2YEVC

Structure of caa3-type cytochrome oxidase
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
63
structure length
63
Chain Sequence
VYIALFALGAALVTLFFYLILNPRVLTTEGETFDLRFVLFMLLLILLAAGTVALMLLIGKAHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights Into Electron Transfer in Caa3-Type Cytochrome Oxidases.
pubmed doi rcsb
molecule keywords CYTOCHROME C OXIDASE POLYPEPTIDE I+III
molecule tags Electron transport
total genus 23
structure length 63
sequence length 63
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1350 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2yevC00
2YEVC
chains in the Genus database with same CATH superfamily
1BR4A 3CX8B 3RYHE 1Y01A 5CFBA 3UQ7A 1V9DA 4IE6A 4BA9A 4DMWA 4ZOLE 3SFDA 4F6RC 2JQHA 4H9PC 3LJCA 1H7CA 3CMLA 4JI6T 4AKRB 4WZXA 5HAXA 2BZBA 4TNVA 5C3JA 3K3OA 2BBHA 4WYVA 2IAKA 1WR0A 3EHZA 2JQKA 5ABFA 3OYZA 5H6RB 2MAWA 5ABGA 3GMIA 4ZI3C 3RYIE 1IBMT 2LM9A 4YJ3E 2MOZA 2YEVC 3AEBA 4E7SA 1YKHB 2XQ5A 5JVDE 2KXPB 1N32T 2XAGB 2I6HA 1W0BA 5L3GB 5FKYA 4JI7T 2WZIA 3A7MA 4ZXLA 2LSJA 2ZM8A 4IE0A 5JH7E 5ABFB 5JDLA 3HKEE 3HL6A 3HR0A 4TV8E 1XMQT 2HN2A 2XAQB 3V5SA 3LFMA 4ZHQE 2R6GF 3FZKB 3PUQA 4DV7T 3AEAA 3UTKA 4ISSA 2K48A 1WYCA 2E5VA 2ES0A 2VB6A 3C51A 5JDHA 2Y48B 2Q9QB 5CJ5A 4IT4A 4ZS2A 4BJNA 2CXFA 5J2TE 5BR8T 4IGUA 2BVMA 3D0TA 5JTGA 3KBUA 2JQQA 2CBIA 1NAFA 1YXRA 4ZI2D 4G2AA 1YD8G 1X79A 3UU8A 2NP9A 4AKLA 3PUXF 2LSIA 1MMDA 1YKEB 4A98A 1B7TA 3O4XE 3K8PC 5IYZE 3RHWA 2YDRA 4PAGA 3VRAA 4IL4A 5TAOA 3AA7B 3ZT7A 4IE4A 4H9SE 5FYMA 5LBMA 3EDUA 3V5UA 3F2EA 2WMNA 3UUMA 2VASA 3C98B 1IJ6A 3MACA 1D1AA 2YU1A 3ZYLA 2RP4A 2B76A 1I94T 4IIJE 4ZEYA 4I43B 5DQWA 5J1GA 4PJNA 5HWXA 4F8HA 4V1Av 5AQGB 3Q9DA 1FIOA 3PUZF 2DHRA 4H9OC 1NENA 4KI0F 1BR2A 4QX7B 3B13A 4L5GA 3QB5K 2QYWA 4OYJA 1OEDE 5CGMA 4I55E 1D0YA 3ZMZB 2KMFA 2WMOA 4KMCA 1UGOA 4LF7T 3AA0B 3KDSE 4HN9A 5CB4E 5AQVB 3AXJA 5FL0A 2P9BA 2VQET 1FEWA 3FBZA 2V1DB 2DL1A 3EUHA 2BS2A 2CLYB 3AA6B 1VCSA 2V6XA 5FNVE 1HFAA 3KBTA 4HWDA 1HF8A 4U74A 3UFGA 1XDPA 3CVRA 5L3BB 2Q9QC 2BVLA 1N36T 4PFPA 3AEGA 1JNRA 2XZEA 4CXYA 3UQ4A 4ASKA 4C91A 1OEDB 2YDQA 1FJGT 2J47A 2KINB 2LHNA 2LJLA 2BS4A 2M6BA 4YT0A 4BJMA 5JR9C 5AQIB 2V26A 4HWIB 5FP3A 1ZV4X 1SE7A 1HR0T 5LBQB 5H6QB 5HCJA 4CXWA 2LE8A 1CUNA 4EXTA 4PJMA 3LK2B 2XTLA 5HEOA 4DR5T 3QB5A 3J9X1 2E9XA 2K3WA 4CN6A 1G8XA 3CK6A 3TLSA 5JQGE 2UU9T 3E22E 2W67A 3N9PA 4CI1B 1WFDA 4NIQA 3EI0A 3VKHA 1G73A 4UXNB 5LGNB 3AE7A 5LG3A 2Y8DA 3C50A 3Q5XA 5LHGB 2KZ7B 2E9XB 4UVBB 2CBJA 3TLUA 4JEUB 4HFHA 1N33T 2ODVA 4JI8T 2I59A 4OK0A 3EDVA 4GIWA 3CKDA 3KV4A 4EZ4A 3DJBA 4H9RC 1E2AA 5DQVA 2CHOA 3PJAJ 2WCAA 1ZOYA 4A5XA 2KWHA 2WP9A 2IC6A 3EVYA 3NWIA 2D0UA 4O4JE 2CEAA 2CLYC 1HG5A 3ZMSB 2VKOA 4XZCA 2CCQA 4EEDA 2XQ8A 2OLTA 3TLVA 3ABVA 4LMJA 2H88A 2V7IA 1HNZT 2F4VT 2YU2A 3BQIA 4DR1T 5AQPB 2HH7A 4X1YE 1OEDC 2C5KT 4YY3T 4ISTA 3VR8A 4O4IE 3ZJ1A 2VWAA 1QSDA 1BR1A 4QH1A 4UR9A 2DWKA 2WB5A 4GK0E 3CQXC 5C8YE 2IIUA 5IHYA 4HWCA 5AQRB 1IBLT 3KFWX 4EB6E 2UXCT 2AXDS 3Q5DA 3LBXA 3PUVF 4HGAA 5FXWA 3L09A 2WZHA 2BKPA 1KNRA 4IHJE 3ONLC 2VL8A 4YLHA 2BKOA 4YTMA 4MHCA 3R6NA 3RGLA 1MMGA 4UVCB 3MA9A 5LMUT 2LRLA 3HI2A 2SPCA 4JV5T 3CX7B 2FJDA 5HEUA 5LB7B 3ZJ2A 3TLTA 3N9LA 4UV9B 4A56A 4AI6A 3L39A 4ADZA 1MIVA 4LF4T 2NWBA 4LF5T 4XBFB 3LBXB 3OYXA 3FZFB 3P4WA 3RRCA 3QNUA 2V6YA 5FXVA 2PG8A 5HEHA 1J5WA 1MNDA 4B3TT 4O4HE 4KP3C 4UEMA 4IDPA 2LSYA 3RIUC 5AQFB 2XQ6A 1JNZA 3CPZA 1BR0A 1US7B 4EYUA 3ZEFB 3KVAA 4U7YA 2M6IA 2KWIB 1XMOT 2V6YB 3AE6A 4JI1T 5EZYE 3P7IA 3NRXA 3L8RA 4X65T 2YN6A 3VHLA 2V5DA 3ZMUB 4DUYT 2A9UA 4ILCA 4YTNA 2XQ3A 5DABA 5AFUL 1MIYA 3N9NA 1HNWT 4DBRA 5KXJA 3UU4A 3RYCE 1WLXA 3RKGA 4DV3T 3IHRA 3WI3A 2CM0A 4WW0A 2WAUA 4X66T 3UULA 3MXZA 5AQSB 2Q9QA 2H89A 3VRBA 2UUCT 2FUPA 5LP6E 1KFYA 1IAPA 2E8IA 2LKHA 3SFEA 2X0LB 2CHNA 4JBWF 4CN4A 1UX4A 5JR9A 3ZC1A 4UV8B 5FL1A 4ERRA 5E0OA 3P4RA 5AQJB 4JI0T 4EEBA 3QK6A 2K24A 2A2FX 4QH4A 3RQUA 2JQ9A 2FBWA 3LK3B 1W0AA 4GOUA 2NTXA 3QC9A 1VOMA 3ZLIA 3JAEA 3FZHB 4MFRA 1HX8A 5EK2A 4BAYB 2XY8B 3MKDA 4HTEA 2CPTA 2DI4A 2QA7A 5JR9B 4NPPA 1Y64B 3RC3A 3OJAA 3MZKB 3AAEB 1UURA 3FXEB 4L0RA 3O1HA 1WCRA 2EHOC 3W15B 2KSRA 2IUBA 1U5PA 5HXEA 5IWAT 4AQGA 4H63V 4LF9T 4DR3T 5C2TA 2L9QA 2X68A 4IDZA 2ZM6T 3N2OA 3BK9A 2V7KA 4PK5A 4AIUA 2D9DA 2ZMAA 4GK5E 3KV5A 4FJOA 4X1KE 4PK6A 1FMVA 3K3NA 4X1IE 4U3CA 4GYSA 4JI3T 4OHFA 4DV2T 1XNRT 1UCUA 2VKJA 5HXCA 4KX6A 2OV9A 4GYRA 1LKXA 4G63A 1OEDA 2WM9A 4WBOA 2BG9C 2WU5A 2XASB 1Z0PA 2PJQA 2VKHA 3FBLA 2CWOA 5LHHB 3C64A 2WWVA 2IW5B 5AQLB 2E2AA 5FY1A 3UUXB 2W66A 2KNDA 3OVUA 1HX1B 1KK7A 2RA1A 3AECA 2CXDA 3U3IA 1YW0A 1HTJF 2V7JA 2XSBA 1WR6A 4DV6T 5L3FB 5LMNT 2N9DA 2JIWA 2YDSA 3N5LA 2E5LT 3PUAA 4IREA 5AQMB 3ZSSA 5LHIB 4DV4T 3A5XA 4HFEA 4HFVA 3AA1B 3GWHA 2W2UA 3HKDE 3T8OA 2I0MA 4AKHA 3AVRA 2XQ7A 4LF6T 1HS7A 4U2ZA 3AEEA 3JAFA 5HEGA 4X5TA 5LJMA 4PNIA 3WAKA 1O3XA 4Z8XA 4EV6A 2XM2A 1MIWA 3IBPA 5L2LA 4GKJT 4XAXB 2X9WA 1LVFA 4TNWA 3FHNA 2H7OA 4EOZB 3E08A 4NUVA 5JDQA 3ZCJA 3VU7H 2QGSA 3P50A 5LXTE 4L9IA 2LM2A 3SOLA 3RIUA 2FJBA 4ILUA 1R8IA 3FZMB 3BQLA 4HE8A 5HXSA 5JDFA 3S4UA 2XQ9A 4M1PA 3ZPOA 2IHR1 3RX6A 4PJLA 4B3ST 3ETVA 5F3JA 4CXXA 4O2AE 4WBNE 1SHZC 2DCFA 5IUXA 2VVSA 4TN7B 4HWHA 2JMHA 2DWGA 1D0XA 2QRXA 2EHOD 1XDOA 2C0SA 5L4HA 2IDOB 2QVAA 3TLWA 2H3RA 2XAHB 3CQGB 2W61A 2MBGA 1X9BA 3PTRB 4DMVA 3PUGA 4GKKT 4AXPA 3PU8A 4HFCA 3U78A 5KX5E 2D0TA 4IE7A 2N1GA 2XSAA 4DR2T 4LF8T 4YHHT 3AVSA 2LKGA 3BQKA 3HA4A 2WBLA 1EZ3A 3RQWA 2ZM2A 3KV6A 1YQ3A 2VK9A 3SWHA 3JCFA 2IC9A 3R84B 1XNQT 2VQFT 3G06A 1FMWA 4CI3B 4Q25A 1HNXT 2LOPA 5LA6E 3A8YC 5BMVE 3NZPA 5AQNB 3ZSTA 4O8SA 4AQYT 5FXXA 4CQIA 3QUJA 4QXBB 4QKNA 4LFCT 4UVAB 3KVBA 2XQYA 4I0UA 2PTFA 4H9NC 1MNEA 3JC6D 1M62A 3ZT5A 2WU2A 3ZC0A 2FJAA 3PJAA 2X9XA 5KDMC 2X0HA 4TZ4C 4LMLA 3ESLA 2YK0A 4K0UA 1U4QA 4QH5A 4HFIA 3HKCE 4UIGA 1T8BA 5L4EA 3C4ZA 3MJXA 5AQUB 2EHOA 3AE9A 3RF1A 3ZN1B 5LGUB 3O1IA 4DUZT 2L8KA 2J4GA 4P0BA 3AE4A 2HHHT 4QHOA 1UK5A 5HXHA 4LMKA 4YXDA 1XZYA 5LOVE 3AAIA 4ZS3A 5ETWA 2G0UA 2CA5A 2OA5A 3CWZB 1W9RA 1LVKA 5LNKA 2X0YA 4ZZBA 3MK7C 5JREA 1CHUA 3T1HT 4LFBT 4DV5T 3NZQA 2VKDA 2NR4A 3O1JA 5GONE 3QOFA 2EHOB 3NKZA 4N78D 2BDEA 2A72A 3CX6B 5DJQC 3OKQA 2WDQA 5AQQB 2XQ4A 1IZNB 2BG9E 1OXZA 1M7KA 1D1CA 4CI2B 2MPKA 2W62A 2UXBT 2ZLYA 4H63H 2LSGA 3EABA 3LK42 2BG9A 2WS3A 5FVKA 3PURA 2WDVA 3Q5EA 3M65A 3I0QA 3LSVA 4EIWA 3M3ZB 2YKSA 3E0ZA 3IF8B 1T7SA 2VL0A 3T1YT 5HYAA 3AB3B 2WDRA 2CXLA 1ZEEA 1KNPA 3ZYMA 2N2NA 3UU3A 1IBKT 3K1SA 2XPKA 3SS1A 4B6XA 1MMNA 4IDNA 4HWFA 2BG9B 5L3DB 3N2GE 2C5JA 2RPAA 2LEHA 3C4XA 4PK4A 4DBQA 4X62T 3ONJA 1UX5A 5HCMA 5CA1E 3KV9A 3K3QC 4NXMT 3TKLB 5AQKB 3FB2A 3UT5E 2NTYA 4JI2T 3PUYF 3RKOA 3GN5A 3KINB 5CA0E 1IJ5A 4KHPT 4QWNB 2BS3A 4K0KT 3HKBE 3RPUA 4IL9A 4HFDA 4DR4T 3RIFA 4JLEA 4PFOA 1DU2A 2IMLA 2VVNA 4PJJA 2V8SV 2X51A 1SUMB 1Z8UA 3F57A 3ZYKA 4U33A 4UELA 1D1BA 4TWDA 3ZCIA 4COFA 1WYBA 2CE7A 2B1EA 2XQAA 3PV0F 3H3MA 1OWAA 2XHEB 3AE1A 3PUWF 4H9QC 5F8PA 4DVDA 2LHRA 2Z6EA 4KBMB 5FY7A 3AEFA 4JI5T 3GN5B 4AQFC 3RRWA 4YJ2E 3UU6A 2LRKA 4OYKA 2WWUA 3I9WA 4IDOA 3ZKRA 2X67A 2HPJA 1D0ZA 4YHJA 1VCTA 4Z91A 4AISA 4IDQA 2BBJA 3VR9A 3PDYA 3P4SA 5LG4A 2C5IT 4C90A 2E9XD 4I50E 2HPLA 4J2CA 4TWHA 1SA0E 1WRDA 2CMRA 4YSZA 3GA8A 3Q5WA 1J5ET 4HEAA 4B3MT 2M67A 3JADA 4DO0A 1UUSA 4DNDA 3H37A 5AQTB 3I1AA 3RYFE 3ZMVB 4ZI7E 3AEDA 4AKGA 5J0ZA 1NWMX 3LDQB 3RC8A 1E1HB 3X1DA 2K5BB 4YSYA 2DLRA 2WY2A 3CIRA 3FZLB 4EYYR 4KUMB 3PU3A 4U7IA 5FVLA 4HFBA 2UUAT 2J1DG 2MYSA 4MALA 4PW8A 2DNXA 3JC6C 1E7PA 3B5MA 1GQEA 1KEYA 2K9AA 1HCIA 5HEJA 2FJEA 5EK4A 2JMKA 2KLQA 4DR7T 3P4QA 5JDGA 1I6ZA 4YTPA 5AQOB 4LFAT 2NW7A 3SRZA 2JPFA 4EAHA 5LJNA 2PFVA 4YFSA 1S35A 2X9YA 1ZHCA 1ZKEA 4B3RT 4U31A 2Y6XA 3ZT6A 3UU5A 4TWFA 4TUYE 4ZI3D 3UUNA 3RLFF 2A3DA 4CZZB 4A97A 4DV0T 3AXJB 3RH3A 2LSKA 4TX5A 2V5CA 1YQ4A 2PBIA 3B57A 1T98A 4HKAA 3UFEA 4MLKA 3DP7A 2XAFB 2UUBT 5AQHB 4MBQA 4YSXA 1W09A 5ABHA 3ANWA 4UF0A 2CWYA 2AE9A 3I9YA 5ABEA 4E7ZA 4DV1T 2XJ7A 3AAAB 4EZHA 2LOSA 2UXXB 5FMNA 4IE5A 4O4LE 3ONXA 2J62A 3WAJA 1VRBA 4ZZCA 4JI4T 3P8CD 5L47A 3LG7A 3N9QA 4JUYA 3IA3A 3NBXX 4ILAA 1AJ3A 4OX9T 3ANWB 4UF0B 4DR6T 5EK3A 5A1LA 4X20E 3AE8A 2W63A 4QXCB 3AE2A 3N9MA 5J2UE 3N9OA 5FY0A 4NXNT 2W0GA 4Z90A 2YINA 3I0OA 2X66A 2CRBA 1L0VA 4QX8B 3N2KE 5LYJE 2WSSV 5JDMA 5F5WA 5JRCA 4CN1A 3EAMA 3P4PA 1T72A 2JJ9A 4QXHB 3C4WA 2UXNB 4JEHB 4ILBA 2D5UA 4P09A 3ZN0B 5L3CB 1QLBA 4X64T 4WNKA 2XM1A 4I4TE 2UXDT 4FI5A 1KF6A 1NEKA 4DIDB 4OFZA 2NW8A 5JRCB 2X9HA 2H7VC 3OTOT 3VKGA 2V7LA 1S94A 3PUSA 3Q2MA 5HXRA 2ZM0A 4NUUA 3ZMTB 1MMAA 2LT3A 2V7MA 4ZI2C 4P1NA 2NW9A 2D2SA 1N34T 2ACZA 2ACXA 3OPCA 3OBVE 2VURA 5FXZA 3O9XA 4AKIA 2GK9A 2JRKA 3RIAA 1J1JA 3RI5A 3PE0A 2ODUA 1QUUA 5LGTB 2W4XA 3H3AA 5KMGP 2Q9QD 4AQFA 3NVOA 5L3EB 3FXDB 4JYAT 4O2BE 2XAJB 3NRYA 1ZP0A 5LCYA 3J7Yq 1LRZA 2XUEA 2W00A 4P0AA 2E9XC 2LLYA 3DTOA 5ADXL 3ETUA 3IEEA 3AE5A 2L3LA 4TV9E 3L3PA 3CQCB 4U2YA 2HN1A 2NOXA 2BKNA 1HG2A 3AE3A 4EGWA 2YOEA 3UUBA 4KHZF 1KNZA 5HWYA 4U72A 4ANJA 5JDNA 2MTQA 1XWMA 2KT9A 5M4YA 2WQYA 3F31A
chains in the Genus database with same CATH topology
2CCQA 1BR4A 3CX8B 3RYHE 3ZCIA 5LHIB 1WYBA 2CE7A 2B1EA 3A5XA 1OWAA 1V9DA 2V7IA 4IE6A 2XHEB 4BA9A 4HFVA 3AA1B 4H9QC 3GWHA 4DMWA 4ZOLE 5F8PA 4DVDA 2LHRA 2Z6EA 3HKDE 3T8OA 2YU2A 3BQIA 4KBMB 5FY7A 4AKHA 3AVRA 2HH7A 3GN5B 4X1YE 4AQFC 2C5KT 3RRWA 4F6RC 4YJ2E 1HS7A 4H9PC 4ISTA 5LJMA 4O4IE 3ZJ1A 3LJCA 1H7CA 4PNIA 3CMLA 3WAKA 4AKRB 2VWAA 1QSDA 5HAXA 4OYKA 2BZBA 1BR1A 3K3OA 2WWUA 1O3XA 4Z8XA 1MIWA 2IAKA 3I9WA 3IBPA 2X67A 2HPJA 5L2LA 2DWKA 1D0ZA 4GK0E 2X9WA 4XAXB 1LVFA 4YHJA 3FHNA 3CQXC 5C8YE 5IHYA 2H7OA 4EOZB 3OYZA 5H6RB 3KFWX 4EB6E 3E08A 4NUVA 3GMIA 5JDQA 3ZCJA 3LBXA 3PDYA 4ZI3C 3RYIE 3VU7H 4HGAA 5LG4A 5FXWA 3L09A 2QGSA 2C5IT 2LM9A 2E9XD 4I50E 2HPLA 2MOZA 4IHJE 4J2CA 1SA0E 1WRDA 2CMRA 2VL8A 4YLHA 2YEVC 5LXTE 4L9IA 4E7SA 1YKHB 3SOLA 3GA8A 4MHCA 3R6NA 4ILUA 3Q5WA 4HEAA 1MMGA 5JVDE 2KXPB 4UVCB 3MA9A 3BQLA 4HE8A 5HXSA 2M67A 4DO0A 4DNDA 3HI2A 3H37A 2XAGB 5JDFA 3I1AA 3RYFE 3ZMVB 3S4UA 2SPCA 4ZI7E 4M1PA 5L3GB 3ZPOA 3CX7B 4AKGA 3RX6A 4PJLA 3ETVA 5F3JA 4CXXA 1NWMX 2LSJA 4O2AE 3RC8A 1E1HB 4WBNE 2K5BB 2ZM8A 3ZJ2A 4IE0A 3N9LA 5JH7E 2DLRA 4EYYR 1SHZC 2DCFA 4UV9B 4KUMB 4A56A 5JDLA 4AI6A 3HKEE 4ADZA 1MIVA 3PU3A 2NWBA 2J1DG 2MYSA 4TN7B 3HL6A 4MALA 4XBFB 2JMHA 2DWGA 1D0XA 4PW8A 3LBXB 3OYXA 3HR0A 2EHOD 4TV8E 2DNXA 3RRCA 3JC6C 5FXVA 2XAQB 3V5SA 4ZHQE 3LFMA 3PUQA 3UTKA 4ISSA 2PG8A 2C0SA 2K48A 2K9AA 1HCIA 1WYCA 1MNDA 2H3RA 2XAHB 3CQGB 2W61A 2ES0A 2VB6A 3C51A 2MBGA 3PTRB 4DMVA 3PUGA 4KP3C 4O4HE 4UEMA 5EK4A 2JMKA 5JDHA 2KLQA 2Y48B 5JDGA 2Q9QB 2NW7A 4ZS2A 2JPFA 3SRZA 4BJNA 4EAHA 4AXPA 3PU8A 2LSYA 3U78A 5KX5E 5LJNA 2D0TA 2CXFA 2PFVA 4YFSA 5J2TE 1S35A 4IGUA 2BVMA 2X9YA 3CPZA 3D0TA 4IE7A 1ZHCA 3KBUA 1ZKEA 2JQQA 2N1GA 1NAFA 2Y6XA 1BR0A 1US7B 4EYUA 3ZEFB 3KVAA 4ZI2D 4TUYE 3AVSA 4G2AA 1YD8G 2KWIB 4ZI3D 3UUNA 3BQKA 3HA4A 2WBLA 2A3DA 1EZ3A 4CZZB 2ZM2A 1X79A 3KV6A 2VK9A 2NP9A 4AKLA 2LSIA 3SWHA 1MMDA 1YKEB 5EZYE 2IC9A 1B7TA 3O4XE 3P7IA 3R84B 3K8PC 5IYZE 4PAGA 1FMWA 3RH3A 4CI3B 2LSKA 3NRXA 4TX5A 2PBIA 3B57A 5TAOA 1T98A 3AA7B 4IE4A 2LOPA 4H9SE 3VHLA 5FYMA 5LBMA 3ZMUB 3EDUA 3V5UA 3F2EA 5LA6E 2WMNA 5BMVE 4HKAA 3NZPA 5DABA 3UFEA 4O8SA 5AFUL 3UUMA 2VASA 1MIYA 3N9NA 4MLKA 3C98B 3DP7A 1IJ6A 5FXXA 2XAFB 4CQIA 3MACA 4DBRA 1D1AA 2YU1A 3QUJA 4MBQA 4QKNA 4QXBB 1WLXA 3RYCE 3ZYLA 4UVAB 2RP4A 3KVBA 2XQYA 4IIJE 3ANWA 4UF0A 4I43B 3IHRA 4H9NC 5DQWA 1MNEA 5J1GA 3I9YA 3JC6D 4E7ZA 4PJNA 5HWXA 3ZC0A 3WI3A 4V1Av 2CM0A 3Q9DA 4WW0A 2X9XA 1FIOA 5KDMC 4TZ4C 3AAAB 2DHRA 2WAUA 3ESLA 2LOSA 4EZHA 3UULA 3MXZA 4H9OC 2UXXB 5FMNA 2Q9QA 4IE5A 2YK0A 4O4LE 1BR2A 3ONXA 3WAJA 5LP6E 4K0UA 1IAPA 1U4QA 4QX7B 2E8IA 3B13A 1VRBA 4L5GA 3HKCE 4UIGA 4OYJA 3P8CD 2X0LB 3LG7A 3C4ZA 3MJXA 4I55E 1D0YA 3N9QA 4JUYA 1UX4A 3ZMZB 5JR9A 2KMFA 2WMOA 4KMCA 2EHOA 3ZC1A 3ZN1B 3NBXX 5LGUB 3O1IA 1AJ3A 2L8KA 3AA0B 4UV8B 3KDSE 4ERRA 3ANWB 5E0OA 4HN9A 4UF0B 5CB4E 5EK3A 4P0BA 3QK6A 2K24A 4QHOA 2A2FX 5A1LA 2P9BA 4X20E 5HXHA 1FEWA 2W63A 4QXCB 3LK3B 3FBZA 2V1DB 4GOUA 5LOVE 3N9MA 5J2UE 3AAIA 3EUHA 3N9OA 4ZS3A 5FY0A 2NTXA 2CLYB 3QC9A 5ETWA 2W0GA 3AA6B 2G0UA 2YINA 2CA5A 2OA5A 3CWZB 2X66A 3I0OA 1VOMA 4QX8B 3ZLIA 3N2KE 1HFAA 1LVKA 4MFRA 5FNVE 5LNKA 1HX8A 3KBTA 5EK2A 4BAYB 3MK7C 5JREA 1HF8A 4U74A 3CVRA 3MKDA 4HTEA 5L3BB 5LYJE 2DI4A 3NZQA 2Q9QC 2VKDA 2WSSV 2BVLA 5JDMA 5JRCA 2QA7A 3O1JA 5GONE 4PFPA 5JR9B 2EHOB 1Y64B 3RC3A 4N78D 4CXYA 4ASKA 2BDEA 4C91A 2A72A 3CX6B 3MZKB 3OJAA 5DJQC 3AAEB 3OKQA 2KINB 2LHNA 2LJLA 2JJ9A 4QXHB 1IZNB 3FXEB 3C4WA 4L0RA 2UXNB 4BJMA 4JEHB 3O1HA 5JR9C 2EHOC 3W15B 2V26A 2D5UA 5FP3A 4P09A 3ZN0B 1ZV4X 1OXZA 1U5PA 5L3CB 5HXEA 1D1CA 4AQGA 4H63V 4CI2B 2W62A 2ZLYA 4H63H 2LSGA 3LK42 5LBQB 5H6QB 4CXWA 2LE8A 3PURA 4WNKA 1CUNA 4EXTA 4PJMA 3M65A 3I0QA 3LK2B 2L9QA 2XTLA 4I4TE 2X68A 4IDZA 3J9X1 3N2OA 2E9XA 3BK9A 4EIWA 2V7KA 4FI5A 4PK5A 4OFZA 2NW8A 5JRCB 2X9HA 3E0ZA 2H7VC 3VKGA 2V7LA 2ZMAA 1S94A 1G8XA 3IF8B 3PUSA 3Q2MA 5HXRA 2ZM0A 4GK5E 4NUUA 5JQGE 3ZMTB 1MMAA 2LT3A 2V7MA 3KV5A 4FJOA 5HYAA 4X1KE 4ZI2C 2NW9A 3AB3B 3E22E 4PK6A 2CXLA 1FMVA 1ZEEA 2D2SA 2ACXA 3N9PA 3K3NA 4X1IE 3OBVE 5FXZA 4CI1B 3O9XA 4AKIA 3ZYMA 2N2NA 2GK9A 4GYSA 3VKHA 2JRKA 3SS1A 4B6XA 1MMNA 4OHFA 4YJ3E 1G73A 4UXNB 5L3DB 3N2GE 5LGNB 1UCUA 2C5JA 2VKJA 5HXCA 3PE0A 2ODUA 2LEHA 3C4XA 2Y8DA 3C50A 3Q5XA 1QUUA 4GYRA 5LHGB 2KZ7B 1LKXA 4G63A 4PK4A 5LGTB 2E9XB 3H3AA 4UVBB 4DBQA 5KMGP 2Q9QD 4AQFA 5L3EB 3FXDB 1UX5A 2WM9A 4JEUB 4O2BE 5CA1E 2XAJB 4WBOA 2ODVA 2I59A 4OK0A 3EDVA 3KV9A 4GIWA 3K3QC 2XASB 3NRYA 1Z0PA 3CKDA 3KV4A 2PJQA 5LCYA 3TKLB 1LRZA 2XUEA 4EZ4A 3J7Yq 3FB2A 2VKHA 3FBLA 3UT5E 3DJBA 4H9RC 2NTYA 2W00A 2CWOA 4P0AA 5LHHB 2E9XC 3RKOA 3GN5A 3KINB 3C64A 2IW5B 3DTOA 5CA0E 5FY1A 1IJ5A 5DQVA 3ETUA 3UUXB 3IEEA 4QWNB 5ADXL 2L3LA 4TV9E 3L3PA 2KNDA 3HKBE 3RPUA 4C90A 2KWHA 1KK7A 2IC6A 2RA1A 2CXDA 4JLEA 3CQCB 4PFOA 3EVYA 3U3IA 2NOXA 2D0UA 1HG2A 1YW0A 4PJJA 1HTJF 2V7JA 4O4JE 2CEAA 1KNZA 1WR6A 2CLYC 2X51A 4U72A 5HWYA 4ANJA 5JDNA 3F57A 1HG5A 2MTQA 2VKOA 3ZMSB 3ZYKA 5L3FB 2N9DA 4UELA 4XZCA 2KT9A 5M4YA 2CWYA 3N5LA 3PUAA 3F31A 1D1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YEV C; 
#chains in the Genus database with same CATH topology
 1BR4 A;  3CX8 B;  3RYH E;  1Y01 A;  5CFB A;  3UQ7 A;  1V9D A;  4IE6 A;  4BA9 A;  4DMW A;  4ZOL E;  3SFD A;  4F6R C;  2JQH A;  4H9P C;  3LJC A;  1H7C A;  3CML A;  4JI6 T;  4AKR B;  4WZX A;  5HAX A;  2BZB A;  4TNV A;  5C3J A;  3K3O A;  2BBH A;  4WYV A;  2IAK A;  1WR0 A;  3EHZ A;  2JQK A;  5ABF A;  3OYZ A;  5H6R B;  2MAW A;  5ABG A;  3GMI A;  4ZI3 C;  3RYI E;  1IBM T;  2LM9 A;  4YJ3 E;  2MOZ A;  2YEV C;  3AEB A;  4E7S A;  1YKH B;  2XQ5 A;  5JVD E;  2KXP B;  1N32 T;  2XAG B;  2I6H A;  1W0B A;  5L3G B;  5FKY A;  4JI7 T;  2WZI A;  3A7M A;  4ZXL A;  2LSJ A;  2ZM8 A;  4IE0 A;  5JH7 E;  5ABF B;  5JDL A;  3HKE E;  3HL6 A;  3HR0 A;  4TV8 E;  1XMQ T;  2HN2 A;  2XAQ B;  3V5S A;  3LFM A;  4ZHQ E;  2R6G F;  3FZK B;  3PUQ A;  4DV7 T;  3AEA A;  3UTK A;  4ISS A;  2K48 A;  1WYC A;  2E5V A;  2ES0 A;  2VB6 A;  3C51 A;  5JDH A;  2Y48 B;  2Q9Q B;  5CJ5 A;  4IT4 A;  4ZS2 A;  4BJN A;  2CXF A;  5J2T E;  5BR8 T;  4IGU A;  2BVM A;  3D0T A;  5JTG A;  3KBU A;  2JQQ A;  2CBI A;  1NAF A;  1YXR A;  4ZI2 D;  4G2A A;  1YD8 G;  1X79 A;  3UU8 A;  2NP9 A;  4AKL A;  3PUX F;  2LSI A;  1MMD A;  1YKE B;  4A98 A;  1B7T A;  3O4X E;  3K8P C;  5IYZ E;  3RHW A;  2YDR A;  4PAG A;  3VRA A;  4IL4 A;  5TAO A;  3AA7 B;  3ZT7 A;  4IE4 A;  4H9S E;  5FYM A;  5LBM A;  3EDU A;  3V5U A;  3F2E A;  2WMN A;  3UUM A;  2VAS A;  3C98 B;  1IJ6 A;  3MAC A;  1D1A A;  2YU1 A;  3ZYL A;  2RP4 A;  2B76 A;  1I94 T;  4IIJ E;  4ZEY A;  4I43 B;  5DQW A;  5J1G A;  4PJN A;  5HWX A;  4F8H A;  4V1A v;  5AQG B;  3Q9D A;  1FIO A;  3PUZ F;  2DHR A;  4H9O C;  1NEN A;  4KI0 F;  1BR2 A;  4QX7 B;  3B13 A;  4L5G A;  3QB5 K;  2QYW A;  4OYJ A;  1OED E;  5CGM A;  4I55 E;  1D0Y A;  3ZMZ B;  2KMF A;  2WMO A;  4KMC A;  1UGO A;  4LF7 T;  3AA0 B;  3KDS E;  4HN9 A;  5CB4 E;  5AQV B;  3AXJ A;  5FL0 A;  2P9B A;  2VQE T;  1FEW A;  3FBZ A;  2V1D B;  2DL1 A;  3EUH A;  2BS2 A;  2CLY B;  3AA6 B;  1VCS A;  2V6X A;  5FNV E;  1HFA A;  3KBT A;  4HWD A;  1HF8 A;  4U74 A;  3UFG A;  1XDP A;  3CVR A;  5L3B B;  2Q9Q C;  2BVL A;  1N36 T;  4PFP A;  3AEG A;  1JNR A;  2XZE A;  4CXY A;  3UQ4 A;  4ASK A;  4C91 A;  1OED B;  2YDQ A;  1FJG T;  2J47 A;  2KIN B;  2LHN A;  2LJL A;  2BS4 A;  2M6B A;  4YT0 A;  4BJM A;  5JR9 C;  5AQI B;  2V26 A;  4HWI B;  5FP3 A;  1ZV4 X;  1SE7 A;  1HR0 T;  5LBQ B;  5H6Q B;  5HCJ A;  4CXW A;  2LE8 A;  1CUN A;  4EXT A;  4PJM A;  3LK2 B;  2XTL A;  5HEO A;  4DR5 T;  3QB5 A;  3J9X 1;  2E9X A;  2K3W A;  4CN6 A;  1G8X A;  3CK6 A;  3TLS A;  5JQG E;  2UU9 T;  3E22 E;  2W67 A;  3N9P A;  4CI1 B;  1WFD A;  4NIQ A;  3EI0 A;  3VKH A;  1G73 A;  4UXN B;  5LGN B;  3AE7 A;  5LG3 A;  2Y8D A;  3C50 A;  3Q5X A;  5LHG B;  2KZ7 B;  2E9X B;  4UVB B;  2CBJ A;  3TLU A;  4JEU B;  4HFH A;  1N33 T;  2ODV A;  4JI8 T;  2I59 A;  4OK0 A;  3EDV A;  4GIW A;  3CKD A;  3KV4 A;  4EZ4 A;  3DJB A;  4H9R C;  1E2A A;  5DQV A;  2CHO A;  3PJA J;  2WCA A;  1ZOY A;  4A5X A;  2KWH A;  2WP9 A;  2IC6 A;  3EVY A;  3NWI A;  2D0U A;  4O4J E;  2CEA A;  2CLY C;  1HG5 A;  3ZMS B;  2VKO A;  4XZC A;  2CCQ A;  4EED A;  2XQ8 A;  2OLT A;  3TLV A;  3ABV A;  4LMJ A;  2H88 A;  2V7I A;  1HNZ T;  2F4V T;  2YU2 A;  3BQI A;  4DR1 T;  5AQP B;  2HH7 A;  4X1Y E;  1OED C;  2C5K T;  4YY3 T;  4IST A;  3VR8 A;  4O4I E;  3ZJ1 A;  2VWA A;  1QSD A;  1BR1 A;  4QH1 A;  4UR9 A;  2DWK A;  2WB5 A;  4GK0 E;  3CQX C;  5C8Y E;  2IIU A;  5IHY A;  4HWC A;  5AQR B;  1IBL T;  3KFW X;  4EB6 E;  2UXC T;  2AXD S;  3Q5D A;  3LBX A;  3PUV F;  4HGA A;  5FXW A;  3L09 A;  2WZH A;  2BKP A;  1KNR A;  4IHJ E;  3ONL C;  2VL8 A;  4YLH A;  2BKO A;  4YTM A;  4MHC A;  3R6N A;  3RGL A;  1MMG A;  4UVC B;  3MA9 A;  5LMU T;  2LRL A;  3HI2 A;  2SPC A;  4JV5 T;  3CX7 B;  2FJD A;  5HEU A;  5LB7 B;  3ZJ2 A;  3TLT A;  3N9L A;  4UV9 B;  4A56 A;  4AI6 A;  3L39 A;  4ADZ A;  1MIV A;  4LF4 T;  2NWB A;  4LF5 T;  4XBF B;  3LBX B;  3OYX A;  3FZF B;  3P4W A;  3RRC A;  3QNU A;  2V6Y A;  5FXV A;  2PG8 A;  5HEH A;  1J5W A;  1MND A;  4B3T T;  4O4H E;  4KP3 C;  4UEM A;  4IDP A;  2LSY A;  3RIU C;  5AQF B;  2XQ6 A;  1JNZ A;  3CPZ A;  1BR0 A;  1US7 B;  4EYU A;  3ZEF B;  3KVA A;  4U7Y A;  2M6I A;  2KWI B;  1XMO T;  2V6Y B;  3AE6 A;  4JI1 T;  5EZY E;  3P7I A;  3NRX A;  3L8R A;  4X65 T;  2YN6 A;  3VHL A;  2V5D A;  3ZMU B;  4DUY T;  2A9U A;  4ILC A;  4YTN A;  2XQ3 A;  5DAB A;  5AFU L;  1MIY A;  3N9N A;  1HNW T;  4DBR A;  5KXJ A;  3UU4 A;  3RYC E;  1WLX A;  3RKG A;  4DV3 T;  3IHR A;  3WI3 A;  2CM0 A;  4WW0 A;  2WAU A;  4X66 T;  3UUL A;  3MXZ A;  5AQS B;  2Q9Q A;  2H89 A;  3VRB A;  2UUC T;  2FUP A;  5LP6 E;  1KFY A;  1IAP A;  2E8I A;  2LKH A;  3SFE A;  2X0L B;  2CHN A;  4JBW F;  4CN4 A;  1UX4 A;  5JR9 A;  3ZC1 A;  4UV8 B;  5FL1 A;  4ERR A;  5E0O A;  3P4R A;  5AQJ B;  4JI0 T;  4EEB A;  3QK6 A;  2K24 A;  2A2F X;  4QH4 A;  3RQU A;  2JQ9 A;  2FBW A;  3LK3 B;  1W0A A;  4GOU A;  2NTX A;  3QC9 A;  1VOM A;  3ZLI A;  3JAE A;  3FZH B;  4MFR A;  1HX8 A;  5EK2 A;  4BAY B;  2XY8 B;  3MKD A;  4HTE A;  2CPT A;  2DI4 A;  2QA7 A;  5JR9 B;  4NPP A;  1Y64 B;  3RC3 A;  3OJA A;  3MZK B;  3AAE B;  1UUR A;  3FXE B;  4L0R A;  3O1H A;  1WCR A;  2EHO C;  3W15 B;  2KSR A;  2IUB A;  1U5P A;  5HXE A;  5IWA T;  4AQG A;  4H63 V;  4LF9 T;  4DR3 T;  5C2T A;  2L9Q A;  2X68 A;  4IDZ A;  2ZM6 T;  3N2O A;  3BK9 A;  2V7K A;  4PK5 A;  4AIU A;  2D9D A;  2ZMA A;  4GK5 E;  3KV5 A;  4FJO A;  4X1K E;  4PK6 A;  1FMV A;  3K3N A;  4X1I E;  4U3C A;  4GYS A;  4JI3 T;  4OHF A;  4DV2 T;  1XNR T;  1UCU A;  2VKJ A;  5HXC A;  4KX6 A;  2OV9 A;  4GYR A;  1LKX A;  4G63 A;  1OED A;  2WM9 A;  4WBO A;  2BG9 C;  2WU5 A;  2XAS B;  1Z0P A;  2PJQ A;  2VKH A;  3FBL A;  2CWO A;  5LHH B;  3C64 A;  2WWV A;  2IW5 B;  5AQL B;  2E2A A;  5FY1 A;  3UUX B;  2W66 A;  2KND A;  3OVU A;  1HX1 B;  1KK7 A;  2RA1 A;  3AEC A;  2CXD A;  3U3I A;  1YW0 A;  1HTJ F;  2V7J A;  2XSB A;  1WR6 A;  4DV6 T;  5L3F B;  5LMN T;  2N9D A;  2JIW A;  2YDS A;  3N5L A;  2E5L T;  3PUA A;  4IRE A;  5AQM B;  3ZSS A;  5LHI B;  4DV4 T;  3A5X A;  4HFE A;  4HFV A;  3AA1 B;  3GWH A;  2W2U A;  3HKD E;  3T8O A;  2I0M A;  4AKH A;  3AVR A;  2XQ7 A;  4LF6 T;  1HS7 A;  4U2Z A;  3AEE A;  3JAF A;  5HEG A;  4X5T A;  5LJM A;  4PNI A;  3WAK A;  1O3X A;  4Z8X A;  4EV6 A;  2XM2 A;  1MIW A;  3IBP A;  5L2L A;  4GKJ T;  4XAX B;  2X9W A;  1LVF A;  4TNW A;  3FHN A;  2H7O A;  4EOZ B;  3E08 A;  4NUV A;  5JDQ A;  3ZCJ A;  3VU7 H;  2QGS A;  3P50 A;  5LXT E;  4L9I A;  2LM2 A;  3SOL A;  3RIU A;  2FJB A;  4ILU A;  1R8I A;  3FZM B;  3BQL A;  4HE8 A;  5HXS A;  5JDF A;  3S4U A;  2XQ9 A;  4M1P A;  3ZPO A;  2IHR 1;  3RX6 A;  4PJL A;  4B3S T;  3ETV A;  5F3J A;  4CXX A;  4O2A E;  4WBN E;  1SHZ C;  2DCF A;  5IUX A;  2VVS A;  4TN7 B;  4HWH A;  2JMH A;  2DWG A;  1D0X A;  2QRX A;  2EHO D;  1XDO A;  2C0S A;  5L4H A;  2IDO B;  2QVA A;  3TLW A;  2H3R A;  2XAH B;  3CQG B;  2W61 A;  2MBG A;  1X9B A;  3PTR B;  4DMV A;  3PUG A;  4GKK T;  4AXP A;  3PU8 A;  4HFC A;  3U78 A;  5KX5 E;  2D0T A;  4IE7 A;  2N1G A;  2XSA A;  4DR2 T;  4LF8 T;  4YHH T;  3AVS A;  2LKG A;  3BQK A;  3HA4 A;  2WBL A;  1EZ3 A;  3RQW A;  2ZM2 A;  3KV6 A;  1YQ3 A;  2VK9 A;  3SWH A;  3JCF A;  2IC9 A;  3R84 B;  1XNQ T;  2VQF T;  3G06 A;  1FMW A;  4CI3 B;  4Q25 A;  1HNX T;  2LOP A;  5LA6 E;  3A8Y C;  5BMV E;  3NZP A;  5AQN B;  3ZST A;  4O8S A;  4AQY T;  5FXX A;  4CQI A;  3QUJ A;  4QXB B;  4QKN A;  4LFC T;  4UVA B;  3KVB A;  2XQY A;  4I0U A;  2PTF A;  4H9N C;  1MNE A;  3JC6 D;  1M62 A;  3ZT5 A;  2WU2 A;  3ZC0 A;  2FJA A;  3PJA A;  2X9X A;  5KDM C;  2X0H A;  4TZ4 C;  4LML A;  3ESL A;  2YK0 A;  4K0U A;  1U4Q A;  4QH5 A;  4HFI A;  3HKC E;  4UIG A;  1T8B A;  5L4E A;  3C4Z A;  3MJX A;  5AQU B;  2EHO A;  3AE9 A;  3RF1 A;  3ZN1 B;  5LGU B;  3O1I A;  4DUZ T;  2L8K A;  2J4G A;  4P0B A;  3AE4 A;  2HHH T;  4QHO A;  1UK5 A;  5HXH A;  4LMK A;  4YXD A;  1XZY A;  5LOV E;  3AAI A;  4ZS3 A;  5ETW A;  2G0U A;  2CA5 A;  2OA5 A;  3CWZ B;  1W9R A;  1LVK A;  5LNK A;  2X0Y A;  4ZZB A;  3MK7 C;  5JRE A;  1CHU A;  3T1H T;  4LFB T;  4DV5 T;  3NZQ A;  2VKD A;  2NR4 A;  3O1J A;  5GON E;  3QOF A;  2EHO B;  3NKZ A;  4N78 D;  2BDE A;  2A72 A;  3CX6 B;  5DJQ C;  3OKQ A;  2WDQ A;  5AQQ B;  2XQ4 A;  1IZN B;  2BG9 E;  1OXZ A;  1M7K A;  1D1C A;  4CI2 B;  2MPK A;  2W62 A;  2UXB T;  2ZLY A;  4H63 H;  2LSG A;  3EAB A;  3LK4 2;  2BG9 A;  2WS3 A;  5FVK A;  3PUR A;  2WDV A;  3Q5E A;  3M65 A;  3I0Q A;  3LSV A;  4EIW A;  3M3Z B;  2YKS A;  3E0Z A;  3IF8 B;  1T7S A;  2VL0 A;  3T1Y T;  5HYA A;  3AB3 B;  2WDR A;  2CXL A;  1ZEE A;  1KNP A;  3ZYM A;  2N2N A;  3UU3 A;  1IBK T;  3K1S A;  2XPK A;  3SS1 A;  4B6X A;  1MMN A;  4IDN A;  4HWF A;  2BG9 B;  5L3D B;  3N2G E;  2C5J A;  2RPA A;  2LEH A;  3C4X A;  4PK4 A;  4DBQ A;  4X62 T;  3ONJ A;  1UX5 A;  5HCM A;  5CA1 E;  3KV9 A;  3K3Q C;  4NXM T;  3TKL B;  5AQK B;  3FB2 A;  3UT5 E;  2NTY A;  4JI2 T;  3PUY F;  3RKO A;  3GN5 A;  3KIN B;  5CA0 E;  1IJ5 A;  4KHP T;  4QWN B;  2BS3 A;  4K0K T;  3HKB E;  3RPU A;  4IL9 A;  4HFD A;  4DR4 T;  3RIF A;  4JLE A;  4PFO A;  1DU2 A;  2IML A;  2VVN A;  4PJJ A;  2V8S V;  2X51 A;  1SUM B;  1Z8U A;  3F57 A;  3ZYK A;  4U33 A;  4UEL A;  1D1B A;  4TWD A;  3ZCI A;  4COF A;  1WYB A;  2CE7 A;  2B1E A;  2XQA A;  3PV0 F;  3H3M A;  1OWA A;  2XHE B;  3AE1 A;  3PUW F;  4H9Q C;  5F8P A;  4DVD A;  2LHR A;  2Z6E A;  4KBM B;  5FY7 A;  3AEF A;  4JI5 T;  3GN5 B;  4AQF C;  3RRW A;  4YJ2 E;  3UU6 A;  2LRK A;  4OYK A;  2WWU A;  3I9W A;  4IDO A;  3ZKR A;  2X67 A;  2HPJ A;  1D0Z A;  4YHJ A;  1VCT A;  4Z91 A;  4AIS A;  4IDQ A;  2BBJ A;  3VR9 A;  3PDY A;  3P4S A;  5LG4 A;  2C5I T;  4C90 A;  2E9X D;  4I50 E;  2HPL A;  4J2C A;  4TWH A;  1SA0 E;  1WRD A;  2CMR A;  4YSZ A;  3GA8 A;  3Q5W A;  1J5E T;  4HEA A;  4B3M T;  2M67 A;  3JAD A;  4DO0 A;  1UUS A;  4DND A;  3H37 A;  5AQT B;  3I1A A;  3RYF E;  3ZMV B;  4ZI7 E;  3AED A;  4AKG A;  5J0Z A;  1NWM X;  3LDQ B;  3RC8 A;  1E1H B;  3X1D A;  2K5B B;  4YSY A;  2DLR A;  2WY2 A;  3CIR A;  3FZL B;  4EYY R;  4KUM B;  3PU3 A;  4U7I A;  5FVL A;  4HFB A;  2UUA T;  2J1D G;  2MYS A;  4MAL A;  4PW8 A;  2DNX A;  3JC6 C;  1E7P A;  3B5M A;  1GQE A;  1KEY A;  2K9A A;  1HCI A;  5HEJ A;  2FJE A;  5EK4 A;  2JMK A;  2KLQ A;  4DR7 T;  3P4Q A;  5JDG A;  1I6Z A;  4YTP A;  5AQO B;  4LFA T;  2NW7 A;  3SRZ A;  2JPF A;  4EAH A;  5LJN A;  2PFV A;  4YFS A;  1S35 A;  2X9Y A;  1ZHC A;  1ZKE A;  4B3R T;  4U31 A;  2Y6X A;  3ZT6 A;  3UU5 A;  4TWF A;  4TUY E;  4ZI3 D;  3UUN A;  3RLF F;  2A3D A;  4CZZ B;  4A97 A;  4DV0 T;  3AXJ B;  3RH3 A;  2LSK A;  4TX5 A;  2V5C A;  1YQ4 A;  2PBI A;  3B57 A;  1T98 A;  4HKA A;  3UFE A;  4MLK A;  3DP7 A;  2XAF B;  2UUB T;  5AQH B;  4MBQ A;  4YSX A;  1W09 A;  5ABH A;  3ANW A;  4UF0 A;  2CWY A;  2AE9 A;  3I9Y A;  5ABE A;  4E7Z A;  4DV1 T;  2XJ7 A;  3AAA B;  4EZH A;  2LOS A;  2UXX B;  5FMN A;  4IE5 A;  4O4L E;  3ONX A;  2J62 A;  3WAJ A;  1VRB A;  4ZZC A;  4JI4 T;  3P8C D;  5L47 A;  3LG7 A;  3N9Q A;  4JUY A;  3IA3 A;  3NBX X;  4ILA A;  1AJ3 A;  4OX9 T;  3ANW B;  4UF0 B;  4DR6 T;  5EK3 A;  5A1L A;  4X20 E;  3AE8 A;  2W63 A;  4QXC B;  3AE2 A;  3N9M A;  5J2U E;  3N9O A;  5FY0 A;  4NXN T;  2W0G A;  4Z90 A;  2YIN A;  3I0O A;  2X66 A;  2CRB A;  1L0V A;  4QX8 B;  3N2K E;  5LYJ E;  2WSS V;  5JDM A;  5F5W A;  5JRC A;  4CN1 A;  3EAM A;  3P4P A;  1T72 A;  2JJ9 A;  4QXH B;  3C4W A;  2UXN B;  4JEH B;  4ILB A;  2D5U A;  4P09 A;  3ZN0 B;  5L3C B;  1QLB A;  4X64 T;  4WNK A;  2XM1 A;  4I4T E;  2UXD T;  4FI5 A;  1KF6 A;  1NEK A;  4DID B;  4OFZ A;  2NW8 A;  5JRC B;  2X9H A;  2H7V C;  3OTO T;  3VKG A;  2V7L A;  1S94 A;  3PUS A;  3Q2M A;  5HXR A;  2ZM0 A;  4NUU A;  3ZMT B;  1MMA A;  2LT3 A;  2V7M A;  4ZI2 C;  4P1N A;  2NW9 A;  2D2S A;  1N34 T;  2ACZ A;  2ACX A;  3OPC A;  3OBV E;  2VUR A;  5FXZ A;  3O9X A;  4AKI A;  2GK9 A;  2JRK A;  3RIA A;  1J1J A;  3RI5 A;  3PE0 A;  2ODU A;  1QUU A;  5LGT B;  2W4X A;  3H3A A;  5KMG P;  2Q9Q D;  4AQF A;  3NVO A;  5L3E B;  3FXD B;  4JYA T;  4O2B E;  2XAJ B;  3NRY A;  1ZP0 A;  5LCY A;  3J7Y q;  1LRZ A;  2XUE A;  2W00 A;  4P0A A;  2E9X C;  2LLY A;  3DTO A;  5ADX L;  3ETU A;  3IEE A;  3AE5 A;  2L3L A;  4TV9 E;  3L3P A;  3CQC B;  4U2Y A;  2HN1 A;  2NOX A;  2BKN A;  1HG2 A;  3AE3 A;  4EGW A;  2YOE A;  3UUB A;  4KHZ F;  1KNZ A;  5HWY A;  4U72 A;  4ANJ A;  5JDN A;  2MTQ A;  1XWM A;  2KT9 A;  5M4Y A;  2WQY A;  3F31 A; 
#chains in the Genus database with same CATH homology
 2CCQ A;  1BR4 A;  3CX8 B;  3RYH E;  3ZCI A;  5LHI B;  1WYB A;  2CE7 A;  2B1E A;  3A5X A;  1OWA A;  1V9D A;  2V7I A;  4IE6 A;  2XHE B;  4BA9 A;  4HFV A;  3AA1 B;  4H9Q C;  3GWH A;  4DMW A;  4ZOL E;  5F8P A;  4DVD A;  2LHR A;  2Z6E A;  3HKD E;  3T8O A;  2YU2 A;  3BQI A;  4KBM B;  5FY7 A;  4AKH A;  3AVR A;  2HH7 A;  3GN5 B;  4X1Y E;  4AQF C;  2C5K T;  3RRW A;  4F6R C;  4YJ2 E;  1HS7 A;  4H9P C;  4IST A;  5LJM A;  4O4I E;  3ZJ1 A;  3LJC A;  1H7C A;  4PNI A;  3CML A;  3WAK A;  4AKR B;  2VWA A;  1QSD A;  5HAX A;  4OYK A;  2BZB A;  1BR1 A;  3K3O A;  2WWU A;  1O3X A;  4Z8X A;  1MIW A;  2IAK A;  3I9W A;  3IBP A;  2X67 A;  2HPJ A;  5L2L A;  2DWK A;  1D0Z A;  4GK0 E;  2X9W A;  4XAX B;  1LVF A;  4YHJ A;  3FHN A;  3CQX C;  5C8Y E;  5IHY A;  2H7O A;  4EOZ B;  3OYZ A;  5H6R B;  3KFW X;  4EB6 E;  3E08 A;  4NUV A;  3GMI A;  5JDQ A;  3ZCJ A;  3LBX A;  3PDY A;  4ZI3 C;  3RYI E;  3VU7 H;  4HGA A;  5LG4 A;  5FXW A;  3L09 A;  2QGS A;  2C5I T;  2LM9 A;  2E9X D;  4I50 E;  2HPL A;  2MOZ A;  4IHJ E;  4J2C A;  1SA0 E;  1WRD A;  2CMR A;  2VL8 A;  4YLH A;  2YEV C;  5LXT E;  4L9I A;  4E7S A;  1YKH B;  3SOL A;  3GA8 A;  4MHC A;  3R6N A;  4ILU A;  3Q5W A;  4HEA A;  1MMG A;  5JVD E;  2KXP B;  4UVC B;  3MA9 A;  3BQL A;  4HE8 A;  5HXS A;  2M67 A;  4DO0 A;  4DND A;  3HI2 A;  3H37 A;  2XAG B;  5JDF A;  3I1A A;  3RYF E;  3ZMV B;  3S4U A;  2SPC A;  4ZI7 E;  4M1P A;  5L3G B;  3ZPO A;  3CX7 B;  4AKG A;  3RX6 A;  4PJL A;  3ETV A;  5F3J A;  4CXX A;  1NWM X;  2LSJ A;  4O2A E;  3RC8 A;  1E1H B;  4WBN E;  2K5B B;  2ZM8 A;  3ZJ2 A;  4IE0 A;  3N9L A;  5JH7 E;  2DLR A;  4EYY R;  1SHZ C;  2DCF A;  4UV9 B;  4KUM B;  4A56 A;  5JDL A;  4AI6 A;  3HKE E;  4ADZ A;  1MIV A;  3PU3 A;  2NWB A;  2J1D G;  2MYS A;  4TN7 B;  3HL6 A;  4MAL A;  4XBF B;  2JMH A;  2DWG A;  1D0X A;  4PW8 A;  3LBX B;  3OYX A;  3HR0 A;  2EHO D;  4TV8 E;  2DNX A;  3RRC A;  3JC6 C;  5FXV A;  2XAQ B;  3V5S A;  4ZHQ E;  3LFM A;  3PUQ A;  3UTK A;  4ISS A;  2PG8 A;  2C0S A;  2K48 A;  2K9A A;  1HCI A;  1WYC A;  1MND A;  2H3R A;  2XAH B;  3CQG B;  2W61 A;  2ES0 A;  2VB6 A;  3C51 A;  2MBG A;  3PTR B;  4DMV A;  3PUG A;  4KP3 C;  4O4H E;  4UEM A;  5EK4 A;  2JMK A;  5JDH A;  2KLQ A;  2Y48 B;  5JDG A;  2Q9Q B;  2NW7 A;  4ZS2 A;  2JPF A;  3SRZ A;  4BJN A;  4EAH A;  4AXP A;  3PU8 A;  2LSY A;  3U78 A;  5KX5 E;  5LJN A;  2D0T A;  2CXF A;  2PFV A;  4YFS A;  5J2T E;  1S35 A;  4IGU A;  2BVM A;  2X9Y A;  3CPZ A;  3D0T A;  4IE7 A;  1ZHC A;  3KBU A;  1ZKE A;  2JQQ A;  2N1G A;  1NAF A;  2Y6X A;  1BR0 A;  1US7 B;  4EYU A;  3ZEF B;  3KVA A;  4ZI2 D;  4TUY E;  3AVS A;  4G2A A;  1YD8 G;  2KWI B;  4ZI3 D;  3UUN A;  3BQK A;  3HA4 A;  2WBL A;  2A3D A;  1EZ3 A;  4CZZ B;  2ZM2 A;  1X79 A;  3KV6 A;  2VK9 A;  2NP9 A;  4AKL A;  2LSI A;  3SWH A;  1MMD A;  1YKE B;  5EZY E;  2IC9 A;  1B7T A;  3O4X E;  3P7I A;  3R84 B;  3K8P C;  5IYZ E;  4PAG A;  1FMW A;  3RH3 A;  4CI3 B;  2LSK A;  3NRX A;  4TX5 A;  2PBI A;  3B57 A;  5TAO A;  1T98 A;  3AA7 B;  4IE4 A;  2LOP A;  4H9S E;  3VHL A;  5FYM A;  5LBM A;  3ZMU B;  3EDU A;  3V5U A;  3F2E A;  5LA6 E;  2WMN A;  5BMV E;  4HKA A;  3NZP A;  5DAB A;  3UFE A;  4O8S A;  5AFU L;  3UUM A;  2VAS A;  1MIY A;  3N9N A;  4MLK A;  3C98 B;  3DP7 A;  1IJ6 A;  5FXX A;  2XAF B;  4CQI A;  3MAC A;  4DBR A;  1D1A A;  2YU1 A;  3QUJ A;  4MBQ A;  4QKN A;  4QXB B;  1WLX A;  3RYC E;  3ZYL A;  4UVA B;  2RP4 A;  3KVB A;  2XQY A;  4IIJ E;  3ANW A;  4UF0 A;  4I43 B;  3IHR A;  4H9N C;  5DQW A;  1MNE A;  5J1G A;  3I9Y A;  3JC6 D;  4E7Z A;  4PJN A;  5HWX A;  3ZC0 A;  3WI3 A;  4V1A v;  2CM0 A;  3Q9D A;  4WW0 A;  2X9X A;  1FIO A;  5KDM C;  4TZ4 C;  3AAA B;  2DHR A;  2WAU A;  3ESL A;  2LOS A;  4EZH A;  3UUL A;  3MXZ A;  4H9O C;  2UXX B;  5FMN A;  2Q9Q A;  4IE5 A;  2YK0 A;  4O4L E;  1BR2 A;  3ONX A;  3WAJ A;  5LP6 E;  4K0U A;  1IAP A;  1U4Q A;  4QX7 B;  2E8I A;  3B13 A;  1VRB A;  4L5G A;  3HKC E;  4UIG A;  4OYJ A;  3P8C D;  2X0L B;  3LG7 A;  3C4Z A;  3MJX A;  4I55 E;  1D0Y A;  3N9Q A;  4JUY A;  1UX4 A;  3ZMZ B;  5JR9 A;  2KMF A;  2WMO A;  4KMC A;  2EHO A;  3ZC1 A;  3ZN1 B;  3NBX X;  5LGU B;  3O1I A;  1AJ3 A;  2L8K A;  3AA0 B;  4UV8 B;  3KDS E;  4ERR A;  3ANW B;  5E0O A;  4HN9 A;  4UF0 B;  5CB4 E;  5EK3 A;  4P0B A;  3QK6 A;  2K24 A;  4QHO A;  2A2F X;  5A1L A;  2P9B A;  4X20 E;  5HXH A;  1FEW A;  2W63 A;  4QXC B;  3LK3 B;  3FBZ A;  2V1D B;  4GOU A;  5LOV E;  3N9M A;  5J2U E;  3AAI A;  3EUH A;  3N9O A;  4ZS3 A;  5FY0 A;  2NTX A;  2CLY B;  3QC9 A;  5ETW A;  2W0G A;  3AA6 B;  2G0U A;  2YIN A;  2CA5 A;  2OA5 A;  3CWZ B;  2X66 A;  3I0O A;  1VOM A;  4QX8 B;  3ZLI A;  3N2K E;  1HFA A;  1LVK A;  4MFR A;  5FNV E;  5LNK A;  1HX8 A;  3KBT A;  5EK2 A;  4BAY B;  3MK7 C;  5JRE A;  1HF8 A;  4U74 A;  3CVR A;  3MKD A;  4HTE A;  5L3B B;  5LYJ E;  2DI4 A;  3NZQ A;  2Q9Q C;  2VKD A;  2WSS V;  2BVL A;  5JDM A;  5JRC A;  2QA7 A;  3O1J A;  5GON E;  4PFP A;  5JR9 B;  2EHO B;  1Y64 B;  3RC3 A;  4N78 D;  4CXY A;  4ASK A;  2BDE A;  4C91 A;  2A72 A;  3CX6 B;  3MZK B;  3OJA A;  5DJQ C;  3AAE B;  3OKQ A;  2KIN B;  2LHN A;  2LJL A;  2JJ9 A;  4QXH B;  1IZN B;  3FXE B;  3C4W A;  4L0R A;  2UXN B;  4BJM A;  4JEH B;  3O1H A;  5JR9 C;  2EHO C;  3W15 B;  2V26 A;  2D5U A;  5FP3 A;  4P09 A;  3ZN0 B;  1ZV4 X;  1OXZ A;  1U5P A;  5L3C B;  5HXE A;  1D1C A;  4AQG A;  4H63 V;  4CI2 B;  2W62 A;  2ZLY A;  4H63 H;  2LSG A;  3LK4 2;  5LBQ B;  5H6Q B;  4CXW A;  2LE8 A;  3PUR A;  4WNK A;  1CUN A;  4EXT A;  4PJM A;  3M65 A;  3I0Q A;  3LK2 B;  2L9Q A;  2XTL A;  4I4T E;  2X68 A;  4IDZ A;  3J9X 1;  3N2O A;  2E9X A;  3BK9 A;  4EIW A;  2V7K A;  4FI5 A;  4PK5 A;  4OFZ A;  2NW8 A;  5JRC B;  2X9H A;  3E0Z A;  2H7V C;  3VKG A;  2V7L A;  2ZMA A;  1S94 A;  1G8X A;  3IF8 B;  3PUS A;  3Q2M A;  5HXR A;  2ZM0 A;  4GK5 E;  4NUU A;  5JQG E;  3ZMT B;  1MMA A;  2LT3 A;  2V7M A;  3KV5 A;  4FJO A;  5HYA A;  4X1K E;  4ZI2 C;  2NW9 A;  3AB3 B;  3E22 E;  4PK6 A;  2CXL A;  1FMV A;  1ZEE A;  2D2S A;  2ACX A;  3N9P A;  3K3N A;  4X1I E;  3OBV E;  5FXZ A;  4CI1 B;  3O9X A;  4AKI A;  3ZYM A;  2N2N A;  2GK9 A;  4GYS A;  3VKH A;  2JRK A;  3SS1 A;  4B6X A;  1MMN A;  4OHF A;  4YJ3 E;  1G73 A;  4UXN B;  5L3D B;  3N2G E;  5LGN B;  1UCU A;  2C5J A;  2VKJ A;  5HXC A;  3PE0 A;  2ODU A;  2LEH A;  3C4X A;  2Y8D A;  3C50 A;  3Q5X A;  1QUU A;  4GYR A;  5LHG B;  2KZ7 B;  1LKX A;  4G63 A;  4PK4 A;  5LGT B;  2E9X B;  3H3A A;  4UVB B;  4DBQ A;  5KMG P;  2Q9Q D;  4AQF A;  5L3E B;  3FXD B;  1UX5 A;  2WM9 A;  4JEU B;  4O2B E;  5CA1 E;  2XAJ B;  4WBO A;  2ODV A;  2I59 A;  4OK0 A;  3EDV A;  3KV9 A;  4GIW A;  3K3Q C;  2XAS B;  3NRY A;  1Z0P A;  3CKD A;  3KV4 A;  2PJQ A;  5LCY A;  3TKL B;  1LRZ A;  2XUE A;  4EZ4 A;  3J7Y q;  3FB2 A;  2VKH A;  3FBL A;  3UT5 E;  3DJB A;  4H9R C;  2NTY A;  2W00 A;  2CWO A;  4P0A A;  5LHH B;  2E9X C;  3RKO A;  3GN5 A;  3KIN B;  3C64 A;  2IW5 B;  3DTO A;  5CA0 E;  5FY1 A;  1IJ5 A;  5DQV A;  3ETU A;  3UUX B;  3IEE A;  4QWN B;  5ADX L;  2L3L A;  4TV9 E;  3L3P A;  2KND A;  3HKB E;  3RPU A;  4C90 A;  2KWH A;  1KK7 A;  2IC6 A;  2RA1 A;  2CXD A;  4JLE A;  3CQC B;  4PFO A;  3EVY A;  3U3I A;  2NOX A;  2D0U A;  1HG2 A;  1YW0 A;  4PJJ A;  1HTJ F;  2V7J A;  4O4J E;  2CEA A;  1KNZ A;  1WR6 A;  2CLY C;  2X51 A;  4U72 A;  5HWY A;  4ANJ A;  5JDN A;  3F57 A;  1HG5 A;  2MTQ A;  2VKO A;  3ZMS B;  3ZYK A;  5L3F B;  2N9D A;  4UEL A;  4XZC A;  2KT9 A;  5M4Y A;  2CWY A;  3N5L A;  3PUA A;  3F31 A;  1D1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...