T1YT 3KV5A 2H7OA 2V6XA 4JI7T 3ZLIA 2VB6A 3NZQA 4QX8B 4LMLA 3RYHE 3V5UA 2J1DG 1US7B 2V7JA 3LK3B 5LP6E 3AE3A 3R84B 3E0ZA 1WYBA 3PUYF 5CFBA 2UXNB 5HEJA 4ISSA 4GOUA 2Y8DA 3N9LA 3ZN0B 3FZLB 2BG9B 4KUMB 3PUQA 5L3CB 3BQIA 3AAIA 4O8SA 4IE5A 3H3AA 3P8CD 2VQFT 5L3FB 4GYRA 2NW9A 2BZBA 4HFHA 3AXJA 1W9RA 1U4QA 1HNWT 4YJ3E 4DR3T 3ZMSB 2Q9QB 3OYXA 2HPLA 3OTOT 2NP9A 4K0KT 4LF6T 5LBMA 4DBRA 5FKYA 2QRXA 4U33A 2E5LT 3OKQA 3UTKA 5DQWA 3KV9A 2N1GA 5DABA 4PJNA 5C3JA 4CQIA 2CCQA 1YKEB 3ABVA 2K5BB 2Q9QC 3CQXC 4DO0A 1T7SA 3KVAA 2V7IA 1T98A 2LM9A 3SOLA 5F5WA 4TUYE 4IDOA 4IIJE 2VKJA 5F8PA 5LJNA 2CA5A 1IBKT 1YD8G 4AISA 3T1HT 3FHNA 2VWAA 4XZCA 3PV0F 4QKNA 3AAEB 3A5XA 5AFUL 2VASA 2IMLA 3RF1A 1HS7A 5FXZA 2CBIA 4IDZA 4DR6T 3VKHA 5ABGA 3RRWA 3VR8A 1V9DA 1KNRA 4WZXA 1UGOA 2QYWA 2XQ3A 5IYZE 3RYIE 2ZM0A 4HWIB 4PJMA 3I0OA 4LF5T 3JADA 5JRCB 5JR9C 3AE9A 4O2BE 5HXRA 2F4VT 5JDHA 4WNKA 1H7CA 4JEHB 4QX7B 5C8YE 5HYAA 2JQQA 4YJ2E 4UF0B 2I0MA 2K9AA 3LFMA 1WR6A 3N9QA 2YN6A 4TZ4C 3PUGA 5HWYA 2X9XA 5ABEA 2EHOA 4X62T 1BR0A 4O4IE 3UU8A 4A98A 5AQPB 1NEKA 3ZC0A 4TX5A 3QC9A 2FJBA 4DV4T 4A97A 1OEDC 3CQCB 2DL1A 2H7VC 5AQTB 3EABA 1LVKA 2Y48B 5L4HA 3C50A 4TN7B 3MZKB 2A72A 2XSAA 4AKHA 4NXMT 4EZ4A 2WBLA 3Q5XA 5HAXA 3I9YA 3UQ7A 4DR5T 3RYFE 3N9MA 3MXZA 2WMOA 1J5ET 3O4XE 4EEDA 5CA0E 5AQHB 3PUAA 3DJBA 1IJ6A 1Y01A 2CRBA 4WBOA 4LFAT 2DWGA 3NVOA 3RQWA 2LT3A 4AKRB 2W2UA 5IUXA 1SHZC 1MMAA 3ZYKA 3U3IA 2VURA 2V26A 3P4RA 1W0BA 3Q5EA 4E7ZA 3ZYMA 1MIVA 1G8XA 4KP3C 2V7LA 2Q9QD 1XNRT 2H88A 2HHHT 1D0XA 3J9X1 3QB5A 2E9XA 3G06A 3NBXX 4KI0F 4JUYA 5L47A 2VKDA 3ANWA 1N36T 3FXEB 1HTJF 2W62A 1G73A 4DMVA 2VVNA 2YU2A 4ZZBA 2DLRA 3VRAA 3LK42 3RIUA 3RC8A 4AI6A 3AXJB 2LEHA 5AQRB 1SE7A 4FJOA 3SFDA 4OX9T 1NAFA 5FXVA 2P9BA 4ZZCA 2FJEA 5AQNB 4GIWA 2BVMA 3RH3A 4HFBA 3OYZA 2CHOA 4ZHQE 4DV0T 3FBZA 1ZV4X 2YOEA 3I9WA 3F57A 5LBQB 5JDFA 2D0UA 4HTEA 4PNIA 4X20E 1WLXA 4O4JE 3HL6A 2C0SA 1DU2A 2V5DA 4BA9A 5JVDE 3PUSA 2C5IT 2WY2A 4XAXB 4QXCB 4EGWA 2J4GA 2MPKA 4JI0T 4OK0A 2JIWA 4H9NC 4CN1A 3ZYLA 1MNEA 3CIRA 3RI5A 2PFVA 3ZCJA 5AQIB 4I50E 1GQEA 2ZMAA 3ZT5A 2X67A 4EV6A 2CWYA 4B3TT 5JQGE 4CZZB 4EIWA 4GKKT 1XNQT 4H9PC 3PUZF 4ZOLE 1CUNA 1KEYA 2XM2A 1VCSA 3UULA 2BDEA 3M65A 5FY7A 4V1Av 5JDMA 5ABFA 3OPCA 2OLTA 4MFRA 3PU8A 2RPAA 2XQ4A 3QOFA 4UVAB 3HKCE 1ZP0A 4PW8A 4ZXLA 2Y6XA 2WWUA 4TV8E 3C98B 5LG3A 2XHEB 3N2GE 3NRXA 3JCFA 2CBJA 3VHLA 4LFBT 1QLBA 2K3WA 4YTMA 2WQYA 2BKOA 2HH7A 3ZC1A 3CMLA 4ILBA 3ZN1B 2XQAA 2KSRA 1YQ4A 4HWFA 4X64T 3P4WA 2EHOC 2UXXB 4UVBB 1VCTA 1MIWA 1FMWA 4F8HA 2JQ9A 3QK6A 2LSIA 5ADXL 5L2LA 3PTRB 2HN1A 2WU5A 3ZT7A 1NENA 4K0UA 2V6YA 4CXWA 4P09A 2WAUA 5LJMA 3ETUA 4AIUA 4QWNB 4EYUA 1KFYA 4UV9B 2VKHA 3Q5WA 1LVFA 3ESLA 4HE8A 2K24A 2NOXA 3IHRA 3ONLC 3ZJ1A 2JRKA 2WZIA 2V1DB 2NTYA 3PURA 3OJAA 4YFSA 3FZFB 4WBNE 3EI0A 2OV9A 3EDUA 2X51A 4YXDA 3PUWF 5AQUB 5J2TE 4QH5A 4B3RT 2E9XB 3N9NA 3ANWB 3UFEA 4DNDA 1N33T 3JC6C 1SA0E 3MKDA 3AEBA 3LG7A 2XAHB 3CPZA 3O1JA 4JBWF 4CXXA 4BAYB 3F2EA 2BG9C 1T72A 3ETVA 2WS3A 4ILUA 3CQGB 5HXHA 2LLYA 1J1JA 4H63V 4U74A 4IL9A 3UT5E 4CI2B 4DV5T 4M1PA 2NW8A 4H9QC 4PK4A 4IDPA 1D0ZA 3P4SA 4AQFA 3KDSE 2ODUA 2UUBT 1ZHCA 3L09A 4KHZF 2JMHA 4G2AA 5ETWA 1HNZT 3SFEA 5CJ5A 3HKBE 4DVDA 1Z8UA 2JQKA 2D2SA 1D1CA 5JDQA 4ILCA 1W09A 2LOSA 4UV8B 2HN2A 4X5TA 5L4EA 4LF9T 3C4WA 4X65T 4IE6A 2IUBA 1IBLT 3ZEFB 4F6RC 4PAGA 4G63A 1N34T 4DV3T 5HXEA 3AEDA 3N9PA 2MBGA 1MMNA 1S94A 2JMKA 4MBQA 3P50A 2W63A 2W66A 4PK6A 5EK3A 2JQHA 3ZJ2A 5LGUB 5LGTB 3AE6A 5JH7E 3GN5B 2DNXA 1WFDA 1KNZA 2UXBT 4Z91A 1VRBA 3AA1B 4I4TE 2XJ7A 5AQJB 3X1DA 3VU7H 2EHOD 1UURA 2VK9A 4U7IA 4Q25A 3A8YC 5ABFB 5KMGP 4TWFA 1UX4A 3L8RA 4ANJA 2W4XA 3I1AA 2XQ7A 3AA7B 3UQ4A 2XM1A 3MJXA 4YY3T 3AEAA 3K3QC 5LG4A 2DCFA 4ZI3C 1X9BA 5FYMA 1S35A 1HFAA 3PU3A 4AXPA 5J0ZA 1QSDA 4UELA 2WU2A 2CMRA 4DUZT 5JTGA 3LBXA 1XWMA 3C64A 1YQ3A 2VKOA 2QGSA 2MAWA 4I0UA 3AA6B 1LRZA 4MALA 4U7YA 4AKLA 2ACXA 4HFIA 3Q2MA 3TLWA 3SS1A 2VL8A 1WYCA 3VKGA 3CX6B 2LM2A 1OXZA 3NWIA 4EEBA 3MA9A 3JC6D 1MMGA 3EUHA 3ZMZB 2W00A 2LHRA 2LE8A 1HF8A 4LF7T 5F3JA 1JNRA 2CXDA 4JLEA 5L3EB 4X1YE 2DHRA 2V6YB 2BS4A 4DV1T 3SWHA 5FXWA 3RKOA 1E1HB 1Z0PA 2LKHA 1HG2A 5LCYA 4ZS2A 1X79A 2UXDT 5JDGA 5FY0A 5LNKA 2FJDA 1B7TA 5FNVE 2X9HA 4GKJT 4PJJA 2X9YA 3KV6A 4HKAA 3EDVA 1HCIA 4UXNB 4DUYT 4MHCA 5AQSB 5A1LA 1OEDE 4U3CA 2BS2A 3AE8A 3LSVA 3AECA 2JJ9A 5KDMC 3GMIA 5GONE 2IAKA 2XQ8A 4I43B 4N78D 4IE0A 5AQGB 3RRCA 4OYJA 1KF6A 2CXLA 3UUNA 4HFVA 3AE5A 2IC9A 2C5KT 1UK5A 3ZPOA 2UU9T 3H37A 2VVSA 2W67A 4LF8T 4LFCT 2LRKA 1BR1A 4COFA 1IZNB 2M6IA 5LXTE 5L3DB 5H6QB 1UCUA 4DV2T 2J62A 3RIFA 2XY8B 4JYAT 3IEEA 4HFCA 2N2NA 4NUVA 4QH4A 2KT9A 3ZCIA 2AXDS 2GK9A 2K48A 3ZMVB 4O2AE 3PUVF 4EB6E 3EHZA 2CHNA 2A2FX 1IJ5A 5JR9A 2D0TA 2DWKA 3C4ZA 5HCMA 5FXXA 4DV7T 1MIYA 3GN5A 4HWHA 4ZI3D 4TNWA 1I6ZA 4QH1A 3AE4A 3GA8A 3TLVA 2UUCT 3KFWX 4C91A 4Z8XA 4JI5T 2E5VA 4YTPA 2L3LA 4PFPA 4HFEA 4HGAA 5LHIB 3UU3A 4YHJA 1OEDA 3CVRA 4HN9A 5DJQC 2YEVC 3AE1A 4ZS3A 1J5WA 1KNPA 3V5SA 5FVLA 2WMNA 4OFZA 3IA3A 2XPKA 3B13A 4JI6T 3FZKB 2J47A 3A7MA 2XUEA 3UUMA 2N9DA 2CE7A 2W61A 2X0HA 3LK2B 4JI2T 1IAPA 3CK6A 5FY1A 2IC6A 3RKGA 4HWDA 3I0QA 2A3DA 2FBWA 2WDVA 4FI5A 5H6RB 5BMVE 2V5CA 2CLYB 2HPJA 1HR0T
chains in the Genus database with same CATH topology
2G0UA 3RYFE 2XAQB 3LBXB 5FP3A 3AVRA 4TV9E 2M67A 5LHGB 2D2SA 1D1CA 3RX6A 1MNDA 2XASB 3E08A 3N9MA 4J2CA 3MXZA 5HXCA 5JDQA 3O1HA 2LOSA 4UV8B 2WMOA 1U5PA 3O4XE 3C4WA 4IE6A 4JEUB 4L5GA 5LA6E 4EZHA 2LSGA 3NRYA 2PJQA 3AB3B 3O1IA 3ZEFB 3J7Yq 4F6RC 2X66A 2KLQA 3IBPA 5CA0E 2L9QA 1LKXA 2SPCA 4AQFC 4IE4A 4PAGA 3PUAA 4G63A 2B1EA 4L0RA 1EZ3A 3DJBA 3N2OA 5HXEA 2X9WA 3K8PC 1IJ6A 3N9PA 4BJNA 3Q9DA 4AKIA 2MBGA 2MYSA 2CEAA 1MMNA 1YKHB 1S94A 4WBOA 2JMKA 4XBFB 3LJCA 2DWGA 4MBQA 4EXTA 1BR4A 4DMWA 1FMVA 2W63A 4PK6A 3S4UA 1O3XA 5EK3A 3ZJ2A 3KBTA 4QXBB 5LGUB 2ODVA 5LGTB 2LT3A 4AKRB 3RPUA 4A56A 5JH7E 3WAJA 2X0LB 1HX8A 3GWHA 4ZI2D 1ZKEA 3BQLA 1SHZC 3GN5B 1MMAA 3ZYKA 2DNXA 4KBMB 3KBUA 3U3IA 2V26A 1KNZA 3O9XA 2MTQA 2BVLA 4E7ZA 5JRCA 5LGNB 1VRBA 1WRDA 2W0GA 3AA1B 4I4TE 3ZYMA 1MIVA 1G8XA 4KP3C 2V7LA 1UX5A 2I59A 2Q9QD 3AVSA 2MOZA 5EZYE 3SRZA 1D0XA 3J9X1 4KMCA 1MMDA 2E9XA 3VU7H 3NBXX 3CKDA 4JUYA 2EHOD 2VKDA 2VK9A 3ANWA 3MK7C 4GK5E 3FXEB 4UF0A 1HTJF 2W62A 2ZM2A 3HA4A 4AKGA 2YU1A 1G73A 2PBIA 1KK7A 3L3PA 4DMVA 5KMGP 2YU2A 3C51A 3CX8B 4MLKA 2DLRA 3B57A 4HEAA 1UX4A 4ISTA 2WM9A 4ANJA 3LK42 3HKDE 3RC8A 2ES0A 3I1AA 4AI6A 5JDNA 3WI3A 4BJMA 2LEHA 3N2KE 3AA7B 2IW5B 4FJOA 2KZ7B 4ADZA 3FBLA 1NAFA 3KVBA 5FXVA 3PDYA 3FXDB 4IHJE 2V7KA 2P9BA 3WAKA 4UEMA 3MJXA 1D1BA 1FIOA 3K3QC 2LOPA 5LG4A 4GIWA 2BVMA 2DCFA 2NWBA 3RH3A 2V7MA 3OYZA 5IHYA 4EOZB 4ZHQE 5DQVA 4ZI3C 5L3BB 2QA7A 4ZI7E 5FYMA 2EHOB 2LJLA 2D5UA 1S35A 2E9XC 4H63H 3R6NA 1HFAA 3PU3A 4AXPA 4NUUA 2KWHA 2LSKA 1QSDA 3FBZA 3P7IA 5E0OA 2OA5A 4UELA 1ZV4X 3N5LA 4WW0A 2LSYA 2CMRA 4GYSA 4PK5A 4CI3B 3I9WA 3F57A 2XAJB 5LBQB 5LHHB 2KMFA 4I55E 5JDFA 2D0UA 4HTEA 4PNIA 2RA1A 4X20E 3LBXA 3CX7B 3C64A 1WLXA 4O4JE 2XQYA 3HL6A 2VKOA 2QGSA 1D1AA 5FMNA 3DTOA 3AA6B 2C0SA 1LRZA 2ZLYA 4MALA 2E8IA 4BA9A 2KWIB 4IGUA 3KV4A 5JVDE 2YK0A 3D0TA 1AJ3A 4AKLA 5J1GA 2ACXA 3PUSA 3Q2MA 3N9OA 3SS1A 2C5IT 2VL8A 2CWOA 4XAXB 4O4LE 1WYCA 5LYJE 3CX6B 4QXCB 3VKGA 2NTXA 2KNDA 5LOVE 2X68A 1OXZA 3FB2A 3W15B 3IF8B 3MA9A 3JC6D 1MMGA 3AAAB 3EUHA 3NZPA 2CLYC 2LHRA 2W00A 2LE8A 4OK0A 3ZMZB 3K3NA 1HF8A 4H9NC 5F3JA 2CXDA 4JLEA 2KINB 3ZYLA 1Y64B 1MNEA 5JDLA 3KV5A 5L3EB 2H7OA 2PFVA 4X1YE 3ZLIA 2DHRA 5J2UE 3ZCJA 3RYCE 4I50E 4CI1B 2ZMAA 2VB6A 3NZQA 4QX8B 5JR9B 2CM0A 1D0YA 3SWHA 2WSSV 2X67A 4QXHB 5FXWA 3RKOA 1E1HB 1Z0PA 2CWYA 5JQGE 4CZZB 4EIWA 3RYHE 3V5UA 1HG2A 2J1DG 4H9PC 5LCYA 1US7B 2V7JA 3LK3B 4ZS2A 5LP6E 1X79A 4ZOLE 1CUNA 3R84B 3E0ZA 1WYBA 5JDGA 5FY0A 2UXNB 4O4HE 5LNKA 4ISSA 4EYYR 4GOUA 2Y8DA 1B7TA 3N9LA 3UULA 5FNVE 2X9HA 3ZN0B 2Z6EA 2BDEA 3M65A 4PJJA 5FY7A 2LHNA 5M4YA 5CA1E 4KUMB 4V1Av 3PUQA 5JDMA 2X9YA 5L3CB 3BQIA 3KV6A 3AAIA 5EK2A 4O8SA 4IE5A 3H3AA 2LSJA 3AA0B 3P8CD 3PU8A 4MFRA 4HKAA 3EDVA 5L3FB 3EVYA 1HCIA 4GYRA 2NW9A 2BZBA 4UXNB 5JREA 4E7SA 4YLHA 1U4QA 4MHCA 5A1LA 3ONXA 4YJ3E 4UVAB 3HKCE 2JJ9A 5HXSA 3ZMSB 2Q9QB 4PW8A 3OYXA 5KDMC 3GMIA 5GONE 2HPLA 2IAKA 2WWUA 2Y6XA 1VOMA 2NP9A 4C90A 5HWXA 4TV8E 4I43B 5LBMA 4N78D 4IE0A 4DBRA 3C98B 3E22E 3RRCA 4OYJA 3UUXB 2CXLA 3OKQA 5KX5E 3UTKA 3UUNA 2XHEB 4HFVA 2XTLA 5DQWA 3N2GE 3NRXA 2IC9A 3KV9A 2JPFA 3VHLA 4ERRA 2N1GA 3OBVE 1ZEEA 2C5KT 4ZI2C 4QHOA 5DABA 3ZPOA 3H37A 3U78A 2C5JA 2HH7A 4PJNA 3ZC1A 3CMLA 3KINB 1BR1A 4CQIA 1IZNB 2CCQA 3ZN1B 1YKEB 1FEWA 5CB4E 5LXTE 2K5BB 5L3DB 2YINA 4OYKA 2Q9QC 5H6QB 4GK0E 3CQXC 4DO0A 1UCUA 5TAOA 3KVAA 3BQKA 2V7IA 3HI2A 3IEEA 2EHOC 1T98A 2UXXB 2LM9A 3SOLA 2N2NA 4UVBB 4NUVA 4TUYE 1MIWA 2RP4A 4IIJE 1FMWA 2VKJA 2NW7A 2XAGB 2KXPB 5F8PA 2KT9A 3QK6A 2LSIA 3ZCIA 2GK9A 5LJNA 4ASKA 2K48A 3ZMVB 2CA5A 5ADXL 2H3RA 1YD8G 5L2LA 3PTRB 1NWMX 2CXFA 4O2AE 3FHNA 4EB6E 2VWAA 4XZCA 4K0UA 3HR0A 2DI4A 5L3GB 2A2FX 1IJ5A 4CXWA 4P09A 4QKNA 2WAUA 3A5XA 3AAEB 3ETUA 5LJMA 5JR9A 4QWNB 2D0TA 2DWKA 4UIGA 3C4ZA 2VASA 4EYUA 5AFUL 3TKLB 4UV9B 1HS7A 5FXXA 2L8KA 5FXZA 3T8OA 2VKHA 1MIYA 3GN5A 4IDZA 3Q5WA 1LVFA 4ZI3D 3VKHA 3ESLA 4HE8A 2K24A 3RRWA 2NOXA 2E9XD 4H9OC 3IHRA 1V9DA 4IE7A 3PE0A 3ZJ1A 2JRKA 4X1KE 2V1DB 4AQGA 3GA8A 2NTYA 3DP7A 1QUUA 3CWZB 3KFWX 3PURA 4C91A 5IYZE 3OJAA 4Z8XA 3RYIE 2ZM0A 4YFSA 4WBNE 2L3LA 4PFPA 4PJMA 4HGAA 2ZM8A 5LHIB 3I0OA 4PFOA 4YHJA 3CVRA 4HN9A 5DJQC 2XAFB 5JRCB 2YEVC 3EDUA 4X1IE 5JR9C 2X51A 4O2BE 5HXRA 4ZS3A 5JDHA 3BK9A 4WNKA 1H7CA 3V5SA 5J2TE 2WMNA 4OFZA 5EK4A 4JEHB 4QX7B 2E9XB 5C8YE 4DBQA 3N9NA 5HYAA 3ANWB 2JQQA 1BR2A 4YJ2E 3B13A 4UF0B 3UFEA 4DNDA 3QUJA 4EAHA 2Q9QA 3JC6C 2K9AA 4CXYA 1SA0E 3LFMA 1WR6A 1OWAA 2XUEA 3MKDA 3N9QA 3LG7A 4P0BA 4TZ4C 3UUMA 3ZMUB 2N9DA 4U72A 3PUGA 2CE7A 2XAHB 3CPZA 3O1JA 4OHFA 5HWYA 2X9XA 4B6XA 4CXXA 2EHOA 2W61A 3F2EA 4BAYB 3LK2B 1BR0A 3HKEE 1IAPA 4O4IE 3ETVA 4UVCB 5FY1A 2IC6A 4ILUA 3ZC0A 3CQGB 1YW0A 4TX5A 5HXHA 3QC9A 3I0QA 2A3DA 3CQCB 4P0AA 4H63V 2H7VC 3ZMTB 4U74A 4FI5A 3F31A 3K3OA 3UT5E 1LVKA 4CI2B 2Y48B 3MACA 2PG8A 3C50A 4M1PA 4TN7B 2NW8A 4H9QC 3MZKB 4PK4A 3RC3A 2A72A 1HG5A 1D0ZA 4AQFA 3KDSE 4AKHA 5H6RB 2ODUA 4H9RC 4EZ4A 2WBLA 3Q5XA 1ZHCA 3L09A 4PJLA 5BMVE 2JMHA 4G2AA 4H9SE 5ETWA 5HAXA 3I9YA 3C4XA 2CLYB 2HPJA 4L9IA 3HKBE 4DVDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YEV C; 
#chains in the Genus database with same CATH topology
 2G0U A;  3LBX B;  5FP3 A;  4NPP A;  2M67 A;  1IBM T;  5LHG B;  1YXR A;  3E08 A;  4J2C A;  3K1S A;  1U5P A;  4L5G A;  4EZH A;  3NRY A;  2PJQ A;  3AB3 B;  3UU6 A;  3O1I A;  2X66 A;  2KLQ A;  2L9Q A;  2SPC A;  4IE4 A;  3N2O A;  2X9W A;  3K8P C;  3PUX F;  4BJN A;  3Q9D A;  2MYS A;  1YKH B;  3LJC A;  4Z90 A;  4EXT A;  1BR4 A;  2NR4 A;  3VR9 A;  1FMV A;  1O3X A;  3KBT A;  5LMN T;  3WAJ A;  1HX8 A;  5C2T A;  1ZKE A;  4JI4 T;  2BS3 A;  5HEG A;  3O9X A;  2MTQ A;  2I6H A;  5LGN B;  1WRD A;  2W0G A;  2I59 A;  2MOZ A;  3SRZ A;  2CPT A;  4GK5 E;  2WWV A;  2ZM2 A;  4AKG A;  2YU1 A;  2PBI A;  2R6G F;  1KK7 A;  3L3P A;  3C51 A;  4MLK A;  3B57 A;  4HEA A;  2WM9 A;  3PJA J;  2WCA A;  3WI3 A;  2XSB A;  2IW5 B;  3FBL A;  3QNU A;  3KVB A;  3PDY A;  2ACZ A;  4ILA A;  4CN6 A;  2LOP A;  4A5X A;  1UUS A;  2V7M A;  1E7P A;  4DR1 T;  5L3B B;  4YSY A;  4ZI7 E;  3R6N A;  2E9X C;  2KWH A;  2LSK A;  5E0O A;  3N5L A;  5CGM A;  2LSY A;  1JNZ A;  4GYS A;  4PK5 A;  5IWA T;  5LHH B;  3QB5 K;  5HEU A;  4I55 E;  3RIU C;  2D9D A;  2BBJ A;  3CX7 B;  1D1A A;  2ZLY A;  1I94 T;  2KWI B;  4IGU A;  3KV4 A;  3D0T A;  1XMO T;  3N9O A;  2CWO A;  4O4L E;  5LYJ E;  4B3M T;  4YT0 A;  2E2A A;  3UU5 A;  5LOV E;  2X68 A;  5AQO B;  3W15 B;  3IF8 B;  5AQF B;  5AQQ B;  3AAA B;  3NZP A;  2FUP A;  2BBH A;  3K3N A;  4IDQ A;  2KIN B;  1Y64 B;  5JDL A;  1SUM B;  2VL0 A;  5J2U E;  3RYC E;  4CI1 B;  4X66 T;  5JR9 B;  2CM0 A;  1D0Y A;  2WSS V;  4QXH B;  4CN4 A;  2XZE A;  5FL0 A;  2FJA A;  4O4H E;  1XDP A;  4EYY R;  3RIA A;  2Z6E A;  4NXN T;  2LHN A;  5M4Y A;  5CA1 E;  1WR0 A;  5EK2 A;  2IIU A;  2LSJ A;  2XQ9 A;  3AA0 B;  1OED B;  4IL4 A;  3EVY A;  1FJG T;  2BG9 E;  4TWH A;  4B3S T;  1R8I A;  5JRE A;  5ABH A;  4E7S A;  4YLH A;  5BR8 T;  2H89 A;  3ONX A;  5HXS A;  4C90 A;  1VOM A;  5HWX A;  3RQU A;  1WCR A;  3E22 E;  3UUX B;  3ZST A;  5KX5 E;  2XTL A;  2JPF A;  4ERR A;  3OBV E;  1ZEE A;  2V8S V;  4DID B;  2XQ5 A;  4ZI2 C;  4QHO A;  4JI3 T;  4IRE A;  3U78 A;  2C5J A;  1XZY A;  4U2Z A;  2YKS A;  3NKZ A;  2IHR 1;  3RHW A;  3KIN B;  1FEW A;  3TLT A;  1M7K A;  5CB4 E;  2YIN A;  4OYK A;  4JV5 T;  4GK0 E;  2YDR A;  5TAO A;  3BQK A;  3HI2 A;  2X0Y A;  1CHU A;  5FL1 A;  2RP4 A;  3UFG A;  2NW7 A;  2XAG B;  2KXP B;  4TNV A;  5FVK A;  3OVU A;  4ASK A;  2H3R A;  1NWM X;  2CXF A;  3AEF A;  3HR0 A;  2DI4 A;  5L3G B;  1HX1 B;  4UIG A;  4DR7 T;  3TKL B;  2WB5 A;  2L8K A;  3PJA A;  3T8O A;  2YDS A;  3AEE A;  2E9X D;  4H9O C;  4IE7 A;  3PE0 A;  4X1K E;  2M6B A;  4AQG A;  4U2Y A;  3DP7 A;  1QUU A;  3CWZ B;  2BG9 A;  4LMJ A;  2ZM8 A;  4PFO A;  3TLS A;  2XAF B;  4X1I E;  2IDO B;  3BK9 A;  3VRB A;  5EK4 A;  4DBQ A;  1XMQ T;  1BR2 A;  3QUJ A;  4EAH A;  2Q9Q A;  4CXY A;  1OWA A;  3L39 A;  4P0B A;  3ZMU B;  4IT4 A;  4U72 A;  4OHF A;  4B6X A;  3HKE E;  3JAF A;  4UVC B;  4P1N A;  1M62 A;  1YW0 A;  4DR4 T;  1T8B A;  4P0A A;  2UXC T;  3ZMT B;  3F31 A;  3K3O A;  2YDQ A;  2PTF A;  3MAC A;  2PG8 A;  3FZM B;  3UUB A;  3RC3 A;  1HG5 A;  4H9R C;  4PJL A;  4H9S E;  3C4X A;  2WDR A;  4AQY T;  4L9I A;  4KX6 A;  2WZH A;  3P4P A;  4U31 A;  2XAQ B;  3AVR A;  4YSZ A;  4TV9 E;  4TWD A;  5AQK B;  5HCJ A;  3RX6 A;  1MND A;  2XAS B;  5HXC A;  4UR9 A;  3O1H A;  4DR2 T;  4JEU B;  5LA6 E;  2LSG A;  3J7Y q;  3TLU A;  4LMK A;  3IBP A;  1W0A A;  3M3Z B;  1LKX A;  1N32 T;  4AQF C;  2WDQ A;  5LMU T;  2B1E A;  3Q5D A;  4L0R A;  1EZ3 A;  4NIQ A;  4IDN A;  4AKI A;  2UUA T;  2CEA A;  2B76 A;  4XBF B;  4DMW A;  3S4U A;  3H3M A;  4QXB B;  2ODV A;  3RPU A;  4A56 A;  3B5M A;  2X0L B;  3GWH A;  4ZI2 D;  2BKP A;  3BQL A;  4KBM B;  3KBU A;  4YSX A;  4JI1 T;  3P4Q A;  2BVL A;  5JRC A;  1HNX T;  4HFD A;  3EAM A;  4KHP T;  1UX5 A;  4JI8 T;  3AVS A;  5EZY E;  4KMC A;  1MMD A;  3CKD A;  4YHH T;  3ONJ A;  5AQL B;  3MK7 C;  4UF0 A;  3RGL A;  5KXJ A;  1ZOY A;  3HA4 A;  3ZT6 A;  3CX8 B;  4IST A;  5AQM B;  3HKD E;  2ES0 A;  5JDN A;  5AQV B;  4BJM A;  3N2K E;  2KZ7 B;  4ADZ A;  3FXD B;  4IHJ E;  2V7K A;  3WAK A;  3ZKR A;  4UEM A;  2LRL A;  1E2A A;  1D1B A;  1FIO A;  3AE2 A;  2NWB A;  5IHY A;  2LKG A;  2AE9 A;  3AEG A;  4EOZ B;  5DQV A;  2QA7 A;  1XDO A;  2EHO B;  2LJL A;  2D5U A;  4H63 H;  4NUU A;  2A9U A;  3FZH B;  3P7I A;  2OA5 A;  4LF4 T;  4YTN A;  4WW0 A;  3AE7 A;  4CI3 B;  2XAJ B;  2KMF A;  2RA1 A;  5HEH A;  2XQ6 A;  3ZSS A;  2XQY A;  4HWC A;  5FMN A;  3DTO A;  1L0V A;  2E8I A;  4WYV A;  2YK0 A;  5LB7 B;  1AJ3 A;  5J1G A;  5HEO A;  4DV6 T;  2ZM6 T;  3JAE A;  2VQE T;  3LDQ B;  2NTX A;  2KND A;  3FB2 A;  3UU4 A;  4ZEY A;  2BKN A;  2WP9 A;  2CLY C;  3RLF F;  2QVA A;  3T1Y T;  3KV5 A;  2H7O A;  2V6X A;  4JI7 T;  3ZLI A;  2VB6 A;  3NZQ A;  4QX8 B;  4LML A;  3RYH E;  3V5U A;  2J1D G;  1US7 B;  2V7J A;  3LK3 B;  5LP6 E;  3AE3 A;  3R84 B;  3E0Z A;  1WYB A;  3PUY F;  5CFB A;  2UXN B;  5HEJ A;  4ISS A;  4GOU A;  2Y8D A;  3N9L A;  3ZN0 B;  3FZL B;  2BG9 B;  4KUM B;  3PUQ A;  5L3C B;  3BQI A;  3AAI A;  4O8S A;  4IE5 A;  3H3A A;  3P8C D;  2VQF T;  5L3F B;  4GYR A;  2NW9 A;  2BZB A;  4HFH A;  3AXJ A;  1W9R A;  1U4Q A;  1HNW T;  4YJ3 E;  4DR3 T;  3ZMS B;  2Q9Q B;  3OYX A;  2HPL A;  3OTO T;  2NP9 A;  4K0K T;  4LF6 T;  5LBM A;  4DBR A;  5FKY A;  2QRX A;  4U33 A;  2E5L T;  3OKQ A;  3UTK A;  5DQW A;  3KV9 A;  2N1G A;  5DAB A;  4PJN A;  5C3J A;  4CQI A;  2CCQ A;  1YKE B;  3ABV A;  2K5B B;  2Q9Q C;  3CQX C;  4DO0 A;  1T7S A;  3KVA A;  2V7I A;  1T98 A;  2LM9 A;  3SOL A;  5F5W A;  4TUY E;  4IDO A;  4IIJ E;  2VKJ A;  5F8P A;  5LJN A;  2CA5 A;  1IBK T;  1YD8 G;  4AIS A;  3T1H T;  3FHN A;  2VWA A;  4XZC A;  3PV0 F;  4QKN A;  3AAE B;  3A5X A;  5AFU L;  2VAS A;  2IML A;  3RF1 A;  1HS7 A;  5FXZ A;  2CBI A;  4IDZ A;  4DR6 T;  3VKH A;  5ABG A;  3RRW A;  3VR8 A;  1V9D A;  1KNR A;  4WZX A;  1UGO A;  2QYW A;  2XQ3 A;  5IYZ E;  3RYI E;  2ZM0 A;  4HWI B;  4PJM A;  3I0O A;  4LF5 T;  3JAD A;  5JRC B;  5JR9 C;  3AE9 A;  4O2B E;  5HXR A;  2F4V T;  5JDH A;  4WNK A;  1H7C A;  4JEH B;  4QX7 B;  5C8Y E;  5HYA A;  2JQQ A;  4YJ2 E;  4UF0 B;  2I0M A;  2K9A A;  3LFM A;  1WR6 A;  3N9Q A;  2YN6 A;  4TZ4 C;  3PUG A;  5HWY A;  2X9X A;  5ABE A;  2EHO A;  4X62 T;  1BR0 A;  4O4I E;  3UU8 A;  4A98 A;  5AQP B;  1NEK A;  3ZC0 A;  4TX5 A;  3QC9 A;  2FJB A;  4DV4 T;  4A97 A;  1OED C;  3CQC B;  2DL1 A;  2H7V C;  5AQT B;  3EAB A;  1LVK A;  2Y48 B;  5L4H A;  3C50 A;  4TN7 B;  3MZK B;  2A72 A;  2XSA A;  4AKH A;  4NXM T;  4EZ4 A;  2WBL A;  3Q5X A;  5HAX A;  3I9Y A;  3UQ7 A;  4DR5 T;  3RYF E;  3N9M A;  3MXZ A;  2WMO A;  1J5E T;  3O4X E;  4EED A;  5CA0 E;  5AQH B;  3PUA A;  3DJB A;  1IJ6 A;  1Y01 A;  2CRB A;  4WBO A;  4LFA T;  2DWG A;  3NVO A;  3RQW A;  2LT3 A;  4AKR B;  2W2U A;  5IUX A;  1SHZ C;  1MMA A;  3ZYK A;  3U3I A;  2VUR A;  2V26 A;  3P4R A;  1W0B A;  3Q5E A;  4E7Z A;  3ZYM A;  1MIV A;  1G8X A;  4KP3 C;  2V7L A;  2Q9Q D;  1XNR T;  2H88 A;  2HHH T;  1D0X A;  3J9X 1;  3QB5 A;  2E9X A;  3G06 A;  3NBX X;  4KI0 F;  4JUY A;  5L47 A;  2VKD A;  3ANW A;  1N36 T;  3FXE B;  1HTJ F;  2W62 A;  1G73 A;  4DMV A;  2VVN A;  2YU2 A;  4ZZB A;  2DLR A;  3VRA A;  3LK4 2;  3RIU A;  3RC8 A;  4AI6 A;  3AXJ B;  2LEH A;  5AQR B;  1SE7 A;  4FJO A;  3SFD A;  4OX9 T;  1NAF A;  5FXV A;  2P9B A;  4ZZC A;  2FJE A;  5AQN B;  4GIW A;  2BVM A;  3RH3 A;  4HFB A;  3OYZ A;  2CHO A;  4ZHQ E;  4DV0 T;  3FBZ A;  1ZV4 X;  2YOE A;  3I9W A;  3F57 A;  5LBQ B;  5JDF A;  2D0U A;  4HTE A;  4PNI A;  4X20 E;  1WLX A;  4O4J E;  3HL6 A;  2C0S A;  1DU2 A;  2V5D A;  4BA9 A;  5JVD E;  3PUS A;  2C5I T;  2WY2 A;  4XAX B;  4QXC B;  4EGW A;  2J4G A;  2MPK A;  4JI0 T;  4OK0 A;  2JIW A;  4H9N C;  4CN1 A;  3ZYL A;  1MNE A;  3CIR A;  3RI5 A;  2PFV A;  3ZCJ A;  5AQI B;  4I50 E;  1GQE A;  2ZMA A;  3ZT5 A;  2X67 A;  4EV6 A;  2CWY A;  4B3T T;  5JQG E;  4CZZ B;  4EIW A;  4GKK T;  1XNQ T;  4H9P C;  3PUZ F;  4ZOL E;  1CUN A;  1KEY A;  2XM2 A;  1VCS A;  3UUL A;  2BDE A;  3M65 A;  5FY7 A;  4V1A v;  5JDM A;  5ABF A;  3OPC A;  2OLT A;  4MFR A;  3PU8 A;  2RPA A;  2XQ4 A;  3QOF A;  4UVA B;  3HKC E;  1ZP0 A;  4PW8 A;  4ZXL A;  2Y6X A;  2WWU A;  4TV8 E;  3C98 B;  5LG3 A;  2XHE B;  3N2G E;  3NRX A;  3JCF A;  2CBJ A;  3VHL A;  4LFB T;  1QLB A;  2K3W A;  4YTM A;  2WQY A;  2BKO A;  2HH7 A;  3ZC1 A;  3CML A;  4ILB A;  3ZN1 B;  2XQA A;  2KSR A;  1YQ4 A;  4HWF A;  4X64 T;  3P4W A;  2EHO C;  2UXX B;  4UVB B;  1VCT A;  1MIW A;  1FMW A;  4F8H A;  2JQ9 A;  3QK6 A;  2LSI A;  5ADX L;  5L2L A;  3PTR B;  2HN1 A;  2WU5 A;  3ZT7 A;  1NEN A;  4K0U A;  2V6Y A;  4CXW A;  4P09 A;  2WAU A;  5LJM A;  3ETU A;  4AIU A;  4QWN B;  4EYU A;  1KFY A;  4UV9 B;  2VKH A;  3Q5W A;  1LVF A;  3ESL A;  4HE8 A;  2K24 A;  2NOX A;  3IHR A;  3ONL C;  3ZJ1 A;  2JRK A;  2WZI A;  2V1D B;  2NTY A;  3PUR A;  3OJA A;  4YFS A;  3FZF B;  4WBN E;  3EI0 A;  2OV9 A;  3EDU A;  2X51 A;  4YXD A;  3PUW F;  5AQU B;  5J2T E;  4QH5 A;  4B3R T;  2E9X B;  3N9N A;  3ANW B;  3UFE A;  4DND A;  1N33 T;  3JC6 C;  1SA0 E;  3MKD A;  3AEB A;  3LG7 A;  2XAH B;  3CPZ A;  3O1J A;  4JBW F;  4CXX A;  4BAY B;  3F2E A;  2BG9 C;  1T72 A;  3ETV A;  2WS3 A;  4ILU A;  3CQG B;  5HXH A;  2LLY A;  1J1J A;  4H63 V;  4U74 A;  4IL9 A;  3UT5 E;  4CI2 B;  4DV5 T;  4M1P A;  2NW8 A;  4H9Q C;  4PK4 A;  4IDP A;  1D0Z A;  3P4S A;  4AQF A;  3KDS E;  2ODU A;  2UUB T;  1ZHC A;  3L09 A;  4KHZ F;  2JMH A;  4G2A A;  5ETW A;  1HNZ T;  3SFE A;  5CJ5 A;  3HKB E;  4DVD A;  1Z8U A;  2JQK A;  2D2S A;  1D1C A;  5JDQ A;  4ILC A;  1W09 A;  2LOS A;  4UV8 B;  2HN2 A;  4X5T A;  5L4E A;  4LF9 T;  3C4W A;  4X65 T;  4IE6 A;  2IUB A;  1IBL T;  3ZEF B;  4F6R C;  4PAG A;  4G63 A;  1N34 T;  4DV3 T;  5HXE A;  3AED A;  3N9P A;  2MBG A;  1MMN A;  1S94 A;  2JMK A;  4MBQ A;  3P50 A;  2W63 A;  2W66 A;  4PK6 A;  5EK3 A;  2JQH A;  3ZJ2 A;  5LGU B;  5LGT B;  3AE6 A;  5JH7 E;  3GN5 B;  2DNX A;  1WFD A;  1KNZ A;  2UXB T;  4Z91 A;  1VRB A;  3AA1 B;  4I4T E;  2XJ7 A;  5AQJ B;  3X1D A;  3VU7 H;  2EHO D;  1UUR A;  2VK9 A;  4U7I A;  4Q25 A;  3A8Y C;  5ABF B;  5KMG P;  4TWF A;  1UX4 A;  3L8R A;  4ANJ A;  2W4X A;  3I1A A;  2XQ7 A;  3AA7 B;  3UQ4 A;  2XM1 A;  3MJX A;  4YY3 T;  3AEA A;  3K3Q C;  5LG4 A;  2DCF A;  4ZI3 C;  1X9B A;  5FYM A;  1S35 A;  1HFA A;  3PU3 A;  4AXP A;  5J0Z A;  1QSD A;  4UEL A;  2WU2 A;  2CMR A;  4DUZ T;  5JTG A;  3LBX A;  1XWM A;  3C64 A;  1YQ3 A;  2VKO A;  2QGS A;  2MAW A;  4I0U A;  3AA6 B;  1LRZ A;  4MAL A;  4U7Y A;  4AKL A;  2ACX A;  4HFI A;  3Q2M A;  3TLW A;  3SS1 A;  2VL8 A;  1WYC A;  3VKG A;  3CX6 B;  2LM2 A;  1OXZ A;  3NWI A;  4EEB A;  3MA9 A;  3JC6 D;  1MMG A;  3EUH A;  3ZMZ B;  2W00 A;  2LHR A;  2LE8 A;  1HF8 A;  4LF7 T;  5F3J A;  1JNR A;  2CXD A;  4JLE A;  5L3E B;  4X1Y E;  2DHR A;  2V6Y B;  2BS4 A;  4DV1 T;  3SWH A;  5FXW A;  3RKO A;  1E1H B;  1Z0P A;  2LKH A;  1HG2 A;  5LCY A;  4ZS2 A;  1X79 A;  2UXD T;  5JDG A;  5FY0 A;  5LNK A;  2FJD A;  1B7T A;  5FNV E;  2X9H A;  4GKJ T;  4PJJ A;  2X9Y A;  3KV6 A;  4HKA A;  3EDV A;  1HCI A;  4UXN B;  4DUY T;  4MHC A;  5AQS B;  5A1L A;  1OED E;  4U3C A;  2BS2 A;  3AE8 A;  3LSV A;  3AEC A;  2JJ9 A;  5KDM C;  3GMI A;  5GON E;  2IAK A;  2XQ8 A;  4I43 B;  4N78 D;  4IE0 A;  5AQG B;  3RRC A;  4OYJ A;  1KF6 A;  2CXL A;  3UUN A;  4HFV A;  3AE5 A;  2IC9 A;  2C5K T;  1UK5 A;  3ZPO A;  2UU9 T;  3H37 A;  2VVS A;  2W67 A;  4LF8 T;  4LFC T;  2LRK A;  1BR1 A;  4COF A;  1IZN B;  2M6I A;  5LXT E;  5L3D B;  5H6Q B;  1UCU A;  4DV2 T;  2J62 A;  3RIF A;  2XY8 B;  4JYA T;  3IEE A;  4HFC A;  2N2N A;  4NUV A;  4QH4 A;  2KT9 A;  3ZCI A;  2AXD S;  2GK9 A;  2K48 A;  3ZMV B;  4O2A E;  3PUV F;  4EB6 E;  3EHZ A;  2CHN A;  2A2F X;  1IJ5 A;  5JR9 A;  2D0T A;  2DWK A;  3C4Z A;  5HCM A;  5FXX A;  4DV7 T;  1MIY A;  3GN5 A;  4HWH A;  4ZI3 D;  4TNW A;  1I6Z A;  4QH1 A;  3AE4 A;  3GA8 A;  3TLV A;  2UUC T;  3KFW X;  4C91 A;  4Z8X A;  4JI5 T;  2E5V A;  4YTP A;  2L3L A;  4PFP A;  4HFE A;  4HGA A;  5LHI B;  3UU3 A;  4YHJ A;  1OED A;  3CVR A;  4HN9 A;  5DJQ C;  2YEV C;  3AE1 A;  4ZS3 A;  1J5W A;  1KNP A;  3V5S A;  5FVL A;  2WMN A;  4OFZ A;  3IA3 A;  2XPK A;  3B13 A;  4JI6 T;  3FZK B;  2J47 A;  3A7M A;  2XUE A;  3UUM A;  2N9D A;  2CE7 A;  2W61 A;  2X0H A;  3LK2 B;  4JI2 T;  1IAP A;  3CK6 A;  5FY1 A;  2IC6 A;  3RKG A;  4HWD A;  3I0Q A;  2A3D A;  2FBW A;  2WDV A;  4FI5 A;  5H6R B;  5BMV E;  2V5C A;  2CLY B;  2HPJ A;  1HR0 T; 
#chains in the Genus database with same CATH homology
 2G0U A;  3RYF E;  2XAQ B;  3LBX B;  5FP3 A;  3AVR A;  4TV9 E;  2M67 A;  5LHG B;  2D2S A;  1D1C A;  3RX6 A;  1MND A;  2XAS B;  3E08 A;  3N9M A;  4J2C A;  3MXZ A;  5HXC A;  5JDQ A;  3O1H A;  2LOS A;  4UV8 B;  2WMO A;  1U5P A;  3O4X E;  3C4W A;  4IE6 A;  4JEU B;  4L5G A;  5LA6 E;  4EZH A;  2LSG A;  3NRY A;  2PJQ A;  3AB3 B;  3O1I A;  3ZEF B;  3J7Y q;  4F6R C;  2X66 A;  2KLQ A;  3IBP A;  5CA0 E;  2L9Q A;  1LKX A;  2SPC A;  4AQF C;  4IE4 A;  4PAG A;  3PUA A;  4G63 A;  2B1E A;  4L0R A;  1EZ3 A;  3DJB A;  3N2O A;  5HXE A;  2X9W A;  3K8P C;  1IJ6 A;  3N9P A;  4BJN A;  3Q9D A;  4AKI A;  2MBG A;  2MYS A;  2CEA A;  1MMN A;  1YKH B;  1S94 A;  4WBO A;  2JMK A;  4XBF B;  3LJC A;  2DWG A;  4MBQ A;  4EXT A;  1BR4 A;  4DMW A;  1FMV A;  2W63 A;  4PK6 A;  3S4U A;  1O3X A;  5EK3 A;  3ZJ2 A;  3KBT A;  4QXB B;  5LGU B;  2ODV A;  5LGT B;  2LT3 A;  4AKR B;  3RPU A;  4A56 A;  5JH7 E;  3WAJ A;  2X0L B;  1HX8 A;  3GWH A;  4ZI2 D;  1ZKE A;  3BQL A;  1SHZ C;  3GN5 B;  1MMA A;  3ZYK A;  2DNX A;  4KBM B;  3KBU A;  3U3I A;  2V26 A;  1KNZ A;  3O9X A;  2MTQ A;  2BVL A;  4E7Z A;  5JRC A;  5LGN B;  1VRB A;  1WRD A;  2W0G A;  3AA1 B;  4I4T E;  3ZYM A;  1MIV A;  1G8X A;  4KP3 C;  2V7L A;  1UX5 A;  2I59 A;  2Q9Q D;  3AVS A;  2MOZ A;  5EZY E;  3SRZ A;  1D0X A;  3J9X 1;  4KMC A;  1MMD A;  2E9X A;  3VU7 H;  3NBX X;  3CKD A;  4JUY A;  2EHO D;  2VKD A;  2VK9 A;  3ANW A;  3MK7 C;  4GK5 E;  3FXE B;  4UF0 A;  1HTJ F;  2W62 A;  2ZM2 A;  3HA4 A;  4AKG A;  2YU1 A;  1G73 A;  2PBI A;  1KK7 A;  3L3P A;  4DMV A;  5KMG P;  2YU2 A;  3C51 A;  3CX8 B;  4MLK A;  2DLR A;  3B57 A;  4HEA A;  1UX4 A;  4IST A;  2WM9 A;  4ANJ A;  3LK4 2;  3HKD E;  3RC8 A;  2ES0 A;  3I1A A;  4AI6 A;  5JDN A;  3WI3 A;  4BJM A;  2LEH A;  3N2K E;  3AA7 B;  2IW5 B;  4FJO A;  2KZ7 B;  4ADZ A;  3FBL A;  1NAF A;  3KVB A;  5FXV A;  3PDY A;  3FXD B;  4IHJ E;  2V7K A;  2P9B A;  3WAK A;  4UEM A;  3MJX A;  1D1B A;  1FIO A;  3K3Q C;  2LOP A;  5LG4 A;  4GIW A;  2BVM A;  2DCF A;  2NWB A;  3RH3 A;  2V7M A;  3OYZ A;  5IHY A;  4EOZ B;  4ZHQ E;  5DQV A;  4ZI3 C;  5L3B B;  2QA7 A;  4ZI7 E;  5FYM A;  2EHO B;  2LJL A;  2D5U A;  1S35 A;  2E9X C;  4H63 H;  3R6N A;  1HFA A;  3PU3 A;  4AXP A;  4NUU A;  2KWH A;  2LSK A;  1QSD A;  3FBZ A;  3P7I A;  5E0O A;  2OA5 A;  4UEL A;  1ZV4 X;  3N5L A;  4WW0 A;  2LSY A;  2CMR A;  4GYS A;  4PK5 A;  4CI3 B;  3I9W A;  3F57 A;  2XAJ B;  5LBQ B;  5LHH B;  2KMF A;  4I55 E;  5JDF A;  2D0U A;  4HTE A;  4PNI A;  2RA1 A;  4X20 E;  3LBX A;  3CX7 B;  3C64 A;  1WLX A;  4O4J E;  2XQY A;  3HL6 A;  2VKO A;  2QGS A;  1D1A A;  5FMN A;  3DTO A;  3AA6 B;  2C0S A;  1LRZ A;  2ZLY A;  4MAL A;  2E8I A;  4BA9 A;  2KWI B;  4IGU A;  3KV4 A;  5JVD E;  2YK0 A;  3D0T A;  1AJ3 A;  4AKL A;  5J1G A;  2ACX A;  3PUS A;  3Q2M A;  3N9O A;  3SS1 A;  2C5I T;  2VL8 A;  2CWO A;  4XAX B;  4O4L E;  1WYC A;  5LYJ E;  3CX6 B;  4QXC B;  3VKG A;  2NTX A;  2KND A;  5LOV E;  2X68 A;  1OXZ A;  3FB2 A;  3W15 B;  3IF8 B;  3MA9 A;  3JC6 D;  1MMG A;  3AAA B;  3EUH A;  3NZP A;  2CLY C;  2LHR A;  2W00 A;  2LE8 A;  4OK0 A;  3ZMZ B;  3K3N A;  1HF8 A;  4H9N C;  5F3J A;  2CXD A;  4JLE A;  2KIN B;  3ZYL A;  1Y64 B;  1MNE A;  5JDL A;  3KV5 A;  5L3E B;  2H7O A;  2PFV A;  4X1Y E;  3ZLI A;  2DHR A;  5J2U E;  3ZCJ A;  3RYC E;  4I50 E;  4CI1 B;  2ZMA A;  2VB6 A;  3NZQ A;  4QX8 B;  5JR9 B;  2CM0 A;  1D0Y A;  3SWH A;  2WSS V;  2X67 A;  4QXH B;  5FXW A;  3RKO A;  1E1H B;  1Z0P A;  2CWY A;  5JQG E;  4CZZ B;  4EIW A;  3RYH E;  3V5U A;  1HG2 A;  2J1D G;  4H9P C;  5LCY A;  1US7 B;  2V7J A;  3LK3 B;  4ZS2 A;  5LP6 E;  1X79 A;  4ZOL E;  1CUN A;  3R84 B;  3E0Z A;  1WYB A;  5JDG A;  5FY0 A;  2UXN B;  4O4H E;  5LNK A;  4ISS A;  4EYY R;  4GOU A;  2Y8D A;  1B7T A;  3N9L A;  3UUL A;  5FNV E;  2X9H A;  3ZN0 B;  2Z6E A;  2BDE A;  3M65 A;  4PJJ A;  5FY7 A;  2LHN A;  5M4Y A;  5CA1 E;  4KUM B;  4V1A v;  3PUQ A;  5JDM A;  2X9Y A;  5L3C B;  3BQI A;  3KV6 A;  3AAI A;  5EK2 A;  4O8S A;  4IE5 A;  3H3A A;  2LSJ A;  3AA0 B;  3P8C D;  3PU8 A;  4MFR A;  4HKA A;  3EDV A;  5L3F B;  3EVY A;  1HCI A;  4GYR A;  2NW9 A;  2BZB A;  4UXN B;  5JRE A;  4E7S A;  4YLH A;  1U4Q A;  4MHC A;  5A1L A;  3ONX A;  4YJ3 E;  4UVA B;  3HKC E;  2JJ9 A;  5HXS A;  3ZMS B;  2Q9Q B;  4PW8 A;  3OYX A;  5KDM C;  3GMI A;  5GON E;  2HPL A;  2IAK A;  2WWU A;  2Y6X A;  1VOM A;  2NP9 A;  4C90 A;  5HWX A;  4TV8 E;  4I43 B;  5LBM A;  4N78 D;  4IE0 A;  4DBR A;  3C98 B;  3E22 E;  3RRC A;  4OYJ A;  3UUX B;  2CXL A;  3OKQ A;  5KX5 E;  3UTK A;  3UUN A;  2XHE B;  4HFV A;  2XTL A;  5DQW A;  3N2G E;  3NRX A;  2IC9 A;  3KV9 A;  2JPF A;  3VHL A;  4ERR A;  2N1G A;  3OBV E;  1ZEE A;  2C5K T;  4ZI2 C;  4QHO A;  5DAB A;  3ZPO A;  3H37 A;  3U78 A;  2C5J A;  2HH7 A;  4PJN A;  3ZC1 A;  3CML A;  3KIN B;  1BR1 A;  4CQI A;  1IZN B;  2CCQ A;  3ZN1 B;  1YKE B;  1FEW A;  5CB4 E;  5LXT E;  2K5B B;  5L3D B;  2YIN A;  4OYK A;  2Q9Q C;  5H6Q B;  4GK0 E;  3CQX C;  4DO0 A;  1UCU A;  5TAO A;  3KVA A;  3BQK A;  2V7I A;  3HI2 A;  3IEE A;  2EHO C;  1T98 A;  2UXX B;  2LM9 A;  3SOL A;  2N2N A;  4UVB B;  4NUV A;  4TUY E;  1MIW A;  2RP4 A;  4IIJ E;  1FMW A;  2VKJ A;  2NW7 A;  2XAG B;  2KXP B;  5F8P A;  2KT9 A;  3QK6 A;  2LSI A;  3ZCI A;  2GK9 A;  5LJN A;  4ASK A;  2K48 A;  3ZMV B;  2CA5 A;  5ADX L;  2H3R A;  1YD8 G;  5L2L A;  3PTR B;  1NWM X;  2CXF A;  4O2A E;  3FHN A;  4EB6 E;  2VWA A;  4XZC A;  4K0U A;  3HR0 A;  2DI4 A;  5L3G B;  2A2F X;  1IJ5 A;  4CXW A;  4P09 A;  4QKN A;  2WAU A;  3A5X A;  3AAE B;  3ETU A;  5LJM A;  5JR9 A;  4QWN B;  2D0T A;  2DWK A;  4UIG A;  3C4Z A;  2VAS A;  4EYU A;  5AFU L;  3TKL B;  4UV9 B;  1HS7 A;  5FXX A;  2L8K A;  5FXZ A;  3T8O A;  2VKH A;  1MIY A;  3GN5 A;  4IDZ A;  3Q5W A;  1LVF A;  4ZI3 D;  3VKH A;  3ESL A;  4HE8 A;  2K24 A;  3RRW A;  2NOX A;  2E9X D;  4H9O C;  3IHR A;  1V9D A;  4IE7 A;  3PE0 A;  3ZJ1 A;  2JRK A;  4X1K E;  2V1D B;  4AQG A;  3GA8 A;  2NTY A;  3DP7 A;  1QUU A;  3CWZ B;  3KFW X;  3PUR A;  4C91 A;  5IYZ E;  3OJA A;  4Z8X A;  3RYI E;  2ZM0 A;  4YFS A;  4WBN E;  2L3L A;  4PFP A;  4PJM A;  4HGA A;  2ZM8 A;  5LHI B;  3I0O A;  4PFO A;  4YHJ A;  3CVR A;  4HN9 A;  5DJQ C;  2XAF B;  5JRC B;  2YEV C;  3EDU A;  4X1I E;  5JR9 C;  2X51 A;  4O2B E;  5HXR A;  4ZS3 A;  5JDH A;  3BK9 A;  4WNK A;  1H7C A;  3V5S A;  5J2T E;  2WMN A;  4OFZ A;  5EK4 A;  4JEH B;  4QX7 B;  2E9X B;  5C8Y E;  4DBQ A;  3N9N A;  5HYA A;  3ANW B;  2JQQ A;  1BR2 A;  4YJ2 E;  3B13 A;  4UF0 B;  3UFE A;  4DND A;  3QUJ A;  4EAH A;  2Q9Q A;  3JC6 C;  2K9A A;  4CXY A;  1SA0 E;  3LFM A;  1WR6 A;  1OWA A;  2XUE A;  3MKD A;  3N9Q A;  3LG7 A;  4P0B A;  4TZ4 C;  3UUM A;  3ZMU B;  2N9D A;  4U72 A;  3PUG A;  2CE7 A;  2XAH B;  3CPZ A;  3O1J A;  4OHF A;  5HWY A;  2X9X A;  4B6X A;  4CXX A;  2EHO A;  2W61 A;  3F2E A;  4BAY B;  3LK2 B;  1BR0 A;  3HKE E;  1IAP A;  4O4I E;  3ETV A;  4UVC B;  5FY1 A;  2IC6 A;  4ILU A;  3ZC0 A;  3CQG B;  1YW0 A;  4TX5 A;  5HXH A;  3QC9 A;  3I0Q A;  2A3D A;  3CQC B;  4P0A A;  4H63 V;  2H7V C;  3ZMT B;  4U74 A;  4FI5 A;  3F31 A;  3K3O A;  3UT5 E;  1LVK A;  4CI2 B;  2Y48 B;  3MAC A;  2PG8 A;  3C50 A;  4M1P A;  4TN7 B;  2NW8 A;  4H9Q C;  3MZK B;  4PK4 A;  3RC3 A;  2A72 A;  1HG5 A;  1D0Z A;  4AQF A;  3KDS E;  4AKH A;  5H6R B;  2ODU A;  4H9R C;  4EZ4 A;  2WBL A;  3Q5X A;  1ZHC A;  3L09 A;  4PJL A;  5BMV E;  2JMH A;  4G2A A;  4H9S E;  5ETW A;  5HAX A;  3I9Y A;  3C4X A;  2CLY B;  2HPJ A;  4L9I A;  3HKB E;  4DVD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...