2YEZB

Complex of a b21 chicken mhc class i molecule and a 10mer chicken peptide
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
97
structure length
96
Chain Sequence
LTPKVQVYSRFPASAGTKNVLNCFAAGFHPPKISITLMKDGVPMEGAQYSMSFNDDWTFQRLVHADFTPSSGSTYACKVEHETLKEPQVYKWDPEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Expression levels of MHC class I molecules are inversely correlated with promiscuity of peptide binding.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Immune system
molecule keywords MAJOR HISTOCOMPATIBILITY COMPLEX CLASS I GLYCOPROTEIN HAPLOT
total genus 11
structure length 96
sequence length 97
ec nomenclature
pdb deposition date 2011-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2yezB00
2DWEA 3W5MA 4XVTH 3FO9A 5I8OH 4F57H 1VA9A 1I4FA 1ZSDA 4P2OB 4JAMB 4KQ4L 2P5EB 4FTVB 3UTQA 3CUPB 1U8HB 1PKQB 1SJHB 3BRDA 3MV8B 1RIVH 2LFGA 4PJ8A 1UKQA 3ILQD 4LGPB 1GC1C 4PY8J 5IM7A 2CIKA 1MCJA 3GMQB 4NJ9L 5C2UB 4EDWH 1MAJA 1U8JB 3B2UD 3KNBB 4KJPD 3G5ZA 4UOJA 2CSPA 4NQDE 4U6YA 3SKMB 2BNUB 3M17B 3GJFK 4PJXA 2V2WA 3LEXA 3P0GB 2IQAA 1S5HA 43CAA 1B3JA 3L3OB 4NUGH 2OL3A 5EBWA 4G6KH 1E28A 3PDOA 2DTML 1C12A 5FKPA 2X1PA 2DB8A 2GFBB 2YPLA 4XCFH 4HEPG 5C3TA 2A0LD 5INCA 5TDOA 5IMMA 1DEEB 3PXHA 5I8EB 4OM1H 4JFXB 1H3PH 4OKVA 3RWIA 1GGIH 1W0WA 3L3IA 3O8XB 2XICA 3C87A 3MRQA 5D72H 1TJHH 4HF5L 5IJVB 1IGFH 4KV5F 5C08A 4ISVA 4PJFF 4UT6L 4GSDL 1ZLUH 5C0BE 3H3PH 1FV1B 3SCMA 2J6EH 3U9UB 2G2RB 2OX5A 1HHGB 2VITA 3S37L 3KXFD 1H8NA 3PABB 4GMSL 3C5JB 4ZO9A 4FZ8L 1NGZA 2HVJB 5LG1A 3MCKA 5D4QA 2OJZL 4P2RD 1DQDL 3DECA 5MENE 3QYCA 5SWQB 1G84A 1QBMH 5DURB 3DXAE 3LEVL 3O4LE 4M9OA 4NT6B 1PX4A 2JF1A 3Q5YA 4P5TB 4N8VG 3ROOB 4XI5C 1KB9J 1PAMA 3INUL 3AREA 3FFCE 4X0KA 2B0SL 4Y1AB 1NUNB 3IJSB 4L3EE 5IF0B 4Y4HB 3GSXB 3VDCA 5GRJL 1Y0LB 4TNVF 1M05B 4P5TD 5EO1A 3RL1B 2X1WL 3FB5A 4XMLH 4NN6B 4HKXB 3NCMA 5JXAL 4XT1C 1S9VB 1I3VA 1YEFH 5E8NA 3FHAA 3O2DA 2Q6WA 5I9QC 3JWDL 4LPXA 3VG0L 4WWKC 3BJLA 3O45B 2P48B 4L3CB 3WFCL 1N6QH 1TCMA 5FHAH 1AGCB 5IV2B 43C9B 4W68A 2NX5D 3QDJD 2FBJL 1I7ZA 3MFGB 4XPHH 3EYUH 3QCUL 5J06A 1PYWB 3VXUB 4XBPA 2YD1A 5DD6A 1JTPA 4NJAH 3QUML 3EZ8A 4MDJA 3SDAB 4I3RH 1X5HA 1XH3A 1JHTB 2CDEA 3D39D 1NC2D 3QP3A 5KW9L 4PJHF 1B6UA 2KZ1B 3VE0B 4KZEH 4ODHL 4FXKA 3IVKA 4LLMA 3W39B 5CD3A 3UDWA 2X10A 3HS0B 3CSYA 3KPTA 4RMWA 1ZHNA 3EHBD 4HEME 4JGJA 3GB7A 5D7KD 4BZ2H 5FKAA 3WE6B 5IBUB 4G9FD 2GQHA 3O8XC 1MHHB 2PR4L 1SYVB 3C2AH 1OP5K 3DRQB 3H9SD 4JRXB 3RAJH 2ZNXA 1VACB 1I9JH 4PB0H 5ID0A 3RWHA 1YC7A 2HH0H 1M4KA 3N85L 5JR1H 1RSFA 4AEIL 1WISA 4KK5D 2WP3O 4ZPVB 5E2TH 3QFJD 4HWBL 1I7TB 5GS0L 5TE4H 1UWEL 4FXKB 3DURB 2I25N 1AQKL 4OFYD 4XZUA 1X5AA 3U7AA 3WCYA 2QHRL 4TRPL 1U91A 1MCSA 1WBYB 4C56B 4CKVX 5MERB 3SE4A 5ALBH 1XF3B 2PNDA 1LO4H 4KVCL 3QT2A 1MLBB 4KK9C 5BVPH 4X99A 1PLGH 2ZOKB 1HCFX 1LP9B 4JRXA 3JV4A 1MSPA 2DAVA 1QBML 4UV4L 2FJFA 2OJZH 4X7DC 5IB2A 4GMSH 1K3ZA 4ZUSA 1QUNA 1F42A 1EXUA 3CX2A 4Q6YA 1V8HA 1A14H 1G9NH 1C1EH 5AD0A 4JGMA 4ZUTB 2HWZH 5ICXB 4JO1L 4JFZL 5LQBH 4M43H 2CJUH 4LLYB 4XZUB 1QA9A 2WINA 2GUOA 2R2BA 3WDHA 3MLZL 1LE9B 4NGHL 1D5BB 2NY3C 1WZ1H 4A6YH 4E0RA 2FH6A 3BGFC 5HI4C 3QQ9C 4GRLA 4X4ZA 4CJ1A 4KK5C 1UC6A 1HCVA 1PVHA 2UYLB 5E8OA 1S8DB 4LRIC 4O58H 3GI8H 4L4JA 3OGOE 2X40A 1TJGL 3IDMA 5HI3D 1NFDA 4AIXA 2HJLB 5E6YA 2UWEF 1XAUA 5JIPA 4NRXA 3V0WH 3PHQB 3SDDD 5IVXA 3CDGB 4UIKL 3DROB 2ENYA 4Y4KA 1X4XA 1NQBA 3FO0H 3ULUL 5GGTL 2OR9H 4MX7A 1I1FB 4EEEA 5KZCD 5IT2H 2WWKT 4NBXB 4D2NA 1IC7L 3CVHH 2Q8AH 6FABH 1N2RA 2E6JA 4ZPTB 4K7PY 2C3HA 2H26A 3O4OB 1U8LB 4HHAA 5F88A 1LHZA 4MDIA 5CS7A 3D9AL 3PWPE 2BXZA 2R2CA 3J7HA 3DX9B 6FABL 2XTJC 4OGXH 5C0GB 4NYLB 1KJ2B 2VABB 3ES6A 2OXGA 4FQQB 1N26A 1BBJA 1MJ8H 4OSUH 3CFIC 3PP4H 4JCMA 4KROD 3DO7B 3IFNL 1HHGA 2FIRT 5L7XH 1XIWC 5AZ2H 1R5IA 2BHZA 3G5VB 1FBIH 2YUWA 2XFXA 1RUKL 1LD9B 2WSKA 1SJEB 4X6DB 4HBCL 2X4PA 1VGEL 1UWGL 2E5EA 4X4XA 1AJ7H 5B3JF 2QADC 5IQ9B 3VA6A 1JNHB 3IETA 5KVFL 1BM3L 4J4PC 2OM5A 3QG6B 3QIBC 1URLA 4WEBH 3CVHA 5E2WL 5MP6L 3OGCB 3MBXH 2RR3A 4KAQH 3SJVB 3DOSA 3VFUB 4KPHL 2HWZL 5DUMH 2AXFA 5CJOH 5ACZB 1J18A 3OZ9L 1G1YA 3VXTA 5DRWB 3RY4A 4JHBA 1HQRA 5IVNA 4BFBD 4HC1L 3WDJA 3FONA 5CUSH 5KSBF 3VWKC 2HN7A 5FB8A 3V5HA 1RJYB 3HUJE 4JZJC 5BVJB 3LZFL 4BELD 3GDBA 4MNGE 5I18L 2OMNA 3RDTD 1J0HA 3REVB 3O3BA 2FATL 4S1QH 5DFVD 4PRIE 4XCNB 4HG4J 5DMKB 2ARJA 4D3CH 3L5HA 4JFDD 3MODL 4JFEE 4CNIB 2EH7H 5FYJU 3WHE0 1YMHA 1HI6A 1OF2B 1A7OL 1AKJB 4M6AA 4YUEH 1L0YA 2VZOA 5ALBL 5E8NB 5TF1H 1NFIA 3OXRA 5I75B 4W4NA 4I2XB 4TRPH 2A9NH 3GRWL 3O3AB 1DQTA 4R90L 4ZFGL 5E2WH 5C9JA 1FORL 1KCUL 1XT5A 3WNLA 4P4RB 2NY7H 4XVSH 5L2JA 2CPCA 2DKSA 4KAQL 3OKKA 4HXAL 1NDMB 3WN5B 2IFFH 5I2IA 3TYFA 3GIVB 2F74B 3BXNA 1K9TA 1QFPA 3OKEA 4KK8C 5IB3A 5I0DA 5IVXE 4ZXBA 2AK4E 3D3VA 2D7PA 4JPKL 1U3ZA 3BMWA 4RFEA 3BAEH 3UAJD 2VOTA 4Y5XA 3PWJB 4DJMA 5C6TL 1OF2A 1F4YH 5GRXG 3BKCH 5IK3B 4M5ZL 5T33L 4HJJH 3ZHDA 1VACA 4U1HA 4ZAKA 5ERWA 4JKPL 3QIBA 5I16A 1WGOA 3ETBF 4K94H 1IGCL 4AEFA 3HAEH 2FEEI 3QEQE 1U8PA 8FABB 5KN5A 3NA9L 1H8SA 3C6LA 3SOBL 4LLMB 1CD9B 5DVOA 3SGEH 1A6TA 1KCVL 3GIVA 4NZRL 4Z5RB 3MUGB 3EFDL 5TGBA 1CICA 1JMZA 2JLLA 2NY0C 3FOMB 5T3XE 3ULUH 1UVQB 4GS7B 3SDXE 4MB4A 4UDTA 4OLUL 2YUZA 2AJUH 4N90E 5FV2A 5T1LD 3V0WL 1WAAA 1B0RB 3GSUB 1CFVL 4LSQH 4JFYB 3T0VA 5D71H 2DWDA 3MV8A 1MQKL 4A6YL 4IOIA 4PS4H 1JYWA 4NGHH 5CWSB 4K3DH 3GMRA 2I5YH 2XQBL 4X6FA 3KLSA 3LSOA 2X1OA 1WWAX 3TT1L 4FA8A 4YFLF 5FO9A 1JWMA 1N6UA 2X89A 1YMMA 4K2UL 3WLBB 3MRHB 2J88H 1M7XA 5E1HB 1OGAD 5DTFB 4FQCL 2CJUL 3QIUD 3U2SB 4NKOA 5T1MB 1QA9B 4YHLL 2EKJA 5FUOH 4OFPA 2NY5C 4MA1C 5FV1L 3AVEA 4WEUD 4XH2B 5HHOD 3S3JA 1EEYA 1TDQA 4JCLA 5CHNB 4NRXB 5SWSB 4KMLB 3P9MB 3UTTB 2BSRB 3VMPA 2VXQL 4Y16A 4PG9A 5SWZE 3LY6A 1EFXD 4YHZL 3N06B 2BSTB 1BFSA 3DV6B 4LMQI 2QQLH 2VITB 2V7NB 4HIEB 2X41A 4HUNB 5C07B 1ZHBA 4AMKH 2EDBA 4JFEA 4MDIB 3MV7B 4XCFL 4HDIB 2A83B 4MZ2A 4Q74A 3FFCB 1OARH 2P8MB 2QQKL 3HKFA 1IZKA 1KIPA 3NIFF 4OV5A 2A6DB 4TSCH 1X5IA 3GJFB 3ROOA 5IWLA 3D85B 5EZIL 4GRWE 3N1PC 5SX5H 2GIYA 4LF3A 1VGEH 2O61B 3ULVD 3MNVA 3LAFA 4I4WB 2R0WH 4PRHB 1SEQL 4KRPB 4P48A 3DX7A 5ITBH 4MX7B 1OAQH 5E1AB 1KLFA 1SJEA 5EU3B 3ESUF 4Y0GA 1UM6L 4PR5A 2ORBH 1P7QD 1ZS8A 5FM8A 4P5TC 4KZEL 3U9PL 2H6PB 1RVFH 1LMKA 3D48R 2IPTH 3MV7A 5FYKU 3O6LL 4YFEA 4P4KA 3ZE1F 1PZ5A 1ACZA 4N0CD 2A9MH 4M61A 4YXHL 3MOBH 5DEFB 4U1JB 4ZS7L 4RMRA 1WIPA 4TUKH 2MQ3A 3QDJB 3PGCA 3TBSB 3G5VA 5BXFB 1ZT7A 3P9LA 5DD5H 5GGVL 2P24A 1PSKH 4P9ML 3RVUC 3TZVC 4L8DB 2FGZA 3WFDH 3RNQB 1ODAA 4LSDA 4JREB 2GJZA 5C1MB 2DQGL 3SE3A 1DN0A 5IB5A 4CMMA 2DQTH 3AMLA 2H8PB 3FONB 4DGYL 3V4VL 3E6HB 4J3UA 4FQJL 1J8HA 4GXVH 3UDWC 1AKJA 1JGVH 3AY4A 4M7ZB 4WRLA 1NBZA 1VFAA 2VQ1A 2MMXA 4N0UE 2CR6A 3S88L 4XHJC 2ARJB 1E27A 4P4KC 3MV11 1KTRL 4XAWL 1P7QB 2XT1B 1D6EA 4KGLA 2DMBA 3MLZH 1HEZB 1RJYA 2WUBL 3ZKXB 5I19H 4YDJB 4U1IB 5CSZB 1BAFH 1DL7L 4ZS6C 2NMSA 3KYNB 1AGDA 1T22A 2XOTA 1MFBL 5IB3B 5E6IA 5DDHB 4J3OC 4FZ8H 5E56A 3F7PC 2EKSB 3WN5A 2LVCA 1ZANL 2DLTA 2ZG1A 1TTGA 4QYOA 1A3LL 1A64A 4QXUL 3NACH 3UYPA 1KULA 2XZQH 5BVPL 1E0OB 4LVOC 5KVEH 5JPMB 3VXSA 2YD6A 3OKKB 4X7SL 1Z9SA 1MI5A 3MJ6A 3FRUA 3W9DB 1VENA 1T4KA 4NUGL 5FEBA 4E5XA 4YZFE 5DUPL 4GG8A 4PJCB 5EBMA 2H32H 1ETZB 4DGIL 1UEYA 3ZHKA 4BH8B 4XX1E 1U93B 3TCXA 2RCSH 3TO4A 4Y4FC 1JIBA 3MXWH 4EDWL 5IKCB 4LVHB 4YEFA 4HMEA 1F02I 4PJHB 1TNMA 3MJ9H 4M62L 5DK0B 1SBSL 2YPLD 4BZ2L 1RD6A 3D18A 3ARDA 5I8OL 2R0LL 1P4LB 3MJ7B 2FWOB 1WT5C 2CIKB 4KI1A 4IRJA 3S3PA 1MFCH 2BSSA 3S5LA 2Z91B 1DQQA 3RVWC 1WUNT 1SJVA 5JZ7D 4EN3A 4F8TA 4WI5A 4QRTB 4RNRA 4HXBH 1RI8A 2VTFA 4NNYB 1IGIL 3LHPL 2EIDA 5EUKB 1RMFL 3OKOB 1E28B 3EAKA 3QO0A 4I13B 1FRGL 4PJ8C 4D8PA 2EDEA 2ADFL 4OTXL 4L8CA 3WFDL 5A2KH 1MCIA 3G6JF 1FAIH 1KJ3H 3CX5K 4LCWE 4ZTOH 1T66C 3RUGA 3MJ7A 5D7JD 3MOBL 1BVKA 3AGVA 1RJLB 3ARED 2YC1A 4KU1A 5KSBA 3KJ4C 4PJDB 3TNMB 1MCWM 3AM8A 3FN0L 5J13C 1KNOB 4XP1L 4FMFA 2KPNA 3VFMB 4O9HL 3V7AE 5GRJH 1HKLL 2NQCA 1Q9WA 1UXSA 4NNYA 4J3WA 3RKDC 4DUWA 1LO3H 3ZTNH 2VDQL 4J4PA 4MNHA 5HYSB 1DLHB 2K1MA 1QSEB 3U83A 5EU5A 2R0WL 3VI3E 1A7QH 1JNNH 4RX4D 2QSTA 2QQQA 1ES0B 1ZVYA 1ED3B 3MOAL 1ZGLA 1RZ8A 1ND0B 2G5BA 3MV8E 5HPMB 2ADJB 1QEWA 4R7NA 4KZDH 3E0GA 3HG1B 4CN6A 5DJDB 2XRAL 3QAZB 4JPIA 3EYVB 2VYRE 1QRNB 5SWSD 3TVMA 3MRLA 3D5OF 3QQNA 1MAMH 2HT2C 5L2KA 4G6ML 4HDIA 1UA6H 5K9KA 4HG4K 4RGNC 2EH7L 3RDTC 1GJIA 2AK4A 1DLHA 4CU6A 3G5ZB 3B6SB 5JW3H 3ARZA 3GSQB 3ISWA 3ALWA 1QBLL 4M1CD 5CP7B 5F3HA 1JWUA 1NL0H 3GMNA 1QBBA 2VR9A 2CGRH 4PRDB 4U1JA 3BH9A 3TT3L 4LPVA 4NCDA 4KJQC 3K1DA 3B5GA 2XN9D 1I1AA 1NDMA 1K2DA 3G9AB 3NN8B 4HLJA 2NY2B 4JY6A 3U46A 5I75C 3MTRA 3BP7A 2R8SH 1WZLA 4TSBL 2EDRA 4P57B 2N56A 4I9WE 3TZVB 1A3RH 2W9EH 1EDQA 4PS4L 4AEHH 3SKUD 3KXFE 4XVTL 4FQHA 4LVOB 5HVHC 3KPQA 1KLGB 3FMGH 1N0XL 5I17A 1A3RL 1OPGL 1XF5A 5CP7A 5L7XL 1KACB 3KYOA 3CH1B 3OKLB 4GBXD 3G5YA 1BJMA 1KG0B 4FQLH 5D1QC 5C0EB 1IC4H 3FN9A 4IS6A 4MQXD 3SPVA 1NMBL 1LEGA 3TPKA 1OM3H 1DVFC 3OKDB 4Z76A 3AREB 3C60B 1Q1JL 1TETH 1NBZB 1VFAB 5KVGL 3QUYA 2EDWA 1KLUA 1KXTB 5CMAA 3TNNB 3NFPA 5C0CE 2VLLA 1U8KB 1L7TH 1M7DA 5I0ZA 1OAYH 3SE4C 1HXYA 2YXFA 1HWGB 3BPLC 5LBSL 1RIUL 2FX7L 1CXIA 3V0AC 3VG9C 4GRLD 3VWJB 3Q0HA 5F1KC 4UIKH 4MQ7B 4I3SL 4LIQH 2GHWB 5E6ZA 2VC2H 3LVEA 2CD0A 1LDPL 4HX1B 4FTVE 4R4ND 4NDMA 3HC3L 2AJSH 4KJWD 1Q0XH 4CRPA 2AABL 43C9A 4TVPE 3SDDA 1MUJB 2DLEA 3S36X 5JW4Q 4QRPE 4XRCB 2YXMA 2NY3D 4PJ7A 3ARUA 2J8UA 4UTAH 1FZOA 2Z31A 4YHIB 3VD4A 3HZYB 4HV8B 3QHZH 4A2MA 2ZUSA 1FSKC 4X5XB 3F12B 5CJBA 2EDNA 1EHLL 3M45A 1HSAB 1ZAGA 3GGWB 3S96B 2QL1A 1MF2L 3RDTB 5EIIB 3QIUC 4L8SC 5AZEL 5M7QA 3KJ6L 3HAEA 4N1EA 4XP4H 3U6RA 2V7HB 2YWZA 2GCYB 1MRDH 4HZAA 5FHBH 5HHNA 3CCHB 5FO9B 2CXGA 3DVGA 3TM6A 1U8NA 1QSZA 1ZXQA 2MHAB 4MXWL 5C71A 3WS6A 1XF2B 2UZYB 2ZCHL 4XP1H 4ALAH 1I1CA 5CEXA 4PG9B 5DC0A 4UIMA 1H0DB 1BD2A 2BSTA 2DL2A 1S78D 4V1DB 4OBSA 4HJ0C 2Y06H 4G8EA 2D4DA 5DJAB 1G6VK 3HUJB 4OLWL 3O3DA 1NJ9B 5C07A 4RNRB 1EEYB 4ZD3H 4RZCA 3T77B 2IG2H 1O5DT 3R8BB 4ELKB 1RZIB 4U7KA 2G5RA 1T0MB 2V7HA 2Q87A 1FFPA 5KG9B 3A6BL 5HJ3A 3QUXA 1GSMA 1RZFL 4EI5A 5F8RC 2X4QA 3N85H 4EXPX 4HS8L 4ZUTA 3M17A 1BM3H 2P8PB 1QSFE 3FQWB 4JANB 2PW1A 3HE6D 3GMLA 1OTTC 2ZOLA 5D9SA 4G8EB 4HBCH 1ZVHA 3C08H 5DJ8A 3B9KC 4YHMH 3MRPA 5HY9B 3ZMRA 2IAMB 2V5SA 1W2KT 3QDMD 2ICCA 3O9WA 4IMKC 3HR5A 1SHMA 4OSUL 3F5WB 5DXWA 3LN5A 1U42A 4TUOA 4XBEH 1CDBA 3CVIL 1ZS8B 1HQRB 2VXSH 2VB5A 4JFPB 3SCMC 5IBLC 5D8JL 4W4OC 1TNNA 3HMXL 4LSVH 3QXVA 1UH3A 1EO8L 3QCTH 3T2QA 1G9ML 4MJ4A 1G9EA 3RNQA 3SBWC 4S1RH 3QULB 5ETUB 1NUDA 1T1XB 3CFBA 5HHXL 2OMBA 5GS0D 3RGVB 3EO9H 1U58B 5GQBA 5DEFA 2ZCKL 3QQ3B 1T3FB 4AENB 4LLWA 1MFEH 1G7QB 2D7OA 4Y5VA 4WTZA 4L8BB 5D7SH 2VMFA 5IHZA 4BSWB 1HHKA 2F5AL 1CDJA 5I1IL 2LABA 4L5FH 1V3JA 5ENWB 3DO7A 3D0LB 4PGBB 3RA7L 5ESAB 2CRMA 4Y89A 3BO8B 1A6PA 3P9WB 2R0ZH 5I2IB 2B5IC 1EPFA 3V7MA 3CXDL 1CI5A 5GISH 3IAQA 2IAMD 2VLME 2G75A 5F97E 1YY9D 4MD0B 3C6LD 1RK0B 1ZMYA 3WV0A 5BOPA 1VSCA 5IHBA 1X7QA 1IL1B 5KVDL 1IQDA 5DO2C 4F7CA 4E41D 4ZFFB 4J23A 4YDVA 4OCWL 3CVHB 1I7ZB 3QDGB 2VDKH 1CGSL 1JWUB 3ZE1E 3WSQH 1LO5B 3QBTB 4OCNC 3DUUB 2J6EA 2D9CA 4XXCC 3AS0A 3QA3A 3MO1B 3DNKA 4N0YH 4GSDH 2PKDA 2OBGA 1IGFL 4CW1A 3BH8B 1KENH 5FGSA 4GUPA 2VDOH 1XR9B 2RIKA 1A7RL 1KTDA 1KXVC 2EDOA 3BT2L 3LKRA 1KCRH 3TZVA 1JK8A 3HMWH 4P5MB 3GSOB 1KB5L 5CEZD 5I1JH 1I7RA 1KGCD 4QRUB 3VXTB 2HVKB 2D2OA 2NXYC 3IDJB 3RPIA 1OLZA 5DMGC 2ICWI 2EO1A 4UINH 1N5AA 3BN9D 5E8EA 3ZE0E 1ZLVK 3V5HB 1NGYB 1J1OH 3G5YB 1TCRB 1OGAB 1S3KH 4AEEA 5C0DA 4GFTB 4Y5VC 5D96C 1X5XA 2XTJB 2KQNA 5F71A 5DEZA 5DHVH 1U8QB 3LPWA 2O93L 3MLTA 2HKHL 1VFOA 3KLDA 4KKAC 4Y16D 4YHML 1YNTA 5J11B 3TH3T 3D3VB 3LRHA 1JWSA 4JFHE 3LKPB 3NAAH 4DKEH 1NLBH 4LQFL 4KHXL 4TQEH 2HJFB 2LAAA 3I3EA 4NWUL 1HSAA 4KXZI 4RA0C 1NGPL 1RZJC 2VLJD 3DXAA 4O5LL 4HIHB 4ZPVA 2AEPH 1CE1H 3NCCB 5SWZD 2V17L 4F3FB 4JHZA 1U8OB 3MRKB 3JV6A 4NO0B 4U3CA 4WI6A 5CZVH 2APWA 3DMMD 1MCDA 1ZLSH 5HDBF 4YHOH 4Y4HD 4Z7VA 1INQA 5ICXA 5A43C 5DQ9B 2EDKA 1N6QL 1HYSD 1A6TB 1JP5A 4XNYL 3VCLA 4GT7A 4U1HB 4P3CL 3SE8L 1XZ0B 2X42A 2ZUTA 3RY6A 1AGBB 3PNWB 5J0BA 4WHTB 1P9MC 1GC1L 5I73C 5EZOL 3MQIA 3OPZL 1G7MB 5DHXB 3ME0A 1NGXB 4I0KA 1W72B 4Q9BA 2IBGA 2J8HA 3QUMB 5D1QD 4DK3A 1PEZA 5I1DB 2WUCH 4DKDC 4MCZB 3HUJA 1F4WH 3ULVL 3ARTA 1AE6H 5KG9A 2DQUH 4BFGA 5FAAA 1WBZA 4Q2ZA 2OS7A 3DSFH 1CDHA 2A77L 2CQVA 1INQB 2WQRA 4UDTB 3W2DH 2AJYH 4X5WA 3WFZA 3K81A 5DJ0A 4BZ1H 4JPIB 2DLFH 1S9XA 4XVJL 3OB0K 1F90L 2GTZA 4OGAC 2ED9A 1EJ6A 3LIZL 4WI7A 4NC2B 3ZKNC 3O6FB 3O6ML 2IMMA 1RY7B 1QNZH 4NKMA 4O51B 4K7FB 4ONGH 3DX9A 1EEQA 1J8HD 3L3GB 3GBLA 3GMRB 5KANG 1VDGA 2YEZA 5K33A 5C7XL 1ORSA 5DYOA 4PBWD 1RZKC 1KIRB 1RAMA 1RZ7L 1YY9C 3ZL4H 3P0VL 4XNXH 5DF0A 3K1KC 3GSQA 3ILQC 5IFJA 3ALPA 3UTTD 4UQ3A 1AH1A 1DANU 5D9SB 2L0DA 2VXSL 1UG9A 2D0GA 2H3NB 1OAKL 1T1XA 3CFBB 4XCCL 2IH1B 3N1QC 3IETB 2BSED 3C5ZD 3AU1B 3WHXA 4JKPH 2YMXL 1GCFA 2XN9B 1YECH 3P73B 5C0AE 5FYLE 1J0ZA 5D7LE 5CKGA 5DD1H 4D9RD 1XGQA 2CUMA 1G7LB 4MJ6B 1T5WA 4J6RH 4P3DB 5LGKA 4PD4K 1AGDB 3DBXB 4WWKB 5GGSB 3P0VH 4XNXL 1RZ7H 3ZL4L 4KHTL 4PR5B 3P0YL 3O45A 4HXAH 5HHQB 4JFFA 4NKQB 1CLYL 4QHNB 1G7PA 5E4EB 4E42B 5TDNB 4PJ7E 3OKNB 1NFDE 1T21A 1ZHKA 4NO3A 1OSZA 3N9GH 3V5DB 1FORH 3BPOB 4K8RD 1VFMA 3C60A 3REWA 4ELMB 1IVLA 1ITBB 1BLNB 1KFAL 4AG4H 4QOKA 3LN9A 1KPUA 4YIQA 1EGJH 4D9LH 4LHJB 4PYHA 5KOVC 3FL7A 2Q3ZA 1NL0L 4HMCA 5E4IA 5L2JB 1AXTL 1B4RA 1TENA 1CLZL 2VXVH 3BHBB 4P2QE 5GSRB 1RFDL 3VI3F 2PXYB 1LP9E 2VIRB 2GYSA 4ODWB 3SY0B 2IPUG 3T0EA 2H32A 2P47B 4I0PC 5GGSA 3TJEL 5C0IA 4PGCA 3K2MC 5HHQA 1J9CT 1HHHA 3VWKA 1MJ7L 4BH8A 2PTUA 3SDDB 4YXLH 4DGVH 2A74A 4WUKL 4XXDB 4F9PA 3FB6B 4O2FA 4QXWA 2P5EE 2Z0BA 3MRNB 1EO5A 1WWCA 2NCMA 5KSUB 4WFED 3IFOA 4DQOL 4G3YL 2PTVA 2V5RA 1UQSB 3EOBA 4PJHA 3I9GH 4TVPH 2ERJB 1FO0H 2NR6D 2CRIA 3KGRA 3M8OL 5B3JE 5FDWA 3QRFM 4HQQH 1E6JL 4ORGA 1RPQA 5LGHH 4RWYL 2EICA 2Q6WB 4I0CC 4WY7L 1T22B 5D70L 2BCKB 5E94B 3IDGB 1I7RB 3WS3B 4J3XA 1FVCA 1UB6B 1S7TA 3BMVA 4UV7L 3RWGA 3UTPD 2C9AA 4ETQA 1CFNA 2C3WA 5J56B 3OSKA 3TFKD 4Z6AT 4FQIH 3NIDE 3MRNA 5KSUA 3E1F1 5M95B 3BP4A 1B9ZA 4IOFC 1RU9H 3V6FB 4HFWA 3NAAL 4UUJB 3E8UH 3FKUS 3RVTD 5E5UB 4I8DA 3R0MA 4WCYL 1YC8A 4JFDE 3RNKA 4GAGH 3FQTA 4PJAB 1TQCB 4AT6B 1IC5H 2CIIB 3KDMA 2IAND 5AUMB 2HFGH 4YEEA 3IVKB 2A73A 2C1PB 4OFIA 2DI9A 5CP3H 3I2CH 2XWJA 3BD4A 2OLDA 4OZHA 3T4AB 3WUWG 4Y4KC 2AXJA 3U48A 2MKLC 2C3GA 3O81A 3PQYE 1P7KB 3DYMA 1T83A 3OR7B 1WBXB 5D2LB 4OF0A 2QHLA 3SGKC 3M1BB 2I27N 3ECBA 1KN4H 1XCTB 4EOWL 1ORQB 4NKIH 5DZNA 1QSEA 1X6LA 1HHIA 5GGQL 4PP2B 2B4CH 2YPVH 4N0RA 4Y5YC 3ZZ1A 5EU6E 2AJ3B 1X5JA 2R0KH 4JJHA 3SO5A 3ZKMC 5ISZB 3IYLW 3P9MA 4U6HB 3U0WH 2PETA 4B5EA 2I9LA 5DQ9A 1YEKL 2PYFA 1IC1A 2RBLA 1JGDB 2N4IA 2H45A 4YDKH 1WVZA 2DRUA 2CLRA 4OQTL 1DQQB 2C5DC 3IDYB 3RJQB 1CU4L 1XF3A 3RX8A 5J13B 3MYZA 2Q8BH 1F6AA 3VXMD 1FZKA 4XCCH 2WZPD 4NQEB 1T7XA 4LCCA 4X6EB 2AV1A 1MNUH 1FNFA 2XNAA 3OKMA 4YGVB 4W6WB 5JHDA 4RMVA 1E4XL 2H2PC 4QXTB 1YEDB 3MRBB 4UZGA 1MWAB 1XGYH 1YNLH 2NZ9C 3BISA 1KEMH 2GW5A 4M6OL 2CKBL 1JGEA 4LKCA 1IM9D 4PLJD 4HK3J 2H1PL 1WT5A 4GOSA 2D7TH 3CFCL 1K4CB 2XKNA 3X3GL 4PGEB 4PJDE 4OF6A 2X4PB 2HFFB 3TO4C 4U3HA 2AGJL 2B1AL 4MJ5A 5EU3A 3MRJA 1FG2A 1IBGL 4MJIA 4BYHA 3ARPA 4ODXB 4QO1A 3KWWA 4P23A 2JJTC 1XGUB 3ARWA 2EXYD 5FB8B 1OAXH 1IEAB 5HDBE 5E2TL 3JUYA 2Z8WC 4M9PA 4MD0A 1ZGLP 1CVSC 1OAZL 3O3UN 1OCWL 2AJXH 3RAJL 3DMMC 3KNBA 1LDSA 3VFPB 1QQDB 3BQUD 3BIKA 2CLZB 5FYJD 2M26A 3CJJA 4HIJB 1QSVA 5HGDA 1MELA 4POUB 1M6OA 4RFNC 2ADJA 2KZWA 3D69A 4LCYA 3IKCA 4HCRL 4ODVH 1FYTD 2L7UA 5C3LD 1WICA 2HFFA 3ULUC 1QLFB 3FJTA 3VFVA 4JM2D 2VDMH 4R2GD 3HMXA 4RQQA 4S1DD 3IFPA 1ZV5A 1HDMA 4MAUH 5BZDB 5IQ7L 2DI8A 5DHVA 5I1HL 4P2QB 5K59F 4GQ9L 3QUMH 1KTDB 2IADA 3I84A 1I8LA 1CXKA 4HWZA 1YYLH 2AJZB 1U8KA 3S98A 4CJ0A 3GK8L 3MYJA 7FABL 1ZLSL 3HNTH 4R9HA 3IXAB 1T5WB 3NZHH 4YAQB 4OD1L 5FOJA 3WFCH 4QRRA 4OUOA 3ARBC 3IJSA 3VMNA 4NKIL 3GSXA 4R8WL 3WKMH 1SVCP 3CZFB 3KPSE 4KJWC 3UTSD 5D7IB 1MCHA 5EU7C 2OP4L 4H1LB 4QLRA 2XWBA 1IAKA 4ETYA 4N9OB 3FFCD 4RQQB 4YHNA 4WU7A 2B7DT 4GRWH 3MLRH 1CWVA 3F58H 4F7MA 3QNXB 1NGYA 3T0WA 5TGBB 5ELIA 1K8IB 3GO1L 3W82A 4P23C 1PZUB 3GHBH 1JNLH 3JVGA 1TITA 4CVWA 4X5XA 3MGAA 5ISZD 3MCG1 2E27L 3LKPA 1A47A 1QZ1A 4ZOAA 1HE7A 3BDYL 2YD2A 5D1ZC 5T3ZD 3IKKA 3ZDYF 5ILTH 2GSGA 3FZUC 1NCWL 5EZIH 4GAJL 3W0WA 3MA7B 3RL2B 4JO3L 1IQWH 1NC2B 3PWPA 1I1YA 4N1CA 4KMTH 1P2CA 4F3FA 3NFNA 5ADPH 4HH9A 4GKNA 3HR6A 2ITDB 5F1IB 3K7UA 4U1GB 1A2YB 3GSNB 3VA2C 4NO5A 1D9KA 2L7JA 3VXRB 4KDTC 4NOBA 3LQZB 4MQTB 4JQVA 3F7QA 4HQQL 1I85C 3B83A 3TA3C 1R0AL 2VDLL 1JHKL 1ZA6B 4GLRI 2WWKO 2ZKHL 4QHUA 4CVUA 3HZVA 4CDHA 3U7WL 2NYYC 5HI3C 1CR9L 2GY5A 3SDAD 4MXQC 2P46B 1OY3B 4KTDL 5K9OB 4U6VL 1KB5B 1QSFB 2B2XH 2VLLB 1AGFB 3HCVA 4H1LH 2SEBA 4JQIL 5CGYC 2IGFH 3UYRL 4H1LG 5ANMB 4WEMB 1X6NA 1U3HD 1G7MA 1UM4L 1OTTD 5E2VH 3ARFD 2BHUA 1P5VA 1S5IL 1FO0A 3NFSL 1BFOA 2VAAB 5H94B 4X6CA 1XR8A 2OI9C 4Y16C 1EHAA 1QP1A 3BQUB 4K2UH 1XCTA 4BK4A 3GNML 5KTEH 1WC7B 1QKZH 1TQCC 1ACYH 4POYA 4P0DA 2VXVL 5F9WC 5HY9A 1WBZB 2BC4B 2X9WA 3MUZ1 4Q2ZB 1JE6A 3BZFB 5LGJA 3KPSD 1EK3A 1ZWIB 5DJXA 1UH2A 5MEND 5FUZL 4OQTH 3MNZA 2R29H 1D5IH 5I8KL 3SDXF 1CFVH 4M8QA 4YFLI 4Z5RA 2K3TA 1YQVL 3TH2T 2B1HL 3U79A 5F8QC 1HXMA 3B9VA 3UZEA 4AL8H 4G9DA 1A4JA 1I4FB 2BNRD 5MEOB 3BVNB 3MA9H 2P1YA 3QPXH 2D03L 1ZT1B 1YNKH 1FZKB 1RJCA 5GGQH 3W5NA 3U6RB 2AQ1A 1KIQA 4X7TA 1H5BA 3QCTL 4WFGD 3CCHA 1BGXL 2EXWC 1INDL 3VXMB 1EXUB 1U8NB 3MBED 4KY1H 5F1SA 3B8SA 4PJBB 4U1NB 1DBKL 5HPMA 1IGYB 1BOYA 2RFXA 2CR3A 2FEDD 5J9PB 4YC2C 1YEHL 3RZCA 3NPZB 4YX2H 1RVFL 1K6QL 1UM5H 4MJ5B 3CAFA 3CDGA 3IDXL 1LO0L 1F6AB 4JG1H 5FGCB 1XGUA 1F4HA 1OAKH 5BV7C 2OZ4L 3PGFH 1KIUA 2AI0L 3TO2A 4YLQT 4ELKA 2E7MA 3FQRA 3C6LC 4JO2H 4E9LA 4XCYA 4ZUWB 3WO4B 3CDCA 1NKOA 1Q9KA 4QTHB 1CXHA 5EN2B 3WNOA 5HGHB 2IBBA 3LKNB 3UTZB 2UZIL 4NRZA 3KG5A 4WW1B 1QEWB 1CBVH 4L3AA 4U1NA 2ICEA 4R4BA 3C5ZB 2R1WA 4I48A 3S36H 3MRCA 4MAYC 1II4E 2VABA 3ES6B 3F5WA 4LEXL 2EDXA 1DR9A 2NY6C 2NY5L 4K3JH 4ODXA 2HMIC 5GRUL 3KYKL 2Z92A 4YDLC 4BUHA 3QXWA 4PTUA 1E4XI 2QTEA 4ZXBC 3RFZC 4NZUL 1MCLA 1FO0L 2XFXB 5CINH 3MBEB 4A6YA 1F90H 2AJVH 1RZKL 4I0PA 2DDQL 1ZKAA 4Y88A 5F44A 3R1GL 3MBEC 1MJJA 3NIGE 5D7IE 1FAKT 4JFQB 1XMWA 5DHYB 5D2NB 1ITCA 4YXLL 1IAOA 2VLMD 3X17A 4YHLH 2ZSVA 2P8LB 5EIQA 4MHHI 5HVWA 1OW0C 2BOBB 2FJGA 3CLEH 2ZUYA 1BIHA 2ESVD 3SDCB 4HGWB 4R97B 4FQCH 4KRLB 3T1FB 4L8BA 5IHZB 1HKLH 2BZDA 1EBPA 4NN6C 4O9HH 5JPNA 4KROB 3VFVB 4UT7H 4U7SA 1IAIL 2PN5A 3GUTB 3BDBA 3Q1SL 3RX5A 2A74B 3JTTA 4XCEB 4NBYB 4LOUC 1DDHA 1W8NA 1DVFA 4MCYA 1CIUA 4KDWA 1C08B 4Y19E 5A3ID 2BCKA 1BREA 5F1NA 3T65A 4X83A 5CZVL 2BNRB 2X5PA 5IBTH 2AABH 4NFBA 4DFHA 4LEXH 4LVNC 2XWTA 5BVJA 5GJSH 1WEJH 1AO7A 2PTTB 2ZP0T 1TZHA 3C9NB 1KXQE 3V6FA 3OAYK 4ODSH 3L3DB 1I8MA 1GGCL 1MLCB 3D0VB 2XPGB 1U8OA 4HS3A 3VDBA 3GJEA 3NTCH 4P9HH 4OGXL 1WQVT 3L7EA 2ITDA 5F1IA 4IRZL 1J10A 3BZ4A 5AYUH 5GSVB 4Z0XA 1ZOXA 1SBSH 3E3QC 5LXGH 1NLDH 1A6AB 1NEZA 1RZJL 1V7ML 2DYPD 3EYOB 3NCYP 2CUIA 2YR3A 4L4VD 2OR9L 3C09C 4JZNA 1UH4A 4YX2L 3IDIB 1B0GA 4PY7A 5EBLB 1JF5A 1WCBB 1R3HB 5C6TH 4P59H 3X3FH 1I3GH 4ZFZA 2I60L 1N4XH 2DM3A 5BV7L 4YBQD 4CMHB 1JHLH 1TJIL 1K4DB 1DQJA 4PYGA 3QHFL 3G6JE 5E6IB 4P46B 1BVLA 2Q3AA 4FRWA 2LTQC 4KKCD 1QPPA 1JN6B 3RWCB 4DVRL 5E08H 4N90D 4AEHL 4KKBC 4F37F 3LS5H 4QYOB 5MEQB 3VH8B 5D1ZD 5E99H 4APQD 4NWTH 2GEEA 1ORQA 1F5WA 2FB4L 4TPRL 5IMLB 1HH9A 1MIMH 3TO4D 4LCWB 4RGOL 4QXGL 1D5IL 5I8KH 2JB6A 4QRSB 3OKMB 1C1EL 3MV7E 1E4JA 5KSBB 3FRUB 1VGKB 3V5KB 4WHYH 2WINB 1U8JA 4PJIB 3BEWB 3TC9A 4CU8A 4RCAA 1CGUA 3DRTB 2O5YL 4CAGA 4LLDB 3GNMH 3ZT6A 5BRZE 4XP5L 4XPFH 2VDPL 5LAXA 1ZA3A 2WUBH 5D7KE 5MEQA 3VXQB 2I26N 1XZ0A 2R69H 1LO4L 4KVCH 2V9TA 4KKAD 3TWCL 1QACA 2LVEA 2VXUL 4OZFA 1QRND 4NP4H 1NGWA 4X6DE 3MBXL 3A67L 5FGCE 1J86A 3U2SA 1A6VH 2FWOA 3MFFB 5F7KC 3CFEA 4E41B 4ELMF 3CIQA 3OKYA 5TE4L 3E3QE 1PDKA 3RTQA 1L9MA 5JIHA 1RUAH 2BDNH 4HJGB 4PGZA 4DWHA 2BFVL 3W9EB 4U6XB 2HRLA 4ODUA 4H25B 1FN4A 4Y2OA 5CJQH 1J11A 1NGZB 3BFOA 1U36A 4JEGB 5CLTA 3CK0H 1QLEL 2I24N 2X4UA 3D1MC 1IT9L 2DBLL 3T4YA 4TUKL 3FQRB 4EN3C 4JFFB 4RIRA 2NW3B 5HVFB 4HIEA 1P84K 3HI1B 4NWUH 5GGRY 5AWNL 1FL6A 1CCZA 4Q9QH 4NKMB 4TOYH 4IRJC 4KTEL 2EDHA 5ESVA 3CVIH 1IGYA 1VEOA 4CU7A 2VLRA 1TZGH 4FFVC 4BFEA 1OP3H 1AP2B 3GIZL 1T0NB 5ESQA 4RX4A 5L9DH 2EC9T 3ZTJG 9CGTA 5HI5D 5BZWA 3RIFF 2VISB 4HT1L 1X3DA 5BQ7A 3X11A 25C8L 3JVGC 1KLGA 5TPWL 3BZEB 1MFDH 4TSAH 3SKNB 5GHWL 3UC0H 2DQDL 2ERJC 2V2WB 1IFHL 2WBKA 4ODWA 5IESL 5KJRH 1JPSH 5HDQL 2KKQA 3WLWC 4GAFB 2R1XA 1QFWL 2EYRA 5KS9B 3PIQA 4P57A 5IM7B 2D4FA 4OI9A 1QO3A 4OB5H 4OFYA 2ENSA 1WAAE 5DYOB 2PYEB 2H6PA 1DE4B 4JRXE 5JOPD 4F7CB 1IAOB 1A6VL 1AR2A 2FZ3A 2X7LB 5LCVH 2FX8L 3O8XA 4KMQA 5D93C 3H3KA 4DN3H 3RU8L 1FDLH 1KB5H 2ZPKL 1KBGL 4HGWA 1K8IA 2YKLH 2V2XB 1V7NH 1NCNA 1T80A 4OD1H 3SE9H 1A7RH 4D0CB 5INDB 1WIOA 4OLVL 1K85A 3QNYB 4J1UA 4DAGL 2BJML 1BZ9B 2VH5H 35C8L 1UZ8A 3HHRB 1OT2A 2XG5A 5GZOC 1YEGL 4C54A 3INUH 5JPNB 1RK1B 4YO0A 5E2JA 4P5MA 5IHUH 5IB5B 3QJFA 4L29A 3VFOA 3HI5H 4M93C 4KROC 3HTLX 4OCRL 5KOMC 4M03A 1U3YA 1IKNA 4LLQA 1DUYB 8CGTA 3FT2A 5DMJB 1ZVSA 5GPRA 1MHPH 3REWB 5I1KH 5DUPH 4BZYA 5K59E 4NQDA 1TQBC 1IZJA 3HZYA 4M7JH 1XIWD 2EDQA 4UILL 3SGDI 1U3HC 4XP4L 5FCUH 3RNKB 1SVZA 4OZHE 4JDVB 4Q9RL 3L3JB 1S7QB 1JYVA 3TA3D 4K3DL 1F8TH 2Q76A 4HS3B 1AQKH 2VL5A 5A2IH 3RWDA 4U1IA 5I15H 3C9NA 3MLXH 4K7PX 1JZ6A 2GCYA 4WO4B 4Y4KD 3A0OA 1D9KB 2XZCL 2DQIL 3TBYB 2Y23A 1YNTB 5HHNB 2YPLE 1EJOL 1AD0B 2NY6B 1S7UB 3HZMA 1W8OA 4LLQB 3B5HA 1Q9LB 2FL5B 4HGKC 1U2CA 3B9KA 4Y4HC 5GJTL 4Z9KB 4OV6F 4E41E 1CXLA 1Q94B 3B9DA 4XNUL 2VN4A 4FQXB 3QUXC 4X6CF 2UVFA 4EI5C 1UJ3A 4R7DA 1TCRA 5T3XL 3JV5A 5LXGL 5SX4I 1YN7A 1T5XB 2EKSA 4YR6B 4IS6B 3SPVB 2DKMA 4QHMB 1E4XH 4CN4A 4OGZA 5I8CA 4ZSOA 2Z8SA 1MREH 1RURL 3VXNA 1BFOB 5H94A 5HYFA 5C08D 1WJ3A 4LP4A 3L1OL 5EUOE 3HPJB 5J3HD 1JZ8A 5DJYA 3UPCA 4DUXA 4RAVB 4JM2B 1OOAA 1IEBA 4Z7UA 2BC4A 4EDXA 1PY9A 5E8OB 4JLRA 3SO3B 3EJYD 4NKOB 4FQLL 2NR6C 3MREA 3HC0A 1GOFA 3OBAA 1OAUH 1IAMA 4M8QB 1VGKA 3V5KA 1HILB 4DZ8B 1KN2L 2VLKA 3RTQC 4FQ2L 1DP0A 3VG0H 4XP6H 3MRHA 1J0YA 3QRGH 5CD5D 2N1KA 1F58L 3Q1SH 4H0GA 5IKCA 1DBBL 4AQOA 3MZGB 4NNPH 1BWMA 3NIFE 2PCPA 3EDFA 3O4LB 4IHOA 5GIRB 3RIAF 3RHWK 3QCVL 4GH7B 1V3MA 3QO1A 4Z7UB 4LNVA 5TE6L 4WI8A 3TWCH 1NCUA 1Y6MR 3LN5B 1AXSB 3QXDB 5C07D 3MODH 3P4NA 4OD3H 2OK0L 2VDPH 1S7SA 2YRZA 3HRPA 5E9DB 2GY7B 4R4FL 5EZJA 1PJ9A 1FFRA 3EOAA 4ZUVA 4YHYC 1C5BH 2GJ6E 2V9QA 2NY0D 1R3JB 1TQBB 4NQED 5E1AA 2MQCA 3QDJE 5GRUH 5FKPB 2W0LA 5IQ9A 3MLWH 1ZEAL 2GFBA 4LCWD 1L4IA 5AZEH 5JZ7C 3IFPB 3D39A 4NSKB 3KPMB 4PBXA 4LHUD 3U1SL 4XHJD 4TUJB 5DVKA 5MP6H 1WZMA 3BOVA 3UTPE 4YGVA 2I9LB 2R2EB 4RAHA 3ARBB 5GS3A 5F9OL 2CRZA 2DM7A 3HC4L 3CFDA 4PLJC 1UWGH 3S7GA 2APXA 4LKCB 4J3SA 1LO2L 1FNEA 1IEHA 4HKBB 1BECA 2CKNA 1KT2A 1G1CA 2X9XA 3TN0D 5JTWA 2O26U 4POZC 2VISA 1CFTA 1FL3B 3QA3B 1BFVL 2HJLA 2W92A 1PG7H 3BKMH 4YHNB 4TTDD 2BX5A 2E7LA 1XR9A 3GI9L 4RFOH 1G6RA 4PJXF 3RUGF 1TIUA 2I5YL 2XQBH 3EFFB 2WQ8A 5JHLH 1KELL 1LK3L 3H8NA 1RJZB 3VFPA 5JW5B 3AAZA 3SKJH 2EDJA 2CK2A 1OM3L 5EB9A 4LU5H 1LEIB 3V6ZB 1F4XH 5GGTH 1S9VA 3X13A 4HKBA 4TVPD 2AJUL 1GAFH 3T0EB 2VQ1B 1QLFA 2A6IA 5H2BB 2E7LC 5EU6A 4C56E 5TF0A 1FE8L 4S1SH 1EERB 1FL5A 5E7FA 4R0LB 4NQCD 4KK6D 1QVOA 1BWWA 4GRMA 1TLKA 2BY1A 3QQ3A 1UCTA 2EE3A 1PY4A 3DPBA 4Y1AA 3L1OH 2WANA 3D69B 4QOKB 3EOTH 5ICZB 3K8KA 3BWAB 5D5MA 4F7PA 4O2EA 1AIFA 3D87B 2J5LB 4OCXH 5JO5A 2AXFB 1JRHI 1KUMA 4X8JA 2J4WH 2Y6SD 3GJEB 5I17B 4GO6B 4G5ZL 1PKQE 1T7WA 3MUGA 3A6CL 1N59B 4JQIH 3D2UD 5T1KD 4U33A 4HJJL 2X4RA 1J0IA 5DRZA 4EJ1C 2VLJB 3WFHB 1CYGA 3DYOA 4QT5A 5JW3L 1MJUH 5DRWA 5C0ND 1H9VA 3ARRA 5KAQF 3HC4H 5E00B 4Z77B 1A5FL 3ARGB 2DQIH 4I2XA 5D6DA 3RVUD 3TZVD 1S9WA 5C09E 5I15L 15C8H 5GGVY 1CK0L 5JO5B 3UTTE 1SM3H 3SGEI 5AYQA 3H2WA 3PL6C 5ITFA 3S9DB 4PREB 3VD7A 1HN1A 1UWEH 4NHCH 4R97C 4YE4L 3W0WB 4M4PA 5CMAB 1KC5H 1JPTH 4OCYH 3N1GC 1I9IL 3MRFA 4OKDA 4CBPA 2IQ9H 4OUUB 3B9KB 4L3EA 1SBBA 1LK2B 2ITCB 5T5FL 2ZJSH 3M1BA 1N7MH 4PLKD 4WHDA 3TYFB 2PR4H 3UMTA 5DJYB 4ZTPH 1X9QA 4CGTA 4A2LA 1JFQL 4NZTL 4G8IA 4PPTA 5EC2B 4YDLB 4OLVH 4OLXL 1CD1B 2LV4A 3QUZD 1FHGA 3BI9X 3T8XA 1F2QA 4WEBL 4HGMA 2NXZC 2GT9B 4JKKA 5CSGA 4AZ8A 1HIML 1J05B 4QHLB 1FNHA 4YH6A 3BKYH 3QDGD 3SE8H 4FQ2H 3ULVC 2JE8A 5JOFA 3MMEA 2Z93A 3R06B 1BD2B 2AXGB 1FAIL 1UJ3C 3VXSE 5JQHC 2ZCLH 1LK2A 4K71C 4ONOA 2F53A 5DZOA 4P49A 5JHDB 1FG9C 1AR1D 4M7LL 2AEIT 4D0BB 1ZLWK 2NW3A 5KJRL 3RTQB 3KPOA 4KVNH 2JK5B 1RUKH 2IH1A 1XGTA 5C0JA 2HFEA 3O11B 4LSPH 4JFYA 4OIAA 4KI5E 4YXHH 2FD6H 3P77B 4MS8C 2B1HH 5IFJB 1JGDA 5DO2D 3W81A 5KS9F 4PGEA 5CJ8A 1A7NH 4KHXH 1DQLL 1MFCL 3SKJL 5FYJH 3OXSB 3SQOL 5E5MA 1E4WH 3KHOA 1ZHLA 3OAUH 4IIQC 3HPLA 2BVUA 4HCRH 1N0LA 5F9DC 3QR2A 5J12B 1OB1B 3E2HB 4FG6D 3KPLB 2X2YA 3MOQA 4WGWB 1G9MC 5EUOF 4PJ9B 1KJ2A 3BKJH 5IFHL 3MRGB 1FFPB 1WITA 3ULVE 3UXFA 5BZWB 1FFNA 3VRIA 1NMAH 5E9DA 4N1HB 3MACH 5HGBA 2BOBA 4UB0L 4RDQG 2BRRH 2VLKE 4HWEL 4DGIH 3O9WB 1BLNA 2H9GA 5IF0A 5HHVL 2QQKH 3A6OA 1I1FA 1FG2B 2XZAL 1FZMA 5F89B 1D5MB 4FFWC 5DQDH 2AK4B 1A1OB 1D3CA 3QNYA 3DYPA 2DWEB 4O4YL 3QZWA 2BMKB 2DMCA 5AAMA 5F9OH 5CHNA 3K4DA 4OF3A 1JCKA 1QR1A 2R1YA 4LARH 1T66D 1U8HA 1OLLA 5I30H 5C0IB 5F1NB 5IFAH 4N0YL 4YHPA 1T1YA 4MYWB 4PRID 3QJFB 1M05A 1FNSH 3AREC 4NO0D 2HRPH 5K9JL 1DBAH 2DTMH 1KIRA 5EUOA 2WBJA 1QFUH 3PP3H 3TLRA 2Q8BL 2DTSA 4OCSL 4WW2B 3AXLB 3WFEH 4Z7UF 2D7QA 4R26H 1CG9A 2PO6D 5IIEB 5C0NC 1YEGH 1GPOL 4M6NH 3AAZB 4L3CA 2AERT 5JMRA 2BMKA 1AGCA 4JN1L 3SCMD 4CNIA 1XF4A 1YEKH 4U7MA 4JY4A 4NRZB 5EOTB 2WV3A 3ULVF 2HKFL 1HQ4B 1D5XA 2XTJD 2R0ZL 3I02B 3L7FB 4U1GC 2BJMH 4C55A 3I6LD 3RU8H 3BUYA 3V79C 1MQKH 5CCKH 3PQYD 1S7TB 2F5BH 2VLJE 3SCMB 3EO1B 1XGQB 1LGVA 3MJ8B 1KN4L 1DQLH 1A7NL 3QDJA 1INEL 4Y19D 4U2YA 4Y4FD 2DQTL 2MSPA 3RVVD 3WXVL 1NCBH 2I60H 2DICA 2HVJA 4UB0H 3VFWB 5TH2A 2DQCL 1JF6A 1NUGA 2NLJA 5IESH 1PSKL 4P9MH 1I8LC 4FTVD 1FL5B 4WIQA 4ENED 2HG5B 3TJHD 4P5TA 3H0TA 4HT1H 2P7TB 1JPSL 4PRAB 3AFLA 4F80A 7FABH 4Z7VF 1BF8A 2JJVA 3O41B 3O6KH 1T89C 5BW7C 3RJDA 4ODTH 4ZAKB 3LQZA 1EA9C 4ZFOA 3JTSA 1YYMH 5I1HH 2PO6B 1QG3A 4HX1A 3WUWB 2AAVA 2Y6SC 3KPRE 4LPTA 4FQIL 4V1DE 4RGND 3BD5A 4KH2A 3PWNB 5BRZD 4KJQD 2PYED 3SGKA 5FUCE 5CEZE 4MXVF 2RAMA 2B39A 4L4VB 4M5ZH 4HLZG 1P4BH 4MVBC 1IT9H 2DBLH 4BSVB 1PBYA 3MLVL 4JZOA 3UBXB 5CBEB 5E8PB 4Q9CA 3S4SA 1NSNH 5IEKB 1S7XA 4MNQB 4U1LA 4X80L 3O3DB 3PDGA 1MVFA 1MLCA 3MROB 4WFHD 1NGQH 4ZDHB 1HKFA 1LVEA 1XFPA 3D6GA 4YE4H 5LGJB 4Z8FL 4WUUB 1IGTB 5C9KA 3UZQA 4PJ9D 2CDFA 3H9SA 5F7EH 3A67H 1KCSH 1KV3A 2H2PD 4HFUL 4NRYB 3NMEA 1KB9K 2VLRD 1BMGA 1U6AH 4LLVB 1UCBL 2AV7B 5J6HA 4DN4H 3VFSB 2J3SA 1BVLB 1IM9B 2VXQH 1UACL 5FCUL 2R69L 4PJFE 3VGHA 2O5YH 4PRHD 2Y07H 4L4TE 2RB8A 5DTFA 4CVZA 3ESVF 4EXKA 3P30H 1R5VA 1MJUL 1JPGA 2NXZB 5DMIH 4OCSH 3V4UH 1CICC 1KC5L 3K8MA 4R4NC 4Z7WF 5MI0B 5F9JA 4BFIA 1S7SB 5EZJB 1GRWA 4IIQA 1IEAA 4RGMC 3WUZA 4R96A 2CIIA 3KDMB 1UZ6E 4M48L 1D7FA 2Y5TB 2BSRA 4RISH 4X4YB 4WUUA 5KSAA 2X4SA 2XYCA 5ECJE 3TBVB 1AKJD 1WWBX 3TO4B 3FQXA 4XPTL 1FGVL 2NW2A 3L5XH 2VH5L 1YEJL 3DLQR 3WEXB 3UPRB 3W11D 5HYQA 3TESA 5DJ2A 4TNWK 2UZIH 4OZGF 3IU3A 5GGTA 1KTKE 1MLBA 2YKLL 3DARA 5F7MC 3H9SE 3MGTA 5CEYA 1P4LA 3PIQB 2AXHA 3OMZA 1CFSB 1JPGB 4XNZC 2XY2A 4Y1AE 4G80A 5FYKE 1MY5A 1KPRA 3K4ZA 1IMHC 5DT1H 4HC1A 4P2QA 1V7MH 4R6UA 2GK2A 2O61A 1G7HB 4U1MA 3CFEB 5A2LH 2EDYA 4X6DF 3ZO0A 1DBKH 5FA3A 3VXUE 3CFKA 4UNUA 1UENA 5F96L 4J1UB 5D1XC 4OZFB 3EBAA 2JELH 4ZYKA 3T2OA 4JFEB 2Z4QA 2VWEC 4X6BA 4BUGA 4I5BA 3HE7B 3F7RA 4KI5C 5T1DH 3I3BA 5B22A 2IALB 3SO3C 2NY2C 2XZZA 5I1EL 1AY1H 4PJBF 5GJSL 4G6AC 1IL1A 4X9FA 1NDGA 5TFSH 3WIIL 5I8EA 4U6YB 3LS4L 4GRMB 4GAYA 2OTWA 3MNVB 3IDNB 4JPKH 1RHFA 4FFVD 4LU5L 4K9EL 3RKPA 3RWFB 2XTJE 5D5MB 3REVA 4F7PB 4HPOL 3TJHC 5FA3B 1G9NC 4MSWA 2OYPA 2HFTA 3G6JA 5HSFA 4G6FB 1YMHB 4LK4A 1KCUH 2Z4QB 3QH3A 4OGAD 2AKRA 4M1DL 4YWGH 1NCDH 5IIEA 4RMQA 2DQUL 4NP4L 4AQ1B 4WFHE 1ZGLM 3EYFB 3MGOA 2R56H 4P3DA 5E4EC 1MRFH 4HIJA 4B7LA 1Z9LA 3UYOD 3I6GB 5DUBA 4FQXA 1F3JA 4PJXE 2HAZA 4PJEA 4H8WH 4XGZA 1RFDH 4H20L 1PLGL 4JY5H 4S2SA 3HNVH 1BZ9A 4QHMA 1GZPB 3PWJA 4OAWA 4PJ5A 4J2XA 1P84J 5DWUL 5HYJE 3WBDA 1U6AL 1FZOB 4PJGB 4YHIA 2AQ3A 4KQ3H 3D25B 3ELAT 3BUYB 3FRPA 1EEZA 4W81A 3DIFB 2SEBB 1NKRA 3VFOB 2ZSWB 1A3QA 4JFHD 4HS6B 1SY6L 3ZHLA 5ABDE 2JIXA 2P5WE 2VZ3A 2PTTA 1MI5B 4X80H 1TZHB 1YA5A 2MOVA 3B3IA 5E08L 4G9FA 4APQC 4WDIA 3ZT5A 4X8XA 5K9OA 3HE6C 3RP1A 4PV8B 4ERSL 1LO0H 2GJ6D 5FDWB 1F4AA 1G7IB 5ANME 1OAUL 4I1NB 5DJXB 3IFNH 1X5KA 2FHFA 4WU7B 5DD1L 3GHBL 3MNZB 3QISA 4YXKH 2FDBP 3ARBD 4Z0XB 3CMOH 4LEOA 5J6GB 1KLUB 5L8JB 3TBYA 5DD6B 3T8XB 1UQSA 5F72S 4QHKJ 4FQ1H 2DKUA 5IB4B 1U0QA 5C9JB 1MEXL 1HH9B 1JV5B 4FNLH 2ZUXA 3B5TA 1SYVA 1HXYB 4F8QA 4HUUA 1MRCH 3D39E 5L0QC 2YA2A 3NCYS 2JELL 5HYJA 4OCXL 3MRMA 5F96H 3UPAA 1P53A 2P44B 3HS0A 3NTCL 4P9HL 4D0BA 4ZTOL 5T1LA 3F7YA 3GB7B 1XGTB 3RL2A 3STLB 4I9WD 1HXMB 4KRMB 4XPGL 3TV3H 1DQMH 1EAPB 5IUSA 3TBTB 2NXYD 4K07A 3TPUB 4ETQB 1CQYA 4Z7OE 3QWOB 1I8IA 2FSEA 4C4KO 4Y4FB 1L7IL 5FUZH 5DR5H 1S7XB 4MNQA 3RI5K 4C83A 4FFZH 5ERWB 4LL9A 1VFBA 3DV4A 5IB4A 1AI1L 4H88H 1YN7B 4JB9H 1VPOL 2XZCH 1I85A 4N0UA 3MNWB 1H3TA 1I1AD 5F7YC 2OL3L 3KR3H 5KTEL 3KPPA 4GLRH 2CDFB 3H9SB 4OIIH 4PJGF 3BQUC 4E41A 5F9WB 2LAGB 4ZQKB 4OV5B 5F3BA 4LASH 1IAIH 3JWDC 1FPTH 4PP2A 5HGHA 5E2VL 4OZ4A 3HCVB 2HA1A 4M48H 1IEBB 2WP3T 3BKML 2F58L 2ATPB 2EC8A 4KDTA 2ZOKA 2UV3A 5BMFH 4KDVA 3RA7H 5HGGS 1FZJA 1CGTA 3U36B 4OCRH 2DMKA 5GGSY 3WFEL 4FN0A 4JM4H 1B0WA 5EO9A 3CDYA 2BVQB 4KUCF 1KJ2L 4R2GB 3KYMA 2EDLA 4Z7UE 3QG7L 2MHAA 4X6EA 1S7WB 3WHXB 1GC1H 5DSCB 5AD0B 5IOPA 2FGWL 4M5YH 1WF5A 2X44D 1BOGA 1A4KB 5E2UH 4Y1AD 3JWOC 4OBRA 1NFDB 1AP2A 1MWAA 2IBZX 2R9HC 4U6XA 4JGUA 1DUZB 3LV3A 4NFDA 1H3GA 2DIJA 4OIBA 4P5KA 1MPAL 3DROA 5GGRB 1J8KA 5FO8B 1RK0A 5I9QB 1RZIA 4M6MH 5K9KB 1EFXA 3G6AB 2COQA 1C5CL 1MH5A 4U0QB 4KMTL 5I1LB 3ARFC 3GM8A 3S35H 4JFQA 4C57C 2ZG2A 1ES0A 4OKVB 3RWIB 4BH7A 1D5XB 2XKNB 2Y36H 3T1FA 3VG9B 1MCEA 2OI9B 4Y16B 4CADB 4OZIF 2O5XH 5HI4D 3RZCB 3UCRA 1IKNC 5IP4A 4Z7VE 3VRJB 1U3HB 5CSBA 1DUZA 3FZUD 3LV3B 5L9DL 4I18C 4HKXA 3GO1H 1L6ZA 3TCLA 5I6XC 3QI9D 1N5YH 2VNCA 3Q6GL 3MC0A 5A16A 4RGNB 2PXYA 2I07A 4NO2A 5SWZA 5M94B 2EYRB 3MX0A 3C5SB 3K80A 2EIEA 2C4FT 3PQYB 3K4AA 1UGNA 4Y4HA 4DGYH 3UJIH 4U05A 1M71B 1QOKA 5EORH 3TA3B 1WFUA 5C86A 1GIGH 3VFGL 1OSPL 1P7QA 3EZJB 4LSSH 2FZ3B 5E00A 3I85A 4Z77A 3TIEA 4D9QE 1U8MA 3TEUA 1Z3GH 3V6BR 1CL7L 1T2XA 2ICEB 2P5ED 3KPNA 1BD2D 1XGPB 2FX9L 5TPWH 2VDNH 3MXVL 3BSZL 3WIFA 4QF1B 1R3IH 2DQFB 4G8GE 4WI3A 1WAAF 5E0QA 5FGBC 1D5ZB 1S7QA 4WCYH 5ITFB 2YWYA 5DMGD 4XMLL 1HIMH 1X5LA 4F15C 5CCKL 5GS1A 5A2FA 5AWNH 2O5ZH 4S11A 4D0DB 1N5YL 1ZHNB 4ORZC 3IDGA 5CILH 3EOBB 2JB5L 1MRDL 4PJIE 4S2SB 5BO1H 5JIIA 4FQHB 4EZMA 2ORBL 3T0BA 4PGDB 1HNFA 1MCNA 4JZNB 1CZ8L 3PG2A 3G5XA 1RV6X 4V1DD 3LB6D 4JN2B 3I6GA 1XGPA 3BGMB 4QF1A 2F53D 1KF9B 1N7ML 4NIKB 1I7UA 3ZKQD 4NM4H 5FKAB 1OAXL 1QYGL 3LKQB 1OCWH 5E5RB 3U7YH 3VE0A 2X1XR 1QVOB 5AUMA 4TVPL 1IGTA 3W39A 1J1XH 4NRYA 2IFGA 3VH8A 3O9WD 1WWWX 1TVDA 4FP8H 1TXKA 1FC2D 4XWGH 1KTLB 1C08A 1OTUD 1J87A 1S7VB 3IGAB 2BK8A 5HYIA 1MQ8A 5E70A 2IAMC 3RWEB 3KAAA 5D7LD 5CAYB 2GTWB 5DD0L 1NGXA 2Z93B 3R06A 3ET9F 4X99B 2Z9TA 3SGDH 1FLRH 3N1FC 3MRMB 2WIMA 5GS1C 1L7TL 2XTLA 1KEML 2B5IB 4M4RA 2ED8A 1CLZH 1JK8B 5DFTA 5EOCL 4Z7NE 3GEWB 2R15A 4QRTA 1NCTA 1I3GL 4LSTH 4XXCA 12E8L 3L3HA 1UXWA 3LDBB 5J4MA 2J8UB 3HPJA 3L6FB 3SGJC 4Y2DB 4YBLB 4Q6IA 1JV5A 3MXVH 2CUHA 1NLDL 4WV1A 2YPVL 3KJ4B 4QRPA 3P0YH 3QQ4B 2QJDA 4APQA 4M7LH 2ITCA 3SQOH 3LD8B 1U8IB 1WCBA 1OSPH 4PJDA 3GBNL 2ZCLL 3QEHB 3C60D 4QGYA 1ORSB 2N7AA 2VLKB 1UVQA 4PRHE 1KPRB 4FS0A 2FD6L 4ZO6A 4ODUB 4FFZL 3SKOA 5JA8B 5ANMA 3TBTA 3JV6B 1L7IH 2XKSA 4NO0A 4UOW1 4KKLD 5D7JA 5EFIB 3QUZC 4YC2B 3ARDD 3GBML 3QFJE 2WBJD 4NBZB 2HLFD 3GKZA 1IRAY 3LH2H 4XAKD 1JZ3A 4X4ME 2C26A 3KWWB 4OLZL 2X1QA 1MCCA 3WL9B 2PW2A 2ATPA 4M1GH 1ZGLB 3MV9A 3KS0H 4DEPC 25C8H 4MGXA 5HHME 3V95A 2OZ4A 3E8UL 4OGYL 1G7HA 5EOQL 4WVRA 1LE5A 4ERSH 5BS0E 3GSNL 4J4PD 4ZQKA 4HK0A 2XQYK 4MCZA 2JK5A 2YBRA 2JCCF 3U9UA 1G7LA 2VAJA 4G8GB 3ZSSA 4LDEB 4S1DC 4LLDA 1S7WA 2D0HA 1NC4A 1NPUA 4S10A 1NAKL 5FHBL 2HLAA 1FYHB 3PJSA 4OZIA 4X9HA 4KK6C 3Q3GB 4M3JA 4OZGA 3V9FA 1CFTB 2H26B 1WV7T 1Q9OB 5CIPA 4V2CB 4BM7A 1RQ5A 2DQJL 1F97A 2APTA 5C0JB 1NDGB 5E2UL 4FTVA 4XVJH 1CLOH 2IANB 2W0FB 4WHYG 3CSGA 3HNVL 2FR4A 5IB1B 2P8MA 3GFUA 4NZUH 2IPUK 2AK4D 3GMQA 4P46D 5A2JH 3TBWA 4UT7L 4LHUB 2FJHB 3D2UB 5T1KB 4OLYL 1SMOA 2GTZB 3LPFA 3MLPA 3FO2B 2GAZA 2DYPB 3EDDA 3MCLL 2A9NL 1J0JA 4CDGC 4QNPF 4JPWL 3X13B 5GRZA 1YDPB 1DFBH 1AFVH 3HNSH 4XP9L 5ETUA 4Z78B 3TFKC 3Q3GA 3HI6L 3OHXA 3VDAA 4HWBA 1YPZF 2AK1H 4YWGL 5HVHB 1T20A 2BNQA 4MD5A 5A16B 4LLWB 1AR1C 4BH7B 5JXEA 1QHPA 1JGLH 5DJZA 2GSIA 5FM5M 4P4KB 5L2KD 4M1GL 3MRCB 1AXTH 4HWUA 3ULUE 4GMTH 3EYQC 4JPVH 3P4MA 4O2EB 2A6KB 1RJZA 1A1OA 4QXGH 3PGCB 3R4DA 2ZSVB 1IAKB 2FL5A 1CLYH 3PABA 3VWJD 3EOYG 1NAMH 4B7IA 3KHQA 5I66B 4XPGH 3TV3L 5C6PB 1INDH 1NANH 4LRNL 1DBBH 4L4TA 2IEPA 1A02N 4GBXB 4NT6A 4UBDD 4JO2L 1P2CB 1ZTXH 4W6XB 2ZSWA 2EZ0C 5IMOB 4NC1C 1EGJA 5AEAA 1O7SA 1MFNA 5AAWA 1CXEA 3IDXH 4H26A 5EPMB 3VMOA 4ZNCD 4YK4B 4JRYD 1QHOA 5TFSL 1OP9A 4ZFOL 1UM5L 3EO1A 3GMPB 1EVUA 2W0PA 3MJ8A 3GUTA 1U8PB 8FABA 5ICYB 5KN5B 3NFNB 1G7IA 1FCGA 2VQTA 4LVEA 4JFOA 2EIZA 2QKIB 1YJDH 4WNQB 1LK3H 4KY1L 1HQ4A 3NPSC 5JHLL 4LEOB 5J6GA 1I8MB 3WXWH 4M7KL 3F7VB 4RDQF 5JDSA 4QRUA 4YPGA 4QT5B 4GKOA 1VEMA 4GBXA 3RUGE 1A22B 4Y5XB 4JHAL 2OTUA 4QWWC 3ARSA 5DFVC 3EYQD 4NZDA 3RVXC 3WIHL 5CEXB 5IT2L 3NABH 1DUYA 2CMRH 3HUJF 2AK1L 5EIIA 3K46A 4G8FA 3ECBB 3QPXL 4OF7A 5K9QI 2VIRA 2CO7B 5F7WC 3DWTA 3ZKSD 2PCPB 1UA6L 4K94C 3V7AG 5CJ5A 1KENL 1U9KA 4UI2A 1XH3B 3ZDZF 2EEAA 3Q5TA 4OJFH 3H7LA 3TPUA 3NZ8A 5LVEA 1ZANH 3RWDB 3PV7A 3SJVD 5CWSA 1EJOH 3U7YL 4X6CB 1FGNH 3M8OH 3IFOB 1QYGH 3E6FA 4RFNB 3MRDA 5HYSG 3MRIA 1HOCA 3PGDA 4HAGA 3T0AA 4FG6C 4HD9A 5GIRA 1YMMB 3H9HA 4XBGA 4GS7C 4YNYB 3PV6A 4BZ1L 1BZQK 1JTTA 2PF6A 3U1SH 2PW1B 3HI6H 3VD9A 4FXLA 5D1XD 4XP9H 4IOIB 4LCIL 3UJTH 1CGVA 1LEKA 4EN3D 5IW6A 1OD7A 3CGTA 4JPWH 5IEHA 1JGUH 4NN7B 3GSUA 2I9TB 1F4WL 4U1KA 5KAQG 3WS3A 3AS1A 5FA4B 4HFUH 3PHSA 4NC1E 2XV6B 4GAJH 2OTPA 3STZB 3HN3A 1IAIM 3O6FD 4HIXL 4DOHE 1JHKH 4PRIB 2CH8A 2XWJB 3OPZH 3TGXA 2Z31B 3LD8C 3K74B 2M2DA 3QUXD 4OGYH 1XCQB 4ACPA 1EGJL 4RWHA 3HPLB 2VDNL 2FX9H 2Z35A 2FIKB 3FQTB 5F7UA 2EECA 3NGBC 1HYRC 2OJEA 3MV9B 3RDTA 1KJMB 4N5UA 3FFCA 3SN6N 4YDIL 5H37H 3N9GL 4NKDB 4MXVE 1G9MH 1YEIH 3EO0B 2IPKA 2OP4H 4HBQA 1HILA 1X5ZA 3O2WH 4DZ8A 4LPUA 1FFNB 1F58H 2ZWLT 4GKZB 4Q97A 4R96B 1NSNL 3MUY1 5D7JB 4MZ3A 4F33B 5J57B 3ARDC 3ZE2F 1ONQB 2VXTL 3GSNH 5DJCB 2PYFB 2NTFA 3THML 1JUFB 2CKBA 1BQSA 1B2WL 2C4FU 4G42A 1A1NB 3QDME 3VFNA 1CE6A 4FQXD 1BQLL 2BVPB 3ULSB 3RGVA 1J1PH 2YPLB 5TDOB 5GS0C 1K5NA 3T2NL 3L5WA 3CSBA 1CDGA 3D85A 3QXAA 1S5HB 1G7QA 2OL3B 3QEUB 1BHGA 4PG2A 1FFOA 1N3NA 1I3RA 3GBMH 4QY8A 1S9YB 3MXWL 2WIIB 1LNUA 4IMLA 3GMOA 1MREL 1RURH 4LHUA 1D9KD 3EDJA 1RULH 5FGBA 1OARL 4BKLB 1RZFH 1S78C 1T7VA 4UAOC 3O2WL 4IRSA 5F6HJ 1JF1B 4ZAKD 1CGXA 2VUOA 5IROC 3FQWA 3NZHL 3VXRD 1ADQL 3O3BB 3UO1L 4FZEH 2C4XA 3TVMB 4RIRB 1MJJB 5FHAL 5FDYA 1A6UL 4LPCA 1YNKL 4P23B 2XIDA 1HI6B 2X70B 4XPTH 1BQHB 1OAZH 2DQCH 1HK6A 2VDOL 2IANA 2YPKB 4N8PA 5HGAA 1ND0A 2IAMA 3WN5C 4ELMA 3BX7C 1CICD 1AGEB 1KJ2H 2DQEH 3EYVA 5JNYA 5CBAB 12E8H 2GKIA 5BQ7B 1QQDA 1G0XA 4XB7A 1ZT7B 3DVFA 3OX8A 5C0RL 3SKNA 1OHQA 2K9UA 1JZ4A 4LSUL 3MCKB 1QKZL 2W59A 2J88L 2D7TL 3CFCH 3VFWA 1ADQA 3GMNB 3FCTA 3DX8B 3L3DA 2E6QA 2GITB 4RSVA 3RL1A 3VJ6B 1PGRB 2XXMB 35C8H 3NCFB 5C8JB 4XPFL 3VWKB 5HTSA 2E9BA 2WUCL 3RY5A 4OIIL 1L0QA 1EUTA 2F15A 5BO1L 1U8QA 4LBEB 3MLTB 3L7FA 5FECA 2W9DH 3VXPA 4H88L 1NEZB 2X09A 3O4LD 4WI2A 1AD9B 3DJ9A 2A6KA 5GRVK 4PRDA 4NQCA 3RWEA 4LQ1A 2XZAH 3KVQA 1OGAA 2ZKHH 3C8DA 2X4NB 4IM8A 4EQ3A 2KL6A 5IFAL 3B43A 4NQSB 1WFTA 3BD3A 4K8RH 5DZLA 3P2TA 2PXYC 3ZKXC 1Y6NR 3B8YA 2RGSA 5C0BD 5GHWH 1Z3GL 4G8IB 5EC2A 2WM0A 2EZ0D 3WE6A 5E03A 5JA9A 2EEBA 2FX8H 4JKLA 4IDLA 3CZJA 2QEJA 4YAQA 2A9ML 2VLRE 1PYWA 3VXUA 3HMXH 4LSVL 4OF5A 4PJGE 3WXWL 5I1AB 1CVRA 4GG6B 3WJJC 2UZXB 5ID0B 2D31B 3O3AA 5SV4A 4JVPA 3MLSL 3EJZC 3KYOB 3OKLA 4Y8DC 5HDQH 1JHTA 2CDEB 5ILTL 4UOW0 1BVZA 4Q9QL 1IFHH 4YDKL 3QAZC 1A1MB 1IC4L 1RHHA 4WFGE 3BKJL 5IW3A 3RWCA 3L3HB 4WNQA 2HTLC 2HFGL 3UROR 1V05A 3EDEA 3WO3B 3S5LB 1HHJB 4PJCA 2R4SH 5EBMB 3FMGL 1SYSA 2J12B 3G6DH 2YHGA 3BVNA 3DMMA 2YA1A 4HUVA 1CF8H 2YN5A 2P43B 3O2DH 3PWUB 3MR9A 5CJXA 4DOHB 5FXCH 1A6WH 1FIEA 4KXZH 1NEZG 3FO9B 3VGFA 5DGRA 4JM2A 2Z91A 3GRWH 1I7TA 4ZUSB 2UUDK 4P2OA 2QR0B 2MCPL 5D70H 3RGVC 2VZSA 2AJ3A 5DSCA 5IOPB 4QHUB 4PJCF 1MUJA 3RUGB 3L3GA 1OVZA 4OCLC 1JFQH 4NZTH 5I74B 4ZNEE 2FGWH 3NIDF 1P4IL 4QGTA 4BQ6A 4HPYL 3GKWL 5T5FH 1WBXA 3QIWB 3LZFH 4PRNA 3BP6A 3TIDA 2IQ9L 5L88L 4NN7C 3VD5A 4JM4L 4RMUA 6CGTA 3QUKA 1LE5B 2NY2D 4ZUWA 1CFSA 3MRBA 2EYTB 2VKXA 1Q9KB 4X9BA 5B8CC 4Z7OF 3HI1A 4AIZB 4Q7DA 4MHHG 3HE6A 2E8ZA 3VFRB 3MJGX 1Z2KA 4LCIH 1FSKB 2GK0B 3QHZL 1IJ9A 4MA7H 4CVXA 1JNJA 4U1SA 4MVBD 1V5JA 3RGHA 3UPRA 3MRJB 1D6VH 4XMKH 4C83B 2J1KA 4LHQB 4AH2B 3MRLB 4OZ4B 5IMMB 4DQOH 1TVHB 1A7QL 1GXEA 2F5AH 4NO2B 1AHWC 3BZFA 4X98B 5FO7B 2BRRL 4M02A 2ZZUT 3LS4H 3QUMA 5SX5K 3NOIA 4XNQA 2MQ0A 2R2HB 2VSDA 2V5MA 4LSRL 4CL7A 3W0WD 3VWJC 2FO4B 2Y5EA 1H5BB 5HHXH 3OKNA 3TJEH 1QPXA 3LKSA 4HJ0D 5K9QG 2WMPA 4JKMA 5MEOA 2EE9A 4PV9A 5L2KB 3D3VE 1ZT1A 5EIVA 1RIUH 1YDPA 4I2XE 2XA3A 3T08A 4JHAH 5DJ0B 3HZKA 1NAMA 1RZGA 3DV6A 1BQHG 3SOBH 3FB8A 3PGFL 4OI8A 2PUQT 3RQ3A 4BKLA 3ARGD 3L5WB 2VE6A 3PE9A 3OL2A 3I6KA 1EO7A 4IRSB 1OSZB 2W1NA 1GGCH 4OTXH 1TFHA 5FO8A 1DVFB 4MCYB 4NCC2 4WFFE 5DR5L 3RKDD 2P42B 4PJBA 4H5SB 5DC4B 2WNGA 2R2EA 5DT1L 1AHWA 2NY1D 1F00I 5A1AA 4XCYB 4N68A 1GZQB 4IRZH 4BA8A 1BQLH 1EIBA 2OTWB 3IXAA 4HW6A 2MPAH 5F70A 4HULB 4X4MA 1MY7A 4KRPC 4MA3B 3C5ZA 4L9DA 3BGMA 4J6RL 4CADA 4H26B 3QEGH 4XWOD 1T04B 2VR5A 4F7TB 2A1WH 4GBXC 1C8PA 2Z92B 5B4MC 4W70A 2D03H 1H5BC 4JE4B 3BO8A 3V6ZA 3QG6A 3F6LA 3JWNC 1CE6B 5GZND 3TT3H 4GG6F 2I07B 5SWZB 5DVMA 4FFYL 3T0ED 4WO4A 3FCTB 3BPNB 1QNZL 4ZD3L 1MIEH 2RCSL 4NQVA 5FFLA 4LSTL 4RAUB 2HP4A 1MHHA 4R0LA 1A7OH 3G04A 4J8RA 3DRQA 1UWXK 3FQUB 1CFNB 4JFDB 3BJ91 3CNKA 3P40A 2FJGB 2BVYA 2BOCB 4IEFB 1ZE3C 5ICZA 4F37K 3ZKMD 2NX5A 2EE2A 1I9IH 1Q94A 2J8UF 1UACH 1FLRL 3FAWA 3ULUF 3MA7A 3EW3B 1PG7L 4P2OC 4F7TA 1ETZA 4R2GC 5GRWA 1T0PB 4UAOB 3CLEL 3MUHL 1YJDC 2EYSB 4PJBE 4U6TA 4OLYH 2IBZY 3BW9A 4EVNB 1DZBA 2NNAB 2B2XL 4KQ3L 3S97C 3MCLH 3X12B 2F8VA 3JBG7 3LOWA 3BWAA 5DWUH 1JI1A 1CBVL 1KPUB 5IMLA 4G8GD 4ZNEA 1WFOA 2ID5A 2AJVL 3GMMA 4WV1B 4XHQA 4YNYA 3IJHB 3OR6A 3VXME 2BY3A 3W2DL 1A1MA 1R0AH 4G43A 3Q6FB 4GUPB 2APVA 4K3JL 3VXNB 2DJ4A 1N59A 2V17H 1CXFA 3MRDB 1CFBA 4JVWA 1JI2A 4WUKH 4K55A 4YBLC 5EG6C 4I3SH 4L9LA 1MJ7H 4OT1L 5D2LA 1K6QH 1I9EA 1H0DA 1NC4D 1DEDA 1IQWL 1FO0B 4QKXB 1NANI 3LDBC 2CMRL 4Y8AA 5LBSH 5C92A 2CLRB 3TP4A 3ZDXF 3LEYL 5EOQH 4QTIH 1CQKA 3S3SA 5B38G 2EDTA 3QIBB 3CXHJ 3F12A 4HUKB 5F6IC 4P3CH 4PTTA 2NY0B 4M7KH 3U30C 2KQMA 4OLZH 1JVKA 1Y18B 1MCOH 5KZCB 4HPOH 4QEGA 4NKDA 5SV3A 1EBAA 1QFOA 1QSED 2IC2A 3LSOB 1CIDA 2IPKB 3QCVH 1IGIH 3WEXA 3O0RH 4P46A 4NNXA 3FQNB 4LP5A 3C8HA 2X4QB 5MENB 3I75A 1K4CA 2HJFA 4OUUA 3RWGB 4UTBH 4GRWB 2NY1B 1A21A 3QWOA 3VFTA 5I1CH 1QBAA 4PJEF 1U3JA 2VAAA 1BQUA 5CBEA 1B0GB 3T4YB 3GSRA 4UINL 5EBLA 1M7IB 5DEGB 4XPAH 3G6DL 2IPTL 3ZSTA 2R4SL 2Q7YA 2VZ1A 3PWLA 5DJ8B 1KCRL 1W0WB 3HLAA 2YD9A 3GBNH 4PD4J 4TUJA 3T2PA 3QXAB 3BIBX 4PJAA 5ACMA 2HKFH 4AT6A 4YZFF 1ZWIA 3KPPB 4R7NB 4U1MB 1CT8B 3HG1A 5D7IF 1U8IA 1X4YA 3TBWB 3ARGC 1QSFD 5CEZL 4MJIB 1A1NA 4N5EC 4GQ9H 2YMXH 4DUVA 1XIWA 1XF1A 2CGRL 5CGYD 3V8OA 4Q6IB 4JPVL 3QWRA 3MRPB 3S35L 3VXSD 4IOSD 1C7TA 4LCYB 4N0FB 2NY4C 1JGLL 4PJ8D 4Z7WE 1DBAL 4MSWB 2F8XC 5HHPB 1T7YA 4OFKA 1S5IH 2A6DA 3BT2H 5T3XH 3L3KB 4OZFG 2AVGA 2J5LC 5CKAA 4O51A 3UTTA 4O02H 3RVWD 4C58B 4F2MA 3RY6C 3P11L 2V2XA 2X4SB 3TBVA 1RJLA 3KPRA 5BS0B 4TUOB 4JZJB 4HUWA 4WTWA 5KVEL 4RISL 2V7NA 1FIGH 5ADPL 3EJYC 4M7JL 3HRZB 4EI6A 1F6LL 1R3LA 4G6KL 2YRPA 1A0QH 1NGWB 4FP8L 5EO0B 2PW2B 1Z9MA 5BZDA 5HD8D 3V4UL 1C5BL 1BJ8A 4F9LC 4XMKL 1A7BA 3AY4C 2CDGA 1OWWA 2WW8A 3HI5L 1VESA 1F8TL 1YZZA 5DMKA 1OP3K 2ADIB 2HTKC 3IF1B 4I18B 5JUEH 5HDOA 3LKNA 3UTZA 4M61B 4PJHE 5F6IB 5ENWA 2VDQH 2V6HA 3K0WA 4ZFFA 4P23D 5FGRA 1LEIA 3BPCB 3OB0H 1FVEB 4LASL 2JB5H 1HHKB 1NAKH 4DAGH 4F57L 3DGGB 4B0MM 1EHXA 1JGVL 2OL3H 3KR3L 5DVLA 1FH5H 1MNUL 4GXVL 4PTUB 3HRZA 1LEGB 1ZLWH 3S88H 3C2SA 3BZEA 3WDIA 4XPBL 3GKWH 4Z7QF 3ROLB 3NCJH 2DI7A 4H5SA 1IM3A 4PJFA 4OZIE 1E6OL 1NC2A 1BX2B 3PWPB 2QADD 5DD5L 1GZQA 1AD9A 5GGUB 2FBJH 4N9GB 3UO1H 4GW1A 3BSZH 1U2HA 1YEEL 4WI9A 4XX1G 4D9RE 3WJJA 1CL7H 5GRYA 5I1AA 2P5WD 3IDNA 1E6OH 1AO7B 3O6LH 5KS9A 1RULL 3LKRB 1EMTH 3WXVH 3GIZH 4J8RB 4PLOB 2A38A 3JZ7A 1INEH 3OJDA 4X6CE 3BEVB 1T20B 2BNQB 4CW1B 1MEXH 4K8RC 1YYML 1FH5L 5EOTA 4DKEL 1QFWH 3QH3B 2NX5B 3GSNA 2DQDH 4LDOB 3LMJH 3QFJA 5GSVA 3BKCL 4YIQB 3BGFB 1UB5B 4XTRC 5TQ2H 3G04B 5BJTB 5DMYA 5IBUG 5C0AA 5EU7E 5ITBL 1A9BB 2VRAA 1GH7A 1UZ8B 5E95B 4P2YA 1QFWM 1XF5B 3BPOC 4MXWH 5E9DE 4OI7A 5ISZE 2HT4D 5DS8A 3GMMB 4I77H 1JPTL 5C0EA