2YFLA

Crystal structure of biphenyl dioxygenase variant rr41 with 2-chloro dibenzofuran
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
442
structure length
433
Chain Sequence
NWTPEAIRGLVDQEKGLLDPRIYADQSLYELELERVFGRSWLLLGHESHVPETGDFLATYMGEDPVVMVRQKDKSIKVFLNQCRHRGMRICRSDAGNAKAFTCSYHGWAYDIAGKLVNVPFEKEAFFDKAEWGPLQARVATYKGLVFANWDVQAPDLETYLGDARPYMDVMLDRTPAGTVAIGGMQKWVIPCNWKFAAEQFCSDMYHAGTTTHLSGILAGIPPEMDLSQAQIPTKGNQFRAAWGGHGSGWYVDEPGSLLAVMGPKVTQYWTEGPAAELAEQRLGHTGMPVRRMVGQHMTIFPTCSFLPAMNQIRVWHPRGPNEIEVWAFTLVDADAPAEIKEEYRRHNIRNFSAGGVFEQDDGENWVEIQKGLRGYKAKSQPFNAQMGLGRSQTGHPDFPGNVGYVYAEEAARGMYHHWMRMMSEPSWATLKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BIPHENYL DIOXYGENASE SUBUNIT ALPHA
publication title Structural Insights Into the Metabolism of 2-Chlorodibenzofuran by an Evolved Biphenyl Dioxygenase.
pubmed doi rcsb
source organism Burkholderia xenovorans
molecule tags Oxidoreductase
total genus 132
structure length 433
sequence length 442
chains with identical sequence C, E, G, I, K
ec nomenclature ec 1.14.12.18: Biphenyl 2,3-dioxygenase.
pdb deposition date 2011-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
A PF00848 Ring_hydroxyl_A Ring hydroxylating alpha subunit (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2yflA02
3.90.380.10 Alpha Beta Alpha-Beta Complex Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 2yflA01
3VMID 2B24A 2BCCE 4NBCD 2E4QA 2BMQA 4AIVA 3L71E 3L72E 2E4PA 4QCKA 2HMMA 4NB8A 3CWBE 2GBWA 5CXMA 1NU1E 2I7FA 2XRXA 4NBBA 4HM2A 4P1BH 2ZYLA 2XSOA 4HM6A 4HM5A 1Z01A 2XR8A 4PD4E 4HM4A 1NTZE 1KYOE 3VCPA 3VCAA 1O7MA 1SQQE 2ZT9D 2HMKA 2YVJB 3GCFA 2CKFA 3N0QA 3L75E 4NBHA 4NBAD 3BCCE 1PP9E 2E74D 3TGUE 3D89A 4NB8D 1O7GA 2DE5D 2DE7D 5HL4A 3VMHA 3EQQA 2DE6D 2NVGA 5KLIC 2NWFA 4HM8A 4NBDA 1WQLA 5KKZC 1G8KB 2JO6A 1FQTA 3H1JE 3H1LE 1NTKE 3GCEA 4NBBD 4HM7A 4HKVA 3CX5E 2A06E 4H13D 3CXHE 1Z02A 4NBGD 3GTEA 3GB4A 4NBEA 3VMGA 3H1KE 4NB9D 4H0LD 1NYKA 1VF5D 1SQVE 4HJLA 2BMRA 3GTSA 3L73E 4QUPA 4AAYB 2XSHA 3GZYA 1ULIA 3GL2A 3EN1A 4QDDA 2B1XA 2HMJA 2NUMA 3H1HE 3VMHD 1NTME 3VMIA 4NBDD 1ULJA 4U3FE 4QURA 3GKQA 1ZRTE 4QDFB 4NBCA 2YIUC 2QJYC 1Q90C 3GL0A 2HMOA 2QPZA 3FOUA 2QJPC 1SQPE 2HMLA 4NBED 2YFJA 3AZCA 4QDFA 1G8JB 1PPJE 2JZAA 1WW9A 4NBFA 4NBHD 4EMJB 4HM1A 2Q3WA 2NVFA 2YFLA 3DQYA 1O7PA 2HMNA 2YFIA 1UUVA 2E76D 1RFSA 4NBAA 4P1CH 3GKEA 2E75D 2QJKC 3GZXA 5KLVE 1UUWA 4HM3A 2DE5A 1SJGA 4QDCA 2DE7A 2BMOA 1JM1A 1NDOA 2NUKA 4HM0A 2DE6A 1VCKA 3C0DA 1BCCE 4PV1D 1L0LE 2FYNC 5BOKA 2NVEA 2D2CD 4QUQA 3VMGD 4NBFD 2IBZE 1SQXE 1L0NE 1VM9A 3H1IE 4H44D 1Z03A 1O7NA 1O7WA 1P84E 1RIEA 3L70E 4NBGA 1KB9E 5AEUA 5AEWA 3L74E 1EZVE 1EG9A 1SQBE 1BE3E 2GBXA 3GOBA 4NB9A 4OGQD 1O7HA 2FYUE
chains in the Genus database with same CATH superfamily
3VMID 2B24A 2BCCE 4NBCD 2E4QA 2BMQA 4AIVA 3L71E 3L72E 2E4PA 4QCKA 2HMMA 4NB8A 3CWBE 2GBWA 5CXMA 1NU1E 2I7FA 2XRXA 4NBBA 4HM2A 4P1BH 2ZYLA 2XSOA 4HM6A 4HM5A 1Z01A 2XR8A 4PD4E 4HM4A 1NTZE 1KYOE 3VCPA 3VCAA 1O7MA 1SQQE 2ZT9D 2HMKA 2YVJB 3GCFA 2CKFA 3N0QA 3L75E 4NBHA 4NBAD 3BCCE 1PP9E 2E74D 3TGUE 3D89A 4NB8D 1O7GA 2DE5D 2DE7D 5HL4A 3VMHA 3EQQA 2DE6D 2NVGA 5KLIC 2NWFA 4HM8A 4NBDA 1WQLA 5KKZC 1G8KB 2JO6A 1FQTA 3H1JE 3H1LE 1NTKE 3GCEA 4NBBD 4HM7A 4HKVA 3CX5E 2A06E 4H13D 3CXHE 1Z02A 4NBGD 3GTEA 3GB4A 4NBEA 3VMGA 3H1KE 4NB9D 4H0LD 1NYKA 1VF5D 1SQVE 4HJLA 2BMRA 3GTSA 3L73E 4QUPA 4AAYB 2XSHA 3GZYA 1ULIA 3GL2A 3EN1A 4QDDA 2B1XA 2HMJA 2NUMA 3H1HE 3VMHD 1NTME 3VMIA 4NBDD 1ULJA 4U3FE 4QURA 3GKQA 1ZRTE 4QDFB 4NBCA 2YIUC 2QJYC 1Q90C 3GL0A 2HMOA 2QPZA 3FOUA 2QJPC 1SQPE 2HMLA 4NBED 2YFJA 3AZCA 4QDFA 1G8JB 1PPJE 2JZAA 1WW9A 4NBFA 4NBHD 4EMJB 4HM1A 2Q3WA 2NVFA 2YFLA 3DQYA 1O7PA 2HMNA 2YFIA 1UUVA 2E76D 1RFSA 4NBAA 4P1CH 3GKEA 2E75D 2QJKC 3GZXA 5KLVE 1UUWA 4HM3A 2DE5A 1SJGA 4QDCA 2DE7A 2BMOA 1JM1A 1NDOA 2NUKA 4HM0A 2DE6A 1VCKA 3C0DA 1BCCE 4PV1D 1L0LE 2FYNC 5BOKA 2NVEA 2D2CD 4QUQA 3VMGD 4NBFD 2IBZE 1SQXE 1L0NE 1VM9A 3H1IE 4H44D 1Z03A 1O7NA 1O7WA 1P84E 1RIEA 3L70E 4NBGA 1KB9E 5AEUA 5AEWA 3L74E 1EZVE 1EG9A 1SQBE 1BE3E 2GBXA 3GOBA 4NB9A 4OGQD 1O7HA 2FYUE
chains in the Genus database with same CATH topology
3VMID 2B24A 2BCCE 4NBCD 2E4QA 2BMQA 4AIVA 3L71E 3L72E 2E4PA 4QCKA 2HMMA 4NB8A 3CWBE 2GBWA 5CXMA 1NU1E 2I7FA 2XRXA 4NBBA 4HM2A 4P1BH 2ZYLA 2XSOA 4HM6A 4HM5A 1Z01A 2XR8A 4PD4E 4HM4A 1NTZE 1KYOE 3VCPA 3VCAA 1O7MA 1SQQE 2ZT9D 2HMKA 2YVJB 3GCFA 2CKFA 3N0QA 3L75E 4NBHA 4NBAD 3BCCE 1PP9E 2E74D 3TGUE 3D89A 4NB8D 1O7GA 2DE5D 2DE7D 5HL4A 3VMHA 3EQQA 2DE6D 2NVGA 5KLIC 2NWFA 4HM8A 4NBDA 1WQLA 5KKZC 1G8KB 2JO6A 1FQTA 3H1JE 3H1LE 1NTKE 3GCEA 4NBBD 4HM7A 4HKVA 3CX5E 2A06E 4H13D 3CXHE 1Z02A 4NBGD 3GTEA 3GB4A 4NBEA 3VMGA 3H1KE 4NB9D 4H0LD 1NYKA 1VF5D 1SQVE 4HJLA 2BMRA 3GTSA 3L73E 4QUPA 4AAYB 2XSHA 3GZYA 1ULIA 3GL2A 3EN1A 4QDDA 2B1XA 2HMJA 2NUMA 3H1HE 3VMHD 1NTME 3VMIA 4NBDD 1ULJA 4U3FE 4QURA 3GKQA 1ZRTE 4QDFB 4NBCA 2YIUC 2QJYC 1Q90C 3GL0A 2HMOA 2QPZA 3FOUA 2QJPC 1SQPE 2HMLA 4NBED 2YFJA 3AZCA 4QDFA 1G8JB 1PPJE 2JZAA 1WW9A 4NBFA 4NBHD 4EMJB 4HM1A 2Q3WA 2NVFA 2YFLA 3DQYA 1O7PA 2HMNA 2YFIA 1UUVA 2E76D 1RFSA 4NBAA 4P1CH 3GKEA 2E75D 2QJKC 3GZXA 5KLVE 1UUWA 4HM3A 2DE5A 1SJGA 4QDCA 2DE7A 2BMOA 1JM1A 1NDOA 2NUKA 4HM0A 2DE6A 1VCKA 3C0DA 1BCCE 4PV1D 1L0LE 2FYNC 5BOKA 2NVEA 2D2CD 4QUQA 3VMGD 4NBFD 2IBZE 1SQXE 1L0NE 1VM9A 3H1IE 4H44D 1Z03A 1O7NA 1O7WA 1P84E 1RIEA 3L70E 4NBGA 1KB9E 5AEUA 5AEWA 3L74E 1EZVE 1EG9A 1SQBE 1BE3E 2GBXA 3GOBA 4NB9A 4OGQD 1O7HA 2FYUE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VMI D;  2B24 A;  2BCC E;  4NBC D;  2E4Q A;  2BMQ A;  4AIV A;  3L71 E;  3L72 E;  2E4P A;  4QCK A;  2HMM A;  4NB8 A;  3CWB E;  2GBW A;  5CXM A;  1NU1 E;  2I7F A;  2XRX A;  4NBB A;  4HM2 A;  4P1B H;  2ZYL A;  2XSO A;  4HM6 A;  4HM5 A;  1Z01 A;  2XR8 A;  4PD4 E;  4HM4 A;  1NTZ E;  1KYO E;  3VCP A;  3VCA A;  1O7M A;  1SQQ E;  2ZT9 D;  2HMK A;  2YVJ B;  3GCF A;  2CKF A;  3N0Q A;  3L75 E;  4NBH A;  4NBA D;  3BCC E;  1PP9 E;  2E74 D;  3TGU E;  3D89 A;  4NB8 D;  1O7G A;  2DE5 D;  2DE7 D;  5HL4 A;  3VMH A;  3EQQ A;  2DE6 D;  2NVG A;  5KLI C;  2NWF A;  4HM8 A;  4NBD A;  1WQL A;  5KKZ C;  1G8K B;  2JO6 A;  1FQT A;  3H1J E;  3H1L E;  1NTK E;  3GCE A;  4NBB D;  4HM7 A;  4HKV A;  3CX5 E;  2A06 E;  4H13 D;  3CXH E;  1Z02 A;  4NBG D;  3GTE A;  3GB4 A;  4NBE A;  3VMG A;  3H1K E;  4NB9 D;  4H0L D;  1NYK A;  1VF5 D;  1SQV E;  4HJL A;  2BMR A;  3GTS A;  3L73 E;  4QUP A;  4AAY B;  2XSH A;  3GZY A;  1ULI A;  3GL2 A;  3EN1 A;  4QDD A;  2B1X A;  2HMJ A;  2NUM A;  3H1H E;  3VMH D;  1NTM E;  3VMI A;  4NBD D;  1ULJ A;  4U3F E;  4QUR A;  3GKQ A;  1ZRT E;  4QDF B;  4NBC A;  2YIU C;  2QJY C;  1Q90 C;  3GL0 A;  2HMO A;  2QPZ A;  3FOU A;  2QJP C;  1SQP E;  2HML A;  4NBE D;  2YFJ A;  3AZC A;  4QDF A;  1G8J B;  1PPJ E;  2JZA A;  1WW9 A;  4NBF A;  4NBH D;  4EMJ B;  4HM1 A;  2Q3W A;  2NVF A;  2YFL A;  3DQY A;  1O7P A;  2HMN A;  2YFI A;  1UUV A;  2E76 D;  1RFS A;  4NBA A;  4P1C H;  3GKE A;  2E75 D;  2QJK C;  3GZX A;  5KLV E;  1UUW A;  4HM3 A;  2DE5 A;  1SJG A;  4QDC A;  2DE7 A;  2BMO A;  1JM1 A;  1NDO A;  2NUK A;  4HM0 A;  2DE6 A;  1VCK A;  3C0D A;  1BCC E;  4PV1 D;  1L0L E;  2FYN C;  5BOK A;  2NVE A;  2D2C D;  4QUQ A;  3VMG D;  4NBF D;  2IBZ E;  1SQX E;  1L0N E;  1VM9 A;  3H1I E;  4H44 D;  1Z03 A;  1O7N A;  1O7W A;  1P84 E;  1RIE A;  3L70 E;  4NBG A;  1KB9 E;  5AEU A;  5AEW A;  3L74 E;  1EZV E;  1EG9 A;  1SQB E;  1BE3 E;  2GBX A;  3GOB A;  4NB9 A;  4OGQ D;  1O7H A;  2FYU E; 
#chains in the Genus database with same CATH topology
 3VMI D;  2B24 A;  2BCC E;  4NBC D;  2E4Q A;  2BMQ A;  4AIV A;  3L71 E;  3L72 E;  2E4P A;  4QCK A;  2HMM A;  4NB8 A;  3CWB E;  2GBW A;  5CXM A;  1NU1 E;  2I7F A;  2XRX A;  4NBB A;  4HM2 A;  4P1B H;  2ZYL A;  2XSO A;  4HM6 A;  4HM5 A;  1Z01 A;  2XR8 A;  4PD4 E;  4HM4 A;  1NTZ E;  1KYO E;  3VCP A;  3VCA A;  1O7M A;  1SQQ E;  2ZT9 D;  2HMK A;  2YVJ B;  3GCF A;  2CKF A;  3N0Q A;  3L75 E;  4NBH A;  4NBA D;  3BCC E;  1PP9 E;  2E74 D;  3TGU E;  3D89 A;  4NB8 D;  1O7G A;  2DE5 D;  2DE7 D;  5HL4 A;  3VMH A;  3EQQ A;  2DE6 D;  2NVG A;  5KLI C;  2NWF A;  4HM8 A;  4NBD A;  1WQL A;  5KKZ C;  1G8K B;  2JO6 A;  1FQT A;  3H1J E;  3H1L E;  1NTK E;  3GCE A;  4NBB D;  4HM7 A;  4HKV A;  3CX5 E;  2A06 E;  4H13 D;  3CXH E;  1Z02 A;  4NBG D;  3GTE A;  3GB4 A;  4NBE A;  3VMG A;  3H1K E;  4NB9 D;  4H0L D;  1NYK A;  1VF5 D;  1SQV E;  4HJL A;  2BMR A;  3GTS A;  3L73 E;  4QUP A;  4AAY B;  2XSH A;  3GZY A;  1ULI A;  3GL2 A;  3EN1 A;  4QDD A;  2B1X A;  2HMJ A;  2NUM A;  3H1H E;  3VMH D;  1NTM E;  3VMI A;  4NBD D;  1ULJ A;  4U3F E;  4QUR A;  3GKQ A;  1ZRT E;  4QDF B;  4NBC A;  2YIU C;  2QJY C;  1Q90 C;  3GL0 A;  2HMO A;  2QPZ A;  3FOU A;  2QJP C;  1SQP E;  2HML A;  4NBE D;  2YFJ A;  3AZC A;  4QDF A;  1G8J B;  1PPJ E;  2JZA A;  1WW9 A;  4NBF A;  4NBH D;  4EMJ B;  4HM1 A;  2Q3W A;  2NVF A;  2YFL A;  3DQY A;  1O7P A;  2HMN A;  2YFI A;  1UUV A;  2E76 D;  1RFS A;  4NBA A;  4P1C H;  3GKE A;  2E75 D;  2QJK C;  3GZX A;  5KLV E;  1UUW A;  4HM3 A;  2DE5 A;  1SJG A;  4QDC A;  2DE7 A;  2BMO A;  1JM1 A;  1NDO A;  2NUK A;  4HM0 A;  2DE6 A;  1VCK A;  3C0D A;  1BCC E;  4PV1 D;  1L0L E;  2FYN C;  5BOK A;  2NVE A;  2D2C D;  4QUQ A;  3VMG D;  4NBF D;  2IBZ E;  1SQX E;  1L0N E;  1VM9 A;  3H1I E;  4H44 D;  1Z03 A;  1O7N A;  1O7W A;  1P84 E;  1RIE A;  3L70 E;  4NBG A;  1KB9 E;  5AEU A;  5AEW A;  3L74 E;  1EZV E;  1EG9 A;  1SQB E;  1BE3 E;  2GBX A;  3GOB A;  4NB9 A;  4OGQ D;  1O7H A;  2FYU E; 
#chains in the Genus database with same CATH homology
 3VMI D;  2B24 A;  2BCC E;  4NBC D;  2E4Q A;  2BMQ A;  4AIV A;  3L71 E;  3L72 E;  2E4P A;  4QCK A;  2HMM A;  4NB8 A;  3CWB E;  2GBW A;  5CXM A;  1NU1 E;  2I7F A;  2XRX A;  4NBB A;  4HM2 A;  4P1B H;  2ZYL A;  2XSO A;  4HM6 A;  4HM5 A;  1Z01 A;  2XR8 A;  4PD4 E;  4HM4 A;  1NTZ E;  1KYO E;  3VCP A;  3VCA A;  1O7M A;  1SQQ E;  2ZT9 D;  2HMK A;  2YVJ B;  3GCF A;  2CKF A;  3N0Q A;  3L75 E;  4NBH A;  4NBA D;  3BCC E;  1PP9 E;  2E74 D;  3TGU E;  3D89 A;  4NB8 D;  1O7G A;  2DE5 D;  2DE7 D;  5HL4 A;  3VMH A;  3EQQ A;  2DE6 D;  2NVG A;  5KLI C;  2NWF A;  4HM8 A;  4NBD A;  1WQL A;  5KKZ C;  1G8K B;  2JO6 A;  1FQT A;  3H1J E;  3H1L E;  1NTK E;  3GCE A;  4NBB D;  4HM7 A;  4HKV A;  3CX5 E;  2A06 E;  4H13 D;  3CXH E;  1Z02 A;  4NBG D;  3GTE A;  3GB4 A;  4NBE A;  3VMG A;  3H1K E;  4NB9 D;  4H0L D;  1NYK A;  1VF5 D;  1SQV E;  4HJL A;  2BMR A;  3GTS A;  3L73 E;  4QUP A;  4AAY B;  2XSH A;  3GZY A;  1ULI A;  3GL2 A;  3EN1 A;  4QDD A;  2B1X A;  2HMJ A;  2NUM A;  3H1H E;  3VMH D;  1NTM E;  3VMI A;  4NBD D;  1ULJ A;  4U3F E;  4QUR A;  3GKQ A;  1ZRT E;  4QDF B;  4NBC A;  2YIU C;  2QJY C;  1Q90 C;  3GL0 A;  2HMO A;  2QPZ A;  3FOU A;  2QJP C;  1SQP E;  2HML A;  4NBE D;  2YFJ A;  3AZC A;  4QDF A;  1G8J B;  1PPJ E;  2JZA A;  1WW9 A;  4NBF A;  4NBH D;  4EMJ B;  4HM1 A;  2Q3W A;  2NVF A;  2YFL A;  3DQY A;  1O7P A;  2HMN A;  2YFI A;  1UUV A;  2E76 D;  1RFS A;  4NBA A;  4P1C H;  3GKE A;  2E75 D;  2QJK C;  3GZX A;  5KLV E;  1UUW A;  4HM3 A;  2DE5 A;  1SJG A;  4QDC A;  2DE7 A;  2BMO A;  1JM1 A;  1NDO A;  2NUK A;  4HM0 A;  2DE6 A;  1VCK A;  3C0D A;  1BCC E;  4PV1 D;  1L0L E;  2FYN C;  5BOK A;  2NVE A;  2D2C D;  4QUQ A;  3VMG D;  4NBF D;  2IBZ E;  1SQX E;  1L0N E;  1VM9 A;  3H1I E;  4H44 D;  1Z03 A;  1O7N A;  1O7W A;  1P84 E;  1RIE A;  3L70 E;  4NBG A;  1KB9 E;  5AEU A;  5AEW A;  3L74 E;  1EZV E;  1EG9 A;  1SQB E;  1BE3 E;  2GBX A;  3GOB A;  4NB9 A;  4OGQ D;  1O7H A;  2FYU E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...