2YFLA

Crystal structure of biphenyl dioxygenase variant rr41 with 2-chloro dibenzofuran
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
442
structure length
433
Chain Sequence
NWTPEAIRGLVDQEKGLLDPRIYADQSLYELELERVFGRSWLLLGHESHVPETGDFLATYMGEDPVVMVRQKDKSIKVFLNQCRHRGMRICRSDAGNAKAFTCSYHGWAYDIAGKLVNVPFEKEAFFDKAEWGPLQARVATYKGLVFANWDVQAPDLETYLGDARPYMDVMLDRTPAGTVAIGGMQKWVIPCNWKFAAEQFCSDMYHAGTTTHLSGILAGIPPEMDLSQAQIPTKGNQFRAAWGGHGSGWYVDEPGSLLAVMGPKVTQYWTEGPAAELAEQRLGHTGMPVRRMVGQHMTIFPTCSFLPAMNQIRVWHPRGPNEIEVWAFTLVDADAPAEIKEEYRRHNIRNFSAGGVFEQDDGENWVEIQKGLRGYKAKSQPFNAQMGLGRSQTGHPDFPGNVGYVYAEEAARGMYHHWMRMMSEPSWATLKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights Into the Metabolism of 2-Chlorodibenzofuran by an Evolved Biphenyl Dioxygenase.
pubmed doi rcsb
source organism Burkholderia xenovorans
molecule tags Oxidoreductase
molecule keywords BIPHENYL DIOXYGENASE SUBUNIT ALPHA
total genus 132
structure length 433
sequence length 442
chains with identical sequence C, E, G, I, K
ec nomenclature ec 1.14.12.18: Biphenyl 2,3-dioxygenase.
pdb deposition date 2011-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
A PF00848 Ring_hydroxyl_A Ring hydroxylating alpha subunit (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2yflA02
3.90.380.10 Alpha Beta Alpha-Beta Complex Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 2yflA01
1SQPE 1Q90C 2QJYC 1Z01A 3VMHD 2DE5A 5HL4A 3GL2A 1SQXE 3EQQA 3GCEA 4HM1A 4HM3A 4NBDD 2NVGA 4OGQD 2DE7D 1PP9E 1NTZE 4QDCA 2CKFA 4NBFD 3VMGD 3EN1A 2I7FA 2YFLA 2BMRA 2IBZE 4NBHD 3BCCE 2HMKA 1O7NA 1NTKE 4NBGA 4NB9D 4QDFA 5KKZC 2JO6A 2DE6D 3C0DA 4H13D 4PD4E 1SJGA 1PPJE 4NBAA 2HMNA 1SQBE 4EMJB 2NVFA 4QUQA 4HM4A 3GCFA 4U3FE 4NBDA 2FYUE 2A06E 2BMOA 3GZXA 3CWBE 2YFIA 3L73E 4HM8A 3VMGA 2BCCE 1UUWA 2JZAA 1G8KB 4HM2A 1NTME 4QDDA 4NBHA 1JM1A 4NBED 2YFJA 4NBGD 1NDOA 4NBBD 2DE6A 4NBAD 3TGUE 4HM5A 4P1CH 1NYKA 1ULIA 2NWFA 4QURA 3GKEA 4NB8D 2NVEA 2E75D 4P1BH 3GB4A 1SQQE 1SQVE 2YVJB 1KB9E 1ULJA 2HMOA 2E74D 3CX5E 2D2CD 4PV1D 3L74E 4QUPA 3GKQA 3D89A 3H1LE 5CXMA 4NBEA 1EZVE 2ZYLA 3VMID 1FQTA 1L0LE 1O7PA 1VM9A 2XSOA 3AZCA 4NBBA 1KYOE 1L0NE 2E4PA 4QCKA 1VF5D 1O7WA 1Z02A 3GOBA 2B24A 3VCPA 4NB8A 1NU1E 1WW9A 1ZRTE 1Z03A 5KLVE 4HJLA 5AEWA 5KLIC 2QPZA 3H1HE 4QDFB 1RIEA 1BCCE 3GL0A 2FYNC 1BE3E 3FOUA 2NUMA 2HMJA 4AIVA 4NBCA 3VMIA 5AEUA 5BOKA 2E4QA 4AAYB 1EG9A 3H1JE 4H0LD 4HKVA 2XRXA 2GBXA 3H1IE 3H1KE 4HM6A 1P84E 1RFSA 4HM0A 2DE5D 2Q3WA 3VMHA 3N0QA 3GTEA 2GBWA 3L75E 2BMQA 2QJPC 2XSHA 2HMLA 2DE7A 4NBCD 1WQLA 4NBFA 3L72E 3DQYA 3VCAA 3GZYA 2HMMA 3L71E 2QJKC 3GTSA 1G8JB 2NUKA 1O7GA 1O7HA 2B1XA 1VCKA 2E76D 3CXHE 4NB9A 4H44D 1UUVA 2ZT9D 1O7MA 3L70E 2YIUC 2XR8A 4HM7A
chains in the Genus database with same CATH superfamily
1SQPE 1Q90C 2QJYC 1Z01A 3VMHD 2DE5A 5HL4A 3GL2A 1SQXE 3EQQA 3GCEA 4HM1A 4HM3A 4NBDD 2NVGA 4OGQD 2DE7D 1PP9E 1NTZE 4QDCA 2CKFA 4NBFD 3VMGD 3EN1A 2I7FA 2YFLA 2BMRA 2IBZE 4NBHD 3BCCE 2HMKA 1O7NA 1NTKE 4NBGA 4NB9D 4QDFA 5KKZC 2JO6A 2DE6D 3C0DA 4H13D 4PD4E 1SJGA 1PPJE 4NBAA 2HMNA 1SQBE 4EMJB 2NVFA 4QUQA 4HM4A 3GCFA 4U3FE 4NBDA 2FYUE 2A06E 2BMOA 3GZXA 3CWBE 2YFIA 3L73E 4HM8A 3VMGA 2BCCE 1UUWA 2JZAA 1G8KB 4HM2A 1NTME 4QDDA 4NBHA 1JM1A 4NBED 2YFJA 4NBGD 1NDOA 4NBBD 2DE6A 4NBAD 3TGUE 4HM5A 4P1CH 1NYKA 1ULIA 2NWFA 4QURA 3GKEA 4NB8D 2NVEA 2E75D 4P1BH 3GB4A 1SQQE 1SQVE 2YVJB 1KB9E 1ULJA 2HMOA 2E74D 3CX5E 2D2CD 4PV1D 3L74E 4QUPA 3GKQA 3D89A 3H1LE 5CXMA 4NBEA 1EZVE 2ZYLA 3VMID 1FQTA 1L0LE 1O7PA 1VM9A 2XSOA 3AZCA 4NBBA 1KYOE 1L0NE 2E4PA 4QCKA 1VF5D 1O7WA 1Z02A 3GOBA 2B24A 3VCPA 4NB8A 1NU1E 1WW9A 1ZRTE 1Z03A 5KLVE 4HJLA 5AEWA 5KLIC 2QPZA 3H1HE 4QDFB 1RIEA 1BCCE 3GL0A 2FYNC 1BE3E 3FOUA 2NUMA 2HMJA 4AIVA 4NBCA 3VMIA 5AEUA 5BOKA 2E4QA 4AAYB 1EG9A 3H1JE 4H0LD 4HKVA 2XRXA 2GBXA 3H1IE 3H1KE 4HM6A 1P84E 1RFSA 4HM0A 2DE5D 2Q3WA 3VMHA 3N0QA 3GTEA 2GBWA 3L75E 2BMQA 2QJPC 2XSHA 2HMLA 2DE7A 4NBCD 1WQLA 4NBFA 3L72E 3DQYA 3VCAA 3GZYA 2HMMA 3L71E 2QJKC 3GTSA 1G8JB 2NUKA 1O7GA 1O7HA 2B1XA 1VCKA 2E76D 3CXHE 4NB9A 4H44D 1UUVA 2ZT9D 1O7MA 3L70E 2YIUC 2XR8A 4HM7A
chains in the Genus database with same CATH topology
1SQPE 1Q90C 2QJYC 1Z01A 3VMHD 2DE5A 5HL4A 3GL2A 1SQXE 3EQQA 3GCEA 4HM1A 4HM3A 4NBDD 2NVGA 4OGQD 2DE7D 1PP9E 1NTZE 4QDCA 2CKFA 4NBFD 3VMGD 3EN1A 2I7FA 2YFLA 2BMRA 2IBZE 4NBHD 3BCCE 2HMKA 1O7NA 1NTKE 4NBGA 4NB9D 4QDFA 5KKZC 2JO6A 2DE6D 3C0DA 4H13D 4PD4E 1SJGA 1PPJE 4NBAA 2HMNA 1SQBE 4EMJB 2NVFA 4QUQA 4HM4A 3GCFA 4U3FE 4NBDA 2FYUE 2A06E 2BMOA 3GZXA 3CWBE 2YFIA 3L73E 4HM8A 3VMGA 2BCCE 1UUWA 2JZAA 1G8KB 4HM2A 1NTME 4QDDA 4NBHA 1JM1A 4NBED 2YFJA 4NBGD 1NDOA 4NBBD 2DE6A 4NBAD 3TGUE 4HM5A 4P1CH 1NYKA 1ULIA 2NWFA 4QURA 3GKEA 4NB8D 2NVEA 2E75D 4P1BH 3GB4A 1SQQE 1SQVE 2YVJB 1KB9E 1ULJA 2HMOA 2E74D 3CX5E 2D2CD 4PV1D 3L74E 4QUPA 3GKQA 3D89A 3H1LE 5CXMA 4NBEA 1EZVE 2ZYLA 3VMID 1FQTA 1L0LE 1O7PA 1VM9A 2XSOA 3AZCA 4NBBA 1KYOE 1L0NE 2E4PA 4QCKA 1VF5D 1O7WA 1Z02A 3GOBA 2B24A 3VCPA 4NB8A 1NU1E 1WW9A 1ZRTE 1Z03A 5KLVE 4HJLA 5AEWA 5KLIC 2QPZA 3H1HE 4QDFB 1RIEA 1BCCE 3GL0A 2FYNC 1BE3E 3FOUA 2NUMA 2HMJA 4AIVA 4NBCA 3VMIA 5AEUA 5BOKA 2E4QA 4AAYB 1EG9A 3H1JE 4H0LD 4HKVA 2XRXA 2GBXA 3H1IE 3H1KE 4HM6A 1P84E 1RFSA 4HM0A 2DE5D 2Q3WA 3VMHA 3N0QA 3GTEA 2GBWA 3L75E 2BMQA 2QJPC 2XSHA 2HMLA 2DE7A 4NBCD 1WQLA 4NBFA 3L72E 3DQYA 3VCAA 3GZYA 2HMMA 3L71E 2QJKC 3GTSA 1G8JB 2NUKA 1O7GA 1O7HA 2B1XA 1VCKA 2E76D 3CXHE 4NB9A 4H44D 1UUVA 2ZT9D 1O7MA 3L70E 2YIUC 2XR8A 4HM7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQP E;  1Q90 C;  2QJY C;  1Z01 A;  3VMH D;  2DE5 A;  5HL4 A;  3GL2 A;  1SQX E;  3EQQ A;  3GCE A;  4HM1 A;  4HM3 A;  4NBD D;  2NVG A;  4OGQ D;  2DE7 D;  1PP9 E;  1NTZ E;  4QDC A;  2CKF A;  4NBF D;  3VMG D;  3EN1 A;  2I7F A;  2YFL A;  2BMR A;  2IBZ E;  4NBH D;  3BCC E;  2HMK A;  1O7N A;  1NTK E;  4NBG A;  4NB9 D;  4QDF A;  5KKZ C;  2JO6 A;  2DE6 D;  3C0D A;  4H13 D;  4PD4 E;  1SJG A;  1PPJ E;  4NBA A;  2HMN A;  1SQB E;  4EMJ B;  2NVF A;  4QUQ A;  4HM4 A;  3GCF A;  4U3F E;  4NBD A;  2FYU E;  2A06 E;  2BMO A;  3GZX A;  3CWB E;  2YFI A;  3L73 E;  4HM8 A;  3VMG A;  2BCC E;  1UUW A;  2JZA A;  1G8K B;  4HM2 A;  1NTM E;  4QDD A;  4NBH A;  1JM1 A;  4NBE D;  2YFJ A;  4NBG D;  1NDO A;  4NBB D;  2DE6 A;  4NBA D;  3TGU E;  4HM5 A;  4P1C H;  1NYK A;  1ULI A;  2NWF A;  4QUR A;  3GKE A;  4NB8 D;  2NVE A;  2E75 D;  4P1B H;  3GB4 A;  1SQQ E;  1SQV E;  2YVJ B;  1KB9 E;  1ULJ A;  2HMO A;  2E74 D;  3CX5 E;  2D2C D;  4PV1 D;  3L74 E;  4QUP A;  3GKQ A;  3D89 A;  3H1L E;  5CXM A;  4NBE A;  1EZV E;  2ZYL A;  3VMI D;  1FQT A;  1L0L E;  1O7P A;  1VM9 A;  2XSO A;  3AZC A;  4NBB A;  1KYO E;  1L0N E;  2E4P A;  4QCK A;  1VF5 D;  1O7W A;  1Z02 A;  3GOB A;  2B24 A;  3VCP A;  4NB8 A;  1NU1 E;  1WW9 A;  1ZRT E;  1Z03 A;  5KLV E;  4HJL A;  5AEW A;  5KLI C;  2QPZ A;  3H1H E;  4QDF B;  1RIE A;  1BCC E;  3GL0 A;  2FYN C;  1BE3 E;  3FOU A;  2NUM A;  2HMJ A;  4AIV A;  4NBC A;  3VMI A;  5AEU A;  5BOK A;  2E4Q A;  4AAY B;  1EG9 A;  3H1J E;  4H0L D;  4HKV A;  2XRX A;  2GBX A;  3H1I E;  3H1K E;  4HM6 A;  1P84 E;  1RFS A;  4HM0 A;  2DE5 D;  2Q3W A;  3VMH A;  3N0Q A;  3GTE A;  2GBW A;  3L75 E;  2BMQ A;  2QJP C;  2XSH A;  2HML A;  2DE7 A;  4NBC D;  1WQL A;  4NBF A;  3L72 E;  3DQY A;  3VCA A;  3GZY A;  2HMM A;  3L71 E;  2QJK C;  3GTS A;  1G8J B;  2NUK A;  1O7G A;  1O7H A;  2B1X A;  1VCK A;  2E76 D;  3CXH E;  4NB9 A;  4H44 D;  1UUV A;  2ZT9 D;  1O7M A;  3L70 E;  2YIU C;  2XR8 A;  4HM7 A; 
#chains in the Genus database with same CATH topology
 1SQP E;  1Q90 C;  2QJY C;  1Z01 A;  3VMH D;  2DE5 A;  5HL4 A;  3GL2 A;  1SQX E;  3EQQ A;  3GCE A;  4HM1 A;  4HM3 A;  4NBD D;  2NVG A;  4OGQ D;  2DE7 D;  1PP9 E;  1NTZ E;  4QDC A;  2CKF A;  4NBF D;  3VMG D;  3EN1 A;  2I7F A;  2YFL A;  2BMR A;  2IBZ E;  4NBH D;  3BCC E;  2HMK A;  1O7N A;  1NTK E;  4NBG A;  4NB9 D;  4QDF A;  5KKZ C;  2JO6 A;  2DE6 D;  3C0D A;  4H13 D;  4PD4 E;  1SJG A;  1PPJ E;  4NBA A;  2HMN A;  1SQB E;  4EMJ B;  2NVF A;  4QUQ A;  4HM4 A;  3GCF A;  4U3F E;  4NBD A;  2FYU E;  2A06 E;  2BMO A;  3GZX A;  3CWB E;  2YFI A;  3L73 E;  4HM8 A;  3VMG A;  2BCC E;  1UUW A;  2JZA A;  1G8K B;  4HM2 A;  1NTM E;  4QDD A;  4NBH A;  1JM1 A;  4NBE D;  2YFJ A;  4NBG D;  1NDO A;  4NBB D;  2DE6 A;  4NBA D;  3TGU E;  4HM5 A;  4P1C H;  1NYK A;  1ULI A;  2NWF A;  4QUR A;  3GKE A;  4NB8 D;  2NVE A;  2E75 D;  4P1B H;  3GB4 A;  1SQQ E;  1SQV E;  2YVJ B;  1KB9 E;  1ULJ A;  2HMO A;  2E74 D;  3CX5 E;  2D2C D;  4PV1 D;  3L74 E;  4QUP A;  3GKQ A;  3D89 A;  3H1L E;  5CXM A;  4NBE A;  1EZV E;  2ZYL A;  3VMI D;  1FQT A;  1L0L E;  1O7P A;  1VM9 A;  2XSO A;  3AZC A;  4NBB A;  1KYO E;  1L0N E;  2E4P A;  4QCK A;  1VF5 D;  1O7W A;  1Z02 A;  3GOB A;  2B24 A;  3VCP A;  4NB8 A;  1NU1 E;  1WW9 A;  1ZRT E;  1Z03 A;  5KLV E;  4HJL A;  5AEW A;  5KLI C;  2QPZ A;  3H1H E;  4QDF B;  1RIE A;  1BCC E;  3GL0 A;  2FYN C;  1BE3 E;  3FOU A;  2NUM A;  2HMJ A;  4AIV A;  4NBC A;  3VMI A;  5AEU A;  5BOK A;  2E4Q A;  4AAY B;  1EG9 A;  3H1J E;  4H0L D;  4HKV A;  2XRX A;  2GBX A;  3H1I E;  3H1K E;  4HM6 A;  1P84 E;  1RFS A;  4HM0 A;  2DE5 D;  2Q3W A;  3VMH A;  3N0Q A;  3GTE A;  2GBW A;  3L75 E;  2BMQ A;  2QJP C;  2XSH A;  2HML A;  2DE7 A;  4NBC D;  1WQL A;  4NBF A;  3L72 E;  3DQY A;  3VCA A;  3GZY A;  2HMM A;  3L71 E;  2QJK C;  3GTS A;  1G8J B;  2NUK A;  1O7G A;  1O7H A;  2B1X A;  1VCK A;  2E76 D;  3CXH E;  4NB9 A;  4H44 D;  1UUV A;  2ZT9 D;  1O7M A;  3L70 E;  2YIU C;  2XR8 A;  4HM7 A; 
#chains in the Genus database with same CATH homology
 1SQP E;  1Q90 C;  2QJY C;  1Z01 A;  3VMH D;  2DE5 A;  5HL4 A;  3GL2 A;  1SQX E;  3EQQ A;  3GCE A;  4HM1 A;  4HM3 A;  4NBD D;  2NVG A;  4OGQ D;  2DE7 D;  1PP9 E;  1NTZ E;  4QDC A;  2CKF A;  4NBF D;  3VMG D;  3EN1 A;  2I7F A;  2YFL A;  2BMR A;  2IBZ E;  4NBH D;  3BCC E;  2HMK A;  1O7N A;  1NTK E;  4NBG A;  4NB9 D;  4QDF A;  5KKZ C;  2JO6 A;  2DE6 D;  3C0D A;  4H13 D;  4PD4 E;  1SJG A;  1PPJ E;  4NBA A;  2HMN A;  1SQB E;  4EMJ B;  2NVF A;  4QUQ A;  4HM4 A;  3GCF A;  4U3F E;  4NBD A;  2FYU E;  2A06 E;  2BMO A;  3GZX A;  3CWB E;  2YFI A;  3L73 E;  4HM8 A;  3VMG A;  2BCC E;  1UUW A;  2JZA A;  1G8K B;  4HM2 A;  1NTM E;  4QDD A;  4NBH A;  1JM1 A;  4NBE D;  2YFJ A;  4NBG D;  1NDO A;  4NBB D;  2DE6 A;  4NBA D;  3TGU E;  4HM5 A;  4P1C H;  1NYK A;  1ULI A;  2NWF A;  4QUR A;  3GKE A;  4NB8 D;  2NVE A;  2E75 D;  4P1B H;  3GB4 A;  1SQQ E;  1SQV E;  2YVJ B;  1KB9 E;  1ULJ A;  2HMO A;  2E74 D;  3CX5 E;  2D2C D;  4PV1 D;  3L74 E;  4QUP A;  3GKQ A;  3D89 A;  3H1L E;  5CXM A;  4NBE A;  1EZV E;  2ZYL A;  3VMI D;  1FQT A;  1L0L E;  1O7P A;  1VM9 A;  2XSO A;  3AZC A;  4NBB A;  1KYO E;  1L0N E;  2E4P A;  4QCK A;  1VF5 D;  1O7W A;  1Z02 A;  3GOB A;  2B24 A;  3VCP A;  4NB8 A;  1NU1 E;  1WW9 A;  1ZRT E;  1Z03 A;  5KLV E;  4HJL A;  5AEW A;  5KLI C;  2QPZ A;  3H1H E;  4QDF B;  1RIE A;  1BCC E;  3GL0 A;  2FYN C;  1BE3 E;  3FOU A;  2NUM A;  2HMJ A;  4AIV A;  4NBC A;  3VMI A;  5AEU A;  5BOK A;  2E4Q A;  4AAY B;  1EG9 A;  3H1J E;  4H0L D;  4HKV A;  2XRX A;  2GBX A;  3H1I E;  3H1K E;  4HM6 A;  1P84 E;  1RFS A;  4HM0 A;  2DE5 D;  2Q3W A;  3VMH A;  3N0Q A;  3GTE A;  2GBW A;  3L75 E;  2BMQ A;  2QJP C;  2XSH A;  2HML A;  2DE7 A;  4NBC D;  1WQL A;  4NBF A;  3L72 E;  3DQY A;  3VCA A;  3GZY A;  2HMM A;  3L71 E;  2QJK C;  3GTS A;  1G8J B;  2NUK A;  1O7G A;  1O7H A;  2B1X A;  1VCK A;  2E76 D;  3CXH E;  4NB9 A;  4H44 D;  1UUV A;  2ZT9 D;  1O7M A;  3L70 E;  2YIU C;  2XR8 A;  4HM7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...