2YFVB

The heterotrimeric complex of kluyveromyces lactis scm3, cse4 and h4
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
74
structure length
74
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEEVRNVLKTFLESVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTONE H3-LIKE CENTROMERIC PROTEIN CSE4
publication title Recognition of the Centromere-Specific Histone Cse4 by the Chaperone Scm3.
pubmed doi rcsb
source organism Kluyveromyces lactis nrrl y-1140
molecule tags Cell cycle
total genus 27
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2011-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2yfvB00
1P3MD 3MGQA 5AY8B 4NE3A 3AZKB 3WKJA 4LD9A 3AV1C 1EQZB 3AZLC 3B6GA 1BH9B 3AZFA 3A6ND 1P3AD 1H3OA 1S32C 5B2JB 1M1AC 2FJ7B 5B31A 3V9RA 2NQBB 2HIOB 3WKJC 4E45A 4J8XB 2AROA 4ZBJC 5AV5B 2F8NH 1P3GA 4KGCB 1R4VA 1KX5D 3WTPB 1P3MB 1M19C 2RVQC 1ID3D 5AY8A 3AZKA 5AV8D 3W96C 4XUJC 3AYWB 4JJND 5B33C 2CV5D 3WA9A 4CSRA 5JA4B 1EQZA 5GXQC 4XZQA 3KXBA 1F66D 2PYOD 1HTAA 5B32B 1BH9A 3R45B 1N1JA 2AROC 1P3AB 5B1LA 4KUDA 3AZND 4YS3D 1HQ3D 3B0CW 3W99D 4Z5TD 2L5AA 3LZ1C 5CPID 4J8WD 3LELD 2HIOA 4R8PC 4J8XA 1ZLAB 5AV5A 1P3LC 3WA9C 3KXBC 4XZQC 3B0BA 2YFWB 1KX5B 3AFAC 1P3PD 3WTPA 5B1LC 4KUDC 4JJNB 5CPKC 4WNNB 3AZGD 3AZIC 3AYWA 3B0DB 1B6WA 3REIC 5B32A 3R45A 3VH5W 3MVDD 3AZNB 4YS3B 1U35B 3REKB 3RELD 5C3IB 3MNND 5DNNA 3MGSC 3W98B 1P34A 5CPIB 2JSSA 3LELB 5GT3C 5CHLB 1S32D 4CAYA 1ZLAA 5GSUC 3KWQB 3MGQD 2YFWA 3WKJD 4LD9D 2HUEB 3AZGB 4JJNA 3B6GD 4WNNA 3X1VA 4NE6A 3B0CT 5DNNC 3MGRA 3AZFD 2RVQD 4H9NB 5BS7A 1P34C 3X1TC 3W96D 1B67A 3TU4C 3AV1B 3AZLB 3AZNA 4YS3A 1U35A 5B31D 5AV6A 3REKA 5B2IA 2AROD 1M18C 4Z66A 3W98A 1S32B 1M1AB 3X1VC 5B31G 3MGRC 3LZ1D 3KWQA 3WKJB 5AY8D 1KX4C 4ZBJB 3WA9D 1EQZD 3KXBD 4XZQD 5AV6C 1M19B 4AWLC 5F99C 4QLCC 5B2IC 4Z66C 3W96B 4XUJB 5B1LD 4KUDD 5CPKD 3VH6W 4H9QB 5B33B 3AN2C 3AV1A 5GXQB 3B6FC 3AZLA 1Q9CA 5E5AC 2AROB 2HIOD 5AV9C 3WTPE 5AV5D 4NFTA 1M1AA 3VH6A 3WTPD 3LZ1B 3W97A 4R8PB 5GT3D 5B0ZC 3NQUA 3WA9B 4CSRB 3AYWD 3KXBB 4XZQB 5GT0C 4HGAC 3AFAB 1N1JB 5BO0B 1M19A 5B32D 5B1LB 4YM6C 4KUDB 3KUYC 3UT9A 5CPKB 3W96A 4XUJA 3C1BA 3AZIB 1KX3C 4H9QA 5B33A 1TAFA 4Z2MG 5DNMA 5AVBC 5GXQA 3REIB 5DNND 3WAAA 1P34D 3W97C 5B32G 1TZYC 3TU4D 1ZLAD 3AV2C 5B24C 3MGSB 4KHAB 1M18D 3LZ1A 2BYKA 3MGPA 5GT3B 3O62C 3UT9C 4R8PA 3C1BC 5GSUB 3X1VD 5DNMC 3AZJC 1P3LA 5B1MC 3MGRD 3WAAC 5JRGC 3AFAA 4Z2MH 2NZDC 3LJAC 5BO0A 2IO5C 5CPKA 4H9OB 1P3KC 3AZIA 1U35D 5AV6D 3REKD 2F8NB 5DNNB 1P34B 4QLCD 5B2ID 3REIA 5AVCC 4Z66D 3MGPC 3AZHC 3X1TB 3W98D 4H9PB 3TU4B 4CAYB 2F8NK 2BYMB 3AZEA 3KWQD 5AV9D 3MGSA 1M18B 5G49B 4KHAA 5KDMB 5BNVB 5GT3A 4WU8C 3X1VB 3KSYA 5GSUA 3REJC 3MGRB 4UUZB 1KX4B 4ZUXC 5B0ZD 3REHA 3UTBC 3AV1D 3AZLD 4WZSB 5AV6B 3AZEC 4H9OA 4AWLB 5F99B 2F8NA 4QLCB 5B2IB 4WU9C 4G92C 4Z66B 5CPJA 4YM6D 3KUYD 3X1TA 4H9PA 3AN2B 3TU4A 4H9SC 1P3IC 3B6FB 2BYMA 3LZ0A 1M1AD 5E5AB 3W97D 5CP6C 5AV9B 2LY8A 3REHC 1TZYD 1M18A 1P3FC 1JFIB 5G49A 3AV2D 5KDMA 5BNVA 4J8VA 4X23C 1M19D 5CPJC 4UUZA 1F1EA 5B0ZB 3O62D 4XUJD 3C1BD 3UT9D 1KX4A 3UTAC 5B33D 5GT0B 5DNMD 3LZ0C 5GXQD 3WAAD 3X1UC 5F99A 4QLCA 4YM6B 3KUYB 1KX3B 5FUGB 1P3KD 5AVBB 3AN2A 3B6FA 3A6NC 4J8VC 3W97B 5E5AA 3MGPD 1TZYB 3NQUB 5AV9A 4R8PD 3NQJB 3AV2B 5B24B 4M6BA 1P3LD 3VH5T 1JFIA 4J8UC 5BT1C 3AFAD 4H9RA 3O62B 3UT9B 3C1BB 5B0ZA 3AZMA 1TAFB 5DNMB 3AZID 3AZJB 1P3OA 5GT0A 5B1MB 3WAAB 5JRGB 1ID3C 3REID 5AV8C 2CV5C 5B40A 2IO5B 1F66C 2PYOC 4YM6A 3KUYA 1P3KB 1KX3A 5FUGA 4WV4B 3AZED 5AVBA 3MGSD 5AVCB 3MGPB 2BYKB 3AZHB 1HQ3C 1TZYA 3AZMC 1P3ID 3W99C 1P3LB 5GSUD 1P3OC 3NQJA 4Z5TC 5B24A 3AV2A 4J8WC 3REHD 5B40C 1P3FD 2YFVB 1A7WA 4EO5C 4WU8B 3O62A 3REJB 1P3PC 3AZJA 2F8ND 5B1MA 5B0YA 4ZUXB 5CPJD 5JRGA 1AOIA 3X1TD 2NZDA 3UTBB 3LJAA 3UTAD 1BH8A 3LZ0D 1P3BA 3AZEB 1P3KA 2F8NG 4WU9B 3X1UD 3MVDC 4G92B 5AVCA 3AZHA 2CWEA 1P3IB 3RELC 3MNNC 3VH6T 4J8VD 3X1SA 5B0YC 5CP6B 1AOIC 3REHB 1KX4D 1P3FB 2YFVA 3MGQC 1P3BC 4WU8A 4J8UD 3C1CA 5BT1D 3REJA 4X23B 5F99D 4LD9C 5CPJB 4ZUXA 3B6GC 3UTAB 3UTBA 3LZ0B 3AN2D 3AZFC 3B6FD 1BFMA 4G91C 3X1SC 4DRAA 5E5AD 3X1UB 4E44A 5BNXB 4WU9A 5B31C 4H9SA 1P3IA 3C1CC 3A6NB 4J8VB 1KU5A 5CP6A 1P3GC 5B2JA 3AZMD 1P3FA 1P3OD 5GT0D 4J8UB 2FJ7A 5AY8C 3AZKC 2NQBA 4X23A 1ULYA 5B40D 1EQZC 4NE5A 1KX3D 4KGCA 3UTAA 1P3MA 5AVBD 1ID3B 5AV8B 2CV5B 3X1UA 5BNXA 1F66B 1WWSA 5B2JC 2PYOB 5JA4A 2FJ7C 5B24D 2NQBC 4H9RB 2HIOC 4J8XC 3A6NA 5AV5C 1P3AA 1WWIA 1HQ3B 3AZMB 1P3OB 3W99B 4KGCC 4Z5TB 3WTPC 3AZJD 1P3MC 4HGAB 4J8WB 5B1MD 5B0YD 4J8UA 5JRGD 1AOID 2NZDD 5B40B 3AYWC 3LJAD 4EO5B 3VH5A 1P3BD 1KX5A 1P3PB 5B32C 1ID3A 5AV8A 5AVCD 3AZHD 4DRBA 1P3AC 2CV5A 1F66A 2PYOA 3X1SD 3MVDB 1ZLAC 1HQ3A 3RELB 3MNNB 4WU8D 1KX5C 3C1CD 3W99A 3REJD 4Z5TA 5B0YB 5CPIA 4J8WA 1AOIB 3LELA 2NZDB 4ZUXD 1P3GD 3LJAB 4JJNC 3UTBD 3B0DC 1BH8B 3MGQB 1P3BB 5BS7C 3AZKD 1P3PA 4LD9B 4WU9D 3AZNC 4YS3C 3B6GB 3AZGA 1U35C 3REKC 3AZFB 5C3IC 4G91B 3X1SB 4H9NA 3W98C 5CPIC 1H3OB 3LELC 5CP6D 3MVDA 5B2JD 5B31B 3V9RB 2FJ7D 3KWQC 3C1CB 3RELA 3MNNA 2NQBD 4J8XD 4X23D 2HUEC 1P3GB 1S32A 3AZGC 4KGCD
chains in the Genus database with same CATH superfamily
1P3MD 3MGQA 5AY8B 4NE3A 3AZKB 3A1IA 3WKJA 4LD9A 3AV1C 1EQZB 3AZLC 3B6GA 1BH9B 3AZFA 3A6ND 1P3AD 1H3OA 1S32C 5B2JB 1M1AC 2FJ7B 5B31A 3V9RA 2NQBB 2HIOB 3WKJC 4E45A 4J8XB 2AROA 4ZBJC 1PZRA 5AV5B 3IP4C 2F8NH 1P3GA 4KGCB 1R4VA 1KX5D 3WTPB 1P3MB 1M19C 2RVQC 1ID3D 5AY8A 3AZKA 5AV8D 3W96C 4XUJC 3AYWB 4JJND 5B33C 2CV5D 3WA9A 4CSRA 5JA4B 1EQZA 5GXQC 4XZQA 3KXBA 1F66D 2PYOD 1HTAA 5B32B 1BH9A 3R45B 1N1JA 2AROC 1P3AB 5B1LA 4KUDA 3AZND 4YS3D 1HQ3D 2ZM5A 3B0CW 3W99D 2Y2IA 4Z5TD 2L5AA 3LZ1C 5CPID 4J8WD 3LELD 2HIOA 4R8PC 4J8XA 1ZLAB 2F2AC 5AV5A 1P3LC 3WA9C 3KXBC 4XZQC 3B0BA 2YFWB 1KX5B 3AFAC 2ZY3A 1P3PD 3WTPA 5B1LC 4KUDC 4JJNB 5CPKC 4WNNB 3AZGD 3AZIC 3AYWA 3B0DB 1B6WA 3REIC 2G5HC 5B32A 3R45A 3VH5W 3MVDD 2ZY2A 3AZNB 4YS3B 1U35B 3REKB 3RELD 5C3IB 3MNND 3H0LC 5DNNA 3MGSC 3W98B 1P34A 5CPIB 2JSSA 3LELB 5GT3C 5CHLB 1S32D 4CAYA 2Y2JA 5GSUC 1ZLAA 3KWQB 3MGQD 2G5IC 2YFWA 3WKJD 4LD9D 2HUEB 3AZGB 4JJNA 3B6GD 4WNNA 3X1VA 4NE6A 3B0CT 5DNNC 3MGRA 3AZFD 2RVQD 4H9NB 5BS7A 2UWXA 1P34C 3X1TC 3W96D 1B67A 3TU4C 3AV1B 3AZLB 4DQYB 3AZNA 4YS3A 1U35A 5B31D 5AV6A 3REKA 5B2IA 2AROD 1M18C 4Z66A 3W98A 1S32B 1M1AB 3X1VC 2ZY4A 5B31G 3MGRC 3LZ1D 3KWQA 3WKJB 5AY8D 1KX4C 4ZBJB 2RIQA 3WA9D 1EQZD 3KXBD 4XZQD 5AV6C 2Y2MA 1M19B 4AWLC 3AL0C 5F99C 4QLCC 5B2IC 4Z66C 3W96B 4XUJB 5B1LD 4KUDD 5CPKD 1W2EA 4H9QB 3VH6W 5B33B 3AN2C 3AV1A 5GXQB 3B6FC 2Y2PA 3AZLA 1Q9CA 2Y2HA 5E5AC 1Z2CB 2AROB 2HIOD 5AV9C 3WTPE 5AV5D 4NFTA 1M1AA 3VH6A 3WTPD 3LZ1B 3W97A 4R8PB 5GT3D 5B0ZC 3NQUA 3WA9B 2W8SA 4CSRB 3AYWD 3KXBB 4XZQB 5GT0C 4HGAC 3AFAB 1N1JB 5BO0B 1M19A 5B32D 3EPLA 5B1LB 4YM6C 4KUDB 3KUYC 3UT9A 5CPKB 3W96A 4XUJA 3C1BA 3AZIB 1KX3C 4H9QA 5B33A 1TAFA 4Z2MG 5DNMA 5AVBC 5GXQA 3REIB 5DNND 3WAAA 3P5JB 1P34D 5B32G 3W97C 1TZYC 3TU4D 1ZLAD 3AV2C 5B24C 3MGSB 4KHAB 1M18D 3LZ1A 2BYKA 3MGPA 5GT3B 3O62C 3UT9C 4R8PA 3C1BC 5GSUB 3X1VD 5DNMC 3AZJC 1P3LA 2FFFB 5B1MC 3MGRD 3WAAC 5JRGC 3AFAA 4Z2MH 2XD1A 2NZDC 3LJAC 5BO0A 2IO5C 5CPKA 4H9OB 1P3KC 3AZIA 1U35D 5AV6D 3REKD 2F8NB 5DNNB 1P34B 4QLCD 5B2ID 3REIA 5AVCC 4Z66D 3MGPC 3AZHC 3X1TB 3W98D 4H9PB 3TU4B 4WJ3C 4CAYB 2F8NK 2BYMB 3A1KA 3AZEA 3KWQD 5AV9D 3MGSA 1M18B 5G49B 4KHAA 5KDMB 4UPKA 5BNVB 5GT3A 4WU8C 3X1VB 3KSYA 5GSUA 3REJC 3MGRB 4UUZB 1KX4B 1T3UA 4ZUXC 5B0ZD 3REHA 3UTBC 3AV1D 3AZLD 4WZSB 5AV6B 3AZEC 4H9OA 4AWLB 5F99B 2F8NA 4QLCB 5B2IB 4WU9C 4G92C 4Z66B 5CPJA 4YM6D 3KUYD 3X1TA 4H9PA 3EPKA 3AN2B 3TU4A 4H9SC 1P3IC 3B6FB 2BYMA 3LZ0A 1M1AD 5E5AB 3W97D 2DQNC 5CP6C 5AV9B 2LY8A 3REHC 1TZYD 1M18A 1P3FC 2JE5A 1JFIB 5G49A 3AV2D 5KDMA 5BNVA 4J8VA 4X23C 3H0MC 1M19D 5CPJC 4UUZA 1F1EA 5B0ZB 3O62D 4XUJD 3C1BD 3UT9D 1KX4A 3UTAC 5B33D 5GT0B 5DNMD 3LZ0C 5GXQD 3WAAD 2JCHA 3X1UC 5F99A 4QLCA 4YM6B 3KUYB 1KX3B 5FUGB 1P3KD 5AVBB 3AN2A 3B6FA 3A6NC 4J8VC 3W97B 5E5AA 3MGPD 1TZYB 3NQUB 5AV9A 4R8PD 3NQJB 3AV2B 5B24B 4M6BA 1P3LD 3VH5T 1JFIA 4J8UC 5BT1C 3AFAD 4H9RA 2Y2OA 3O62B 3UT9B 3C1BB 5B0ZA 3AZMA 1TAFB 5DNMB 3AZID 3AZJB 1P3OA 5GT0A 5B1MB 3KFUG 3WAAB 2XD5A 5JRGB 1ID3C 3REID 5AV8C 2CV5C 2Y2KA 5B40A 2IO5B 1F66C 2PYOC 4YM6A 3KUYA 1P3KB 1KX3A 5FUGA 4WV4B 3AZED 5AVBA 3MGSD 5AVCB 3MGPB 2BYKB 3AZHB 1HQ3C 1TZYA 3AZMC 1P3ID 3W99C 1P3LB 5GSUD 1P3OC 3NQJA 4Z5TC 5B24A 3AV2A 4J8WC 3REHD 5B40C 1P3FD 2YFVB 1A7WA 4EO5C 4WU8B 3O62A 3REJB 1P3PC 3AZJA 2F8ND 5B1MA 5B0YA 4ZUXB 5CPJD 5JRGA 1AOIA 3X1TD 2NZDA 3UTBB 3LJAA 3UTAD 1BH8A 3LZ0D 1P3BA 3AZEB 1P3KA 2F8NG 4WU9B 3X1UD 3MVDC 4G92B 5AVCA 3AZHA 2CWEA 1P3IB 3RELC 3MNNC 3VH6T 4J8VD 3X1SA 5B0YC 2Y2QA 5CP6B 1AOIC 3REHB 1KX4D 1P3FB 2YFVA 3MGQC 1P3BC 4WU8A 4J8UD 3C1CA 5BT1D 3REJA 4X23B 5F99D 4LD9C 5CPJB 4ZUXA 2BG1A 2Y2GA 3UTAB 3B6GC 3UTBA 3LZ0B 3AN2D 3AZFC 3B6FD 1BFMA 4G91C 3X1SC 4DRAA 5E5AD 3X1UB 4E44A 5BNXB 4WU9A 5B31C 4H9SA 1P3IA 3C1CC 3A6NB 4J8VB 1KU5A 5CP6A 1P3GC 5B2JA 3AZMD 1P3FA 1P3OD 5GT0D 4J8UB 2FJ7A 5AY8C 3AZKC 2NQBA 4X23A 1ULYA 5B40D 1EQZC 4NE5A 2VQRA 1KX3D 4KGCA 3UTAA 3FDDA 1P3MA 5AVBD 1ID3B 5AV8B 2CV5B 3X1UA 5BNXA 1F66B 1WWSA 5B2JC 2PYOB 5JA4A 2FJ7C 5B24D 2NQBC 2HIOC 3F6TA 4H9RB 4J8XC 3A6NA 5AV5C 1P3AA 1WWIA 1HQ3B 3AZMB 1P3OB 3W99B 4KGCC 4Z5TB 3WTPC 3AZJD 1P3MC 4HGAB 4J8WB 5B1MD 5B0YD 4J8UA 5JRGD 1AOID 2NZDD 5B40B 3AYWC 3LJAD 4EO5B 3VH5A 1P3BD 1KX5A 1P3PB 5B32C 2J8PA 1ID3A 3EG5B 5AV8A 5AVCD 3AZHD 4DRBA 1P3AC 2CV5A 1F66A 2PYOA 3X1SD 3MVDB 1ZLAC 2Y2LA 1HQ3A 3RELB 3MNNB 2Y2NA 4WU8D 1KX5C 3C1CD 3W99A 3REJD 4Z5TA 5B0YB 3H0RC 5CPIA 4J8WA 1AOIB 3LELA 2NZDB 4ZUXD 1P3GD 3LJAB 4JJNC 3UTBD 1BH8B 3B0DC 3MGQB 1P3BB 5BS7C 3AZKD 1P3PA 4LD9B 4WU9D 3AZNC 4YS3C 3B6GB 3AZGA 1U35C 3REKC 3EPHA 3AZFB 5C3IC 4G91B 3X1SB 4H9NA 3W98C 5CPIC 1H3OB 3LELC 5CP6D 3MVDA 3EPJA 5B2JD 5B31B 3V9RB 2FJ7D 2DF4C 3KWQC 3C1CB 3RELA 3MNNA 2NQBD 4J8XD 4X23D 2HUEC 2ZY5A 1P3GB 1S32A 3AZGC 4KGCD
chains in the Genus database with same CATH topology
1P3MD 3MGQA 5AY8B 4NE3A 3AZKB 3A1IA 3WKJA 4LD9A 3AV1C 1EQZB 3AZLC 3B6GA 1BH9B 3AZFA 3A6ND 1P3AD 1H3OA 1S32C 5B2JB 1M1AC 2FJ7B 5B31A 3V9RA 2NQBB 2HIOB 3WKJC 4E45A 4J8XB 2AROA 4ZBJC 1PZRA 5AV5B 3IP4C 2F8NH 1P3GA 4KGCB 1R4VA 1KX5D 3WTPB 1P3MB 1M19C 2RVQC 1ID3D 5AY8A 3AZKA 5AV8D 3W96C 4XUJC 3AYWB 4JJND 5B33C 2CV5D 3WA9A 4CSRA 5JA4B 1EQZA 5GXQC 4XZQA 3KXBA 1F66D 2PYOD 1HTAA 5B32B 1BH9A 3R45B 1N1JA 2AROC 1P3AB 5B1LA 4KUDA 3AZND 4YS3D 1HQ3D 2ZM5A 3B0CW 3W99D 2Y2IA 4Z5TD 2L5AA 3LZ1C 5CPID 4J8WD 3LELD 2HIOA 4R8PC 4J8XA 1ZLAB 2F2AC 5AV5A 1P3LC 3WA9C 3KXBC 4XZQC 3B0BA 2YFWB 1KX5B 3AFAC 2ZY3A 1P3PD 3WTPA 5B1LC 4KUDC 4JJNB 5CPKC 4WNNB 3AZGD 3AZIC 3AYWA 3B0DB 1B6WA 3REIC 2G5HC 5B32A 3R45A 3VH5W 3MVDD 2ZY2A 3AZNB 4YS3B 1U35B 3REKB 3RELD 5C3IB 3MNND 3H0LC 5DNNA 3MGSC 3W98B 1P34A 5CPIB 2JSSA 3LELB 5GT3C 5CHLB 1S32D 4CAYA 2Y2JA 5GSUC 1ZLAA 3KWQB 3MGQD 2G5IC 2YFWA 3WKJD 4LD9D 2HUEB 3AZGB 4JJNA 3B6GD 4WNNA 3X1VA 4NE6A 3B0CT 5DNNC 3MGRA 3AZFD 2RVQD 4H9NB 5BS7A 2UWXA 1P34C 3X1TC 3W96D 1B67A 3TU4C 3AV1B 3AZLB 4DQYB 3AZNA 4YS3A 1U35A 5B31D 5AV6A 3REKA 5B2IA 2AROD 1M18C 4Z66A 3W98A 1S32B 1M1AB 3X1VC 2ZY4A 5B31G 3MGRC 3LZ1D 3KWQA 3WKJB 5AY8D 1KX4C 4ZBJB 2RIQA 3WA9D 1EQZD 3KXBD 4XZQD 5AV6C 2Y2MA 1M19B 4AWLC 3AL0C 5F99C 4QLCC 5B2IC 4Z66C 3W96B 4XUJB 5B1LD 4KUDD 5CPKD 1W2EA 4H9QB 3VH6W 5B33B 3AN2C 3AV1A 5GXQB 3B6FC 2Y2PA 3AZLA 1Q9CA 2Y2HA 5E5AC 1Z2CB 2AROB 2HIOD 5AV9C 3WTPE 5AV5D 4NFTA 1M1AA 3VH6A 3WTPD 3LZ1B 3W97A 4R8PB 5GT3D 5B0ZC 3NQUA 3WA9B 2W8SA 4CSRB 3AYWD 3KXBB 4XZQB 5GT0C 4HGAC 3AFAB 1N1JB 5BO0B 1M19A 5B32D 3EPLA 5B1LB 4YM6C 4KUDB 3KUYC 3UT9A 5CPKB 3W96A 4XUJA 3C1BA 3AZIB 1KX3C 4H9QA 5B33A 1TAFA 4Z2MG 5DNMA 5AVBC 5GXQA 3REIB 5DNND 3WAAA 3P5JB 1P34D 5B32G 3W97C 1TZYC 3TU4D 1ZLAD 3AV2C 5B24C 3MGSB 4KHAB 1M18D 3LZ1A 2BYKA 3MGPA 5GT3B 3O62C 3UT9C 4R8PA 3C1BC 5GSUB 3X1VD 5DNMC 3AZJC 1P3LA 2FFFB 5B1MC 3MGRD 3WAAC 5JRGC 3AFAA 4Z2MH 2XD1A 2NZDC 3LJAC 5BO0A 2IO5C 5CPKA 4H9OB 1P3KC 3AZIA 1U35D 5AV6D 3REKD 2F8NB 5DNNB 1P34B 4QLCD 5B2ID 3REIA 5AVCC 4Z66D 3MGPC 3AZHC 3X1TB 3W98D 4H9PB 3TU4B 4WJ3C 4CAYB 2F8NK 2BYMB 3A1KA 3AZEA 3KWQD 5AV9D 3MGSA 1M18B 5G49B 4KHAA 5KDMB 4UPKA 5BNVB 5GT3A 4WU8C 3X1VB 3KSYA 5GSUA 3REJC 3MGRB 4UUZB 1KX4B 1T3UA 4ZUXC 5B0ZD 3REHA 3UTBC 3AV1D 3AZLD 4WZSB 5AV6B 3AZEC 4H9OA 4AWLB 5F99B 2F8NA 4QLCB 5B2IB 4WU9C 4G92C 4Z66B 5CPJA 4YM6D 3KUYD 3X1TA 4H9PA 3EPKA 3AN2B 3TU4A 4H9SC 1P3IC 3B6FB 2BYMA 3LZ0A 1M1AD 5E5AB 3W97D 2DQNC 5CP6C 5AV9B 2LY8A 3REHC 1TZYD 1M18A 1P3FC 2JE5A 1JFIB 5G49A 3AV2D 5KDMA 5BNVA 4J8VA 4X23C 3H0MC 1M19D 5CPJC 4UUZA 1F1EA 5B0ZB 3O62D 4XUJD 3C1BD 3UT9D 1KX4A 3UTAC 5B33D 5GT0B 5DNMD 3LZ0C 5GXQD 3WAAD 2JCHA 3X1UC 5F99A 4QLCA 4YM6B 3KUYB 1KX3B 5FUGB 1P3KD 5AVBB 3AN2A 3B6FA 3A6NC 4J8VC 3W97B 5E5AA 3MGPD 1TZYB 3NQUB 5AV9A 4R8PD 3NQJB 3AV2B 5B24B 4M6BA 1P3LD 3VH5T 1JFIA 4J8UC 5BT1C 3AFAD 4H9RA 2Y2OA 3O62B 3UT9B 3C1BB 5B0ZA 3AZMA 1TAFB 5DNMB 3AZID 3AZJB 1P3OA 5GT0A 5B1MB 3KFUG 3WAAB 2XD5A 5JRGB 1ID3C 3REID 5AV8C 2CV5C 2Y2KA 5B40A 2IO5B 1F66C 2PYOC 4YM6A 3KUYA 1P3KB 1KX3A 5FUGA 4WV4B 3AZED 5AVBA 3MGSD 5AVCB 3MGPB 2BYKB 3AZHB 1HQ3C 1TZYA 3AZMC 1P3ID 3W99C 1P3LB 5GSUD 1P3OC 3NQJA 4Z5TC 5B24A 3AV2A 4J8WC 3REHD 5B40C 1P3FD 2YFVB 1A7WA 4EO5C 4WU8B 3O62A 3REJB 1P3PC 3AZJA 2F8ND 5B1MA 5B0YA 4ZUXB 5CPJD 5JRGA 1AOIA 3X1TD 2NZDA 3UTBB 3LJAA 3UTAD 1BH8A 3LZ0D 1P3BA 3AZEB 1P3KA 2F8NG 4WU9B 3X1UD 3MVDC 4G92B 5AVCA 3AZHA 2CWEA 1P3IB 3RELC 3MNNC 3VH6T 4J8VD 3X1SA 5B0YC 2Y2QA 5CP6B 1AOIC 3REHB 1KX4D 1P3FB 2YFVA 3MGQC 1P3BC 4WU8A 4J8UD 3C1CA 5BT1D 3REJA 4X23B 5F99D 4LD9C 5CPJB 4ZUXA 2BG1A 2Y2GA 3UTAB 3B6GC 3UTBA 3LZ0B 3AN2D 3AZFC 3B6FD 1BFMA 4G91C 3X1SC 4DRAA 5E5AD 3X1UB 4E44A 5BNXB 4WU9A 5B31C 4H9SA 1P3IA 3C1CC 3A6NB 4J8VB 1KU5A 5CP6A 1P3GC 5B2JA 3AZMD 1P3FA 1P3OD 5GT0D 4J8UB 2FJ7A 5AY8C 3AZKC 2NQBA 4X23A 1ULYA 5B40D 1EQZC 4NE5A 2VQRA 1KX3D 4KGCA 3UTAA 3FDDA 1P3MA 5AVBD 1ID3B 5AV8B 2CV5B 3X1UA 5BNXA 1F66B 1WWSA 5B2JC 2PYOB 5JA4A 2FJ7C 5B24D 2NQBC 2HIOC 3F6TA 4H9RB 4J8XC 3A6NA 5AV5C 1P3AA 1WWIA 1HQ3B 3AZMB 1P3OB 3W99B 4KGCC 4Z5TB 3WTPC 3AZJD 1P3MC 4HGAB 4J8WB 5B1MD 5B0YD 4J8UA 5JRGD 1AOID 2NZDD 5B40B 3AYWC 3LJAD 4EO5B 3VH5A 1P3BD 1KX5A 1P3PB 5B32C 2J8PA 1ID3A 3EG5B 5AV8A 5AVCD 3AZHD 4DRBA 1P3AC 2CV5A 1F66A 2PYOA 3X1SD 3MVDB 1ZLAC 2Y2LA 1HQ3A 3RELB 3MNNB 2Y2NA 4WU8D 1KX5C 3C1CD 3W99A 3REJD 4Z5TA 5B0YB 3H0RC 5CPIA 4J8WA 1AOIB 3LELA 2NZDB 4ZUXD 1P3GD 3LJAB 4JJNC 3UTBD 1BH8B 3B0DC 3MGQB 1P3BB 5BS7C 3AZKD 1P3PA 4LD9B 4WU9D 3AZNC 4YS3C 3B6GB 3AZGA 1U35C 3REKC 3EPHA 3AZFB 5C3IC 4G91B 3X1SB 4H9NA 3W98C 5CPIC 1H3OB 3LELC 5CP6D 3MVDA 3EPJA 5B2JD 5B31B 3V9RB 2FJ7D 2DF4C 3KWQC 3C1CB 3RELA 3MNNA 2NQBD 4J8XD 4X23D 2HUEC 2ZY5A 1P3GB 1S32A 3AZGC 4KGCD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3M D;  3MGQ A;  5AY8 B;  4NE3 A;  3AZK B;  3WKJ A;  4LD9 A;  3AV1 C;  1EQZ B;  3AZL C;  3B6G A;  1BH9 B;  3AZF A;  3A6N D;  1P3A D;  1H3O A;  1S32 C;  5B2J B;  1M1A C;  2FJ7 B;  5B31 A;  3V9R A;  2NQB B;  2HIO B;  3WKJ C;  4E45 A;  4J8X B;  2ARO A;  4ZBJ C;  5AV5 B;  2F8N H;  1P3G A;  4KGC B;  1R4V A;  1KX5 D;  3WTP B;  1P3M B;  1M19 C;  2RVQ C;  1ID3 D;  5AY8 A;  3AZK A;  5AV8 D;  3W96 C;  4XUJ C;  3AYW B;  4JJN D;  5B33 C;  2CV5 D;  3WA9 A;  4CSR A;  5JA4 B;  1EQZ A;  5GXQ C;  4XZQ A;  3KXB A;  1F66 D;  2PYO D;  1HTA A;  5B32 B;  1BH9 A;  3R45 B;  1N1J A;  2ARO C;  1P3A B;  5B1L A;  4KUD A;  3AZN D;  4YS3 D;  1HQ3 D;  3B0C W;  3W99 D;  4Z5T D;  2L5A A;  3LZ1 C;  5CPI D;  4J8W D;  3LEL D;  2HIO A;  4R8P C;  4J8X A;  1ZLA B;  5AV5 A;  1P3L C;  3WA9 C;  3KXB C;  4XZQ C;  3B0B A;  2YFW B;  1KX5 B;  3AFA C;  1P3P D;  3WTP A;  5B1L C;  4KUD C;  4JJN B;  5CPK C;  4WNN B;  3AZG D;  3AZI C;  3AYW A;  3B0D B;  1B6W A;  3REI C;  5B32 A;  3R45 A;  3VH5 W;  3MVD D;  3AZN B;  4YS3 B;  1U35 B;  3REK B;  3REL D;  5C3I B;  3MNN D;  5DNN A;  3MGS C;  3W98 B;  1P34 A;  5CPI B;  2JSS A;  3LEL B;  5GT3 C;  5CHL B;  1S32 D;  4CAY A;  1ZLA A;  5GSU C;  3KWQ B;  3MGQ D;  2YFW A;  3WKJ D;  4LD9 D;  2HUE B;  3AZG B;  4JJN A;  3B6G D;  4WNN A;  3X1V A;  4NE6 A;  3B0C T;  5DNN C;  3MGR A;  3AZF D;  2RVQ D;  4H9N B;  5BS7 A;  1P34 C;  3X1T C;  3W96 D;  1B67 A;  3TU4 C;  3AV1 B;  3AZL B;  3AZN A;  4YS3 A;  1U35 A;  5B31 D;  5AV6 A;  3REK A;  5B2I A;  2ARO D;  1M18 C;  4Z66 A;  3W98 A;  1S32 B;  1M1A B;  3X1V C;  5B31 G;  3MGR C;  3LZ1 D;  3KWQ A;  3WKJ B;  5AY8 D;  1KX4 C;  4ZBJ B;  3WA9 D;  1EQZ D;  3KXB D;  4XZQ D;  5AV6 C;  1M19 B;  4AWL C;  5F99 C;  4QLC C;  5B2I C;  4Z66 C;  3W96 B;  4XUJ B;  5B1L D;  4KUD D;  5CPK D;  3VH6 W;  4H9Q B;  5B33 B;  3AN2 C;  3AV1 A;  5GXQ B;  3B6F C;  3AZL A;  1Q9C A;  5E5A C;  2ARO B;  2HIO D;  5AV9 C;  3WTP E;  5AV5 D;  4NFT A;  1M1A A;  3VH6 A;  3WTP D;  3LZ1 B;  3W97 A;  4R8P B;  5GT3 D;  5B0Z C;  3NQU A;  3WA9 B;  4CSR B;  3AYW D;  3KXB B;  4XZQ B;  5GT0 C;  4HGA C;  3AFA B;  1N1J B;  5BO0 B;  1M19 A;  5B32 D;  5B1L B;  4YM6 C;  4KUD B;  3KUY C;  3UT9 A;  5CPK B;  3W96 A;  4XUJ A;  3C1B A;  3AZI B;  1KX3 C;  4H9Q A;  5B33 A;  1TAF A;  4Z2M G;  5DNM A;  5AVB C;  5GXQ A;  3REI B;  5DNN D;  3WAA A;  1P34 D;  3W97 C;  5B32 G;  1TZY C;  3TU4 D;  1ZLA D;  3AV2 C;  5B24 C;  3MGS B;  4KHA B;  1M18 D;  3LZ1 A;  2BYK A;  3MGP A;  5GT3 B;  3O62 C;  3UT9 C;  4R8P A;  3C1B C;  5GSU B;  3X1V D;  5DNM C;  3AZJ C;  1P3L A;  5B1M C;  3MGR D;  3WAA C;  5JRG C;  3AFA A;  4Z2M H;  2NZD C;  3LJA C;  5BO0 A;  2IO5 C;  5CPK A;  4H9O B;  1P3K C;  3AZI A;  1U35 D;  5AV6 D;  3REK D;  2F8N B;  5DNN B;  1P34 B;  4QLC D;  5B2I D;  3REI A;  5AVC C;  4Z66 D;  3MGP C;  3AZH C;  3X1T B;  3W98 D;  4H9P B;  3TU4 B;  4CAY B;  2F8N K;  2BYM B;  3AZE A;  3KWQ D;  5AV9 D;  3MGS A;  1M18 B;  5G49 B;  4KHA A;  5KDM B;  5BNV B;  5GT3 A;  4WU8 C;  3X1V B;  3KSY A;  5GSU A;  3REJ C;  3MGR B;  4UUZ B;  1KX4 B;  4ZUX C;  5B0Z D;  3REH A;  3UTB C;  3AV1 D;  3AZL D;  4WZS B;  5AV6 B;  3AZE C;  4H9O A;  4AWL B;  5F99 B;  2F8N A;  4QLC B;  5B2I B;  4WU9 C;  4G92 C;  4Z66 B;  5CPJ A;  4YM6 D;  3KUY D;  3X1T A;  4H9P A;  3AN2 B;  3TU4 A;  4H9S C;  1P3I C;  3B6F B;  2BYM A;  3LZ0 A;  1M1A D;  5E5A B;  3W97 D;  5CP6 C;  5AV9 B;  2LY8 A;  3REH C;  1TZY D;  1M18 A;  1P3F C;  1JFI B;  5G49 A;  3AV2 D;  5KDM A;  5BNV A;  4J8V A;  4X23 C;  1M19 D;  5CPJ C;  4UUZ A;  1F1E A;  5B0Z B;  3O62 D;  4XUJ D;  3C1B D;  3UT9 D;  1KX4 A;  3UTA C;  5B33 D;  5GT0 B;  5DNM D;  3LZ0 C;  5GXQ D;  3WAA D;  3X1U C;  5F99 A;  4QLC A;  4YM6 B;  3KUY B;  1KX3 B;  5FUG B;  1P3K D;  5AVB B;  3AN2 A;  3B6F A;  3A6N C;  4J8V C;  3W97 B;  5E5A A;  3MGP D;  1TZY B;  3NQU B;  5AV9 A;  4R8P D;  3NQJ B;  3AV2 B;  5B24 B;  4M6B A;  1P3L D;  3VH5 T;  1JFI A;  4J8U C;  5BT1 C;  3AFA D;  4H9R A;  3O62 B;  3UT9 B;  3C1B B;  5B0Z A;  3AZM A;  1TAF B;  5DNM B;  3AZI D;  3AZJ B;  1P3O A;  5GT0 A;  5B1M B;  3WAA B;  5JRG B;  1ID3 C;  3REI D;  5AV8 C;  2CV5 C;  5B40 A;  2IO5 B;  1F66 C;  2PYO C;  4YM6 A;  3KUY A;  1P3K B;  1KX3 A;  5FUG A;  4WV4 B;  3AZE D;  5AVB A;  3MGS D;  5AVC B;  3MGP B;  2BYK B;  3AZH B;  1HQ3 C;  1TZY A;  3AZM C;  1P3I D;  3W99 C;  1P3L B;  5GSU D;  1P3O C;  3NQJ A;  4Z5T C;  5B24 A;  3AV2 A;  4J8W C;  3REH D;  5B40 C;  1P3F D;  2YFV B;  1A7W A;  4EO5 C;  4WU8 B;  3O62 A;  3REJ B;  1P3P C;  3AZJ A;  2F8N D;  5B1M A;  5B0Y A;  4ZUX B;  5CPJ D;  5JRG A;  1AOI A;  3X1T D;  2NZD A;  3UTB B;  3LJA A;  3UTA D;  1BH8 A;  3LZ0 D;  1P3B A;  3AZE B;  1P3K A;  2F8N G;  4WU9 B;  3X1U D;  3MVD C;  4G92 B;  5AVC A;  3AZH A;  2CWE A;  1P3I B;  3REL C;  3MNN C;  3VH6 T;  4J8V D;  3X1S A;  5B0Y C;  5CP6 B;  1AOI C;  3REH B;  1KX4 D;  1P3F B;  2YFV A;  3MGQ C;  1P3B C;  4WU8 A;  4J8U D;  3C1C A;  5BT1 D;  3REJ A;  4X23 B;  5F99 D;  4LD9 C;  5CPJ B;  4ZUX A;  3B6G C;  3UTA B;  3UTB A;  3LZ0 B;  3AN2 D;  3AZF C;  3B6F D;  1BFM A;  4G91 C;  3X1S C;  4DRA A;  5E5A D;  3X1U B;  4E44 A;  5BNX B;  4WU9 A;  5B31 C;  4H9S A;  1P3I A;  3C1C C;  3A6N B;  4J8V B;  1KU5 A;  5CP6 A;  1P3G C;  5B2J A;  3AZM D;  1P3F A;  1P3O D;  5GT0 D;  4J8U B;  2FJ7 A;  5AY8 C;  3AZK C;  2NQB A;  4X23 A;  1ULY A;  5B40 D;  1EQZ C;  4NE5 A;  1KX3 D;  4KGC A;  3UTA A;  1P3M A;  5AVB D;  1ID3 B;  5AV8 B;  2CV5 B;  3X1U A;  5BNX A;  1F66 B;  1WWS A;  5B2J C;  2PYO B;  5JA4 A;  2FJ7 C;  5B24 D;  2NQB C;  4H9R B;  2HIO C;  4J8X C;  3A6N A;  5AV5 C;  1P3A A;  1WWI A;  1HQ3 B;  3AZM B;  1P3O B;  3W99 B;  4KGC C;  4Z5T B;  3WTP C;  3AZJ D;  1P3M C;  4HGA B;  4J8W B;  5B1M D;  5B0Y D;  4J8U A;  5JRG D;  1AOI D;  2NZD D;  5B40 B;  3AYW C;  3LJA D;  4EO5 B;  3VH5 A;  1P3B D;  1KX5 A;  1P3P B;  5B32 C;  1ID3 A;  5AV8 A;  5AVC D;  3AZH D;  4DRB A;  1P3A C;  2CV5 A;  1F66 A;  2PYO A;  3X1S D;  3MVD B;  1ZLA C;  1HQ3 A;  3REL B;  3MNN B;  4WU8 D;  1KX5 C;  3C1C D;  3W99 A;  3REJ D;  4Z5T A;  5B0Y B;  5CPI A;  4J8W A;  1AOI B;  3LEL A;  2NZD B;  4ZUX D;  1P3G D;  3LJA B;  4JJN C;  3UTB D;  3B0D C;  1BH8 B;  3MGQ B;  1P3B B;  5BS7 C;  3AZK D;  1P3P A;  4LD9 B;  4WU9 D;  3AZN C;  4YS3 C;  3B6G B;  3AZG A;  1U35 C;  3REK C;  3AZF B;  5C3I C;  4G91 B;  3X1S B;  4H9N A;  3W98 C;  5CPI C;  1H3O B;  3LEL C;  5CP6 D;  3MVD A;  5B2J D;  5B31 B;  3V9R B;  2FJ7 D;  3KWQ C;  3C1C B;  3REL A;  3MNN A;  2NQB D;  4J8X D;  4X23 D;  2HUE C;  1P3G B;  1S32 A;  3AZG C;  4KGC D; 
#chains in the Genus database with same CATH topology
 1P3M D;  3MGQ A;  5AY8 B;  4NE3 A;  3AZK B;  3A1I A;  3WKJ A;  4LD9 A;  3AV1 C;  1EQZ B;  3AZL C;  3B6G A;  1BH9 B;  3AZF A;  3A6N D;  1P3A D;  1H3O A;  1S32 C;  5B2J B;  1M1A C;  2FJ7 B;  5B31 A;  3V9R A;  2NQB B;  2HIO B;  3WKJ C;  4E45 A;  4J8X B;  2ARO A;  4ZBJ C;  1PZR A;  5AV5 B;  3IP4 C;  2F8N H;  1P3G A;  4KGC B;  1R4V A;  1KX5 D;  3WTP B;  1P3M B;  1M19 C;  2RVQ C;  1ID3 D;  5AY8 A;  3AZK A;  5AV8 D;  3W96 C;  4XUJ C;  3AYW B;  4JJN D;  5B33 C;  2CV5 D;  3WA9 A;  4CSR A;  5JA4 B;  1EQZ A;  5GXQ C;  4XZQ A;  3KXB A;  1F66 D;  2PYO D;  1HTA A;  5B32 B;  1BH9 A;  3R45 B;  1N1J A;  2ARO C;  1P3A B;  5B1L A;  4KUD A;  3AZN D;  4YS3 D;  1HQ3 D;  2ZM5 A;  3B0C W;  3W99 D;  2Y2I A;  4Z5T D;  2L5A A;  3LZ1 C;  5CPI D;  4J8W D;  3LEL D;  2HIO A;  4R8P C;  4J8X A;  1ZLA B;  2F2A C;  5AV5 A;  1P3L C;  3WA9 C;  3KXB C;  4XZQ C;  3B0B A;  2YFW B;  1KX5 B;  3AFA C;  2ZY3 A;  1P3P D;  3WTP A;  5B1L C;  4KUD C;  4JJN B;  5CPK C;  4WNN B;  3AZG D;  3AZI C;  3AYW A;  3B0D B;  1B6W A;  3REI C;  2G5H C;  5B32 A;  3R45 A;  3VH5 W;  3MVD D;  2ZY2 A;  3AZN B;  4YS3 B;  1U35 B;  3REK B;  3REL D;  5C3I B;  3MNN D;  3H0L C;  5DNN A;  3MGS C;  3W98 B;  1P34 A;  5CPI B;  2JSS A;  3LEL B;  5GT3 C;  5CHL B;  1S32 D;  4CAY A;  2Y2J A;  5GSU C;  1ZLA A;  3KWQ B;  3MGQ D;  2G5I C;  2YFW A;  3WKJ D;  4LD9 D;  2HUE B;  3AZG B;  4JJN A;  3B6G D;  4WNN A;  3X1V A;  4NE6 A;  3B0C T;  5DNN C;  3MGR A;  3AZF D;  2RVQ D;  4H9N B;  5BS7 A;  2UWX A;  1P34 C;  3X1T C;  3W96 D;  1B67 A;  3TU4 C;  3AV1 B;  3AZL B;  4DQY B;  3AZN A;  4YS3 A;  1U35 A;  5B31 D;  5AV6 A;  3REK A;  5B2I A;  2ARO D;  1M18 C;  4Z66 A;  3W98 A;  1S32 B;  1M1A B;  3X1V C;  2ZY4 A;  5B31 G;  3MGR C;  3LZ1 D;  3KWQ A;  3WKJ B;  5AY8 D;  1KX4 C;  4ZBJ B;  2RIQ A;  3WA9 D;  1EQZ D;  3KXB D;  4XZQ D;  5AV6 C;  2Y2M A;  1M19 B;  4AWL C;  3AL0 C;  5F99 C;  4QLC C;  5B2I C;  4Z66 C;  3W96 B;  4XUJ B;  5B1L D;  4KUD D;  5CPK D;  1W2E A;  4H9Q B;  3VH6 W;  5B33 B;  3AN2 C;  3AV1 A;  5GXQ B;  3B6F C;  2Y2P A;  3AZL A;  1Q9C A;  2Y2H A;  5E5A C;  1Z2C B;  2ARO B;  2HIO D;  5AV9 C;  3WTP E;  5AV5 D;  4NFT A;  1M1A A;  3VH6 A;  3WTP D;  3LZ1 B;  3W97 A;  4R8P B;  5GT3 D;  5B0Z C;  3NQU A;  3WA9 B;  2W8S A;  4CSR B;  3AYW D;  3KXB B;  4XZQ B;  5GT0 C;  4HGA C;  3AFA B;  1N1J B;  5BO0 B;  1M19 A;  5B32 D;  3EPL A;  5B1L B;  4YM6 C;  4KUD B;  3KUY C;  3UT9 A;  5CPK B;  3W96 A;  4XUJ A;  3C1B A;  3AZI B;  1KX3 C;  4H9Q A;  5B33 A;  1TAF A;  4Z2M G;  5DNM A;  5AVB C;  5GXQ A;  3REI B;  5DNN D;  3WAA A;  3P5J B;  1P34 D;  5B32 G;  3W97 C;  1TZY C;  3TU4 D;  1ZLA D;  3AV2 C;  5B24 C;  3MGS B;  4KHA B;  1M18 D;  3LZ1 A;  2BYK A;  3MGP A;  5GT3 B;  3O62 C;  3UT9 C;  4R8P A;  3C1B C;  5GSU B;  3X1V D;  5DNM C;  3AZJ C;  1P3L A;  2FFF B;  5B1M C;  3MGR D;  3WAA C;  5JRG C;  3AFA A;  4Z2M H;  2XD1 A;  2NZD C;  3LJA C;  5BO0 A;  2IO5 C;  5CPK A;  4H9O B;  1P3K C;  3AZI A;  1U35 D;  5AV6 D;  3REK D;  2F8N B;  5DNN B;  1P34 B;  4QLC D;  5B2I D;  3REI A;  5AVC C;  4Z66 D;  3MGP C;  3AZH C;  3X1T B;  3W98 D;  4H9P B;  3TU4 B;  4WJ3 C;  4CAY B;  2F8N K;  2BYM B;  3A1K A;  3AZE A;  3KWQ D;  5AV9 D;  3MGS A;  1M18 B;  5G49 B;  4KHA A;  5KDM B;  4UPK A;  5BNV B;  5GT3 A;  4WU8 C;  3X1V B;  3KSY A;  5GSU A;  3REJ C;  3MGR B;  4UUZ B;  1KX4 B;  1T3U A;  4ZUX C;  5B0Z D;  3REH A;  3UTB C;  3AV1 D;  3AZL D;  4WZS B;  5AV6 B;  3AZE C;  4H9O A;  4AWL B;  5F99 B;  2F8N A;  4QLC B;  5B2I B;  4WU9 C;  4G92 C;  4Z66 B;  5CPJ A;  4YM6 D;  3KUY D;  3X1T A;  4H9P A;  3EPK A;  3AN2 B;  3TU4 A;  4H9S C;  1P3I C;  3B6F B;  2BYM A;  3LZ0 A;  1M1A D;  5E5A B;  3W97 D;  2DQN C;  5CP6 C;  5AV9 B;  2LY8 A;  3REH C;  1TZY D;  1M18 A;  1P3F C;  2JE5 A;  1JFI B;  5G49 A;  3AV2 D;  5KDM A;  5BNV A;  4J8V A;  4X23 C;  3H0M C;  1M19 D;  5CPJ C;  4UUZ A;  1F1E A;  5B0Z B;  3O62 D;  4XUJ D;  3C1B D;  3UT9 D;  1KX4 A;  3UTA C;  5B33 D;  5GT0 B;  5DNM D;  3LZ0 C;  5GXQ D;  3WAA D;  2JCH A;  3X1U C;  5F99 A;  4QLC A;  4YM6 B;  3KUY B;  1KX3 B;  5FUG B;  1P3K D;  5AVB B;  3AN2 A;  3B6F A;  3A6N C;  4J8V C;  3W97 B;  5E5A A;  3MGP D;  1TZY B;  3NQU B;  5AV9 A;  4R8P D;  3NQJ B;  3AV2 B;  5B24 B;  4M6B A;  1P3L D;  3VH5 T;  1JFI A;  4J8U C;  5BT1 C;  3AFA D;  4H9R A;  2Y2O A;  3O62 B;  3UT9 B;  3C1B B;  5B0Z A;  3AZM A;  1TAF B;  5DNM B;  3AZI D;  3AZJ B;  1P3O A;  5GT0 A;  5B1M B;  3KFU G;  3WAA B;  2XD5 A;  5JRG B;  1ID3 C;  3REI D;  5AV8 C;  2CV5 C;  2Y2K A;  5B40 A;  2IO5 B;  1F66 C;  2PYO C;  4YM6 A;  3KUY A;  1P3K B;  1KX3 A;  5FUG A;  4WV4 B;  3AZE D;  5AVB A;  3MGS D;  5AVC B;  3MGP B;  2BYK B;  3AZH B;  1HQ3 C;  1TZY A;  3AZM C;  1P3I D;  3W99 C;  1P3L B;  5GSU D;  1P3O C;  3NQJ A;  4Z5T C;  5B24 A;  3AV2 A;  4J8W C;  3REH D;  5B40 C;  1P3F D;  2YFV B;  1A7W A;  4EO5 C;  4WU8 B;  3O62 A;  3REJ B;  1P3P C;  3AZJ A;  2F8N D;  5B1M A;  5B0Y A;  4ZUX B;  5CPJ D;  5JRG A;  1AOI A;  3X1T D;  2NZD A;  3UTB B;  3LJA A;  3UTA D;  1BH8 A;  3LZ0 D;  1P3B A;  3AZE B;  1P3K A;  2F8N G;  4WU9 B;  3X1U D;  3MVD C;  4G92 B;  5AVC A;  3AZH A;  2CWE A;  1P3I B;  3REL C;  3MNN C;  3VH6 T;  4J8V D;  3X1S A;  5B0Y C;  2Y2Q A;  5CP6 B;  1AOI C;  3REH B;  1KX4 D;  1P3F B;  2YFV A;  3MGQ C;  1P3B C;  4WU8 A;  4J8U D;  3C1C A;  5BT1 D;  3REJ A;  4X23 B;  5F99 D;  4LD9 C;  5CPJ B;  4ZUX A;  2BG1 A;  2Y2G A;  3UTA B;  3B6G C;  3UTB A;  3LZ0 B;  3AN2 D;  3AZF C;  3B6F D;  1BFM A;  4G91 C;  3X1S C;  4DRA A;  5E5A D;  3X1U B;  4E44 A;  5BNX B;  4WU9 A;  5B31 C;  4H9S A;  1P3I A;  3C1C C;  3A6N B;  4J8V B;  1KU5 A;  5CP6 A;  1P3G C;  5B2J A;  3AZM D;  1P3F A;  1P3O D;  5GT0 D;  4J8U B;  2FJ7 A;  5AY8 C;  3AZK C;  2NQB A;  4X23 A;  1ULY A;  5B40 D;  1EQZ C;  4NE5 A;  2VQR A;  1KX3 D;  4KGC A;  3UTA A;  3FDD A;  1P3M A;  5AVB D;  1ID3 B;  5AV8 B;  2CV5 B;  3X1U A;  5BNX A;  1F66 B;  1WWS A;  5B2J C;  2PYO B;  5JA4 A;  2FJ7 C;  5B24 D;  2NQB C;  2HIO C;  3F6T A;  4H9R B;  4J8X C;  3A6N A;  5AV5 C;  1P3A A;  1WWI A;  1HQ3 B;  3AZM B;  1P3O B;  3W99 B;  4KGC C;  4Z5T B;  3WTP C;  3AZJ D;  1P3M C;  4HGA B;  4J8W B;  5B1M D;  5B0Y D;  4J8U A;  5JRG D;  1AOI D;  2NZD D;  5B40 B;  3AYW C;  3LJA D;  4EO5 B;  3VH5 A;  1P3B D;  1KX5 A;  1P3P B;  5B32 C;  2J8P A;  1ID3 A;  3EG5 B;  5AV8 A;  5AVC D;  3AZH D;  4DRB A;  1P3A C;  2CV5 A;  1F66 A;  2PYO A;  3X1S D;  3MVD B;  1ZLA C;  2Y2L A;  1HQ3 A;  3REL B;  3MNN B;  2Y2N A;  4WU8 D;  1KX5 C;  3C1C D;  3W99 A;  3REJ D;  4Z5T A;  5B0Y B;  3H0R C;  5CPI A;  4J8W A;  1AOI B;  3LEL A;  2NZD B;  4ZUX D;  1P3G D;  3LJA B;  4JJN C;  3UTB D;  1BH8 B;  3B0D C;  3MGQ B;  1P3B B;  5BS7 C;  3AZK D;  1P3P A;  4LD9 B;  4WU9 D;  3AZN C;  4YS3 C;  3B6G B;  3AZG A;  1U35 C;  3REK C;  3EPH A;  3AZF B;  5C3I C;  4G91 B;  3X1S B;  4H9N A;  3W98 C;  5CPI C;  1H3O B;  3LEL C;  5CP6 D;  3MVD A;  3EPJ A;  5B2J D;  5B31 B;  3V9R B;  2FJ7 D;  2DF4 C;  3KWQ C;  3C1C B;  3REL A;  3MNN A;  2NQB D;  4J8X D;  4X23 D;  2HUE C;  2ZY5 A;  1P3G B;  1S32 A;  3AZG C;  4KGC D; 
#chains in the Genus database with same CATH homology
 1P3M D;  3MGQ A;  5AY8 B;  4NE3 A;  3AZK B;  3A1I A;  3WKJ A;  4LD9 A;  3AV1 C;  1EQZ B;  3AZL C;  3B6G A;  1BH9 B;  3AZF A;  3A6N D;  1P3A D;  1H3O A;  1S32 C;  5B2J B;  1M1A C;  2FJ7 B;  5B31 A;  3V9R A;  2NQB B;  2HIO B;  3WKJ C;  4E45 A;  4J8X B;  2ARO A;  4ZBJ C;  1PZR A;  5AV5 B;  3IP4 C;  2F8N H;  1P3G A;  4KGC B;  1R4V A;  1KX5 D;  3WTP B;  1P3M B;  1M19 C;  2RVQ C;  1ID3 D;  5AY8 A;  3AZK A;  5AV8 D;  3W96 C;  4XUJ C;  3AYW B;  4JJN D;  5B33 C;  2CV5 D;  3WA9 A;  4CSR A;  5JA4 B;  1EQZ A;  5GXQ C;  4XZQ A;  3KXB A;  1F66 D;  2PYO D;  1HTA A;  5B32 B;  1BH9 A;  3R45 B;  1N1J A;  2ARO C;  1P3A B;  5B1L A;  4KUD A;  3AZN D;  4YS3 D;  1HQ3 D;  2ZM5 A;  3B0C W;  3W99 D;  2Y2I A;  4Z5T D;  2L5A A;  3LZ1 C;  5CPI D;  4J8W D;  3LEL D;  2HIO A;  4R8P C;  4J8X A;  1ZLA B;  2F2A C;  5AV5 A;  1P3L C;  3WA9 C;  3KXB C;  4XZQ C;  3B0B A;  2YFW B;  1KX5 B;  3AFA C;  2ZY3 A;  1P3P D;  3WTP A;  5B1L C;  4KUD C;  4JJN B;  5CPK C;  4WNN B;  3AZG D;  3AZI C;  3AYW A;  3B0D B;  1B6W A;  3REI C;  2G5H C;  5B32 A;  3R45 A;  3VH5 W;  3MVD D;  2ZY2 A;  3AZN B;  4YS3 B;  1U35 B;  3REK B;  3REL D;  5C3I B;  3MNN D;  3H0L C;  5DNN A;  3MGS C;  3W98 B;  1P34 A;  5CPI B;  2JSS A;  3LEL B;  5GT3 C;  5CHL B;  1S32 D;  4CAY A;  2Y2J A;  5GSU C;  1ZLA A;  3KWQ B;  3MGQ D;  2G5I C;  2YFW A;  3WKJ D;  4LD9 D;  2HUE B;  3AZG B;  4JJN A;  3B6G D;  4WNN A;  3X1V A;  4NE6 A;  3B0C T;  5DNN C;  3MGR A;  3AZF D;  2RVQ D;  4H9N B;  5BS7 A;  2UWX A;  1P34 C;  3X1T C;  3W96 D;  1B67 A;  3TU4 C;  3AV1 B;  3AZL B;  4DQY B;  3AZN A;  4YS3 A;  1U35 A;  5B31 D;  5AV6 A;  3REK A;  5B2I A;  2ARO D;  1M18 C;  4Z66 A;  3W98 A;  1S32 B;  1M1A B;  3X1V C;  2ZY4 A;  5B31 G;  3MGR C;  3LZ1 D;  3KWQ A;  3WKJ B;  5AY8 D;  1KX4 C;  4ZBJ B;  2RIQ A;  3WA9 D;  1EQZ D;  3KXB D;  4XZQ D;  5AV6 C;  2Y2M A;  1M19 B;  4AWL C;  3AL0 C;  5F99 C;  4QLC C;  5B2I C;  4Z66 C;  3W96 B;  4XUJ B;  5B1L D;  4KUD D;  5CPK D;  1W2E A;  4H9Q B;  3VH6 W;  5B33 B;  3AN2 C;  3AV1 A;  5GXQ B;  3B6F C;  2Y2P A;  3AZL A;  1Q9C A;  2Y2H A;  5E5A C;  1Z2C B;  2ARO B;  2HIO D;  5AV9 C;  3WTP E;  5AV5 D;  4NFT A;  1M1A A;  3VH6 A;  3WTP D;  3LZ1 B;  3W97 A;  4R8P B;  5GT3 D;  5B0Z C;  3NQU A;  3WA9 B;  2W8S A;  4CSR B;  3AYW D;  3KXB B;  4XZQ B;  5GT0 C;  4HGA C;  3AFA B;  1N1J B;  5BO0 B;  1M19 A;  5B32 D;  3EPL A;  5B1L B;  4YM6 C;  4KUD B;  3KUY C;  3UT9 A;  5CPK B;  3W96 A;  4XUJ A;  3C1B A;  3AZI B;  1KX3 C;  4H9Q A;  5B33 A;  1TAF A;  4Z2M G;  5DNM A;  5AVB C;  5GXQ A;  3REI B;  5DNN D;  3WAA A;  3P5J B;  1P34 D;  5B32 G;  3W97 C;  1TZY C;  3TU4 D;  1ZLA D;  3AV2 C;  5B24 C;  3MGS B;  4KHA B;  1M18 D;  3LZ1 A;  2BYK A;  3MGP A;  5GT3 B;  3O62 C;  3UT9 C;  4R8P A;  3C1B C;  5GSU B;  3X1V D;  5DNM C;  3AZJ C;  1P3L A;  2FFF B;  5B1M C;  3MGR D;  3WAA C;  5JRG C;  3AFA A;  4Z2M H;  2XD1 A;  2NZD C;  3LJA C;  5BO0 A;  2IO5 C;  5CPK A;  4H9O B;  1P3K C;  3AZI A;  1U35 D;  5AV6 D;  3REK D;  2F8N B;  5DNN B;  1P34 B;  4QLC D;  5B2I D;  3REI A;  5AVC C;  4Z66 D;  3MGP C;  3AZH C;  3X1T B;  3W98 D;  4H9P B;  3TU4 B;  4WJ3 C;  4CAY B;  2F8N K;  2BYM B;  3A1K A;  3AZE A;  3KWQ D;  5AV9 D;  3MGS A;  1M18 B;  5G49 B;  4KHA A;  5KDM B;  4UPK A;  5BNV B;  5GT3 A;  4WU8 C;  3X1V B;  3KSY A;  5GSU A;  3REJ C;  3MGR B;  4UUZ B;  1KX4 B;  1T3U A;  4ZUX C;  5B0Z D;  3REH A;  3UTB C;  3AV1 D;  3AZL D;  4WZS B;  5AV6 B;  3AZE C;  4H9O A;  4AWL B;  5F99 B;  2F8N A;  4QLC B;  5B2I B;  4WU9 C;  4G92 C;  4Z66 B;  5CPJ A;  4YM6 D;  3KUY D;  3X1T A;  4H9P A;  3EPK A;  3AN2 B;  3TU4 A;  4H9S C;  1P3I C;  3B6F B;  2BYM A;  3LZ0 A;  1M1A D;  5E5A B;  3W97 D;  2DQN C;  5CP6 C;  5AV9 B;  2LY8 A;  3REH C;  1TZY D;  1M18 A;  1P3F C;  2JE5 A;  1JFI B;  5G49 A;  3AV2 D;  5KDM A;  5BNV A;  4J8V A;  4X23 C;  3H0M C;  1M19 D;  5CPJ C;  4UUZ A;  1F1E A;  5B0Z B;  3O62 D;  4XUJ D;  3C1B D;  3UT9 D;  1KX4 A;  3UTA C;  5B33 D;  5GT0 B;  5DNM D;  3LZ0 C;  5GXQ D;  3WAA D;  2JCH A;  3X1U C;  5F99 A;  4QLC A;  4YM6 B;  3KUY B;  1KX3 B;  5FUG B;  1P3K D;  5AVB B;  3AN2 A;  3B6F A;  3A6N C;  4J8V C;  3W97 B;  5E5A A;  3MGP D;  1TZY B;  3NQU B;  5AV9 A;  4R8P D;  3NQJ B;  3AV2 B;  5B24 B;  4M6B A;  1P3L D;  3VH5 T;  1JFI A;  4J8U C;  5BT1 C;  3AFA D;  4H9R A;  2Y2O A;  3O62 B;  3UT9 B;  3C1B B;  5B0Z A;  3AZM A;  1TAF B;  5DNM B;  3AZI D;  3AZJ B;  1P3O A;  5GT0 A;  5B1M B;  3KFU G;  3WAA B;  2XD5 A;  5JRG B;  1ID3 C;  3REI D;  5AV8 C;  2CV5 C;  2Y2K A;  5B40 A;  2IO5 B;  1F66 C;  2PYO C;  4YM6 A;  3KUY A;  1P3K B;  1KX3 A;  5FUG A;  4WV4 B;  3AZE D;  5AVB A;  3MGS D;  5AVC B;  3MGP B;  2BYK B;  3AZH B;  1HQ3 C;  1TZY A;  3AZM C;  1P3I D;  3W99 C;  1P3L B;  5GSU D;  1P3O C;  3NQJ A;  4Z5T C;  5B24 A;  3AV2 A;  4J8W C;  3REH D;  5B40 C;  1P3F D;  2YFV B;  1A7W A;  4EO5 C;  4WU8 B;  3O62 A;  3REJ B;  1P3P C;  3AZJ A;  2F8N D;  5B1M A;  5B0Y A;  4ZUX B;  5CPJ D;  5JRG A;  1AOI A;  3X1T D;  2NZD A;  3UTB B;  3LJA A;  3UTA D;  1BH8 A;  3LZ0 D;  1P3B A;  3AZE B;  1P3K A;  2F8N G;  4WU9 B;  3X1U D;  3MVD C;  4G92 B;  5AVC A;  3AZH A;  2CWE A;  1P3I B;  3REL C;  3MNN C;  3VH6 T;  4J8V D;  3X1S A;  5B0Y C;  2Y2Q A;  5CP6 B;  1AOI C;  3REH B;  1KX4 D;  1P3F B;  2YFV A;  3MGQ C;  1P3B C;  4WU8 A;  4J8U D;  3C1C A;  5BT1 D;  3REJ A;  4X23 B;  5F99 D;  4LD9 C;  5CPJ B;  4ZUX A;  2BG1 A;  2Y2G A;  3UTA B;  3B6G C;  3UTB A;  3LZ0 B;  3AN2 D;  3AZF C;  3B6F D;  1BFM A;  4G91 C;  3X1S C;  4DRA A;  5E5A D;  3X1U B;  4E44 A;  5BNX B;  4WU9 A;  5B31 C;  4H9S A;  1P3I A;  3C1C C;  3A6N B;  4J8V B;  1KU5 A;  5CP6 A;  1P3G C;  5B2J A;  3AZM D;  1P3F A;  1P3O D;  5GT0 D;  4J8U B;  2FJ7 A;  5AY8 C;  3AZK C;  2NQB A;  4X23 A;  1ULY A;  5B40 D;  1EQZ C;  4NE5 A;  2VQR A;  1KX3 D;  4KGC A;  3UTA A;  3FDD A;  1P3M A;  5AVB D;  1ID3 B;  5AV8 B;  2CV5 B;  3X1U A;  5BNX A;  1F66 B;  1WWS A;  5B2J C;  2PYO B;  5JA4 A;  2FJ7 C;  5B24 D;  2NQB C;  2HIO C;  3F6T A;  4H9R B;  4J8X C;  3A6N A;  5AV5 C;  1P3A A;  1WWI A;  1HQ3 B;  3AZM B;  1P3O B;  3W99 B;  4KGC C;  4Z5T B;  3WTP C;  3AZJ D;  1P3M C;  4HGA B;  4J8W B;  5B1M D;  5B0Y D;  4J8U A;  5JRG D;  1AOI D;  2NZD D;  5B40 B;  3AYW C;  3LJA D;  4EO5 B;  3VH5 A;  1P3B D;  1KX5 A;  1P3P B;  5B32 C;  2J8P A;  1ID3 A;  3EG5 B;  5AV8 A;  5AVC D;  3AZH D;  4DRB A;  1P3A C;  2CV5 A;  1F66 A;  2PYO A;  3X1S D;  3MVD B;  1ZLA C;  2Y2L A;  1HQ3 A;  3REL B;  3MNN B;  2Y2N A;  4WU8 D;  1KX5 C;  3C1C D;  3W99 A;  3REJ D;  4Z5T A;  5B0Y B;  3H0R C;  5CPI A;  4J8W A;  1AOI B;  3LEL A;  2NZD B;  4ZUX D;  1P3G D;  3LJA B;  4JJN C;  3UTB D;  1BH8 B;  3B0D C;  3MGQ B;  1P3B B;  5BS7 C;  3AZK D;  1P3P A;  4LD9 B;  4WU9 D;  3AZN C;  4YS3 C;  3B6G B;  3AZG A;  1U35 C;  3REK C;  3EPH A;  3AZF B;  5C3I C;  4G91 B;  3X1S B;  4H9N A;  3W98 C;  5CPI C;  1H3O B;  3LEL C;  5CP6 D;  3MVD A;  3EPJ A;  5B2J D;  5B31 B;  3V9R B;  2FJ7 D;  2DF4 C;  3KWQ C;  3C1C B;  3REL A;  3MNN A;  2NQB D;  4J8X D;  4X23 D;  2HUE C;  2ZY5 A;  1P3G B;  1S32 A;  3AZG C;  4KGC D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...