2YFLA

Crystal structure of biphenyl dioxygenase variant rr41 with 2-chloro dibenzofuran
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
442
structure length
433
Chain Sequence
b'NWTPEAIRGLVDQEKGLLDPRIYADQSLYELELERVFGRSWLLLGHESHVPETGDFLATYMGEDPVVMVRQKDKSIKVFLNQCRHRGMRICRSDAGNAKAFTCSYHGWAYDIAGKLVNVPFEKEAFFDKAEWGPLQARVATYKGLVFANWDVQAPDLETYLGDARPYMDVMLDRTPAGTVAIGGMQKWVIPCNWKFAAEQFCSDMYHAGTTTHLSGILAGIPPEMDLSQAQIPTKGNQFRAAWGGHGSGWYVDEPGSLLAVMGPKVTQYWTEGPAAELAEQRLGHTGMPVRRMVGQHMTIFPTCSFLPAMNQIRVWHPRGPNEIEVWAFTLVDADAPAEIKEEYRRHNIRNFSAGGVFEQDDGENWVEIQKGLRGYKAKSQPFNAQMGLGRSQTGHPDFPGNVGYVYAEEAARGMYHHWMRMMSEPSWATLKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BIPHENYL DIOXYGENASE SUBUNIT ALPHA
publication title Structural Insights Into the Metabolism of 2-Chlorodibenzofuran by an Evolved Biphenyl Dioxygenase.
pubmed doi rcsb
source organism Burkholderia xenovorans
molecule tags Oxidoreductase
total genus 132
structure length 433
sequence length 442
chains with identical sequence C, E, G, I, K
ec nomenclature ec 1.14.12.18: Biphenyl 2,3-dioxygenase.
pdb deposition date 2011-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
A PF00848 Ring_hydroxyl_A Ring hydroxylating alpha subunit (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2yflA02
3.90.380.10 Alpha Beta Alpha-Beta Complex Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 2yflA01
1ULIA 4H44D 2BCCE 4NBBA 3GZXA 1SQPE 5KKZC 4HM7A 1UUWA 2A06E 3L75E 4QDCA 4H13D 2YFIA 2DE7A 3GKEA 4AIVA 3D89A 1BCCE 1SQXE 1PP9E 3GOBA 3EQQA 4P1BH 1ULJA 1O7MA 2BMQA 3EN1A 4NBAD 4PD4E 1RIEA 3VCAA 1L0NE 2DE6A 2FYUE 4NBHA 1KB9E 1Z01A 2GBXA 4NB8D 2YFJA 2NVFA 1ZRTE 4P1CH 2E75D 1SJGA 1VM9A 5AEUA 4HM6A 3CXHE 3GB4A 1FQTA 1Q90C 5CXMA 4NBED 3H1HE 4NBAA 4HM5A 3VMID 4HM1A 2NWFA 2CKFA 1UUVA 2XSOA 2XSHA 5AEWA 2I7FA 4HM0A 2HMKA 3H1JE 1SQQE 1EG9A 2QJYC 1RFSA 4QDFB 3L72E 2DE5A 4NB8A 4QDDA 1O7HA 1WQLA 2JO6A 4QUPA 4PV1D 2IBZE 2E4PA 2B1XA 2Q3WA 4AAYB 4NBEA 2YVJB 3GL2A 4QURA 1SQVE 3VMIA 3CX5E 1P84E 3BCCE 4NBGD 4HM3A 4NB9D 3VMHD 4H0LD 2D2CD 1PPJE 3H1KE 4NBFD 3H1LE 3VCPA 1L0LE 4NBCD 1BE3E 2QPZA 2BMRA 2XRXA 1O7NA 2JZAA 2YFLA 3C0DA 3GTSA 3GCFA 1O7GA 5KLIC 3VMGD 3CWBE 4QDFA 2GBWA 2E76D 4HKVA 4HM2A 1VCKA 2HMJA 2DE7D 4NBGA 1SQBE 1WW9A 3GZYA 1NDOA 1NTKE 2YIUC 3VMHA 3FOUA 2HMNA 2HMOA 3AZCA 2NUKA 1Z02A 4NBDD 1EZVE 4NBFA 1O7WA 4NBCA 1NTME 2NUMA 4HM4A 1G8JB 4EMJB 3TGUE 5KLVE 3L70E 3L74E 4NBHD 1Z03A 3GCEA 3VMGA 2BMOA 3GKQA 2XR8A 2ZT9D 1KYOE 4U3FE 2FYNC 5BOKA 1O7PA 2NVEA 3L73E 3N0QA 2B24A 2QJKC 4NBBD 4NBDA 2E4QA 3GTEA 1G8KB 2E74D 2QJPC 3L71E 3GL0A 5HL4A 1NU1E 1NTZE 1VF5D 2HMMA 2NVGA 2ZYLA 3DQYA 4NB9A 2DE5D 1JM1A 4HM8A 2HMLA 4HJLA 4QUQA 4OGQD 1NYKA 4QCKA 2DE6D 3H1IE
chains in the Genus database with same CATH superfamily
1ULIA 4H44D 2BCCE 4NBBA 3GZXA 1SQPE 5KKZC 4HM7A 1UUWA 2A06E 3L75E 4QDCA 4H13D 2YFIA 2DE7A 3GKEA 4AIVA 3D89A 1BCCE 1SQXE 1PP9E 3GOBA 3EQQA 4P1BH 1ULJA 1O7MA 2BMQA 3EN1A 4NBAD 4PD4E 1RIEA 3VCAA 1L0NE 2DE6A 2FYUE 4NBHA 1KB9E 1Z01A 2GBXA 4NB8D 2YFJA 2NVFA 1ZRTE 4P1CH 2E75D 1SJGA 1VM9A 5AEUA 4HM6A 3CXHE 3GB4A 1FQTA 1Q90C 5CXMA 4NBED 3H1HE 4NBAA 4HM5A 3VMID 4HM1A 2NWFA 2CKFA 1UUVA 2XSOA 2XSHA 5AEWA 2I7FA 4HM0A 2HMKA 3H1JE 1SQQE 1EG9A 2QJYC 1RFSA 4QDFB 3L72E 2DE5A 4NB8A 4QDDA 1O7HA 1WQLA 2JO6A 4QUPA 4PV1D 2IBZE 2E4PA 2B1XA 2Q3WA 4AAYB 4NBEA 2YVJB 3GL2A 4QURA 1SQVE 3VMIA 3CX5E 1P84E 3BCCE 4NBGD 4HM3A 4NB9D 3VMHD 4H0LD 2D2CD 1PPJE 3H1KE 4NBFD 3H1LE 3VCPA 1L0LE 4NBCD 1BE3E 2QPZA 2BMRA 2XRXA 1O7NA 2JZAA 2YFLA 3C0DA 3GTSA 3GCFA 1O7GA 5KLIC 3VMGD 3CWBE 4QDFA 2GBWA 2E76D 4HKVA 4HM2A 1VCKA 2HMJA 2DE7D 4NBGA 1SQBE 1WW9A 3GZYA 1NDOA 1NTKE 2YIUC 3VMHA 3FOUA 2HMNA 2HMOA 3AZCA 2NUKA 1Z02A 4NBDD 1EZVE 4NBFA 1O7WA 4NBCA 1NTME 2NUMA 4HM4A 1G8JB 4EMJB 3TGUE 5KLVE 3L70E 3L74E 4NBHD 1Z03A 3GCEA 3VMGA 2BMOA 3GKQA 2XR8A 2ZT9D 1KYOE 4U3FE 2FYNC 5BOKA 1O7PA 2NVEA 3L73E 3N0QA 2B24A 2QJKC 4NBBD 4NBDA 2E4QA 3GTEA 1G8KB 2E74D 2QJPC 3L71E 3GL0A 5HL4A 1NU1E 1NTZE 1VF5D 2HMMA 2NVGA 2ZYLA 3DQYA 4NB9A 2DE5D 1JM1A 4HM8A 2HMLA 4HJLA 4QUQA 4OGQD 1NYKA 4QCKA 2DE6D 3H1IE
chains in the Genus database with same CATH topology
1ULIA 4H44D 2BCCE 4NBBA 3GZXA 1SQPE 5KKZC 4HM7A 1UUWA 2A06E 3L75E 4QDCA 4H13D 2YFIA 2DE7A 3GKEA 4AIVA 3D89A 1BCCE 1SQXE 1PP9E 3GOBA 3EQQA 4P1BH 1ULJA 1O7MA 2BMQA 3EN1A 4NBAD 4PD4E 1RIEA 3VCAA 1L0NE 2DE6A 2FYUE 4NBHA 1KB9E 1Z01A 2GBXA 4NB8D 2YFJA 2NVFA 1ZRTE 4P1CH 2E75D 1SJGA 1VM9A 5AEUA 4HM6A 3CXHE 3GB4A 1FQTA 1Q90C 5CXMA 4NBED 3H1HE 4NBAA 4HM5A 3VMID 4HM1A 2NWFA 2CKFA 1UUVA 2XSOA 2XSHA 5AEWA 2I7FA 4HM0A 2HMKA 3H1JE 1SQQE 1EG9A 2QJYC 1RFSA 4QDFB 3L72E 2DE5A 4NB8A 4QDDA 1O7HA 1WQLA 2JO6A 4QUPA 4PV1D 2IBZE 2E4PA 2B1XA 2Q3WA 4AAYB 4NBEA 2YVJB 3GL2A 4QURA 1SQVE 3VMIA 3CX5E 1P84E 3BCCE 4NBGD 4HM3A 4NB9D 3VMHD 4H0LD 2D2CD 1PPJE 3H1KE 4NBFD 3H1LE 3VCPA 1L0LE 4NBCD 1BE3E 2QPZA 2BMRA 2XRXA 1O7NA 2JZAA 2YFLA 3C0DA 3GTSA 3GCFA 1O7GA 5KLIC 3VMGD 3CWBE 4QDFA 2GBWA 2E76D 4HKVA 4HM2A 1VCKA 2HMJA 2DE7D 4NBGA 1SQBE 1WW9A 3GZYA 1NDOA 1NTKE 2YIUC 3VMHA 3FOUA 2HMNA 2HMOA 3AZCA 2NUKA 1Z02A 4NBDD 1EZVE 4NBFA 1O7WA 4NBCA 1NTME 2NUMA 4HM4A 1G8JB 4EMJB 3TGUE 5KLVE 3L70E 3L74E 4NBHD 1Z03A 3GCEA 3VMGA 2BMOA 3GKQA 2XR8A 2ZT9D 1KYOE 4U3FE 2FYNC 5BOKA 1O7PA 2NVEA 3L73E 3N0QA 2B24A 2QJKC 4NBBD 4NBDA 2E4QA 3GTEA 1G8KB 2E74D 2QJPC 3L71E 3GL0A 5HL4A 1NU1E 1NTZE 1VF5D 2HMMA 2NVGA 2ZYLA 3DQYA 4NB9A 2DE5D 1JM1A 4HM8A 2HMLA 4HJLA 4QUQA 4OGQD 1NYKA 4QCKA 2DE6D 3H1IE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ULI A;  4H44 D;  2BCC E;  4NBB A;  3GZX A;  1SQP E;  5KKZ C;  4HM7 A;  1UUW A;  2A06 E;  3L75 E;  4QDC A;  4H13 D;  2YFI A;  2DE7 A;  3GKE A;  4AIV A;  3D89 A;  1BCC E;  1SQX E;  1PP9 E;  3GOB A;  3EQQ A;  4P1B H;  1ULJ A;  1O7M A;  2BMQ A;  3EN1 A;  4NBA D;  4PD4 E;  1RIE A;  3VCA A;  1L0N E;  2DE6 A;  2FYU E;  4NBH A;  1KB9 E;  1Z01 A;  2GBX A;  4NB8 D;  2YFJ A;  2NVF A;  1ZRT E;  4P1C H;  2E75 D;  1SJG A;  1VM9 A;  5AEU A;  4HM6 A;  3CXH E;  3GB4 A;  1FQT A;  1Q90 C;  5CXM A;  4NBE D;  3H1H E;  4NBA A;  4HM5 A;  3VMI D;  4HM1 A;  2NWF A;  2CKF A;  1UUV A;  2XSO A;  2XSH A;  5AEW A;  2I7F A;  4HM0 A;  2HMK A;  3H1J E;  1SQQ E;  1EG9 A;  2QJY C;  1RFS A;  4QDF B;  3L72 E;  2DE5 A;  4NB8 A;  4QDD A;  1O7H A;  1WQL A;  2JO6 A;  4QUP A;  4PV1 D;  2IBZ E;  2E4P A;  2B1X A;  2Q3W A;  4AAY B;  4NBE A;  2YVJ B;  3GL2 A;  4QUR A;  1SQV E;  3VMI A;  3CX5 E;  1P84 E;  3BCC E;  4NBG D;  4HM3 A;  4NB9 D;  3VMH D;  4H0L D;  2D2C D;  1PPJ E;  3H1K E;  4NBF D;  3H1L E;  3VCP A;  1L0L E;  4NBC D;  1BE3 E;  2QPZ A;  2BMR A;  2XRX A;  1O7N A;  2JZA A;  2YFL A;  3C0D A;  3GTS A;  3GCF A;  1O7G A;  5KLI C;  3VMG D;  3CWB E;  4QDF A;  2GBW A;  2E76 D;  4HKV A;  4HM2 A;  1VCK A;  2HMJ A;  2DE7 D;  4NBG A;  1SQB E;  1WW9 A;  3GZY A;  1NDO A;  1NTK E;  2YIU C;  3VMH A;  3FOU A;  2HMN A;  2HMO A;  3AZC A;  2NUK A;  1Z02 A;  4NBD D;  1EZV E;  4NBF A;  1O7W A;  4NBC A;  1NTM E;  2NUM A;  4HM4 A;  1G8J B;  4EMJ B;  3TGU E;  5KLV E;  3L70 E;  3L74 E;  4NBH D;  1Z03 A;  3GCE A;  3VMG A;  2BMO A;  3GKQ A;  2XR8 A;  2ZT9 D;  1KYO E;  4U3F E;  2FYN C;  5BOK A;  1O7P A;  2NVE A;  3L73 E;  3N0Q A;  2B24 A;  2QJK C;  4NBB D;  4NBD A;  2E4Q A;  3GTE A;  1G8K B;  2E74 D;  2QJP C;  3L71 E;  3GL0 A;  5HL4 A;  1NU1 E;  1NTZ E;  1VF5 D;  2HMM A;  2NVG A;  2ZYL A;  3DQY A;  4NB9 A;  2DE5 D;  1JM1 A;  4HM8 A;  2HML A;  4HJL A;  4QUQ A;  4OGQ D;  1NYK A;  4QCK A;  2DE6 D;  3H1I E; 
#chains in the Genus database with same CATH topology
 1ULI A;  4H44 D;  2BCC E;  4NBB A;  3GZX A;  1SQP E;  5KKZ C;  4HM7 A;  1UUW A;  2A06 E;  3L75 E;  4QDC A;  4H13 D;  2YFI A;  2DE7 A;  3GKE A;  4AIV A;  3D89 A;  1BCC E;  1SQX E;  1PP9 E;  3GOB A;  3EQQ A;  4P1B H;  1ULJ A;  1O7M A;  2BMQ A;  3EN1 A;  4NBA D;  4PD4 E;  1RIE A;  3VCA A;  1L0N E;  2DE6 A;  2FYU E;  4NBH A;  1KB9 E;  1Z01 A;  2GBX A;  4NB8 D;  2YFJ A;  2NVF A;  1ZRT E;  4P1C H;  2E75 D;  1SJG A;  1VM9 A;  5AEU A;  4HM6 A;  3CXH E;  3GB4 A;  1FQT A;  1Q90 C;  5CXM A;  4NBE D;  3H1H E;  4NBA A;  4HM5 A;  3VMI D;  4HM1 A;  2NWF A;  2CKF A;  1UUV A;  2XSO A;  2XSH A;  5AEW A;  2I7F A;  4HM0 A;  2HMK A;  3H1J E;  1SQQ E;  1EG9 A;  2QJY C;  1RFS A;  4QDF B;  3L72 E;  2DE5 A;  4NB8 A;  4QDD A;  1O7H A;  1WQL A;  2JO6 A;  4QUP A;  4PV1 D;  2IBZ E;  2E4P A;  2B1X A;  2Q3W A;  4AAY B;  4NBE A;  2YVJ B;  3GL2 A;  4QUR A;  1SQV E;  3VMI A;  3CX5 E;  1P84 E;  3BCC E;  4NBG D;  4HM3 A;  4NB9 D;  3VMH D;  4H0L D;  2D2C D;  1PPJ E;  3H1K E;  4NBF D;  3H1L E;  3VCP A;  1L0L E;  4NBC D;  1BE3 E;  2QPZ A;  2BMR A;  2XRX A;  1O7N A;  2JZA A;  2YFL A;  3C0D A;  3GTS A;  3GCF A;  1O7G A;  5KLI C;  3VMG D;  3CWB E;  4QDF A;  2GBW A;  2E76 D;  4HKV A;  4HM2 A;  1VCK A;  2HMJ A;  2DE7 D;  4NBG A;  1SQB E;  1WW9 A;  3GZY A;  1NDO A;  1NTK E;  2YIU C;  3VMH A;  3FOU A;  2HMN A;  2HMO A;  3AZC A;  2NUK A;  1Z02 A;  4NBD D;  1EZV E;  4NBF A;  1O7W A;  4NBC A;  1NTM E;  2NUM A;  4HM4 A;  1G8J B;  4EMJ B;  3TGU E;  5KLV E;  3L70 E;  3L74 E;  4NBH D;  1Z03 A;  3GCE A;  3VMG A;  2BMO A;  3GKQ A;  2XR8 A;  2ZT9 D;  1KYO E;  4U3F E;  2FYN C;  5BOK A;  1O7P A;  2NVE A;  3L73 E;  3N0Q A;  2B24 A;  2QJK C;  4NBB D;  4NBD A;  2E4Q A;  3GTE A;  1G8K B;  2E74 D;  2QJP C;  3L71 E;  3GL0 A;  5HL4 A;  1NU1 E;  1NTZ E;  1VF5 D;  2HMM A;  2NVG A;  2ZYL A;  3DQY A;  4NB9 A;  2DE5 D;  1JM1 A;  4HM8 A;  2HML A;  4HJL A;  4QUQ A;  4OGQ D;  1NYK A;  4QCK A;  2DE6 D;  3H1I E; 
#chains in the Genus database with same CATH homology
 1ULI A;  4H44 D;  2BCC E;  4NBB A;  3GZX A;  1SQP E;  5KKZ C;  4HM7 A;  1UUW A;  2A06 E;  3L75 E;  4QDC A;  4H13 D;  2YFI A;  2DE7 A;  3GKE A;  4AIV A;  3D89 A;  1BCC E;  1SQX E;  1PP9 E;  3GOB A;  3EQQ A;  4P1B H;  1ULJ A;  1O7M A;  2BMQ A;  3EN1 A;  4NBA D;  4PD4 E;  1RIE A;  3VCA A;  1L0N E;  2DE6 A;  2FYU E;  4NBH A;  1KB9 E;  1Z01 A;  2GBX A;  4NB8 D;  2YFJ A;  2NVF A;  1ZRT E;  4P1C H;  2E75 D;  1SJG A;  1VM9 A;  5AEU A;  4HM6 A;  3CXH E;  3GB4 A;  1FQT A;  1Q90 C;  5CXM A;  4NBE D;  3H1H E;  4NBA A;  4HM5 A;  3VMI D;  4HM1 A;  2NWF A;  2CKF A;  1UUV A;  2XSO A;  2XSH A;  5AEW A;  2I7F A;  4HM0 A;  2HMK A;  3H1J E;  1SQQ E;  1EG9 A;  2QJY C;  1RFS A;  4QDF B;  3L72 E;  2DE5 A;  4NB8 A;  4QDD A;  1O7H A;  1WQL A;  2JO6 A;  4QUP A;  4PV1 D;  2IBZ E;  2E4P A;  2B1X A;  2Q3W A;  4AAY B;  4NBE A;  2YVJ B;  3GL2 A;  4QUR A;  1SQV E;  3VMI A;  3CX5 E;  1P84 E;  3BCC E;  4NBG D;  4HM3 A;  4NB9 D;  3VMH D;  4H0L D;  2D2C D;  1PPJ E;  3H1K E;  4NBF D;  3H1L E;  3VCP A;  1L0L E;  4NBC D;  1BE3 E;  2QPZ A;  2BMR A;  2XRX A;  1O7N A;  2JZA A;  2YFL A;  3C0D A;  3GTS A;  3GCF A;  1O7G A;  5KLI C;  3VMG D;  3CWB E;  4QDF A;  2GBW A;  2E76 D;  4HKV A;  4HM2 A;  1VCK A;  2HMJ A;  2DE7 D;  4NBG A;  1SQB E;  1WW9 A;  3GZY A;  1NDO A;  1NTK E;  2YIU C;  3VMH A;  3FOU A;  2HMN A;  2HMO A;  3AZC A;  2NUK A;  1Z02 A;  4NBD D;  1EZV E;  4NBF A;  1O7W A;  4NBC A;  1NTM E;  2NUM A;  4HM4 A;  1G8J B;  4EMJ B;  3TGU E;  5KLV E;  3L70 E;  3L74 E;  4NBH D;  1Z03 A;  3GCE A;  3VMG A;  2BMO A;  3GKQ A;  2XR8 A;  2ZT9 D;  1KYO E;  4U3F E;  2FYN C;  5BOK A;  1O7P A;  2NVE A;  3L73 E;  3N0Q A;  2B24 A;  2QJK C;  4NBB D;  4NBD A;  2E4Q A;  3GTE A;  1G8K B;  2E74 D;  2QJP C;  3L71 E;  3GL0 A;  5HL4 A;  1NU1 E;  1NTZ E;  1VF5 D;  2HMM A;  2NVG A;  2ZYL A;  3DQY A;  4NB9 A;  2DE5 D;  1JM1 A;  4HM8 A;  2HML A;  4HJL A;  4QUQ A;  4OGQ D;  1NYK A;  4QCK A;  2DE6 D;  3H1I E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...