2YFBA

X-ray structure of mcps ligand binding domain in complex with succinate
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
235
structure length
235
Chain Sequence
b'GSHMGDIGQLNKDLTDLRIARLQYMIANGDDTAAANTLAKLDAFSKQQAYLATTFKSPENVKLLGELGDTISAYKLSLNKMRQGYDATRAARVSMDSSAIRADQAMDALSQEVMARPEADSVRLAQYQLISKARQQLLQVRIDVRGYIAENSSANEQAALRQLDAALADTDNLKRQLPSEDARLQQFENAVLAYRDAVRQFRDAVANITTSRAEMTVQGADIVKRSDALYQIQLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHYL-ACCEPTING CHEMOTAXIS TRANSDUCER
publication title Evidence for Chemoreceptors with Bimodular Ligand-Binding Regions Harboring Two Signal-Binding Sites.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Receptor
total genus 115
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.210 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 2yfbA01
1.20.1440.210 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 2yfbA02
2YFBA 3VA9A 2YFAA
chains in the Genus database with same CATH superfamily
2FUG1 3VA9A 4YZ9A 3LJ1A 3JSBA 2ZRRA 2F66B 3DA3A 2JB3A 1JQOA 2XMXA 3DA4A 2FEFA 2KKMA 2A2DA 4NV2A 2YFBA 4JCVE 1U5KA 2E8GA 3FBVA 2P22B 2QZGA 4Z7GA 1W3SA 2JB2A 1YO7A 2V6EA 3UITA 4HEA1 4Z7HA 5LNK1 3LJ0A 2JB1A 1SJ8A 4PL3A 2ETDA 3AJFA 4G75A 3FNBA 2BL7A 3KP9A 4O1OA 4OAUC 4DWLA 4OAVB 3L0IA 2A2CA 2GSCA 2FU2A 3IAM1 4AS3A 1TDPA 2QSBA 3DO9A 2BL8A 2L1LB 3IAS1 3LJ2A 4U6RA 3SDJA 2RIOA 4AS2A 2ZW3A 3Q8DA 4I1TA 4YZCA 2CAZB 2K19A 4YZDA 3FVVA 3F4MA 4PL5A 2JAEA 2XTRA 2IP6A 2HGKA 2F6MB 4HFVA 3P23A 5HGIA 4GXTA 2YFAA 2XTQA 4NV5A 4Q9VA 2RLDA 4O1PA 2QGMA 4PL4A 2V1CC 2MJFB 3I9V1 2JBWA 2RADA 4G76A 3B55A
chains in the Genus database with same CATH topology
2FUG1 3VA9A 4YZ9A 3LJ1A 3JSBA 2ZRRA 2F66B 3DA3A 2JB3A 2XMXA 3DA4A 2KKMA 2A2DA 4NV2A 2YFBA 4JCVE 1U5KA 2E8GA 3FBVA 4Z7GA 2P22B 1W3SA 2JB2A 1YO7A 2V6EA 3UITA 4HEA1 4Z7HA 5LNK1 3LJ0A 2JB1A 1SJ8A 4PL3A 3AJFA 4G75A 3KP9A 4O1OA 4OAUC 4DWLA 4OAVB 3L0IA 2A2CA 3IAM1 4AS3A 3DO9A 2L1LB 3IAS1 3LJ2A 4U6RA 3SDJA 2RIOA 4AS2A 3Q8DA 4YZCA 4I1TA 2CAZB 2K19A 4YZDA 4PL5A 3F4MA 2JAEA 2XTRA 2IP6A 2F6MB 4HFVA 3P23A 5HGIA 4GXTA 2YFAA 2XTQA 4NV5A 4Q9VA 4O1PA 2V1CC 4PL4A 3I9V1 2MJFB 4G76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YFB A;  3VA9 A;  2YFA A; 
#chains in the Genus database with same CATH topology
 2FUG 1;  3VA9 A;  4YZ9 A;  3LJ1 A;  3JSB A;  2ZRR A;  2F66 B;  3DA3 A;  2JB3 A;  1JQO A;  2XMX A;  3DA4 A;  2FEF A;  2KKM A;  2A2D A;  4NV2 A;  2YFB A;  4JCV E;  1U5K A;  2E8G A;  3FBV A;  2P22 B;  2QZG A;  4Z7G A;  1W3S A;  2JB2 A;  1YO7 A;  2V6E A;  3UIT A;  4HEA 1;  4Z7H A;  5LNK 1;  3LJ0 A;  2JB1 A;  1SJ8 A;  4PL3 A;  2ETD A;  3AJF A;  4G75 A;  3FNB A;  2BL7 A;  3KP9 A;  4O1O A;  4OAU C;  4DWL A;  4OAV B;  3L0I A;  2A2C A;  2GSC A;  2FU2 A;  3IAM 1;  4AS3 A;  1TDP A;  2QSB A;  3DO9 A;  2BL8 A;  2L1L B;  3IAS 1;  3LJ2 A;  4U6R A;  3SDJ A;  2RIO A;  4AS2 A;  2ZW3 A;  3Q8D A;  4I1T A;  4YZC A;  2CAZ B;  2K19 A;  4YZD A;  3FVV A;  3F4M A;  4PL5 A;  2JAE A;  2XTR A;  2IP6 A;  2HGK A;  2F6M B;  4HFV A;  3P23 A;  5HGI A;  4GXT A;  2YFA A;  2XTQ A;  4NV5 A;  4Q9V A;  2RLD A;  4O1P A;  2QGM A;  4PL4 A;  2V1C C;  2MJF B;  3I9V 1;  2JBW A;  2RAD A;  4G76 A;  3B55 A; 
#chains in the Genus database with same CATH homology
 2FUG 1;  3VA9 A;  4YZ9 A;  3LJ1 A;  3JSB A;  2ZRR A;  2F66 B;  3DA3 A;  2JB3 A;  2XMX A;  3DA4 A;  2KKM A;  2A2D A;  4NV2 A;  2YFB A;  4JCV E;  1U5K A;  2E8G A;  3FBV A;  4Z7G A;  2P22 B;  1W3S A;  2JB2 A;  1YO7 A;  2V6E A;  3UIT A;  4HEA 1;  4Z7H A;  5LNK 1;  3LJ0 A;  2JB1 A;  1SJ8 A;  4PL3 A;  3AJF A;  4G75 A;  3KP9 A;  4O1O A;  4OAU C;  4DWL A;  4OAV B;  3L0I A;  2A2C A;  3IAM 1;  4AS3 A;  3DO9 A;  2L1L B;  3IAS 1;  3LJ2 A;  4U6R A;  3SDJ A;  2RIO A;  4AS2 A;  3Q8D A;  4YZC A;  4I1T A;  2CAZ B;  2K19 A;  4YZD A;  4PL5 A;  3F4M A;  2JAE A;  2XTR A;  2IP6 A;  2F6M B;  4HFV A;  3P23 A;  5HGI A;  4GXT A;  2YFA A;  2XTQ A;  4NV5 A;  4Q9V A;  4O1P A;  2V1C C;  4PL4 A;  3I9V 1;  2MJF B;  4G76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...