2YFAA

X-ray structure of mcps ligand binding domain in complex with malate
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
236
structure length
236
Chain Sequence
b'GSHMGDIGQLNKDLTDLRIARLQYMIANGDDTAAANTLAKLDAFSKQQAYLATTFKSPENVKLLGELGDTISAYKLSLNKMRQGYDATRAARVSMDSSAIRADQAMDALSQEVMARPEADSVRLAQYQLISKARQQLLQVRIDVRGYIAENSSANEQAALRQLDAALADTDNLKRQLPSEDARLQQFENAVLAYRDAVRQFRDAVANITTSRAEMTVQGADIVKRSDALYQIQLER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHYL-ACCEPTING CHEMOTAXIS TRANSDUCER
publication title Evidence for Chemoreceptors with Bimodular Ligand-Binding Regions Harboring Two Signal-Binding Sites.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Receptor
total genus 118
structure length 236
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.210 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 2yfaA01
1.20.1440.210 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 2yfaA02
3VA9A 2YFAA 2YFBA
chains in the Genus database with same CATH superfamily
1U5KA 3IAM1 3UITA 4OAVB 4PL4A 2KKMA 4AS3A 4NV2A 4O1PA 4HEA1 2ZRRA 2HGKA 5HGIA 1JQOA 4Z7GA 3DO9A 2QZGA 4AS2A 2F66B 2CAZB 4G75A 2QGMA 4HFVA 2F6MB 2JBWA 4YZ9A 2V6EA 4I1TA 2RADA 3IAS1 3I9V1 2V1CC 2YFBA 2GSCA 3Q8DA 3KP9A 3JSBA 2JB3A 2ETDA 4PL3A 4OAUC 3L0IA 3B55A 2FEFA 3P23A 3LJ2A 4NV5A 3VA9A 2RLDA 2JB2A 3DA3A 5LNK1 4JCVE 2FUG1 2QSBA 3LJ1A 2L1LB 2A2DA 3FBVA 2JB1A 2XMXA 4GXTA 1SJ8A 3LJ0A 2MJFB 4O1OA 2BL7A 2FU2A 2XTRA 4Z7HA 3AJFA 4YZDA 3FVVA 2E8GA 2K19A 1W3SA 2A2CA 4PL5A 2JAEA 4Q9VA 2YFAA 3SDJA 3DA4A 4U6RA 2BL8A 2IP6A 2RIOA 1YO7A 1TDPA 4DWLA 2P22B 3FNBA 2ZW3A 2XTQA 4YZCA 3F4MA 4G76A
chains in the Genus database with same CATH topology
1U5KA 3IAM1 3UITA 4OAVB 4PL4A 2KKMA 4AS3A 4NV2A 4O1PA 4HEA1 2ZRRA 5HGIA 4Z7GA 3DO9A 4AS2A 2F66B 2CAZB 4G75A 4HFVA 2F6MB 4YZ9A 2V6EA 4I1TA 3IAS1 3I9V1 2V1CC 2YFBA 3Q8DA 3KP9A 3JSBA 2JB3A 4PL3A 4OAUC 3L0IA 3P23A 3LJ2A 4NV5A 3VA9A 2JB2A 3DA3A 5LNK1 4JCVE 2FUG1 3LJ1A 2L1LB 2A2DA 3FBVA 2JB1A 2XMXA 4GXTA 1SJ8A 3LJ0A 2MJFB 4O1OA 2XTRA 4Z7HA 3AJFA 4YZDA 2E8GA 2K19A 1W3SA 2A2CA 4PL5A 2JAEA 4Q9VA 2YFAA 3SDJA 3DA4A 4U6RA 2IP6A 2RIOA 1YO7A 4DWLA 2P22B 2XTQA 4YZCA 3F4MA 4G76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VA9 A;  2YFA A;  2YFB A; 
#chains in the Genus database with same CATH topology
 1U5K A;  3IAM 1;  3UIT A;  4OAV B;  4PL4 A;  2KKM A;  4AS3 A;  4NV2 A;  4O1P A;  4HEA 1;  2ZRR A;  2HGK A;  5HGI A;  1JQO A;  4Z7G A;  3DO9 A;  2QZG A;  4AS2 A;  2F66 B;  2CAZ B;  4G75 A;  2QGM A;  4HFV A;  2F6M B;  2JBW A;  4YZ9 A;  2V6E A;  4I1T A;  2RAD A;  3IAS 1;  3I9V 1;  2V1C C;  2YFB A;  2GSC A;  3Q8D A;  3KP9 A;  3JSB A;  2JB3 A;  2ETD A;  4PL3 A;  4OAU C;  3L0I A;  3B55 A;  2FEF A;  3P23 A;  3LJ2 A;  4NV5 A;  3VA9 A;  2RLD A;  2JB2 A;  3DA3 A;  5LNK 1;  4JCV E;  2FUG 1;  2QSB A;  3LJ1 A;  2L1L B;  2A2D A;  3FBV A;  2JB1 A;  2XMX A;  4GXT A;  1SJ8 A;  3LJ0 A;  2MJF B;  4O1O A;  2BL7 A;  2FU2 A;  2XTR A;  4Z7H A;  3AJF A;  4YZD A;  3FVV A;  2E8G A;  2K19 A;  1W3S A;  2A2C A;  4PL5 A;  2JAE A;  4Q9V A;  2YFA A;  3SDJ A;  3DA4 A;  4U6R A;  2BL8 A;  2IP6 A;  2RIO A;  1YO7 A;  1TDP A;  4DWL A;  2P22 B;  3FNB A;  2ZW3 A;  2XTQ A;  4YZC A;  3F4M A;  4G76 A; 
#chains in the Genus database with same CATH homology
 1U5K A;  3IAM 1;  3UIT A;  4OAV B;  4PL4 A;  2KKM A;  4AS3 A;  4NV2 A;  4O1P A;  4HEA 1;  2ZRR A;  5HGI A;  4Z7G A;  3DO9 A;  4AS2 A;  2F66 B;  2CAZ B;  4G75 A;  4HFV A;  2F6M B;  4YZ9 A;  2V6E A;  4I1T A;  3IAS 1;  3I9V 1;  2V1C C;  2YFB A;  3Q8D A;  3KP9 A;  3JSB A;  2JB3 A;  4PL3 A;  4OAU C;  3L0I A;  3P23 A;  3LJ2 A;  4NV5 A;  3VA9 A;  2JB2 A;  3DA3 A;  5LNK 1;  4JCV E;  2FUG 1;  3LJ1 A;  2L1L B;  2A2D A;  3FBV A;  2JB1 A;  2XMX A;  4GXT A;  1SJ8 A;  3LJ0 A;  2MJF B;  4O1O A;  2XTR A;  4Z7H A;  3AJF A;  4YZD A;  2E8G A;  2K19 A;  1W3S A;  2A2C A;  4PL5 A;  2JAE A;  4Q9V A;  2YFA A;  3SDJ A;  3DA4 A;  4U6R A;  2IP6 A;  2RIO A;  1YO7 A;  4DWL A;  2P22 B;  2XTQ A;  4YZC A;  3F4M A;  4G76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...