2YG0A

Cbm62 from clostridium thermocellum xyl5a
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
139
structure length
139
Chain Sequence
b'YPKLTGTVIGTQGSWNNIGNTIHKAFDGDLNTFFDGPTANGCWLGLDFGEGVRNVITQIKFCPRSGYEQRMIGGIFQGANKEDFSDAVTLFTITSLPGSGTLTSVDVDNPTGFRYVRYLSPDGSNGNIAELQFFGTPAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBOHYDRATE BINDING FAMILY 6
molecule tags Sugar binding protein
source organism Clostridium thermocellum
publication title A Novel, Noncatalytic Carbohydrate-Binding Module Displays Specificity for Galactose-Containing Polysaccharides Through Calcium-Mediated Oligomerization.
pubmed doi rcsb
total genus 30
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2011-04-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2yg0A00
2VQTA 4QDSA 4JKMA 3HPNA 4JKKA 1GMMA 1W0NA 1XC6A 4BK5A 4IUGA 3FHAA 2Y6LA 3T2OA 2VR4A 2WQ8A 4TTGA 2WN2A 2ZEYA 2VZTA 2ORZA 3W5MA 4L0PA 4DXTA 4AAXA 1UXZA 2WDBA 2VO5A 1CIYA 3K77A 4PQQA 3HN3A 1UYXA 2Y8KA 3VDAA 3P6BA 2JE8A 2YFZA 2EIDA 1MPXA 3I2HA 2V72A 4CU7A 2VQUA 4LKSA 4A41A 3HOBA 2W87A 2WABA 2WO1A 5DMYA 3OGVA 2C26A 2QQMA 4KI5M 4CUBA 3WF2A 3LEGA 3OEAA 4JHZA 3VD3A 4CU9A 5LCWL 1K3IA 2VCBA 4XUTA 5EJZB 2VC9A 3ETPA 3WNLA 3AC0A 5JR2A 4ZZ5A 4OMCA 1GQPA 4A44A 4P02B 3C7OA 2E32A 1OD3A 1OT5A 3GDBA 1JYWA 3ZM8A 2ZEXA 4MADA 2YG0A 3JXSA 3CQOA 1W9SA 4ZXEA 4AG4A 2WUHA 3E1F1 3WF1A 2VMDA 1US2A 4MGSA 1EUUA 1JZ4A 2EIBA 1H6YA 3SKVA 2QQIA 5LA1A 3CMGA 2W1QA 2VZPA 1UXXX 2Y6HA 3IAPA 2V5DA 1SDDB 3ECQA 3LEKA 3OBAA 3WNPA 2BGPA 2VCAA 2VCCA 4BJ0A 2KD7A 3VD9A 3NQHA 3LPFA 3THDA 5FUIA 1D7PM 2RV9A 3UNPA 4DUWA 2Y64A 3WF0A 5HPOA 5I0DA 4A3ZA 3T0BA 3ACFA 4DEQA 1TVGA 3BN6A 2VM9A 5JXHA 1K45A 3I2FA 3U37A 3VD7A 2RVAA 1XNTA 1UYZA 4W4ZA 1JHJA 2XHNA 2W9XA 3THCA 4KWUA 1T2XA 3OG2A 2BBAA 1OH4A 1L7QA 5CYYA 2PQSA 4YPJA 2VZ3A 3WNOA 1UY0A 3WSOA 1SHWB 1YQ2A 1J83A 4ZY9A 3GM8A 1CZVA 1W8OA 4QX2A 4E8DA 1UZ0A 2WBKA 2VZSA 4M4RA 2W1UA 1JI6A 2VMEA 1DLCA 1GNYA 2ZEWA 1H6XA 2B9VA 4XUPA 4MOAA 1K42A 3DYPA 3P1IA 2WO3A 2J1TA 1DYOA 2VMCA 4ARXA 4XUQA 4BXSV 5J1XA 2VZUA 3C7GA 3PUIA 1O8SA 4QX0A 4ARYA 1XNAA 4OMDA 3UESA 1JZ7A 2ZXQA 4P08A 2VZQA 3MV01 2RJ2A 1GU3A 2YB7A 3VD5A 1UMHA 1LNSA 1P8JA 2WAAA 4RN5A 2VTFA 4OZOA 1CZSA 3ABZA 1GOHA 4XZUG 3ACIA 3C7HA 3T2PA 2J22A 1JZ2A 3NRUA 3K4ZA 2E26A 1JU3A 4JX0A 1IQDC 2X10A 3LE0A 2EIEA 4OYUA 2VL4A 1GUIA 3I2GA 4XUOA 4M4PA 1JZ8A 3CZUA 3MV11 3K4DA 3SEEA 1UWWA 2DDUA 1PMJX 5A1AA 2W47A 3A7QA 3C7EA 1NKGA 2XONA 3I2JA 4LPLA 4PF1A 4CUAA 4QX1A 5G04L 4QAWA 1F4HA 3MBWA 4DEVA 3T09A 2J1VA 4MGQA 5JXJA 1CX1A 2W46A 4D0QA 3SKJE 1NX9A 2JD9A 1WKYA 4GWIA 3A21A 4XUNA 1W9TA 3PUHA 2WAOA 4BDVB 4PT6A 2YC4A 3MO4A 2ID4A 4LHSA 3T08A 2ZEZA 2VZ1A 1K12A 3K46A 5IHRA 3A22A 1GOGA 1PX4A 1UYYA 3GXUA 2W1SA 2YFUA 3MUZ1 4GZ9A 4W50A 3WNKA 4QPWA 1UY2A 4QB6A 1R64A 5JXGA 4XVHA 3IB3A 2QQLA 2W5FA 5DN2A 2XQXA 1SG3A 1O59A 1UX7A 3DYOA 5JUVA 1OF3A 1JYNA 3WNMA 3T0AA 3HNMA 4QX3A 5IYYA 3D3AA 1KEXA 2X09A 3C8XA 1RYYA 2W94A 3GGLA 3T2QA 4BK4A 2W92A 3IDAA 3FL7A 3WF3A 1NUKA 2J1UA 5JMOA 1JYVA 3NJVA 4E8CA 3WQBA 4QDRA 1PMHX 3CKHA 5IFPA 4JKLA 4KMQA 2LW8A 3C7FA 3I2KA 1JU4A 2BGOA 3ACGA 4DXRA 5DQ0A 2HYXA 2W1WA 2WO2A 3HEIA 3CIHA 1NAEA 3OGSA 3DECA 5G05L 2JKXA 2Y6GA 4UOJA 4QB2A 4RYDA 4HG6B 3IIIA 2Z4FA 4DUVA 1UY3A 4QDQA 3LPGA 3DYMA 1JZ6A 1JZ3A 3I3EA 1DP0A 2BZDA 2E31A 2R7EB 5C71A 2VZRA 3VDCA 5JXIA 2X05A 3OEBA 1TG7A 1HN1A 3ACHA 3I2IA 3LEIA 2J1EA 1J84A 2C9KA 1W8NA 5HXMA 2EICA 1GOFA 2BERA 2VJXA 1JZ5A 2YC2A 4MO3M 2VMFA 3FHQA 3I3DA 2QQJA 2W3JA 1ULPA 1EUTA 3EYPA 2Y6KA 4CUCA 2DCJA 4A6OA 2LS6A 2VZVA 4ZZ8A 3SEPA 3T0DA 4DXSA 3FN9A 2V4VA 4XURA 5IJRA 1BHGA 1PX3A 1W99A 3CZJA 4LQRA 2QQKA 2HLEA 2QQOA 4D8MA 1KGYA 3NJXA 3OB8A 3WNNA 4A45A 4W8JA 3HJRA 4CU6A 3HNYM 3W5NA 2J1SA 3IAQA 4GWJA 3LQCA 3UETA 1OF4A 3VDBA 1I5PA 3VD4A 3WEZA 2J1RA 2W91A 5LA2A 3J7HA 1L7RA 4Z2AA 2WN3A 5F7UA 2C4XA 1UMIA 4UI9L 4FI9A 2B4KA 4P00B 5EJ1B 3F2ZA 3HNBM 3CDZB 5LA0A 2ORXA 2CDPA 2J7MA 2VZOA 1XPWA 4CU8A 1O8PA 4OUEA 4UAPA 2JDAA 1UY4A 5B4NA 2WZ8A 5B4XA 1US3A 4A4AA 5CZKA 2E33A 4CVUA 1CZTA 3K75B 3I3BA 1F4AA 1WCQA 3I97A 1ULOA 3BGAA 4P5YA 1JYXA 2VOTA 2WYSA 2Y6JA 4A42A 5DPNA 1UY1A 2W95A 4ET7A 5IFTA 3A23A 2J1AA 2OKXA 2QBXA 3OGRA 2WZEA 2QQNA 4TXWA 1W9WA 2XOMA 3WF4A 3NNGA 5C70A 5C7GA 2CDOA 3MUY1 3EB7A 2L9LA 2DCKA 4DUXA 3K4AA 5EIYB 4QB1A
chains in the Genus database with same CATH superfamily
2AR6A 5DUWA 1V9U3 3KVAA 3BTXA 3H9AA 5IVVA 1EPZA 2W2IA 3OBRA 2BVBA 4P9IA 5JLVA 4PLNA 5FYIA 1FYUA 2B46X 3PVNA 3RYKA 3O1RA 1NA1B 2O1QA 4N9IA 2G9ZA 3SCHA 4AFCA 1W0NA 5FZHA 2WIIB 1XE8A 1PVC3 1RUE3 2OX0A 2RS53 2YBPA 4IUGA 1VRH2 4YVSB 4RFRB 1VBD2 3AYDA 3U78A 1EV12 2WQ8A 3SXWA 4BHPA 1CAXB 1CAWB 4LULA 5K7PA 4XBQA 5H9RA 1YEWA 3ZKYA 4L0PA 1OOPB 4LEJA 1UXZA 5DUUA 1HW5A 4Y1XA 4CP9B 5BNPB 4NAMA 4L97A 3T2TA 3POYA 3K77A 1UYXA 2Y34A 4XF0A 3MPBA 1IPKA 3MLJA 3N36A 3P6BA 4WV8A 5KXEA 3JZVA 4OHYA 4YM2A 2WLPA 4YW5A 1BCXA 5CIRA 1JBCA 3KF5A 5BNNB 1JHNA 2VQUA 4FP3A 1ZREA 4HXCA 5A80A 1QIQA 4FPEA 3IWZA 5FK8A 4BLJA 2QZ2A 2WZR3 4LBQB 2WO1A 4A7KA 3BTAA 3OBTA 1PK6A 3ORJA 1E5RA 4YZ3A 3DN7A 4CEYC 4QPIC 3VN4A 4HSJA 4EJRA 4FOWA 5F3CA 4BYYA 1G8WA 2WO7A 1QWRA 2BJSA 3KQ4B 2ET7A 1Y7BA 5E6HA 2D6OX 1PVXA 4QX5A 4GWNA 4LOSA 1AX1A 5FYUA 4CUGA 5IK8A 5EJZB 1AR92 2WT2A 4CCMA 4JHTA 2JB8A 2E6VA 2VC9A 1HKDA 1H2LA 2D6PA 5FO9B 3SMHA 4AEDB 1RUD2 1AHSA 2DCZA 5C33A 5A6XA 1PO23 4XQWA 4CXWA 5F5QA 4A44A 2RS12 4G9SB 2NPIA 3TN93 3J8F1 4YLZA 3AMMA 2E32A 1OT5A 3C7OA 5APAA 3JUUA 3FZ3A 2YG0A 2Q1ZB 4IEVA 1PO21 3S0MA 2HJIA 3E5UA 2JKBA 4B1MA 2FQPA 3OTFA 2WNEA 1V6NA 4ZXEA 4AG4A 2ZGQA 4XDOA 4URAA 2R0HA 5FKCA 4QGMA 2D98A 3H7JA 1CAWA 3WQ0A 3O1MA 4L9BA 1PVC2 4P9GA 2HEWF 4AE2A 1GNHA 1H6YA 2A5ZA 3VZLA 5LA1A 1LOCA 3P3NA 3CMGA 3H1YA 4UFLA 3PHMA 1QGLA 2Y6HA 4NRPA 3LEKA 1CVNA 1D0HA 2WC2A 5FMCA 5HCFA 1ZX5A 1RUI2 3BU0A 3NWKA 1GWMA 4PI2A 5IUQA 4AZZA 3IMNA 2KA3A 1GANA 1KQRA 2VCCA 1FAYA 4BJ0A 1H8TA 1JUHA 1STMA 1OQDA 4N9HA 1NQJA 3VD9A 2ZHNA 1ZM1A 3JD72 4YW4A 3MDPA 4YW3A 5T5OA 3BCWA 1Q8QA 3THDA 3MIHA 4YZ1A 1C3HA 1A6CA 2VTXA 4JAAA 4Q4W3 3VHNA 1O3QA 2HWD2 1YQ5A 1H8VA 4XILA 1ZZCA 3WF0A 4A3ZA 4DEQA 3ACFA 4EN6B 1RMU1 2R30A 4FTEA 1XSRA 1TVGA 3WDXA 1BYHA 4AHZA 1SCSA 4DS0A 5JXHA 1W6OB 3WX5A 3VD7A 3SLIA 4ET7A 4Q2FA 5EYYA 3CU7A 4P9YA 4ASLA 2W9XA 3RRDA 5HI0A 4XAAA 3WG4A 3THCA 1FXZA 2ETEA 3ZDVA 3USUB 4QMAA 4Q4X1 3LZZA 1IPSA 3AKSA 3ROUA 3QBQA 3ZMNA 1QH6A 2WRAA 2QQVA 3RNSA 3DCQA 2HWC2 2V73A 3DV8A 4Q4Y3 3TNQA 3WUDA 1NXD1 5K0UC 1AX2A 2VZ3A 3WG1A 1R093 2TEPA 4C1WA 4KU7A 1TZOA 3WV6A 4HKWA 2WS93 5TSWA 2XUEA 2EALA 4KBZA 4MGYE 4UBGA 1OXCA 1FPN3 1JTZX 3U10A 4S2DA 1W6PA 2Q4SA 1MZFA 5JMCA 1W8OA 4QX2A 1FNZA 1PM7A 4ISRA 1X9TA 2NMOA 4M4RA 1HB2A 2W1UA 1JI6A 3ZR6A 4COVA 1UZVA 1C4RA 1DLCA 1FPN1 3ZOIA 2A7AA 2TBVA 4Y4YA 1LB2A 1GZTA 3ZFFC 5FXXA 1R1A1 1H6XA 2R6QA 2B9VA 3GJBA 2DU1A 1SACA 2V09A 3T3YA 1AR83 4MXWA 3UKNA 4WM8B 4UFKA 2K46A 1MZEA 5D8AB 4QD2A 1DYOA 2VMCA 2XMLA 2ZJCA 4WBBA 4XUQA 5T54A 4ARXA 1QOTA 2PYTA 2B45X 3BOWA 3C7GA 1Q3EA 2PHFA 3TOJA 3FLTA 2YDEA 4S2FA 2BUKA 1AXZA 1COV3 5T3NA 4DXZA 1O3SA 1JZ7A 1RUJ1 4Q29A 1PZ7A 1PIV1 3D8CA 2YY1A 5ANQA 3S6PA 3VDDC 1QJX1 1PGW1 2ARCA 5DZGA 4EWEA 1GU3A 1UMHA 2BP6A 3IM0A 1PZ8A 4GH4A 5A3LA 2FCTA 1LNSA 4YGCA 4CXXA 4D3WA 1VR3A 1OC1A 4XBNA 3RGBA 4E2SA 4XJAA 2VUDA 2Q5TA 3AP4A 5FYBA 4EZ4A 1PGW2 4XCBA 4Y3OA 1W6QA 2VTFA 3IKWA 1BBT1 1KFUL 1VB4A 3ABZA 3FUOA 4XMIA 3ZXFA 1ZZBA 1FOD2 1VB2A 3POFA 4XZUG 1DGRN 1RHI3 3C7HA 4A2UA 2ZA9A 3NRUA 1VRH3 2EAAA 2O0OA 2R061 3KS7A 4NOTA 1URXA 2J42A 5KHJA 3RSJA 4XMAA 3HVDA 5C5TA 2RR12 1CX4A 3LKJA 2WFF1 1R083 1M4WA 1W9FA 1AYM2 1SDWA 3LA7A 4QPIA 3RFRA 5A3TA 3BPSA 2LM3A 3N35A 2ZZJA 3CO2A 3BIWE 1GWKA 1S2KA 1TMF2 2XL9A 4HMZA 3UGGA 3UYJA 5FZDA 3WZ1A 4OZXA 1Q43A 3K4DA 3VUOA 5CADA 1HV1A 2BWAA 5B2GB 1SPPB 2Q0AA 4CDWC 1ZRFA 4MGZE 3I2JA 3IDEA 4PF1A 1GP4A 1DQ5A 1OPOA 4Y5Z0 2IFRA 4DEVA 4RGGA 5H9PA 4KH9A 1MS4A 2GALA 4H7LA 2XJSA 1AYM1 1WCKA 3I4IA 3BU7A 3QOPA 5DZFA 2H0BA 2ZGTA 5LA9A 4Q4Y2 1Z7S2 4AQ2A 3DXUA 4PT6A 4AEKA 4BDVB 5K8SA 3B02A 4LHSA 2QTWB 1DQ0A 5FZAA 4V1PA 3K46A 4WVWA 4YARA 2VNRA 3VHPA 1X7NA 2JG9B 4Q4V1 3WCSA 2B39A 5EHDA 3R0RA 1Z7S1 2ZGNA 1GOGA 2RDQA 2RS32 3PNAA 4W50A 3C2UA 3MUZ1 1MQTB 4YWAA 5AVPA 3AP7A 1W2NA 3NVCA 1VBA3 5IK4A 4LKDA 3H8OA 2BOIA 3KM5A 4LE3A 5JXGA 1C1LA 1NLSA 2AC1A 5A6YA 3RZLA 2QKDA 5CKNA 3IB3A 2X29A 1OURA 3VBRA 5JI9A 1N3QA 5DN2A 3O7OA 2P17A 2FZ2A 4XJ9A 1SG3A 1POV1 1HRV2 2CHHA 4NWWA 1S4CA 1C8M2 1NLQA 1OF3A 1ST8A 2XL7A 3ATGA 4JZRA 3NAPC 4XZPA 5EQUA 3CJIC 3HN1A 5HXMA 4IV1A 2GAUA 2X8KA 1VAMA 4YZ2A 4B4QA 3AMQA 3OY8B 1HRV3 1KEXA 1WLWA 3JCIA 1RYYA 5DAWA 1ASJ3 5A3WA 3VDDA 3GGLA 1OFNA 3ON7A 5FYTA 4BK4A 4LBJA 2W92A 4GD4A 3UGFA 2DVBA 1SEFA 4LNVA 3WF3A 5A33B 2F4LA 4GAZA 4MYEA 2J1UA 4QKBA 5JMOA 1O4YA 4YM3A 4FTSA 3MIDA 3ZN4A 2ZGSA 1IGOA 1RUG3 4Q27A 5IAXA 2BFUL 3E6CC 4CDUC 3PUQA 5FMBA 5CFCA 5IFPA 1A78A 3LA2A 4IQPA 1NZCA 3VKOA 1OA3A 1N3OA 2TNFA 4N43A 1NCQA 3B5LB 1SPPA 1UOJA 3INAA 4P5HA 1WCDJ 1C28A 1S0CA 3PIGA 4XBLA 2VBDA 4O7XA 4GJZA 4EZHA 2G9FA 3ZYIB 1EAH3 1LR5A 3AZVA 3O0XA 1SLCA 5D1IA 3QH7A 1ZRIA 1PHMA 2Q8OA 1DYKA 2JX9A 4LUKA 2ADDA 2B9UA 4DXRA 1AJKA 1AXYA 5FZ8A 2WO2A 4CDXA 1VBC3 3CIHA 5G05L 1YHFA 3OGSA 1AR81 4XPVA 2Y6GA 3NV2A 4QB2A 5EPAA 4RYDA 2XDVA 3WDTA 4LR4A 1O3RA 2Z4FA 1E57A 2RJKA 5FYSA 4BQ4A 2PLV1 3WDUA 1UY3A 4QDQA 4B7KA 5FPUA 2JDNA 3I2DA 3RS6A 4XC9A 3DYMA 1JZ3A 5C71A 1R081 3VDCA 5GM0A 3MIEA 3THTA 2XBO2 1Y9QA 4XTMA 1Z0HA 3OEBA 2B8MA 1HN1A 4E9KA 3I7DA 2BNNA 1GNZA 1W8UA 2C9KA 2BNMA 4J1XA 1W03A 4RD7A 4RQPC 5J09A 2SLIA 3RJ2X 1QJZA 1GOFA 3DGTA 3ME2A 1JZ5A 2DFBA 4CDQC 1XE0A 2CV6A 1K5MC 5BNOC 1FOD3 1J3PA 2ZX3A 3AYEA 3WP6A 2XJRA 1NA1A 3FHQA 2QQJA 2PFWA 3Q8CA 1ULPA 4YW7A 2IXIA 2RDSA 4QXBA 4OHZA 2G19A 4Z07A 2VUCA 5KXCA 1VMHA 1XE7A 2Z2SB 4GMP0 1LRHA 1WMFA 2HWE1 4A6OA 3MGUA 4NROA 5T55A 4XEZA 4H3WA 3WY6A 5I0RA 3FN9A 3SHRA 1WW6A 4YGEA 3MZHA 1HB4A 4TLFA 4PDWB 1TME2 4D7TA 1BHGA 1CAUB 4RS5C 4Y22B 1W99A 3AXEA 4GB32 4GMP1 3RI8A 5ABJA 5FWJA 4NUBA 4EQVA 1JH5A 1MEC3 4Q4W1 1AR61 3NJXA 4A6SA 2ARAA 1W8WA 3OB8A 3WNNA 4C90A 4XIOA 2B7YA 1G7YA 1DQ6A 4ZHNA 2WNVC 4KL1A 2R072 3HNYM 5EWSA 2HWE2 1LOFC 3A0NA 5FYHA 3VZOA 3NV1A 5T52A 2XLFA 4PLMA 4DOUA 4UT5A 2J1SA 4G4FA 1C5IA 2ZAHA 1PO12 4KQ7A 4IGOA 4NAOA 3VDBA 1N1SA 3OPWA 3WEZA 1GZCA 4Q0SA 2W91A 4FPHA 5LA2A 3J7HA 2OVUA 4Z2AA 1BMV1 1ZA4A 2FHRA 1FX5A 4K8FA 5DDJ2 1Y3TA 1HXS1 2E53A 4LO4B 4XFBA 4P00B 3HNBM 3VBUC 4M3CF 4E4DX 1HDKA 2UWBA 4HOOA 3VKFC 2VBBA 3ACLA 5HBAA 2J7MA 1EAH1 1O8PA 3VV1A 3PIJA 2A75A 4WVMA 4Y24A 4LO5B 4C0BA 4Q4X3 3O1UA 4FPCA 4LBKA 1QQP3 5DUXA 1CJPA 5F6KA 3RWKX 1K5MA 4K8RB 1SLBA 1RITA 1UF2C 5ISLA 3OPTA 2UWAA 3V64A 1J3RA 1OLRA 4JRLA 3O0WA 3T4HB 3VKLA 4H55A 5C4WB 2VNGA 2XH6A 5ABJC 4WM7C 3I3BA 4IESA 1WCQA 5C8WA 1AL23 5KWRA 1ULOA 2R071 4P5YA 3AM2A 3AMNA 2OZ6A 4MX3A 4GB31 4MLOA 2P3YA 5DDJ3 3EHKA 3FFQA 5A3OA 3IPVB 2JDZA 2Y6JA 2E7QA 1UY1A 2W95A 1H8TC 2HEVF 1MS5A 4P14A 4RR3A 4R8HA 2HYKA 4XJWA 5FJHA 3LF7A 1OI6A 4AVAA 1UQXA 4Q8LA 2PHWA 4C1XA 1UKGA 5FBJA 1IG0A 3OGRA 4LO8A 2WJSA 2WZEA 4TXWA 3RWNA 3WF4A 1RMU2 3B9IA 2E63A 4Y1VA 1W8TA 5FMOS 3EB7A 3FLPA 3W9AA 1HXS2 5C9AC 3RZMA 1R092 3RZHA 3M3OA 2ZACA 4QB1A 2VQTA 3K51A 2BQPA 4D6SA 2EXHA 3IT8A 1WUVA 3IDBB 3ILRA 4Y1UA 4JKKA 5LK7B 4MGKE 2A6YA 4QHOA 2ERFA 4I02A 1QJFA 1JS9A 1UZZA 5HCBA 2OIIA 3ZXGA 2QNKA 1TME3 5JI7A 1ZZ7A 2DYCA 2JDHA 3B93A 1MS0A 2OQ6A 4LLOA 4PJYA 3ZIXA 4BCUA 1QH7A 3N7MA 4CPBA 2ORZA 4XHXA 4CP1A 3CJIA 4LXLA 1LGCA 4AAXA 4I01A 4NN0A 4SBVA 1W04A 2CNAA 2VD7A 3I3QA 5LK5A 1PNFA 2VO5A 1CIYA 2CGNA 3HN3A 3GCWA 4BB3A 3ZFEA 1YI9A 2JE8A 5FPXA 2YFZA 4QPIB 2GNBA 1RUD3 2W0XA 4IGPA 4IGQA 5D21A 2V72A 2ZGUA 4A41A 1VLNA 4RGAA 4CRQA 1ZBE2 2JDUA 1ND3A 3R05A 5DMYA 1GZWB 5I8TA 3OGVA 2EF6A 1L7LA 2Z69A 3V0BB 3PVOA 2RM21 2FMDA 1N3PA 5AVAA 1NOVA 3UJOA 4NHYA 3WP5A 1GLHA 2WZPP 4EWDA 1S0FA 2QQMA 3K2OA 3USUA 2P3IA 1G9CA 5C3OA 3JQWA 2ZOEB 3WF2A 3URFA 3OEAA 1C1FA 3WNXA 4K21A 3S30A 3VD3A 2MEV2 2DUPA 2P6CA 3CJXA 5DAPA 1MS1A 2DUOA 1S1AA 3KHCA 2VCBA 4XUTA 3D82A 2YU2A 4LOTA 1H4GA 4AK3A 1HN0A 3AC0A 2JG9A 2Y26A 5JOWA 1L3JA 4OQ8A 1S2EA 2R32A 3VBOC 4P02B 1DZQA 3LOBA 4GALA 4EN8B 1CPNA 3ZM8A 4N8MA 5SV8A 2PHLA 4ARYA 3KGLA 3GJAA 3CQOA 2MEV1 2AZ5A 1RUH2 4GXLA 4TYSA 1BEV1 2GDFA 5JCTA 2PXJA 5FPVA 4N7UA 1XRUA 4P9JA 2WKKA 5FYCA 3WF1A 2XB6C 3GHNA 2BW8A 4DNYA 1DGRA 1SCRA 1GP5A 4FAHA 4YW2A 2RS31 4OFGA 5C3PA 1DG6A 1EUUA 3LOIA 1J1TA 4QM8A 5CFDC 4JGZC 4Z82A 2WL1A 2YYOA 3TEWA 1NYWA 1QJX2 2MHFA 2W1QA 2VTXJ 4EV0A 3NNLA 1UXXX 2ZBJA 1ZRDA 1S2BA 3ECQA 2UURA 2W08A 3DPRA 3WNPA 4NPLA 5DG2A 3S5AA 4BQ3A 3D4KA 4S2HA 3H1WA 3MICA 2OXBA 5A1FA 3I54A 2FCUA 2VNVA 3AKTA 3NKTA 3LPFA 5FUIA 4UXAA 1LHWA 4DUWA 1W05A 1KS4A 5FP3A 1HRV1 5F6LB 3VBSB 2HWB2 2GP5A 3ZXKA 1Y43B 4YW6A 3I2FA 3U37A 3GZTB 4DZGA 5I8YA 1FV2A 5K0UB 2RVAA 4Y22A 3PVEA 4AI8A 3WHUA 3FBYA 3GYDA 3SH4A 4FSJA 4W4ZA 1JHJA 3ZXJA 5IVCA 1AXKA 4HBNA 3U11A 1NCRB 4KWUA 5IVJA 2DCTA 5FZGA 5KXDA 1UYPA 1OPMA 5C9AA 4XQDA 1W2OA 1TEIA 5CYYA 1FV3A 1AR82 1RXGA 1VBD3 1WMDA 4CCOA 3ZFFA 2CWMA 4LBQA 4Z8BA 5FTTC 3R6SA 4AAPA 5LZ6A 1UY0A 4AVTA 2ENRA 4ZU4A 3WSOA 2A3WA 1LOAA 1WD4A 1YQ2A 4AVSA 5KHKA 1VJ2A 2WT0A 4IEQA 4Y20A 3WW1A 3WDWA 3HT1A 3PMEA 2JG8A 4Y26A 4OHWA 4XF9A 4BWOA 3NV3A 1W2AX 2D3SA 1NA1C 3WINE 5A6QA 5FMDA 2VMEA 2WZR2 1VRH1 5FZ4A 2ZEWA 1OKOA 5LW9A 4B8EA 2QUOA 3M7AA 3AK0A 4MOAA 2PELA 3VDDB 4BQ1A 4NRMA 4B3NA 1OOPC 1V6KA 2DUQA 2VULA 4JTOA 1TE1B 2QQUA 4UBHA 2H6BA 2W39A 1JOBA 1LEDA 3PJYA 5BNPC 2DFCA 2Y0IA 3FE5A 4IV3C 4J25A 5GJ6A 1UO9A 2JIGA 1C8M1 1CAVA 2VVDA 4UFJA 1XNAA 1DQ2A 4XJ8A 3LD8A 1QJY1 3IIAA 4P08A 3OGGA 1C5HA 2VZQA 2LTNA 1PIV3 4QX7A 2WZR1 3MIGA 2JE7A 4BXFA 2VW0A 1MVEA 2YB7A 3VD5A 3PU3A 3NL1A 1H2MA 2XR4A 2C24A 2WNOA 1Z78A 3IPVA 4Q0QA 3VBHB 3X29B 3LFIA 4NIGA 2ZABA 1AR63 4CXYA 5KHGA 1REDA 1BK1A 4IEXA 4AL9A 4AVCA 4CDXC 3RYPA 4CEYB 3JB8A 1LGBA 1CZSA 1RUF3 2WWJA 1IZ3A 1YQ8A 4JTNA 5CKMA 1R082 5FZ1A 3VZKA 3ACIA 3T2PA 5FZBA 2E26A 1BKZA 1IQDC 2X5IB 4AHYA 3U0ZA 1QDCA 5L7OA 4QXHA 4CDWB 3E6BA 4N43C 3U07A 3VB9A 2EIEA 2R1DA 1YJKA 2WFF3 3GBFA 5FUPA 4NIDA 4BQ2A 2RE9A 4PIZA 4NVPA 2BBVA 4PBPA 2VL4A 1GUIA 2H6CA 1SMVA 4AEDC 5FMOL 4OUSA 4XACA 1F5FA 1UWWA 4CA9A 2YHJA 2DVAA 3TYJA 5A1AA 3HQRA 4CP2A 1JN2P 4HPKA 1E5SA 3FHIB 5JSRA 3S5QA 4LPLA 4QKDA 3HT2A 4CUAA 4I0WB 1LOEA 1ZBA1 5G04L 5F2WA 1VPHA 5J3UA 3MBWA 3T09A 4DRVA 3POJA 3BTYA 3KCYA 5JXJA 2VXJA 1LCLA 1NX9A 2JD9A 3MEPA 4MV2A 4COYA 4BU2A 1QXRA 2P3KA 4NE9A 1W9TA 4IW3A 1IHMA 1KJLA 2YC4A 3T08A 4COWA 1U5YA 3DUIA 5LBFA 1LJ7A 2JECA 5KHHA 1I6XA 4CSWA 3PUAA 1QF3A 4CP0A 4YSFA 2FD8A 2D44A 3A22A 3BI3A 1O4ZA 1UYYA 4Q0UA 2YFUA 4Q1RA 4GA9A 1DGLA 3ITQA 4IDZA 3NAPB 3WNKA 1UY2A 1V9U1 2KR2A 5T5PA 2XVGA 2HWD3 1O6UA 1JYTA 5FDBA 4HLTA 3HAGA 3MLLA 4N90A 5FFOC 1KFXL 3VBOA 2ZCWA 3POGA 3H50A 1FI2A 5A7QA 5F9TA 4XF3A 1O59A 1E5IA 3DYOA 2LALA 1PK6B 2VXRA 5FUNA 4ZU7A 2X53S 2GN7A 5DUVA 4OHVA 3WNMA 3T0AA 2IXLA 1VBE3 1VRBA 3AP9A 5GLVA 2ZMLA 1POQA 2I74A 2NQYA 1PGSA 2X09A 5FZOA 3BALA 2IZWA 3C8XA 4LE4A 1G9DA 1ASJ1 3JD71 4Q4X2 2D5FA 3ZYFA 3H3UA 1NY72 4QKNA 4I3PA 2NLRA 2ZGMA 3UKVA 3FL7A 1CN1A 2OT7A 3TRSB 1APNA 3L9JT 4OLLA 4CTEA 4IEYA 3H1MA 1NE4A 5ACA1 3NO8A 4E8CA 5FPLA 4GH4B 4UW3A 4NJ4A 1PMHX 1EV13 1VMFA 4KMQA 2VMHA 5LWBA 3M3QA 1QEXA 4MGTA 4AFMA 2YPDA 4WZFA 4NIHA 1OD5A 5ACA2 3NJZA 2IC1A 4FXGB 4PLOA 4GWMA 4HVRA 2BGOA 4P9WA 5EFUA 2RS13 2VNOA 2VW1A 2WQZC 4OI0A 1SLAA 4FPYA 4FXKB 2Y0OA 2FDJA 3GZEA 1M06G 1VAKA 3VL9A 3HEIA 4AR2A 3DECA 2IFWA 3VBUA 4UOJA 2ZHMA 3AFKA 5AC92 2ZX2A 2RS11 2NYYA 2X5IA 4HG6B 5FY7A 3IIIA 3RMYA 4NPRA 3VBRC 1RINA 1V70A 4DUVA 3JU9A 1ENQA 4RQPB 3MI8A 1WLTA 3PUSA 4HSLA 3LPGA 4V2WA 4YVWC 4AEDA 4XF1A 4U36A 1OA4A 3I3EA 4RR3B 1W6QB 2BZDA 2WT1A 4WM8C 1I9RA 5D8AC 5ABJB 3EBRA 1A8MA 3GHMA 1OVPA 2X05A 5GKAC 1K5MB 1TG7A 4PF5A 2BPA2 2ZTNA 1H1IA 3O14A 4UWDA 3ZSJA 5ACA3 5AFEA 1MR5A 5A7PA 2HWF2 2W52A 3T4VA 1O7FA 2XKOA 1KXGA 4XJZA 4FP2A 1W8NA 1WW7A 2Y60A 4QKFA 3BB6A 2EICA 2WSUA 3ZMOA 4XABA 4FPLA 2AREA 1SFNA 4MO3M 2XLAA 4LIVA 5A7SA 2FDGA 1Z7S3 5FXVA 5FY0A 1RUH1 3POEA 2WNUB 1RUJ2 1CPMA 4FFFA 5FREA 3OYWA 5BXXA 1UZWA 2AH2A 3UV9A 4GQ7A 1RUI1 2WWUA 3I3DA 4HKOA 2GC2A 1V0AA 2BYVE 4HANA 4I0BA 1OHFA 2BGCA 4CDWA 5AFBA 3WG2A 2VZVA 1QJU3 3SEPA 3JBG3 5FO7B 4CCLA 4ZZ8A 4V2VA 2WNVB 2VOVA 4R52A 4X6QB 1T6BX 2BWCA 4FFIA 3KWVA 5IJRA 1GQGA 5LATA 1BBT2 1ND2B 1PX3A 3AKQA 2LROA 3ZSKA 1ZBA2 1ENRA 3O5SA 2SBAA 1ONAA 4IEWA 1REEA 4M0NA 4CEWA 5JZGB 1IQAA 2ES3A 1UOFA 3OUIA 1O5LA 3KSCA 4W8JA 3HJRA 4AW7A 3ZO0B 1V6JA 4FPOB 1Q8VA 1UU6A 1WLDA 3KD4A 1B35C 2DF7A 4W6WA 1ZZ6A 4GWJA 3LQCA 1ULEA 1OF4A 2JG8C 4IE6A 3T1LA 3VBUB 3SNMA 5A7OA 2ILMA 3FLRA 3S57A 2J1RA 1OBNA 4B1LA 4AQTA 5E88A 3ZYRA 4EN0A 1L7RA 4AFDA 1W28A 1S0GA 3POWA 4XOGA 4INDA 5D2AA 2F6BA 4UI9L 3AKPA 3M3CA 5EZWA 2B4KA 2F17A 3ZFEB 1QQP2 2VVEA 3F2ZA 5LA0A 3CDZB 4F7ZA 2ORXA 2CDPA 5E8AA 5IW0A 5C4WC 2IUWA 2JG9C 2XVLA 2VGDA 1IS3A 3M1HA 3VBHA 4CU8A 2IVJA 4OUEA 4WM7B 4K1YA 4AGRA 1LODA 3ZPOA 4MXVA 2PTMA 1C8NA 2WINB 5LRRA 3V0AB 2WZ8A 4PIYA 2JD4A 1US3A 4A4AA 4AFBA 5CZKA 3BTZA 4RGKA 3T30A 3K48A 3O1OA 2Y33A 3N7KA 1HB1A 1XB9A 3Q8EA 4NHXA 5L7OB 1F4AA 2K0GA 4AQ6A 2Z5WA 1VBB2 1ND3C 1J1LA 2RR13 2D97A 1HV0A 3TBDA 3OJBA 3MLKA 4MGIE 4OCTA 3WP3A 1JYXA 1XBFA 1OLQA 2WYSA 2Q8DA 4M01A 2Q1FA 4OI2A 3CNAA 5DPNA 3VBFB 5IFTA 5FZKA 1G9AA 1AL22 3RZGA 2UWCA 4IE4A 3RZZA 2A71A 4NIAA 1OKQA 4AVVA 3DXTA 3J8F3 5T50A 1SQ4A 2EA7A 2QBXA 3KQRA 3NAPA 2HBTA 2QQNA 3RPQA 4N53B 1W9WA 5FAXA 1B09A 1N47A 3NNGA 4FPGA 1ENSA 1RC6A 3MUY1 2NM1A 3D0SA 4DUXA 2XPJA 1AR72 5EIYB 5CAZA 4CYDA 1J3QA 3LIHA 4MZUA 4BM8A 5FXZA 4CPBD 5FLHA 1ULGA 4QDSA 2WNUA 5FPAA 3HPNA 5CVRA 4O9GA 4QWNA 2GC0A 1AR73 3TN92 3THPA 4BK5A 3O1VA 3FHAA 4LBOA 4RHV2 4RFT0 1DCSA 1NE6A 5F32A 5A32B 1H9WA 4TTGA 1MZ6A 1XNDA 2C0ZA 2GH8A 2VZTA 3KLSA 4EN7B 2YGMA 2JEMA 4IETA 1QJY3 4S2GA 2PLV2 1YI7A 1ND2A 4IE7A 1BQPA 1Q8SA 4JDOA 2Q30A 4BPZA 1RUF1 2GNTA 3RZKA 3G7DA 1QJY2 4TSVA 4X8PA 4L99A 1WA4A 3QCWA 1D0GA 5A33A 1W8ZA 1VBB3 2DTYA 2EIDA 1IG3A 2MNGA 1MPXA 3OOXA 5JDBA 3BUCA 2GN3A 4W6XA 2FDHA 1GICA 2VCMA 3HOBA 3N9OA 1NY71 2OPWA 1N1YA 3BVCA 3PU8A 5F3IA 2VOXA 1UKRA 5CFCC 2ZGOA 2GMEA 3RMXA 4ATEA 5JPMB 3H0OA 4XYXA 4CDQB 2C26A 4LTAA 2JB4A 5GLWA 3J4UH 2JDPA 4TLGA 5F2SA 3WXPA 1AR91 3ZN6B 4KI5M 4CUBA 3TB0A 1W0OA 4FQZA 3ZN6A 3UGHA 2JICA 3E5QA 4JHZA 4CU9A 5LCWL 1ZYBA 4M3CB 5FKBA 1AL21 2Z42A 4AI9A 5FYYA 3WOGA 3WHTA 4LA3A 3H8RA 4L11A 4IV1C 4JC1A 3ETPA 1EP0A 1OLMA 1VBD1 2HWB3 4PDWC 1HQLA 1XNKA 4ZZ5A 1ZZ8A 2LUWA 4F83A 4XETA 4OMCA 1GQPA 2WYFA 3KCCA 5FIXA 4JRAA 5HXVA 1LHNA 3BIEA 1HQNA 2P4EA 1JYWA 3GDBA 1DZRA 1UU4A 4YRDA 3ZXDA 2ZEXA 3LCPA 3VL8A 3JXSA 5I93A 1RUF2 3PDQA 1MZ5A 5F8PA 3H3ZA 1H4HA 5IVYA 3PJQA 5L9BA 1W9SA 1CWPA 4DRRA 1RTVA 1VIWB 1BBT3 3E1F1 1RVF3 2JDKA 2UY8A 3AKRA 1JZ8A 1LULA 1US2A 3T1MA 2XWBB 3WR0A 4R9DA 2G4IA 1FPN2 2WFPA 2WNVA 2EIBA 5A6ZA 1BMV2 1U5ZA 1S0BA 3SKVA 4AQSA 2VZPA 3H3LA 1CAVB 1YIFA 3IAPA 2V5DA 1SDDB 3NNJA 4EE2A 4HKLA 2OUJA 2BGPA 3EXUA 5FZCA 3G6JB 1RUE1 2PAMA 2RS51 2VCAA 4I2OA 4FTBA 1X50A 3AZXA 1IS5A 3NQHA 5LY2A 1D7PM 2RV9A 3NSTA 4LK6A 3EQEA 2Y64A 5LBCA 5I0DA 4KG8A 2WWSA 2HWC1 1XNCA 2P34A 1NCRC 5A7WA 2BOJA 4GMP3 2CGPA 1NZIA 1OFSA 4ES9A 3LWCA 1OOPA 5LBBA 5HCHA 3OF1A 3GBGA 5F3EA 4FPJA 3NNMA 1YQCA 2YXSA 4IE5A 1LHUA 1XNTA 1AUYA 1W6MA 3B3QE 5BV6A 1UYZA 4JGYB 4DO0A 3Q9OA 1O5UA 1QJX3 1X8EA 1GYKA 2IXHA 2ZX4A 5HV4A 1HRI2 1H1MA 1F8VA 5J7MA 4Y1YA 1ZVFA 4XF4A 2BBAA 5LBEA 1U0AA 3WD5A 2XBO3 1GBGA 5CB7A 4FOYA 4E27A 2BDRA 2D40A 2PQSA 1QOOA 2VH9A 2OYZA 4AVBA 2RR11 2F4PA 1PGL1 1D4M3 1ZBE1 3KV6A 3WNOA 5GZDA 2VPVA 1ZBE3 3N7JA 1YFUA 4P9XA 1NCRA 4QM9A 5J98B 3WVJA 1QMJA 1FMD2 1GFF2 5C9AB 5JSPA 3HQUA 4YZ4A 5JSOA 1BVP1 4ZY9A 3GM8A 2A6XA 3JBG1 5FZ3A 2P1BA 5F3GA 1CZVA 2QFEA 1RUC2 3BOPA 2ZGPA 2WBKA 1TME1 3FC0A 4GKYA 2HWF1 2VZSA 3E97A 3N9MA 3B69A 2WQ4A 3AYAA 3HMYA 3KF3A 4NHKA 2DVGA 5FY5A 2UY9A 3ES4A 3H7YA 4KWJA 2VVFA 2B5HA 3KV4A 4QXCA 3LA3A 1LHOA 5FBZA 1K42A 3DYPA 4HZFA 4R4XA 5FOJB 2V4AA 3MW4A 1WBFA 2BV4A 4O9EA 3VBHC 1W6NA 1I1EA 3KT7A 2O14A 1WWYA 2VZUA 3POIA 2MEV3 3OY8A 4H2AA 5C4WA 4UW6A 5DXDA 4OMDA 3UESA 1YLLA 2ZGKA 3Q8AA 3VKMA 3U4SA 1MVQA 4CEWB 4NHMA 4D7YA 5DG1A 2VMGA 3MV01 1RVF2 2A73B 3MW2A 4OULA 2JXAA 2RJ2A 3MF6A 1HLCA 5GALA 3I3MA 4QHZA 1EYBA 2JIJA 3MFCA 4QPGC 3OD0A 2X5IC 1P8JA 4SLIA 5DDJ1 4RA0A 3A4UA 5EJ3A 3ETQA 1MS3A 3DKWA 5K0UA 1W9YA 1MACA 3USSA 4N43B 1TMF1 3GZUC 4CDQA 3AP6A 5HCAA 3ZSMA 3BODA 1LOGA 1TQ5A 1W8HA 4OZOA 4WVVA 4A3XA 1JW6A 2XJUA 5C8CC 1ODNA 1G9FA 2ZS6B 3PLQA 3DPRC 3KT1A 3K4ZA 4JX0A 4AI1A 4LO7A 3ES1A 1H2NA 4HVQA 4OHXA 2X10A 2EIGA 4ASKA 1UIKA 3LE0A 3QACA 5ANNA 1AYN2 3HQXA 4A7YA 2XUMA 1G86A 2R062 2GU9A 4Y5TA 4XUOA 4LHNA 4M4PA 4NRQA 1Y9GA 5L9RA 4FT8A 4XDPA 4R9CA 4QT6A 3ZR5A 4B4RA 3SEEA 1PMJX 5F5CA 2CL2A 4AI0A 1GKBA 4PHZA 4LBNA 3A7QA 2DU0A 3C7EA 5DABA 4ISQA 1IKPA 4HETA 1VBC1 2IXKA 1RUC1 2XONA 4FAGA 4QX1A 4QAWA 4CCDA 1KDMA 3R4UA 2UYAA 2PHXA 2HH9A 5CISA 4MGQA 4AXOA 1UX6A 2W46A 1R1ZA 4GWIA 3V0BA 4HK8A 5FZMA 2XQRA 3A21A 4XUNA 1JYCA 1NCQC 1KDKA 3PUHA 5IWFA 5I91A 3O12A 3POSA 2ID4A 5FY8A 2AACA 2ZEZA 2VZ1A 4JGZB 5DAVA 2PHDA 4XDQA 4QQ2A 1DU3D 4IEZA 2XJVA 2BRTA 4BIOA 5K9YA 1HIXA 1VP6A 1PX4A 1IPJA 2W1SA 3CF6E 1KS5A 3AJZA 1TNFA 2XHKA 5EV7A 1AL0G 4DB5A 3LGRA 4HPKB 4Z2WA 1QXPA 4QPWA 4QB6A 2VECA 1R64A 3ENRA 4XVHA 5DZEA 1OH3A 2QQLA 4YVWA 4JQRA 5H9SA 2R043 2RMU2 4RSUA 1UAIA 3ZSEA 5IATA 4Q4V2 3VBSC 1COV1 3SH3A 1UPIA 4FPFA 3B00A 4BMEA 4XFFA 2XXZA 5AC91 1IS4A 4OVEA 4GH4C 4DIQA 1V6MA 1RUNA 2R063 1Q56A 3KMHA 4CCNA 1I3HA 4QX3A 4XAEA 4XHBA 5J37A 5IYYA 3D3AA 4J1WA 1HXS3 3ZVXA 2W94A 3KGZA 2C6SA 5A3NA 1COV2 1VBA1 5J36A 1N1VA 2HBUA 4AGVA 2WA3A 4YG3A 3IDAA 2ZHKA 2A3XA 4WVZA 2XJTA 2AUYA 3NJVA 4MG2A 1X8MA 2D6MA 1DQ1A 4QDRA 5FZ0A 4ZXKA 4LO6B 2VW2A 4LBMA 2P6HA 3AZZA 4JKLA 5I0UA 1AZDA 1WD3A 3AX4A 4LLFA 1JMUB 2HWE3 4CCJA 2FZ1A 1JU4A 3B7MA 1UZYA 1QNWA 4ZS2A 4HN0A 3VBRB 3Q8FA 5LRSA 2WS91 1CJDA 3M4FA 4YM0A 1POV0 1MEC1 2DCYA 3MYXA 4RR3C 4UFIA 1NT0A 2HYXA 5DQ0A 3LDRA 1BLZA 4YVSC 2W1WA 1NAEA 4JCKA 3FMGA 5L9VA 1BEV3 1O91A 3M3IA 1JYIA 2WS92 2ARXA 3ZYBA 4EWAA 1JUIA 4E4HA 5FZFA 3AXDA 1C57A 4AYUA 4O65A 1YYNA 4Q8KA 2GNMA 1HJFA 5FWEA 5ERLA 1DP0A 2E31A 4XXAA 5E89A 3SC7X 4J6GA 4HVOA 3RYRA 4N53A 2WA4A 5KC5A 5A7WB 3V0AA 3VLBB 2WNUC 4IV3A 1GSLA 5FP4A 1WW5A 4IV3B 2CU5A 4AEJA 5CEHA 4UF0B 1B35A 1DBNA 3TNPB 3GCXA 3ZLIA 4NO4A 1F5JA 5GZFA 3W21A 2EXKA 4I09A 2JE9A 4FFGA 3I8TA 2NMNA 1NLRA 2ET1A 2BERA 4KU8A 1RXFA 4F8AA 3ZPYA 5C8CA 3E5XA 2OS2A 4AGGA 3SCGA 2VMFA 4BQXA 2C1FA 1SFYA 2PQQA 2PN5A 2BNOA 5A1LA 3MF9A 4COUA 1XYPA 1AYN1 3LB9A 1N1TA 4XFAA 3TAYA 4AFAA 1VALA 3SITA 4GKXA 5E1RA 4CDXB 3EYPA 3UL2A 5JZGC 1D4M2 2DVDA 1GR3A 2RG4A 3RG0A 4QU2A 3UKTA 2FDFA 3ZFGA 3T0DA 1MEC2 1UOGA 4XURA 4XCAA 1YQ6A 5C3RA 1DIWA 3AVSA 1UMZA 2K2SA 4FFHA 4YM1A 1B35B 2R073 1ULFA 2HLEA 3IMMA 4WZCA 1RGSA 4L92A 2JG8B 2QQOA 4M0HA 4IEOA 4OI1A 4ZONA 3ZYGA 5JPNB 1DGWX 5LEJA 1KGYA 1ODMA 2PAKA 4LORA 4RHV1 3I2OA 1DHKB 1DQ4A 3TEZA 3AL5A 2VOKA 2G9GA 2GC3A 1AJOA 2XJQA 1H30A 2VAUA 3DL3A 3N3HA 5A7NA 1W06A 3B94A 3O1PA 3K3OA 4UW5A 4W65A 1W2TA 3PL0A 1Y4WA 3ZIWA 2XJPA 4BA6A 1I5PA 2QDRA 3ZFGC 2YBKA 3J9SA 3LEMA 1S0JA 4COZA 3D6EA 5FZLA 3L2YA 2R042 4DINB 3J7NA 4XFIA 4KGGA 1XU1A 1RUC3 2WN3A 3LFMA 1RUG2 4MXWB 5FP7A 2BEOA 4OQ9A 4K6BA 4BMBA 1WMXA 1E5HA 1ZA7A 1UL9A 3WG3A 4KWLA 3DF0A 4GULA 2CYFA 2GP3A 5JZGA 5KHIA 4PDWA 4CP9A 2VZOA 5BNPA 1XPWA 3I59B 1J58A 3SISA 1IOAA 4UAPA 2BFUS 2UYBA 1UCXA 2XVKA 1ND3B 2ZHLA 2JDAA 2E9QA 4I30A 5FV3A 4BQ5A 4FO9A 5GZGA 1LKNA 2R0FA 4E2QA 1OUSA 2YBSA 2EAKA 1C8M3 4L8QA 4ONUA 1XQNA 2E33A 2YZ4A 4Q26A 4CVUA 2GMMA 3K75B 4RQPA 4ZS3A 3ALQA 4CEYA 4CCEA 4C91A 5M0TA 3WLUA 1PK6C 3OCPA 4H14A 2AGSA 3U1XA 2D93A 1F35A 3O1TA 1UPSA 2PMWB 4N53C 2JJ6A 1GWLA 4Q0VA 5JWPA 1LENA 1KJRA 1YXWA 3R4DB 3VZJA 2VE1A 4YVSA 1W6MB 1WGPA 2A6VA 2D6NA 2GZWA 3A23A 2J1AA 1G6NA 3ST7A 2ZKLA 5C6CA 4FQ4A 1G9BA 1QXJA 2OKXA 5FPZA 5FZEA 2D6KA 3O1SA 3ZXLA 2A70A 3UT0A 3NMBA 5HV0A 1EY2A 2VMIA 3V56A 5C7GA 2CDOA 5FCCA 1VAVA 4KBBA 1JU3A 3K4AA 3U75A 3LIGA 1MS8A 1UN1A 3EJKA 1RUE2 2RS52 3ELNA 3K3NA 1XJAA 3N9QA 4QQPA 1FMD3 2A6ZA 1WMEA 4X8NA 1TMF3 5FYMA 4JKMA 4LKEA 2RDNA 1RB8G 1GMMA 4DPNA 4Y1ZA 1DZTA 1SZBA 5CU1A 3ZSLA 5FXWA 3ZKUA 2WR9A 1HX6A 1XC6A 3NW4A 2Q1MA 3FWEA 1VE0A 2Y6LA 3RJRA 3T2OA 5LEKA 1R1A2 2VR4A 2WN2A 2ZEYA 3GNEA 2JDMA 3FFZA 3W5MA 4DXTA 5GLZA 5J96B 1AYM3 3H42B 1F15A 5FP9A 4YVWB 2HWD1 4FPKA 1A3KA 3KVBA 1SBFA 2WDBA 5H9QA 2O8OA 4PQQA 4E4SA 2Y8KA 4N7IA 3TEYA 1CIWA 2Y6FA 2ZAAA 4LJHA 1MS9A 4HN1A 3VDAA 1RHI2 2I07B 2GNDA 3I2HA 2G1MA 4KWKA 2KM2A 4CU7A 4LKSA 4JDNA 1AF9A 1U5IA 1PGL2 2GC1A 2W87A 4BQWA 1SBEA 2WABA 4NHLA 1QY4A 2RHPA 1X33A 1Q8PA 2CGOA 1YWKA 4MVTA 1S55A 3IZOA 4K20A 4YFZA 1BZWA 1H0BA 4IV1B 2YMZA 5GLUA 1K5JA 2XKPA 1A8DA 4U2AA 3IN9A 1SFPA 2OPKA 1KRIA 1BK0A 5BNNC 4YZ5A 4AOCA 1PM4A 2RMU3 3LEGA 4XIKA 2NZ9A 4GIQA 1YUDA 5JVVA 3BKZA 4META 5GZCA 2WSVA 3N7LA 2IXJA 1K3IA 1BEV2 2RM22 2B42B 1D2SA 1Q5OA 2V5YA 2XGXA 4LITA 3HWJA 4IEPA 4KNCA 4TZDA 1NXMA 4NR1A 4XXPA 2N7GA 2VY0A 2BU9A 1D4VB 1LGNA 4NWVA 3I49A 3WNLA 2MPFA 3FBMA 5JR2A 1ND2C 3GF6A 3IBMA 3OD4A 3LDBA 2CY6A 4ZKTB 2R041 3DEMA 1OD3A 4YGDA 2O8QA 4YG6A 5GZEA 2PLV3 1F9KA 5I0TA 4MADA 4ASMB 2GSYA 5A3UA 3NV4A 4GB33 1UIJA 2EXJA 2WLQA 4FCAA 2AEZA 2WUHA 3ZDSA 3PTYA 3UK9A 2HWC3 5C5UA 2E51A 1RVF1 2VMDA 4CE8A 1OQ1A 1HJGA 4MGSA 4PIXA 3M2MA 4CZSA 1EAH2 2QE3A 1UD1A 3AMHA 4YG0A 5F39A 4UFMA 2OW4A 1JZ4A 2XBO1 2QQIA 4F3JA 1DYPA 3OUJA 4R9BA 4E4ZA 1NG0A 3WDVA 2VQAA 3MFAA 1BVVA 3OBAA 1AX0A 2P2KA 1MQTC 3MW3A 3TN91 3ZFEC 3FUQA 4HK9A 5I0SA 1CQ9A 1ACCA 1QU0A 3WQ1A 2KD7A 1YO8A 2HEYF 2AENA 2ZX0A 2QQWA 3J8F2 3HBKA 4D6RA 4DMIA 5BY5A 1W0PA 2WFF2 4LK7A 3N9LA 4JGYC 3UNPA 3VHRA 1OLME 5FO8B 1WZXA 1WA6X 2Q8EA 5HPOA 3WQ7A 1IKQA 1WBLA 2CAUA 5FY4A 3T0BA 5IVBA 3U4XA 4IXLA 5JOZA 3CJIB 5IVEA 3BN6A 1AR93 2VM9A 4D94A 1K45A 4Q4W2 5I8SA 2DURA 1W6OA 5L7OC 2C9AA 2XHNA 4PBOA 1CR7A 4ATFA 3WCRA 1A34A 2CWSA 1VMJA 4IE0A 2Z79A 1T2XA 1FT9A 2VOWA 3OG2A 5LASA 1RUI3 3OPZA 4Y33A 1OH4A 3VBFC 4D69A 4M3CE 1L7QA 1W6NB 5DAQA 5T5JA 1VBB1 3W59A 1SLIA 1RUH3 4YPJA 3GBWA 3VHOA 3MPPG 3PVBB 1LEMA 4WM8A 2YROA 4UYBA 3ILNA 1LESA 1JOPA 1W3VA 1QDOA 2UU8A 5FK7A 2QCSB 2QDNA 1SHWB 1J83A 3KV9A 3GZAA 3BYWA 1RIRA 1RJ8A 5A70A 3ZXEA 4HFSA 1NQDA 4E8DA 1UZ0A 4QQLA 1O3TA 1AYN3 4RL7A 1V6IA 4UW4A 3AZYA 3NNFA 2YPJA 3CHXA 4AHXA 3HR9A 1GNYA 5FZOB 3AMPA 2DVFA 4Y20B 5F5IA 4Q5OA 4LIUA 4XUPA 3JD73 3U14A 1LU2A 1PO22 3AJYA 4EN9B 3OSDA 1PO13 3D0JA 4CEWC 4HT1T 1YNAA 5FY1A 3P1IA 2ATFA 1ZRRA 2WO3A 2J1TA 3APBA 2ZZQA 4BXSV 3HBZA 1LECA 2XLGA 5FYZA 4QPGB 3ZN5A 1DDLA 3VZMA 5J1XA 1OUXA 4E2GA 3PUIA 1O8SA 1ALYA 1GP6A 3MHZA 4QX0A 3ZFFB 5GLTA 4AF9A 2ZXQA 2YV8A 3S7EA 3W20A 1AR62 2HKXA 2Q8CA 4QPYA 1BJQA 2QZ3A 5C3QA 1VBC2 5FJKA 1EV11 2DBNA 4UF0A 4B7EA 3JBG2 3DKQA 2PHUA 4LBQD 5EP9A 2WAAA 4ITCA 2RS33 4A7ZA 4Q0PA 5CFCB 1YIPA 3JQXA 4RN5A 2DBIA 5CG9A 1QKQA 4Y5SA 5FZ6A 1F2NA 1GOHA 4R9AA 4Y4RA 1YFYA 4OI4A 4URTA 4MUVA 2FDKA 1ENXA 5J48A 2J22A 1JZ2A 1DLLA 2OUHA 1VBE1 4Z92B 1JXNA 1JOJA 4K7JA 3BPZA 3ZX7A 2ZPXA 4RS5B 3TEXA 1I5ZA 2H0VA 4NPMA 4PQ9A 4TN7A 1FATA 4ZU5A 5D8AA 1H9PA 1V6LA 4OYUA 3B01A 2ZGRA 3ZYHA 5F1RA 1VBE2 3I2GA 4PI0A 1XNBA 5JIAA 4BQYA 2ZMNA 4QX8A 1CONA 1X36A 1X82A 1QOSA 3EO6A 1HRI1 1O4TA 1DFQA 3CZUA 1XYOA 3VGIA 3MV11 5F37A 2DDUA 2YUEA 1QNYA 4IL7A 2BTVC 1NCQB 2W47A 4XE9A 1UNBA 4BE3A 3CEWA 1LTEA 1NKGA 4R4ZA 5BUVA 3F95A 1D4M1 3PTRB 1HRI3 1W90A 2GH2A 5FLIA 5FP8A 1QJU2 1F4HA 5AC93 5EYXA 1GV9A 1V00A 4AWDA 1V9U2 2J1VA 4C0HA 4EYUA 5BNOA 1CX1A 4D0QA 3SKJE 5DAXA 2ADEA 2YU1A 1WKYA 3WW2A 5LB6A 3POBA 5JAXA 1PMIA 1ZZ9A 2WAOA 3MO4A 4JGZA 1RUJ3 1VBA2 5CFDA 1FNYA 1K12A 2FBEA 2R16A 2VQ0A 4Z1VA 4QQOA 4BOWA 5IHRA 5JR7B 1W3XA 4BLIA 1RUD1 3AFGA 3AP5A 1YRZA 1GZ9A 4LKFA 3GXUA 4GZ9A 1X9PA 2C5DA 3WP4A 5EXOA 4EROA 1RJ7A 2I2SA 3HD8B 2OZJA 5CNAA 1WW4A 4X6RB 4DQAA 4DY3A 2PHRA 4XTPA 4Q4V3 4YW1A 2R49A 2IWGB 2A6WA 1W6PB 2I45A 4XFGA 5IVFA 2W5FA 5JOXA 1WCUA 1GZWA 4P9LA 2XQXA 4G3YC 2A3YA 3RZJA 4CCCA 1RUOA 4CCKA 3LDKA 4K3UA 1UX7A 5JUVA 4QXKA 5FPBA 5A32A 2QJVA 1ASJ2 1HQWA 1RL3A 2Y38A 4MHRA 1JYNA 2YC0A 4H7MA 2FCVA 2FMYA 4KGQA 3ASIA 2AEYA 2RDRA 1U5XA 1XSQA 5K4LA 3NKGA 3L2HA 1RMU3 2K9ZA 3HNMA 4HL0A 4NIIA 1H2KA 2CTVA 3KB5A 3H8UA 3AL6A 4FBFA 5FY9A 1PO11 1CD3G 3O0VA 3T2QA 4AEMA 1R091 1Q8OA 3LAGA 1YFWA 4LHLA 2BVVA 3VZNA 2ZMKA 2E7TA 2P37A 3D5OA 4YFWA 1S0DA 3CLPA 1NUKA 2EXIA 1JYVA 4AI2A 4WM7A 3WQBA 4LA2A 2D3PA 4GJYA 3RVHA 4BISA 3CKHA 1QJU1 2LW8A 3C7FA 4QGNA 1SBDA 1POV3 1XYNA 3I2KA 2ZX1A 1JODA 4BIFA 4FOVA 3M70A 4MHUA 2NN8A 3S7IA 1UOBA 1RUG1 3J7LA 5IT6A 2PHTA 1OA2A 2D7FA 3R4SA 3HIFA 3ACGA 4QU1A 3LSEA 5FYVA 1PIV2 4CDUB 2PAEA 3PMSA 1FMD1 3J7MA 1XU2A 2A1XA 3KT4A 3CBNA 2JKXA 3OUHA 4QQHA 4XW3A 1XOYA 3CL1A 4HONA 5IK5A 3AB0A 4QPGA 4UFHA 3Q8BA 3LSDA 1PZ9A 2ARBA 2IXCA 2XWJB 5FZIA 5A3MA 1ZNPA 4B29A 4W6YA 1JZ6A 1OSGA 2D5HA 3P5BA 4DFSA 3JB4C 2R7EB 3ZXAC 1QQP1 2VZRA 4IEUA 5KXBA 3W58A 4LMFA 4Q1PA 5JXIA 3B9CA 1PVC1 2E7AA 4PCRA 4AI3A 3ACHA 3NJYA 3I2IA 4ZPIA 4D7SA 3LEIA 2J1EA 1J84A 1H1AA 2JDYA 1QHDA 1SLLA 4LUMA 3VBFA 2FDIA 1TNRA 1YFXA 3AVRA 4WVMB 3UJQA 1REFA 4JVAA 4JDMA 2VJXA 1S0IA 4O61A 2VBPA 5BPXA 2YC2A 5SV5A 3SH5A 5FRAA 1R1A3 2QQPA 1J59A 3KHBA 1AVBA 1D2QA 3RI9A 4NMIA 3QH6A 5L19A 3AZWA 3SCFA 2D43A 2PA7A 1OMIA 5FR3A 2W3JA 3QLQA 3TWIA 1KITA 1EPWA 4M00A 3IDCB 1EUTA 3RDIA 5C8CB 3GALA 2Y6KA 4CUCA 4C8DA 2DCJA 2TUNA 2VU9A 4JGYA 4YNIA 2LS6A 2D6LX 4B4PA 3DPRB 3OBZA 1LAJA 1HB3A 3RQ0A 4DXSA 3H8XA 3MIBA 5CBLA 4OUMA 1WLCA 2V4VA 3KV5A 2W68A 5KR7A 5IK7A 5BNOB 3WUCA 2DWRA 3KZ4C 4RHV3 1LHVA 3WW4A 4LQRA 3CZJA 3N4MA 1CAUA 2QQKA 3VBOB 1ZRCA 1KD7A 3ZYPA 2YGLA 4D8MA 3ZFGB 1W8FA 4A45A 3E6DA 3A0KA 3M3EA 4IERA 4I3GA 1CGPA 1ULCA 2VG9A 1OQEA 4CU6A 3VKNA 4BH9A 3J26N 1V6OA 1Y9MA 5A3PA 2QVSB 5KC6A 3W5NA 4QHBA 1DGWA 3UETA 3IAQA 2CAVA 2RJLA 4L2NA 5F5AA 4K1ZA 5BYNA 4LT5A 1XXNA 3VD4A 4JQTA 5CG8A 1AR71 1U12A 2DV9A 3N9PA 1FOD1 3M8LA 1GQHA 1SLTA 3OYWB 1LU1A 5CFDB 5LY1A 5KBFA 4I0AA 2D3RA 4TWTA 4D6QA 5BNQA 2GMPA 1RHI1 5FZ7A 5F7UA 3OGJA 3MIFA 2C4XA 5L36A 1UMIA 4FVVA 4LBLA 4FI9A 4ES8A 1IS6A 5T5LA 1DF0A 1UU5A 5EJ1B 1S0EA 4XFHA 3WW3A 3QD6A 2OQ7A 5FZ9A 3KCXA 3I59A 5JOYA 3EMRA 4ORFA 4BZ4A 2IVIB 1WCSA 3SQOA 4XQ4A 1OVSA 2RM23 1ULDA 3PURA 4K40A 1UW8A 1LOFA 1QJEA 4MSVA 3ILFA 3WDYA 1PNGA 4YGBA 2LRPA 5C3SA 1UY4A 4JV4A 5B4NA 5B4XA 1T6GC 3P3PA 1F31A 5BNNA 2ZGLA 3C3VA 4KG0A 5FQ0B 2VUJA 1CZTA 4YYOA 2OA2A 4CDUA 3N9NA 1W39A 2EVXA 2JENA 3ZYJB 4DY5A 4RS5A 4MH0E 2CSGA 2JWPA 3I97A 2NP0A 5IAVA 4M3CA 3BGAA 2KXLA 3FJSA 4Q4Y1 2VOTA 2RMU1 5L73A 4A42A 1BXHA 4FOQA 4LHKA 5E16A 1YCIA 1LOBA 2R1BA 4AHWA 3AYCA 1CAXA 2P3JA 1W2UA 3FX3A 2HWF3 1CESA 2VUAA 3WT3A 1MQTA 3V65A 2XG3A 4QGLA 5JIUA 4XFCA 2AYHA 2ZKNA 1YC61 4K9SA 5FLJA 3VBSA 2XOMA 2HWB1 2P5BA 5C70A 5FOBB 5CA6A 1ZBA3 2L9LA 5CKQA 1YJLA 1H8TB 2DCKA 2DTWA 4XJUA 5FQ0A
chains in the Genus database with same CATH topology
2VQTA 4QDSA 4JKMA 3HPNA 4JKKA 1GMMA 1W0NA 1XC6A 4BK5A 4IUGA 3FHAA 2Y6LA 3T2OA 2VR4A 2WQ8A 4TTGA 2WN2A 2ZEYA 2VZTA 2ORZA 3W5MA 4L0PA 4DXTA 4AAXA 1UXZA 2WDBA 2VO5A 1CIYA 3K77A 4PQQA 3HN3A 1UYXA 2Y8KA 3VDAA 3P6BA 2JE8A 2YFZA 2EIDA 1MPXA 3I2HA 2V72A 4CU7A 2VQUA 4LKSA 4A41A 3HOBA 2W87A 2WABA 2WO1A 5DMYA 3OGVA 2C26A 2QQMA 4KI5M 4CUBA 3WF2A 3LEGA 3OEAA 4JHZA 3VD3A 4CU9A 5LCWL 1K3IA 2VCBA 4XUTA 5EJZB 2VC9A 3ETPA 3WNLA 3AC0A 5JR2A 4ZZ5A 4OMCA 1GQPA 4A44A 4P02B 3C7OA 2E32A 1OD3A 1OT5A 3GDBA 1JYWA 3ZM8A 2ZEXA 4MADA 2YG0A 3JXSA 3CQOA 1W9SA 4ZXEA 4AG4A 2WUHA 3E1F1 3WF1A 2VMDA 1US2A 4MGSA 1EUUA 1JZ4A 2EIBA 1H6YA 3SKVA 2QQIA 5LA1A 3CMGA 2W1QA 2VZPA 1UXXX 2Y6HA 3IAPA 2V5DA 1SDDB 3ECQA 3LEKA 3OBAA 3WNPA 2BGPA 2VCAA 2VCCA 4BJ0A 2KD7A 3VD9A 3NQHA 3LPFA 3THDA 5FUIA 1D7PM 2RV9A 3UNPA 4DUWA 2Y64A 3WF0A 5HPOA 5I0DA 4A3ZA 3T0BA 3ACFA 4DEQA 1TVGA 3BN6A 2VM9A 5JXHA 1K45A 3I2FA 3U37A 3VD7A 2RVAA 1XNTA 1UYZA 4W4ZA 1JHJA 2XHNA 2W9XA 3THCA 4KWUA 1T2XA 3OG2A 2BBAA 1OH4A 1L7QA 5CYYA 2PQSA 4YPJA 2VZ3A 3WNOA 1UY0A 3WSOA 1SHWB 1YQ2A 1J83A 4ZY9A 3GM8A 1CZVA 1W8OA 4QX2A 4E8DA 1UZ0A 2WBKA 2VZSA 4M4RA 2W1UA 1JI6A 2VMEA 1DLCA 1GNYA 2ZEWA 1H6XA 2B9VA 4XUPA 4MOAA 1K42A 3DYPA 3P1IA 2WO3A 2J1TA 1DYOA 2VMCA 4ARXA 4XUQA 4BXSV 5J1XA 2VZUA 3C7GA 3PUIA 1O8SA 4QX0A 4ARYA 1XNAA 4OMDA 3UESA 1JZ7A 2ZXQA 4P08A 2VZQA 3MV01 2RJ2A 1GU3A 2YB7A 3VD5A 1UMHA 1LNSA 1P8JA 2WAAA 4RN5A 2VTFA 4OZOA 1CZSA 3ABZA 1GOHA 4XZUG 3ACIA 3C7HA 3T2PA 2J22A 1JZ2A 3NRUA 3K4ZA 2E26A 1JU3A 4JX0A 1IQDC 2X10A 3LE0A 2EIEA 4OYUA 2VL4A 1GUIA 3I2GA 4XUOA 4M4PA 1JZ8A 3CZUA 3MV11 3K4DA 3SEEA 1UWWA 2DDUA 1PMJX 5A1AA 2W47A 3A7QA 3C7EA 1NKGA 2XONA 3I2JA 4LPLA 4PF1A 4CUAA 4QX1A 5G04L 4QAWA 1F4HA 3MBWA 4DEVA 3T09A 2J1VA 4MGQA 5JXJA 1CX1A 2W46A 4D0QA 3SKJE 1NX9A 2JD9A 1WKYA 4GWIA 3A21A 4XUNA 1W9TA 3PUHA 2WAOA 4BDVB 4PT6A 2YC4A 3MO4A 2ID4A 4LHSA 3T08A 2ZEZA 2VZ1A 1K12A 3K46A 5IHRA 3A22A 1GOGA 1PX4A 1UYYA 3GXUA 2W1SA 2YFUA 3MUZ1 4GZ9A 4W50A 3WNKA 4QPWA 1UY2A 4QB6A 1R64A 5JXGA 4XVHA 3IB3A 2QQLA 2W5FA 5DN2A 2XQXA 1SG3A 1O59A 1UX7A 3DYOA 5JUVA 1OF3A 1JYNA 3WNMA 3T0AA 3HNMA 4QX3A 5IYYA 3D3AA 1KEXA 2X09A 3C8XA 1RYYA 2W94A 3GGLA 3T2QA 4BK4A 2W92A 3IDAA 3FL7A 3WF3A 1NUKA 2J1UA 5JMOA 1JYVA 3NJVA 4E8CA 3WQBA 4QDRA 1PMHX 3CKHA 5IFPA 4JKLA 4KMQA 2LW8A 3C7FA 3I2KA 1JU4A 2BGOA 3ACGA 4DXRA 5DQ0A 2HYXA 2W1WA 2WO2A 3HEIA 3CIHA 1NAEA 3OGSA 3DECA 5G05L 2JKXA 2Y6GA 4UOJA 4QB2A 4RYDA 4HG6B 3IIIA 2Z4FA 4DUVA 1UY3A 4QDQA 3LPGA 3DYMA 1JZ6A 1JZ3A 3I3EA 1DP0A 2BZDA 2E31A 2R7EB 5C71A 2VZRA 3VDCA 5JXIA 2X05A 3OEBA 1TG7A 1HN1A 3ACHA 3I2IA 3LEIA 2J1EA 1J84A 2C9KA 1W8NA 5HXMA 2EICA 1GOFA 2BERA 2VJXA 1JZ5A 2YC2A 4MO3M 2VMFA 3FHQA 3I3DA 2QQJA 2W3JA 1ULPA 1EUTA 3EYPA 2Y6KA 4CUCA 2DCJA 4A6OA 2LS6A 2VZVA 4ZZ8A 3SEPA 3T0DA 4DXSA 3FN9A 2V4VA 4XURA 5IJRA 1BHGA 1PX3A 1W99A 3CZJA 4LQRA 2QQKA 2HLEA 2QQOA 4D8MA 1KGYA 3NJXA 3OB8A 3WNNA 4A45A 4W8JA 3HJRA 4CU6A 3HNYM 3W5NA 2J1SA 3IAQA 4GWJA 3LQCA 3UETA 1OF4A 3VDBA 1I5PA 3VD4A 3WEZA 2J1RA 2W91A 5LA2A 3J7HA 1L7RA 4Z2AA 2WN3A 5F7UA 2C4XA 1UMIA 4UI9L 4FI9A 2B4KA 4P00B 5EJ1B 3F2ZA 3HNBM 3CDZB 5LA0A 2ORXA 2CDPA 2J7MA 2VZOA 1XPWA 4CU8A 1O8PA 4OUEA 4UAPA 2JDAA 1UY4A 5B4NA 2WZ8A 5B4XA 1US3A 4A4AA 5CZKA 2E33A 4CVUA 1CZTA 3K75B 3I3BA 1F4AA 1WCQA 3I97A 1ULOA 3BGAA 4P5YA 1JYXA 2VOTA 2WYSA 2Y6JA 4A42A 5DPNA 1UY1A 2W95A 4ET7A 5IFTA 3A23A 2J1AA 2OKXA 2QBXA 3OGRA 2WZEA 2QQNA 4TXWA 1W9WA 2XOMA 3WF4A 3NNGA 5C70A 5C7GA 2CDOA 3MUY1 3EB7A 2L9LA 2DCKA 4DUXA 3K4AA 5EIYB 4QB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQT A;  4QDS A;  4JKM A;  3HPN A;  4JKK A;  1GMM A;  1W0N A;  1XC6 A;  4BK5 A;  4IUG A;  3FHA A;  2Y6L A;  3T2O A;  2VR4 A;  2WQ8 A;  4TTG A;  2WN2 A;  2ZEY A;  2VZT A;  2ORZ A;  3W5M A;  4L0P A;  4DXT A;  4AAX A;  1UXZ A;  2WDB A;  2VO5 A;  1CIY A;  3K77 A;  4PQQ A;  3HN3 A;  1UYX A;  2Y8K A;  3VDA A;  3P6B A;  2JE8 A;  2YFZ A;  2EID A;  1MPX A;  3I2H A;  2V72 A;  4CU7 A;  2VQU A;  4LKS A;  4A41 A;  3HOB A;  2W87 A;  2WAB A;  2WO1 A;  5DMY A;  3OGV A;  2C26 A;  2QQM A;  4KI5 M;  4CUB A;  3WF2 A;  3LEG A;  3OEA A;  4JHZ A;  3VD3 A;  4CU9 A;  5LCW L;  1K3I A;  2VCB A;  4XUT A;  5EJZ B;  2VC9 A;  3ETP A;  3WNL A;  3AC0 A;  5JR2 A;  4ZZ5 A;  4OMC A;  1GQP A;  4A44 A;  4P02 B;  3C7O A;  2E32 A;  1OD3 A;  1OT5 A;  3GDB A;  1JYW A;  3ZM8 A;  2ZEX A;  4MAD A;  2YG0 A;  3JXS A;  3CQO A;  1W9S A;  4ZXE A;  4AG4 A;  2WUH A;  3E1F 1;  3WF1 A;  2VMD A;  1US2 A;  4MGS A;  1EUU A;  1JZ4 A;  2EIB A;  1H6Y A;  3SKV A;  2QQI A;  5LA1 A;  3CMG A;  2W1Q A;  2VZP A;  1UXX X;  2Y6H A;  3IAP A;  2V5D A;  1SDD B;  3ECQ A;  3LEK A;  3OBA A;  3WNP A;  2BGP A;  2VCA A;  2VCC A;  4BJ0 A;  2KD7 A;  3VD9 A;  3NQH A;  3LPF A;  3THD A;  5FUI A;  1D7P M;  2RV9 A;  3UNP A;  4DUW A;  2Y64 A;  3WF0 A;  5HPO A;  5I0D A;  4A3Z A;  3T0B A;  3ACF A;  4DEQ A;  1TVG A;  3BN6 A;  2VM9 A;  5JXH A;  1K45 A;  3I2F A;  3U37 A;  3VD7 A;  2RVA A;  1XNT A;  1UYZ A;  4W4Z A;  1JHJ A;  2XHN A;  2W9X A;  3THC A;  4KWU A;  1T2X A;  3OG2 A;  2BBA A;  1OH4 A;  1L7Q A;  5CYY A;  2PQS A;  4YPJ A;  2VZ3 A;  3WNO A;  1UY0 A;  3WSO A;  1SHW B;  1YQ2 A;  1J83 A;  4ZY9 A;  3GM8 A;  1CZV A;  1W8O A;  4QX2 A;  4E8D A;  1UZ0 A;  2WBK A;  2VZS A;  4M4R A;  2W1U A;  1JI6 A;  2VME A;  1DLC A;  1GNY A;  2ZEW A;  1H6X A;  2B9V A;  4XUP A;  4MOA A;  1K42 A;  3DYP A;  3P1I A;  2WO3 A;  2J1T A;  1DYO A;  2VMC A;  4ARX A;  4XUQ A;  4BXS V;  5J1X A;  2VZU A;  3C7G A;  3PUI A;  1O8S A;  4QX0 A;  4ARY A;  1XNA A;  4OMD A;  3UES A;  1JZ7 A;  2ZXQ A;  4P08 A;  2VZQ A;  3MV0 1;  2RJ2 A;  1GU3 A;  2YB7 A;  3VD5 A;  1UMH A;  1LNS A;  1P8J A;  2WAA A;  4RN5 A;  2VTF A;  4OZO A;  1CZS A;  3ABZ A;  1GOH A;  4XZU G;  3ACI A;  3C7H A;  3T2P A;  2J22 A;  1JZ2 A;  3NRU A;  3K4Z A;  2E26 A;  1JU3 A;  4JX0 A;  1IQD C;  2X10 A;  3LE0 A;  2EIE A;  4OYU A;  2VL4 A;  1GUI A;  3I2G A;  4XUO A;  4M4P A;  1JZ8 A;  3CZU A;  3MV1 1;  3K4D A;  3SEE A;  1UWW A;  2DDU A;  1PMJ X;  5A1A A;  2W47 A;  3A7Q A;  3C7E A;  1NKG A;  2XON A;  3I2J A;  4LPL A;  4PF1 A;  4CUA A;  4QX1 A;  5G04 L;  4QAW A;  1F4H A;  3MBW A;  4DEV A;  3T09 A;  2J1V A;  4MGQ A;  5JXJ A;  1CX1 A;  2W46 A;  4D0Q A;  3SKJ E;  1NX9 A;  2JD9 A;  1WKY A;  4GWI A;  3A21 A;  4XUN A;  1W9T A;  3PUH A;  2WAO A;  4BDV B;  4PT6 A;  2YC4 A;  3MO4 A;  2ID4 A;  4LHS A;  3T08 A;  2ZEZ A;  2VZ1 A;  1K12 A;  3K46 A;  5IHR A;  3A22 A;  1GOG A;  1PX4 A;  1UYY A;  3GXU A;  2W1S A;  2YFU A;  3MUZ 1;  4GZ9 A;  4W50 A;  3WNK A;  4QPW A;  1UY2 A;  4QB6 A;  1R64 A;  5JXG A;  4XVH A;  3IB3 A;  2QQL A;  2W5F A;  5DN2 A;  2XQX A;  1SG3 A;  1O59 A;  1UX7 A;  3DYO A;  5JUV A;  1OF3 A;  1JYN A;  3WNM A;  3T0A A;  3HNM A;  4QX3 A;  5IYY A;  3D3A A;  1KEX A;  2X09 A;  3C8X A;  1RYY A;  2W94 A;  3GGL A;  3T2Q A;  4BK4 A;  2W92 A;  3IDA A;  3FL7 A;  3WF3 A;  1NUK A;  2J1U A;  5JMO A;  1JYV A;  3NJV A;  4E8C A;  3WQB A;  4QDR A;  1PMH X;  3CKH A;  5IFP A;  4JKL A;  4KMQ A;  2LW8 A;  3C7F A;  3I2K A;  1JU4 A;  2BGO A;  3ACG A;  4DXR A;  5DQ0 A;  2HYX A;  2W1W A;  2WO2 A;  3HEI A;  3CIH A;  1NAE A;  3OGS A;  3DEC A;  5G05 L;  2JKX A;  2Y6G A;  4UOJ A;  4QB2 A;  4RYD A;  4HG6 B;  3III A;  2Z4F A;  4DUV A;  1UY3 A;  4QDQ A;  3LPG A;  3DYM A;  1JZ6 A;  1JZ3 A;  3I3E A;  1DP0 A;  2BZD A;  2E31 A;  2R7E B;  5C71 A;  2VZR A;  3VDC A;  5JXI A;  2X05 A;  3OEB A;  1TG7 A;  1HN1 A;  3ACH A;  3I2I A;  3LEI A;  2J1E A;  1J84 A;  2C9K A;  1W8N A;  5HXM A;  2EIC A;  1GOF A;  2BER A;  2VJX A;  1JZ5 A;  2YC2 A;  4MO3 M;  2VMF A;  3FHQ A;  3I3D A;  2QQJ A;  2W3J A;  1ULP A;  1EUT A;  3EYP A;  2Y6K A;  4CUC A;  2DCJ A;  4A6O A;  2LS6 A;  2VZV A;  4ZZ8 A;  3SEP A;  3T0D A;  4DXS A;  3FN9 A;  2V4V A;  4XUR A;  5IJR A;  1BHG A;  1PX3 A;  1W99 A;  3CZJ A;  4LQR A;  2QQK A;  2HLE A;  2QQO A;  4D8M A;  1KGY A;  3NJX A;  3OB8 A;  3WNN A;  4A45 A;  4W8J A;  3HJR A;  4CU6 A;  3HNY M;  3W5N A;  2J1S A;  3IAQ A;  4GWJ A;  3LQC A;  3UET A;  1OF4 A;  3VDB A;  1I5P A;  3VD4 A;  3WEZ A;  2J1R A;  2W91 A;  5LA2 A;  3J7H A;  1L7R A;  4Z2A A;  2WN3 A;  5F7U A;  2C4X A;  1UMI A;  4UI9 L;  4FI9 A;  2B4K A;  4P00 B;  5EJ1 B;  3F2Z A;  3HNB M;  3CDZ B;  5LA0 A;  2ORX A;  2CDP A;  2J7M A;  2VZO A;  1XPW A;  4CU8 A;  1O8P A;  4OUE A;  4UAP A;  2JDA A;  1UY4 A;  5B4N A;  2WZ8 A;  5B4X A;  1US3 A;  4A4A A;  5CZK A;  2E33 A;  4CVU A;  1CZT A;  3K75 B;  3I3B A;  1F4A A;  1WCQ A;  3I97 A;  1ULO A;  3BGA A;  4P5Y A;  1JYX A;  2VOT A;  2WYS A;  2Y6J A;  4A42 A;  5DPN A;  1UY1 A;  2W95 A;  4ET7 A;  5IFT A;  3A23 A;  2J1A A;  2OKX A;  2QBX A;  3OGR A;  2WZE A;  2QQN A;  4TXW A;  1W9W A;  2XOM A;  3WF4 A;  3NNG A;  5C70 A;  5C7G A;  2CDO A;  3MUY 1;  3EB7 A;  2L9L A;  2DCK A;  4DUX A;  3K4A A;  5EIY B;  4QB1 A; 
#chains in the Genus database with same CATH topology
 2AR6 A;  5DUW A;  1V9U 3;  3KVA A;  3BTX A;  3H9A A;  5IVV A;  1EPZ A;  2W2I A;  3OBR A;  2BVB A;  4P9I A;  5JLV A;  4PLN A;  5FYI A;  1FYU A;  2B46 X;  3PVN A;  3RYK A;  3O1R A;  1NA1 B;  2O1Q A;  4N9I A;  2G9Z A;  3SCH A;  4AFC A;  1W0N A;  5FZH A;  2WII B;  1XE8 A;  1PVC 3;  1RUE 3;  2OX0 A;  2RS5 3;  2YBP A;  4IUG A;  1VRH 2;  4YVS B;  4RFR B;  1VBD 2;  3AYD A;  3U78 A;  1EV1 2;  2WQ8 A;  3SXW A;  4BHP A;  1CAX B;  1CAW B;  4LUL A;  5K7P A;  4XBQ A;  5H9R A;  1YEW A;  3ZKY A;  4L0P A;  1OOP B;  4LEJ A;  1UXZ A;  5DUU A;  1HW5 A;  4Y1X A;  4CP9 B;  5BNP B;  4NAM A;  4L97 A;  3T2T A;  3POY A;  3K77 A;  1UYX A;  2Y34 A;  4XF0 A;  3MPB A;  1IPK A;  3MLJ A;  3N36 A;  3P6B A;  4WV8 A;  5KXE A;  3JZV A;  4OHY A;  4YM2 A;  2WLP A;  4YW5 A;  1BCX A;  5CIR A;  1JBC A;  3KF5 A;  5BNN B;  1JHN A;  2VQU A;  4FP3 A;  1ZRE A;  4HXC A;  5A80 A;  1QIQ A;  4FPE A;  3IWZ A;  5FK8 A;  4BLJ A;  2QZ2 A;  2WZR 3;  4LBQ B;  2WO1 A;  4A7K A;  3BTA A;  3OBT A;  1PK6 A;  3ORJ A;  1E5R A;  4YZ3 A;  3DN7 A;  4CEY C;  4QPI C;  3VN4 A;  4HSJ A;  4EJR A;  4FOW A;  5F3C A;  4BYY A;  1G8W A;  2WO7 A;  1QWR A;  2BJS A;  3KQ4 B;  2ET7 A;  1Y7B A;  5E6H A;  2D6O X;  1PVX A;  4QX5 A;  4GWN A;  4LOS A;  1AX1 A;  5FYU A;  4CUG A;  5IK8 A;  5EJZ B;  1AR9 2;  2WT2 A;  4CCM A;  4JHT A;  2JB8 A;  2E6V A;  2VC9 A;  1HKD A;  1H2L A;  2D6P A;  5FO9 B;  3SMH A;  4AED B;  1RUD 2;  1AHS A;  2DCZ A;  5C33 A;  5A6X A;  1PO2 3;  4XQW A;  4CXW A;  5F5Q A;  4A44 A;  2RS1 2;  4G9S B;  2NPI A;  3TN9 3;  3J8F 1;  4YLZ A;  3AMM A;  2E32 A;  1OT5 A;  3C7O A;  5APA A;  3JUU A;  3FZ3 A;  2YG0 A;  2Q1Z B;  4IEV A;  1PO2 1;  3S0M A;  2HJI A;  3E5U A;  2JKB A;  4B1M A;  2FQP A;  3OTF A;  2WNE A;  1V6N A;  4ZXE A;  4AG4 A;  2ZGQ A;  4XDO A;  4URA A;  2R0H A;  5FKC A;  4QGM A;  2D98 A;  3H7J A;  1CAW A;  3WQ0 A;  3O1M A;  4L9B A;  1PVC 2;  4P9G A;  2HEW F;  4AE2 A;  1GNH A;  1H6Y A;  2A5Z A;  3VZL A;  5LA1 A;  1LOC A;  3P3N A;  3CMG A;  3H1Y A;  4UFL A;  3PHM A;  1QGL A;  2Y6H A;  4NRP A;  3LEK A;  1CVN A;  1D0H A;  2WC2 A;  5FMC A;  5HCF A;  1ZX5 A;  1RUI 2;  3BU0 A;  3NWK A;  1GWM A;  4PI2 A;  5IUQ A;  4AZZ A;  3IMN A;  2KA3 A;  1GAN A;  1KQR A;  2VCC A;  1FAY A;  4BJ0 A;  1H8T A;  1JUH A;  1STM A;  1OQD A;  4N9H A;  1NQJ A;  3VD9 A;  2ZHN A;  1ZM1 A;  3JD7 2;  4YW4 A;  3MDP A;  4YW3 A;  5T5O A;  3BCW A;  1Q8Q A;  3THD A;  3MIH A;  4YZ1 A;  1C3H A;  1A6C A;  2VTX A;  4JAA A;  4Q4W 3;  3VHN A;  1O3Q A;  2HWD 2;  1YQ5 A;  1H8V A;  4XIL A;  1ZZC A;  3WF0 A;  4A3Z A;  4DEQ A;  3ACF A;  4EN6 B;  1RMU 1;  2R30 A;  4FTE A;  1XSR A;  1TVG A;  3WDX A;  1BYH A;  4AHZ A;  1SCS A;  4DS0 A;  5JXH A;  1W6O B;  3WX5 A;  3VD7 A;  3SLI A;  4ET7 A;  4Q2F A;  5EYY A;  3CU7 A;  4P9Y A;  4ASL A;  2W9X A;  3RRD A;  5HI0 A;  4XAA A;  3WG4 A;  3THC A;  1FXZ A;  2ETE A;  3ZDV A;  3USU B;  4QMA A;  4Q4X 1;  3LZZ A;  1IPS A;  3AKS A;  3ROU A;  3QBQ A;  3ZMN A;  1QH6 A;  2WRA A;  2QQV A;  3RNS A;  3DCQ A;  2HWC 2;  2V73 A;  3DV8 A;  4Q4Y 3;  3TNQ A;  3WUD A;  1NXD 1;  5K0U C;  1AX2 A;  2VZ3 A;  3WG1 A;  1R09 3;  2TEP A;  4C1W A;  4KU7 A;  1TZO A;  3WV6 A;  4HKW A;  2WS9 3;  5TSW A;  2XUE A;  2EAL A;  4KBZ A;  4MGY E;  4UBG A;  1OXC A;  1FPN 3;  1JTZ X;  3U10 A;  4S2D A;  1W6P A;  2Q4S A;  1MZF A;  5JMC A;  1W8O A;  4QX2 A;  1FNZ A;  1PM7 A;  4ISR A;  1X9T A;  2NMO A;  4M4R A;  1HB2 A;  2W1U A;  1JI6 A;  3ZR6 A;  4COV A;  1UZV A;  1C4R A;  1DLC A;  1FPN 1;  3ZOI A;  2A7A A;  2TBV A;  4Y4Y A;  1LB2 A;  1GZT A;  3ZFF C;  5FXX A;  1R1A 1;  1H6X A;  2R6Q A;  2B9V A;  3GJB A;  2DU1 A;  1SAC A;  2V09 A;  3T3Y A;  1AR8 3;  4MXW A;  3UKN A;  4WM8 B;  4UFK A;  2K46 A;  1MZE A;  5D8A B;  4QD2 A;  1DYO A;  2VMC A;  2XML A;  2ZJC A;  4WBB A;  4XUQ A;  5T54 A;  4ARX A;  1QOT A;  2PYT A;  2B45 X;  3BOW A;  3C7G A;  1Q3E A;  2PHF A;  3TOJ A;  3FLT A;  2YDE A;  4S2F A;  2BUK A;  1AXZ A;  1COV 3;  5T3N A;  4DXZ A;  1O3S A;  1JZ7 A;  1RUJ 1;  4Q29 A;  1PZ7 A;  1PIV 1;  3D8C A;  2YY1 A;  5ANQ A;  3S6P A;  3VDD C;  1QJX 1;  1PGW 1;  2ARC A;  5DZG A;  4EWE A;  1GU3 A;  1UMH A;  2BP6 A;  3IM0 A;  1PZ8 A;  4GH4 A;  5A3L A;  2FCT A;  1LNS A;  4YGC A;  4CXX A;  4D3W A;  1VR3 A;  1OC1 A;  4XBN A;  3RGB A;  4E2S A;  4XJA A;  2VUD A;  2Q5T A;  3AP4 A;  5FYB A;  4EZ4 A;  1PGW 2;  4XCB A;  4Y3O A;  1W6Q A;  2VTF A;  3IKW A;  1BBT 1;  1KFU L;  1VB4 A;  3ABZ A;  3FUO A;  4XMI A;  3ZXF A;  1ZZB A;  1FOD 2;  1VB2 A;  3POF A;  4XZU G;  1DGR N;  1RHI 3;  3C7H A;  4A2U A;  2ZA9 A;  3NRU A;  1VRH 3;  2EAA A;  2O0O A;  2R06 1;  3KS7 A;  4NOT A;  1URX A;  2J42 A;  5KHJ A;  3RSJ A;  4XMA A;  3HVD A;  5C5T A;  2RR1 2;  1CX4 A;  3LKJ A;  2WFF 1;  1R08 3;  1M4W A;  1W9F A;  1AYM 2;  1SDW A;  3LA7 A;  4QPI A;  3RFR A;  5A3T A;  3BPS A;  2LM3 A;  3N35 A;  2ZZJ A;  3CO2 A;  3BIW E;  1GWK A;  1S2K A;  1TMF 2;  2XL9 A;  4HMZ A;  3UGG A;  3UYJ A;  5FZD A;  3WZ1 A;  4OZX A;  1Q43 A;  3K4D A;  3VUO A;  5CAD A;  1HV1 A;  2BWA A;  5B2G B;  1SPP B;  2Q0A A;  4CDW C;  1ZRF A;  4MGZ E;  3I2J A;  3IDE A;  4PF1 A;  1GP4 A;  1DQ5 A;  1OPO A;  4Y5Z 0;  2IFR A;  4DEV A;  4RGG A;  5H9P A;  4KH9 A;  1MS4 A;  2GAL A;  4H7L A;  2XJS A;  1AYM 1;  1WCK A;  3I4I A;  3BU7 A;  3QOP A;  5DZF A;  2H0B A;  2ZGT A;  5LA9 A;  4Q4Y 2;  1Z7S 2;  4AQ2 A;  3DXU A;  4PT6 A;  4AEK A;  4BDV B;  5K8S A;  3B02 A;  4LHS A;  2QTW B;  1DQ0 A;  5FZA A;  4V1P A;  3K46 A;  4WVW A;  4YAR A;  2VNR A;  3VHP A;  1X7N A;  2JG9 B;  4Q4V 1;  3WCS A;  2B39 A;  5EHD A;  3R0R A;  1Z7S 1;  2ZGN A;  1GOG A;  2RDQ A;  2RS3 2;  3PNA A;  4W50 A;  3C2U A;  3MUZ 1;  1MQT B;  4YWA A;  5AVP A;  3AP7 A;  1W2N A;  3NVC A;  1VBA 3;  5IK4 A;  4LKD A;  3H8O A;  2BOI A;  3KM5 A;  4LE3 A;  5JXG A;  1C1L A;  1NLS A;  2AC1 A;  5A6Y A;  3RZL A;  2QKD A;  5CKN A;  3IB3 A;  2X29 A;  1OUR A;  3VBR A;  5JI9 A;  1N3Q A;  5DN2 A;  3O7O A;  2P17 A;  2FZ2 A;  4XJ9 A;  1SG3 A;  1POV 1;  1HRV 2;  2CHH A;  4NWW A;  1S4C A;  1C8M 2;  1NLQ A;  1OF3 A;  1ST8 A;  2XL7 A;  3ATG A;  4JZR A;  3NAP C;  4XZP A;  5EQU A;  3CJI C;  3HN1 A;  5HXM A;  4IV1 A;  2GAU A;  2X8K A;  1VAM A;  4YZ2 A;  4B4Q A;  3AMQ A;  3OY8 B;  1HRV 3;  1KEX A;  1WLW A;  3JCI A;  1RYY A;  5DAW A;  1ASJ 3;  5A3W A;  3VDD A;  3GGL A;  1OFN A;  3ON7 A;  5FYT A;  4BK4 A;  4LBJ A;  2W92 A;  4GD4 A;  3UGF A;  2DVB A;  1SEF A;  4LNV A;  3WF3 A;  5A33 B;  2F4L A;  4GAZ A;  4MYE A;  2J1U A;  4QKB A;  5JMO A;  1O4Y A;  4YM3 A;  4FTS A;  3MID A;  3ZN4 A;  2ZGS A;  1IGO A;  1RUG 3;  4Q27 A;  5IAX A;  2BFU L;  3E6C C;  4CDU C;  3PUQ A;  5FMB A;  5CFC A;  5IFP A;  1A78 A;  3LA2 A;  4IQP A;  1NZC A;  3VKO A;  1OA3 A;  1N3O A;  2TNF A;  4N43 A;  1NCQ A;  3B5L B;  1SPP A;  1UOJ A;  3INA A;  4P5H A;  1WCD J;  1C28 A;  1S0C A;  3PIG A;  4XBL A;  2VBD A;  4O7X A;  4GJZ A;  4EZH A;  2G9F A;  3ZYI B;  1EAH 3;  1LR5 A;  3AZV A;  3O0X A;  1SLC A;  5D1I A;  3QH7 A;  1ZRI A;  1PHM A;  2Q8O A;  1DYK A;  2JX9 A;  4LUK A;  2ADD A;  2B9U A;  4DXR A;  1AJK A;  1AXY A;  5FZ8 A;  2WO2 A;  4CDX A;  1VBC 3;  3CIH A;  5G05 L;  1YHF A;  3OGS A;  1AR8 1;  4XPV A;  2Y6G A;  3NV2 A;  4QB2 A;  5EPA A;  4RYD A;  2XDV A;  3WDT A;  4LR4 A;  1O3R A;  2Z4F A;  1E57 A;  2RJK A;  5FYS A;  4BQ4 A;  2PLV 1;  3WDU A;  1UY3 A;  4QDQ A;  4B7K A;  5FPU A;  2JDN A;  3I2D A;  3RS6 A;  4XC9 A;  3DYM A;  1JZ3 A;  5C71 A;  1R08 1;  3VDC A;  5GM0 A;  3MIE A;  3THT A;  2XBO 2;  1Y9Q A;  4XTM A;  1Z0H A;  3OEB A;  2B8M A;  1HN1 A;  4E9K A;  3I7D A;  2BNN A;  1GNZ A;  1W8U A;  2C9K A;  2BNM A;  4J1X A;  1W03 A;  4RD7 A;  4RQP C;  5J09 A;  2SLI A;  3RJ2 X;  1QJZ A;  1GOF A;  3DGT A;  3ME2 A;  1JZ5 A;  2DFB A;  4CDQ C;  1XE0 A;  2CV6 A;  1K5M C;  5BNO C;  1FOD 3;  1J3P A;  2ZX3 A;  3AYE A;  3WP6 A;  2XJR A;  1NA1 A;  3FHQ A;  2QQJ A;  2PFW A;  3Q8C A;  1ULP A;  4YW7 A;  2IXI A;  2RDS A;  4QXB A;  4OHZ A;  2G19 A;  4Z07 A;  2VUC A;  5KXC A;  1VMH A;  1XE7 A;  2Z2S B;  4GMP 0;  1LRH A;  1WMF A;  2HWE 1;  4A6O A;  3MGU A;  4NRO A;  5T55 A;  4XEZ A;  4H3W A;  3WY6 A;  5I0R A;  3FN9 A;  3SHR A;  1WW6 A;  4YGE A;  3MZH A;  1HB4 A;  4TLF A;  4PDW B;  1TME 2;  4D7T A;  1BHG A;  1CAU B;  4RS5 C;  4Y22 B;  1W99 A;  3AXE A;  4GB3 2;  4GMP 1;  3RI8 A;  5ABJ A;  5FWJ A;  4NUB A;  4EQV A;  1JH5 A;  1MEC 3;  4Q4W 1;  1AR6 1;  3NJX A;  4A6S A;  2ARA A;  1W8W A;  3OB8 A;  3WNN A;  4C90 A;  4XIO A;  2B7Y A;  1G7Y A;  1DQ6 A;  4ZHN A;  2WNV C;  4KL1 A;  2R07 2;  3HNY M;  5EWS A;  2HWE 2;  1LOF C;  3A0N A;  5FYH A;  3VZO A;  3NV1 A;  5T52 A;  2XLF A;  4PLM A;  4DOU A;  4UT5 A;  2J1S A;  4G4F A;  1C5I A;  2ZAH A;  1PO1 2;  4KQ7 A;  4IGO A;  4NAO A;  3VDB A;  1N1S A;  3OPW A;  3WEZ A;  1GZC A;  4Q0S A;  2W91 A;  4FPH A;  5LA2 A;  3J7H A;  2OVU A;  4Z2A A;  1BMV 1;  1ZA4 A;  2FHR A;  1FX5 A;  4K8F A;  5DDJ 2;  1Y3T A;  1HXS 1;  2E53 A;  4LO4 B;  4XFB A;  4P00 B;  3HNB M;  3VBU C;  4M3C F;  4E4D X;  1HDK A;  2UWB A;  4HOO A;  3VKF C;  2VBB A;  3ACL A;  5HBA A;  2J7M A;  1EAH 1;  1O8P A;  3VV1 A;  3PIJ A;  2A75 A;  4WVM A;  4Y24 A;  4LO5 B;  4C0B A;  4Q4X 3;  3O1U A;  4FPC A;  4LBK A;  1QQP 3;  5DUX A;  1CJP A;  5F6K A;  3RWK X;  1K5M A;  4K8R B;  1SLB A;  1RIT A;  1UF2 C;  5ISL A;  3OPT A;  2UWA A;  3V64 A;  1J3R A;  1OLR A;  4JRL A;  3O0W A;  3T4H B;  3VKL A;  4H55 A;  5C4W B;  2VNG A;  2XH6 A;  5ABJ C;  4WM7 C;  3I3B A;  4IES A;  1WCQ A;  5C8W A;  1AL2 3;  5KWR A;  1ULO A;  2R07 1;  4P5Y A;  3AM2 A;  3AMN A;  2OZ6 A;  4MX3 A;  4GB3 1;  4MLO A;  2P3Y A;  5DDJ 3;  3EHK A;  3FFQ A;  5A3O A;  3IPV B;  2JDZ A;  2Y6J A;  2E7Q A;  1UY1 A;  2W95 A;  1H8T C;  2HEV F;  1MS5 A;  4P14 A;  4RR3 A;  4R8H A;  2HYK A;  4XJW A;  5FJH A;  3LF7 A;  1OI6 A;  4AVA A;  1UQX A;  4Q8L A;  2PHW A;  4C1X A;  1UKG A;  5FBJ A;  1IG0 A;  3OGR A;  4LO8 A;  2WJS A;  2WZE A;  4TXW A;  3RWN A;  3WF4 A;  1RMU 2;  3B9I A;  2E63 A;  4Y1V A;  1W8T A;  5FMO S;  3EB7 A;  3FLP A;  3W9A A;  1HXS 2;  5C9A C;  3RZM A;  1R09 2;  3RZH A;  3M3O A;  2ZAC A;  4QB1 A;  2VQT A;  3K51 A;  2BQP A;  4D6S A;  2EXH A;  3IT8 A;  1WUV A;  3IDB B;  3ILR A;  4Y1U A;  4JKK A;  5LK7 B;  4MGK E;  2A6Y A;  4QHO A;  2ERF A;  4I02 A;  1QJF A;  1JS9 A;  1UZZ A;  5HCB A;  2OII A;  3ZXG A;  2QNK A;  1TME 3;  5JI7 A;  1ZZ7 A;  2DYC A;  2JDH A;  3B93 A;  1MS0 A;  2OQ6 A;  4LLO A;  4PJY A;  3ZIX A;  4BCU A;  1QH7 A;  3N7M A;  4CPB A;  2ORZ A;  4XHX A;  4CP1 A;  3CJI A;  4LXL A;  1LGC A;  4AAX A;  4I01 A;  4NN0 A;  4SBV A;  1W04 A;  2CNA A;  2VD7 A;  3I3Q A;  5LK5 A;  1PNF A;  2VO5 A;  1CIY A;  2CGN A;  3HN3 A;  3GCW A;  4BB3 A;  3ZFE A;  1YI9 A;  2JE8 A;  5FPX A;  2YFZ A;  4QPI B;  2GNB A;  1RUD 3;  2W0X A;  4IGP A;  4IGQ A;  5D21 A;  2V72 A;  2ZGU A;  4A41 A;  1VLN A;  4RGA A;  4CRQ A;  1ZBE 2;  2JDU A;  1ND3 A;  3R05 A;  5DMY A;  1GZW B;  5I8T A;  3OGV A;  2EF6 A;  1L7L A;  2Z69 A;  3V0B B;  3PVO A;  2RM2 1;  2FMD A;  1N3P A;  5AVA A;  1NOV A;  3UJO A;  4NHY A;  3WP5 A;  1GLH A;  2WZP P;  4EWD A;  1S0F A;  2QQM A;  3K2O A;  3USU A;  2P3I A;  1G9C A;  5C3O A;  3JQW A;  2ZOE B;  3WF2 A;  3URF A;  3OEA A;  1C1F A;  3WNX A;  4K21 A;  3S30 A;  3VD3 A;  2MEV 2;  2DUP A;  2P6C A;  3CJX A;  5DAP A;  1MS1 A;  2DUO A;  1S1A A;  3KHC A;  2VCB A;  4XUT A;  3D82 A;  2YU2 A;  4LOT A;  1H4G A;  4AK3 A;  1HN0 A;  3AC0 A;  2JG9 A;  2Y26 A;  5JOW A;  1L3J A;  4OQ8 A;  1S2E A;  2R32 A;  3VBO C;  4P02 B;  1DZQ A;  3LOB A;  4GAL A;  4EN8 B;  1CPN A;  3ZM8 A;  4N8M A;  5SV8 A;  2PHL A;  4ARY A;  3KGL A;  3GJA A;  3CQO A;  2MEV 1;  2AZ5 A;  1RUH 2;  4GXL A;  4TYS A;  1BEV 1;  2GDF A;  5JCT A;  2PXJ A;  5FPV A;  4N7U A;  1XRU A;  4P9J A;  2WKK A;  5FYC A;  3WF1 A;  2XB6 C;  3GHN A;  2BW8 A;  4DNY A;  1DGR A;  1SCR A;  1GP5 A;  4FAH A;  4YW2 A;  2RS3 1;  4OFG A;  5C3P A;  1DG6 A;  1EUU A;  3LOI A;  1J1T A;  4QM8 A;  5CFD C;  4JGZ C;  4Z82 A;  2WL1 A;  2YYO A;  3TEW A;  1NYW A;  1QJX 2;  2MHF A;  2W1Q A;  2VTX J;  4EV0 A;  3NNL A;  1UXX X;  2ZBJ A;  1ZRD A;  1S2B A;  3ECQ A;  2UUR A;  2W08 A;  3DPR A;  3WNP A;  4NPL A;  5DG2 A;  3S5A A;  4BQ3 A;  3D4K A;  4S2H A;  3H1W A;  3MIC A;  2OXB A;  5A1F A;  3I54 A;  2FCU A;  2VNV A;  3AKT A;  3NKT A;  3LPF A;  5FUI A;  4UXA A;  1LHW A;  4DUW A;  1W05 A;  1KS4 A;  5FP3 A;  1HRV 1;  5F6L B;  3VBS B;  2HWB 2;  2GP5 A;  3ZXK A;  1Y43 B;  4YW6 A;  3I2F A;  3U37 A;  3GZT B;  4DZG A;  5I8Y A;  1FV2 A;  5K0U B;  2RVA A;  4Y22 A;  3PVE A;  4AI8 A;  3WHU A;  3FBY A;  3GYD A;  3SH4 A;  4FSJ A;  4W4Z A;  1JHJ A;  3ZXJ A;  5IVC A;  1AXK A;  4HBN A;  3U11 A;  1NCR B;  4KWU A;  5IVJ A;  2DCT A;  5FZG A;  5KXD A;  1UYP A;  1OPM A;  5C9A A;  4XQD A;  1W2O A;  1TEI A;  5CYY A;  1FV3 A;  1AR8 2;  1RXG A;  1VBD 3;  1WMD A;  4CCO A;  3ZFF A;  2CWM A;  4LBQ A;  4Z8B A;  5FTT C;  3R6S A;  4AAP A;  5LZ6 A;  1UY0 A;  4AVT A;  2ENR A;  4ZU4 A;  3WSO A;  2A3W A;  1LOA A;  1WD4 A;  1YQ2 A;  4AVS A;  5KHK A;  1VJ2 A;  2WT0 A;  4IEQ A;  4Y20 A;  3WW1 A;  3WDW A;  3HT1 A;  3PME A;  2JG8 A;  4Y26 A;  4OHW A;  4XF9 A;  4BWO A;  3NV3 A;  1W2A X;  2D3S A;  1NA1 C;  3WIN E;  5A6Q A;  5FMD A;  2VME A;  2WZR 2;  1VRH 1;  5FZ4 A;  2ZEW A;  1OKO A;  5LW9 A;  4B8E A;  2QUO A;  3M7A A;  3AK0 A;  4MOA A;  2PEL A;  3VDD B;  4BQ1 A;  4NRM A;  4B3N A;  1OOP C;  1V6K A;  2DUQ A;  2VUL A;  4JTO A;  1TE1 B;  2QQU A;  4UBH A;  2H6B A;  2W39 A;  1JOB A;  1LED A;  3PJY A;  5BNP C;  2DFC A;  2Y0I A;  3FE5 A;  4IV3 C;  4J25 A;  5GJ6 A;  1UO9 A;  2JIG A;  1C8M 1;  1CAV A;  2VVD A;  4UFJ A;  1XNA A;  1DQ2 A;  4XJ8 A;  3LD8 A;  1QJY 1;  3IIA A;  4P08 A;  3OGG A;  1C5H A;  2VZQ A;  2LTN A;  1PIV 3;  4QX7 A;  2WZR 1;  3MIG A;  2JE7 A;  4BXF A;  2VW0 A;  1MVE A;  2YB7 A;  3VD5 A;  3PU3 A;  3NL1 A;  1H2M A;  2XR4 A;  2C24 A;  2WNO A;  1Z78 A;  3IPV A;  4Q0Q A;  3VBH B;  3X29 B;  3LFI A;  4NIG A;  2ZAB A;  1AR6 3;  4CXY A;  5KHG A;  1RED A;  1BK1 A;  4IEX A;  4AL9 A;  4AVC A;  4CDX C;  3RYP A;  4CEY B;  3JB8 A;  1LGB A;  1CZS A;  1RUF 3;  2WWJ A;  1IZ3 A;  1YQ8 A;  4JTN A;  5CKM A;  1R08 2;  5FZ1 A;  3VZK A;  3ACI A;  3T2P A;  5FZB A;  2E26 A;  1BKZ A;  1IQD C;  2X5I B;  4AHY A;  3U0Z A;  1QDC A;  5L7O A;  4QXH A;  4CDW B;  3E6B A;  4N43 C;  3U07 A;  3VB9 A;  2EIE A;  2R1D A;  1YJK A;  2WFF 3;  3GBF A;  5FUP A;  4NID A;  4BQ2 A;  2RE9 A;  4PIZ A;  4NVP A;  2BBV A;  4PBP A;  2VL4 A;  1GUI A;  2H6C A;  1SMV A;  4AED C;  5FMO L;  4OUS A;  4XAC A;  1F5F A;  1UWW A;  4CA9 A;  2YHJ A;  2DVA A;  3TYJ A;  5A1A A;  3HQR A;  4CP2 A;  1JN2 P;  4HPK A;  1E5S A;  3FHI B;  5JSR A;  3S5Q A;  4LPL A;  4QKD A;  3HT2 A;  4CUA A;  4I0W B;  1LOE A;  1ZBA 1;  5G04 L;  5F2W A;  1VPH A;  5J3U A;  3MBW A;  3T09 A;  4DRV A;  3POJ A;  3BTY A;  3KCY A;  5JXJ A;  2VXJ A;  1LCL A;  1NX9 A;  2JD9 A;  3MEP A;  4MV2 A;  4COY A;  4BU2 A;  1QXR A;  2P3K A;  4NE9 A;  1W9T A;  4IW3 A;  1IHM A;  1KJL A;  2YC4 A;  3T08 A;  4COW A;  1U5Y A;  3DUI A;  5LBF A;  1LJ7 A;  2JEC A;  5KHH A;  1I6X A;  4CSW A;  3PUA A;  1QF3 A;  4CP0 A;  4YSF A;  2FD8 A;  2D44 A;  3A22 A;  3BI3 A;  1O4Z A;  1UYY A;  4Q0U A;  2YFU A;  4Q1R A;  4GA9 A;  1DGL A;  3ITQ A;  4IDZ A;  3NAP B;  3WNK A;  1UY2 A;  1V9U 1;  2KR2 A;  5T5P A;  2XVG A;  2HWD 3;  1O6U A;  1JYT A;  5FDB A;  4HLT A;  3HAG A;  3MLL A;  4N90 A;  5FFO C;  1KFX L;  3VBO A;  2ZCW A;  3POG A;  3H50 A;  1FI2 A;  5A7Q A;  5F9T A;  4XF3 A;  1O59 A;  1E5I A;  3DYO A;  2LAL A;  1PK6 B;  2VXR A;  5FUN A;  4ZU7 A;  2X53 S;  2GN7 A;  5DUV A;  4OHV A;  3WNM A;  3T0A A;  2IXL A;  1VBE 3;  1VRB A;  3AP9 A;  5GLV A;  2ZML A;  1POQ A;  2I74 A;  2NQY A;  1PGS A;  2X09 A;  5FZO A;  3BAL A;  2IZW A;  3C8X A;  4LE4 A;  1G9D A;  1ASJ 1;  3JD7 1;  4Q4X 2;  2D5F A;  3ZYF A;  3H3U A;  1NY7 2;  4QKN A;  4I3P A;  2NLR A;  2ZGM A;  3UKV A;  3FL7 A;  1CN1 A;  2OT7 A;  3TRS B;  1APN A;  3L9J T;  4OLL A;  4CTE A;  4IEY A;  3H1M A;  1NE4 A;  5ACA 1;  3NO8 A;  4E8C A;  5FPL A;  4GH4 B;  4UW3 A;  4NJ4 A;  1PMH X;  1EV1 3;  1VMF A;  4KMQ A;  2VMH A;  5LWB A;  3M3Q A;  1QEX A;  4MGT A;  4AFM A;  2YPD A;  4WZF A;  4NIH A;  1OD5 A;  5ACA 2;  3NJZ A;  2IC1 A;  4FXG B;  4PLO A;  4GWM A;  4HVR A;  2BGO A;  4P9W A;  5EFU A;  2RS1 3;  2VNO A;  2VW1 A;  2WQZ C;  4OI0 A;  1SLA A;  4FPY A;  4FXK B;  2Y0O A;  2FDJ A;  3GZE A;  1M06 G;  1VAK A;  3VL9 A;  3HEI A;  4AR2 A;  3DEC A;  2IFW A;  3VBU A;  4UOJ A;  2ZHM A;  3AFK A;  5AC9 2;  2ZX2 A;  2RS1 1;  2NYY A;  2X5I A;  4HG6 B;  5FY7 A;  3III A;  3RMY A;  4NPR A;  3VBR C;  1RIN A;  1V70 A;  4DUV A;  3JU9 A;  1ENQ A;  4RQP B;  3MI8 A;  1WLT A;  3PUS A;  4HSL A;  3LPG A;  4V2W A;  4YVW C;  4AED A;  4XF1 A;  4U36 A;  1OA4 A;  3I3E A;  4RR3 B;  1W6Q B;  2BZD A;  2WT1 A;  4WM8 C;  1I9R A;  5D8A C;  5ABJ B;  3EBR A;  1A8M A;  3GHM A;  1OVP A;  2X05 A;  5GKA C;  1K5M B;  1TG7 A;  4PF5 A;  2BPA 2;  2ZTN A;  1H1I A;  3O14 A;  4UWD A;  3ZSJ A;  5ACA 3;  5AFE A;  1MR5 A;  5A7P A;  2HWF 2;  2W52 A;  3T4V A;  1O7F A;  2XKO A;  1KXG A;  4XJZ A;  4FP2 A;  1W8N A;  1WW7 A;  2Y60 A;  4QKF A;  3BB6 A;  2EIC A;  2WSU A;  3ZMO A;  4XAB A;  4FPL A;  2ARE A;  1SFN A;  4MO3 M;  2XLA A;  4LIV A;  5A7S A;  2FDG A;  1Z7S 3;  5FXV A;  5FY0 A;  1RUH 1;  3POE A;  2WNU B;  1RUJ 2;  1CPM A;  4FFF A;  5FRE A;  3OYW A;  5BXX A;  1UZW A;  2AH2 A;  3UV9 A;  4GQ7 A;  1RUI 1;  2WWU A;  3I3D A;  4HKO A;  2GC2 A;  1V0A A;  2BYV E;  4HAN A;  4I0B A;  1OHF A;  2BGC A;  4CDW A;  5AFB A;  3WG2 A;  2VZV A;  1QJU 3;  3SEP A;  3JBG 3;  5FO7 B;  4CCL A;  4ZZ8 A;  4V2V A;  2WNV B;  2VOV A;  4R52 A;  4X6Q B;  1T6B X;  2BWC A;  4FFI A;  3KWV A;  5IJR A;  1GQG A;  5LAT A;  1BBT 2;  1ND2 B;  1PX3 A;  3AKQ A;  2LRO A;  3ZSK A;  1ZBA 2;  1ENR A;  3O5S A;  2SBA A;  1ONA A;  4IEW A;  1REE A;  4M0N A;  4CEW A;  5JZG B;  1IQA A;  2ES3 A;  1UOF A;  3OUI A;  1O5L A;  3KSC A;  4W8J A;  3HJR A;  4AW7 A;  3ZO0 B;  1V6J A;  4FPO B;  1Q8V A;  1UU6 A;  1WLD A;  3KD4 A;  1B35 C;  2DF7 A;  4W6W A;  1ZZ6 A;  4GWJ A;  3LQC A;  1ULE A;  1OF4 A;  2JG8 C;  4IE6 A;  3T1L A;  3VBU B;  3SNM A;  5A7O A;  2ILM A;  3FLR A;  3S57 A;  2J1R A;  1OBN A;  4B1L A;  4AQT A;  5E88 A;  3ZYR A;  4EN0 A;  1L7R A;  4AFD A;  1W28 A;  1S0G A;  3POW A;  4XOG A;  4IND A;  5D2A A;  2F6B A;  4UI9 L;  3AKP A;  3M3C A;  5EZW A;  2B4K A;  2F17 A;  3ZFE B;  1QQP 2;  2VVE A;  3F2Z A;  5LA0 A;  3CDZ B;  4F7Z A;  2ORX A;  2CDP A;  5E8A A;  5IW0 A;  5C4W C;  2IUW A;  2JG9 C;  2XVL A;  2VGD A;  1IS3 A;  3M1H A;  3VBH A;  4CU8 A;  2IVJ A;  4OUE A;  4WM7 B;  4K1Y A;  4AGR A;  1LOD A;  3ZPO A;  4MXV A;  2PTM A;  1C8N A;  2WIN B;  5LRR A;  3V0A B;  2WZ8 A;  4PIY A;  2JD4 A;  1US3 A;  4A4A A;  4AFB A;  5CZK A;  3BTZ A;  4RGK A;  3T30 A;  3K48 A;  3O1O A;  2Y33 A;  3N7K A;  1HB1 A;  1XB9 A;  3Q8E A;  4NHX A;  5L7O B;  1F4A A;  2K0G A;  4AQ6 A;  2Z5W A;  1VBB 2;  1ND3 C;  1J1L A;  2RR1 3;  2D97 A;  1HV0 A;  3TBD A;  3OJB A;  3MLK A;  4MGI E;  4OCT A;  3WP3 A;  1JYX A;  1XBF A;  1OLQ A;  2WYS A;  2Q8D A;  4M01 A;  2Q1F A;  4OI2 A;  3CNA A;  5DPN A;  3VBF B;  5IFT A;  5FZK A;  1G9A A;  1AL2 2;  3RZG A;  2UWC A;  4IE4 A;  3RZZ A;  2A71 A;  4NIA A;  1OKQ A;  4AVV A;  3DXT A;  3J8F 3;  5T50 A;  1SQ4 A;  2EA7 A;  2QBX A;  3KQR A;  3NAP A;  2HBT A;  2QQN A;  3RPQ A;  4N53 B;  1W9W A;  5FAX A;  1B09 A;  1N47 A;  3NNG A;  4FPG A;  1ENS A;  1RC6 A;  3MUY 1;  2NM1 A;  3D0S A;  4DUX A;  2XPJ A;  1AR7 2;  5EIY B;  5CAZ A;  4CYD A;  1J3Q A;  3LIH A;  4MZU A;  4BM8 A;  5FXZ A;  4CPB D;  5FLH A;  1ULG A;  4QDS A;  2WNU A;  5FPA A;  3HPN A;  5CVR A;  4O9G A;  4QWN A;  2GC0 A;  1AR7 3;  3TN9 2;  3THP A;  4BK5 A;  3O1V A;  3FHA A;  4LBO A;  4RHV 2;  4RFT 0;  1DCS A;  1NE6 A;  5F32 A;  5A32 B;  1H9W A;  4TTG A;  1MZ6 A;  1XND A;  2C0Z A;  2GH8 A;  2VZT A;  3KLS A;  4EN7 B;  2YGM A;  2JEM A;  4IET A;  1QJY 3;  4S2G A;  2PLV 2;  1YI7 A;  1ND2 A;  4IE7 A;  1BQP A;  1Q8S A;  4JDO A;  2Q30 A;  4BPZ A;  1RUF 1;  2GNT A;  3RZK A;  3G7D A;  1QJY 2;  4TSV A;  4X8P A;  4L99 A;  1WA4 A;  3QCW A;  1D0G A;  5A33 A;  1W8Z A;  1VBB 3;  2DTY A;  2EID A;  1IG3 A;  2MNG A;  1MPX A;  3OOX A;  5JDB A;  3BUC A;  2GN3 A;  4W6X A;  2FDH A;  1GIC A;  2VCM A;  3HOB A;  3N9O A;  1NY7 1;  2OPW A;  1N1Y A;  3BVC A;  3PU8 A;  5F3I A;  2VOX A;  1UKR A;  5CFC C;  2ZGO A;  2GME A;  3RMX A;  4ATE A;  5JPM B;  3H0O A;  4XYX A;  4CDQ B;  2C26 A;  4LTA A;  2JB4 A;  5GLW A;  3J4U H;  2JDP A;  4TLG A;  5F2S A;  3WXP A;  1AR9 1;  3ZN6 B;  4KI5 M;  4CUB A;  3TB0 A;  1W0O A;  4FQZ A;  3ZN6 A;  3UGH A;  2JIC A;  3E5Q A;  4JHZ A;  4CU9 A;  5LCW L;  1ZYB A;  4M3C B;  5FKB A;  1AL2 1;  2Z42 A;  4AI9 A;  5FYY A;  3WOG A;  3WHT A;  4LA3 A;  3H8R A;  4L11 A;  4IV1 C;  4JC1 A;  3ETP A;  1EP0 A;  1OLM A;  1VBD 1;  2HWB 3;  4PDW C;  1HQL A;  1XNK A;  4ZZ5 A;  1ZZ8 A;  2LUW A;  4F83 A;  4XET A;  4OMC A;  1GQP A;  2WYF A;  3KCC A;  5FIX A;  4JRA A;  5HXV A;  1LHN A;  3BIE A;  1HQN A;  2P4E A;  1JYW A;  3GDB A;  1DZR A;  1UU4 A;  4YRD A;  3ZXD A;  2ZEX A;  3LCP A;  3VL8 A;  3JXS A;  5I93 A;  1RUF 2;  3PDQ A;  1MZ5 A;  5F8P A;  3H3Z A;  1H4H A;  5IVY A;  3PJQ A;  5L9B A;  1W9S A;  1CWP A;  4DRR A;  1RTV A;  1VIW B;  1BBT 3;  3E1F 1;  1RVF 3;  2JDK A;  2UY8 A;  3AKR A;  1JZ8 A;  1LUL A;  1US2 A;  3T1M A;  2XWB B;  3WR0 A;  4R9D A;  2G4I A;  1FPN 2;  2WFP A;  2WNV A;  2EIB A;  5A6Z A;  1BMV 2;  1U5Z A;  1S0B A;  3SKV A;  4AQS A;  2VZP A;  3H3L A;  1CAV B;  1YIF A;  3IAP A;  2V5D A;  1SDD B;  3NNJ A;  4EE2 A;  4HKL A;  2OUJ A;  2BGP A;  3EXU A;  5FZC A;  3G6J B;  1RUE 1;  2PAM A;  2RS5 1;  2VCA A;  4I2O A;  4FTB A;  1X50 A;  3AZX A;  1IS5 A;  3NQH A;  5LY2 A;  1D7P M;  2RV9 A;  3NST A;  4LK6 A;  3EQE A;  2Y64 A;  5LBC A;  5I0D A;  4KG8 A;  2WWS A;  2HWC 1;  1XNC A;  2P34 A;  1NCR C;  5A7W A;  2BOJ A;  4GMP 3;  2CGP A;  1NZI A;  1OFS A;  4ES9 A;  3LWC A;  1OOP A;  5LBB A;  5HCH A;  3OF1 A;  3GBG A;  5F3E A;  4FPJ A;  3NNM A;  1YQC A;  2YXS A;  4IE5 A;  1LHU A;  1XNT A;  1AUY A;  1W6M A;  3B3Q E;  5BV6 A;  1UYZ A;  4JGY B;  4DO0 A;  3Q9O A;  1O5U A;  1QJX 3;  1X8E A;  1GYK A;  2IXH A;  2ZX4 A;  5HV4 A;  1HRI 2;  1H1M A;  1F8V A;  5J7M A;  4Y1Y A;  1ZVF A;  4XF4 A;  2BBA A;  5LBE A;  1U0A A;  3WD5 A;  2XBO 3;  1GBG A;  5CB7 A;  4FOY A;  4E27 A;  2BDR A;  2D40 A;  2PQS A;  1QOO A;  2VH9 A;  2OYZ A;  4AVB A;  2RR1 1;  2F4P A;  1PGL 1;  1D4M 3;  1ZBE 1;  3KV6 A;  3WNO A;  5GZD A;  2VPV A;  1ZBE 3;  3N7J A;  1YFU A;  4P9X A;  1NCR A;  4QM9 A;  5J98 B;  3WVJ A;  1QMJ A;  1FMD 2;  1GFF 2;  5C9A B;  5JSP A;  3HQU A;  4YZ4 A;  5JSO A;  1BVP 1;  4ZY9 A;  3GM8 A;  2A6X A;  3JBG 1;  5FZ3 A;  2P1B A;  5F3G A;  1CZV A;  2QFE A;  1RUC 2;  3BOP A;  2ZGP A;  2WBK A;  1TME 1;  3FC0 A;  4GKY A;  2HWF 1;  2VZS A;  3E97 A;  3N9M A;  3B69 A;  2WQ4 A;  3AYA A;  3HMY A;  3KF3 A;  4NHK A;  2DVG A;  5FY5 A;  2UY9 A;  3ES4 A;  3H7Y A;  4KWJ A;  2VVF A;  2B5H A;  3KV4 A;  4QXC A;  3LA3 A;  1LHO A;  5FBZ A;  1K42 A;  3DYP A;  4HZF A;  4R4X A;  5FOJ B;  2V4A A;  3MW4 A;  1WBF A;  2BV4 A;  4O9E A;  3VBH C;  1W6N A;  1I1E A;  3KT7 A;  2O14 A;  1WWY A;  2VZU A;  3POI A;  2MEV 3;  3OY8 A;  4H2A A;  5C4W A;  4UW6 A;  5DXD A;  4OMD A;  3UES A;  1YLL A;  2ZGK A;  3Q8A A;  3VKM A;  3U4S A;  1MVQ A;  4CEW B;  4NHM A;  4D7Y A;  5DG1 A;  2VMG A;  3MV0 1;  1RVF 2;  2A73 B;  3MW2 A;  4OUL A;  2JXA A;  2RJ2 A;  3MF6 A;  1HLC A;  5GAL A;  3I3M A;  4QHZ A;  1EYB A;  2JIJ A;  3MFC A;  4QPG C;  3OD0 A;  2X5I C;  1P8J A;  4SLI A;  5DDJ 1;  4RA0 A;  3A4U A;  5EJ3 A;  3ETQ A;  1MS3 A;  3DKW A;  5K0U A;  1W9Y A;  1MAC A;  3USS A;  4N43 B;  1TMF 1;  3GZU C;  4CDQ A;  3AP6 A;  5HCA A;  3ZSM A;  3BOD A;  1LOG A;  1TQ5 A;  1W8H A;  4OZO A;  4WVV A;  4A3X A;  1JW6 A;  2XJU A;  5C8C C;  1ODN A;  1G9F A;  2ZS6 B;  3PLQ A;  3DPR C;  3KT1 A;  3K4Z A;  4JX0 A;  4AI1 A;  4LO7 A;  3ES1 A;  1H2N A;  4HVQ A;  4OHX A;  2X10 A;  2EIG A;  4ASK A;  1UIK A;  3LE0 A;  3QAC A;  5ANN A;  1AYN 2;  3HQX A;  4A7Y A;  2XUM A;  1G86 A;  2R06 2;  2GU9 A;  4Y5T A;  4XUO A;  4LHN A;  4M4P A;  4NRQ A;  1Y9G A;  5L9R A;  4FT8 A;  4XDP A;  4R9C A;  4QT6 A;  3ZR5 A;  4B4R A;  3SEE A;  1PMJ X;  5F5C A;  2CL2 A;  4AI0 A;  1GKB A;  4PHZ A;  4LBN A;  3A7Q A;  2DU0 A;  3C7E A;  5DAB A;  4ISQ A;  1IKP A;  4HET A;  1VBC 1;  2IXK A;  1RUC 1;  2XON A;  4FAG A;  4QX1 A;  4QAW A;  4CCD A;  1KDM A;  3R4U A;  2UYA A;  2PHX A;  2HH9 A;  5CIS A;  4MGQ A;  4AXO A;  1UX6 A;  2W46 A;  1R1Z A;  4GWI A;  3V0B A;  4HK8 A;  5FZM A;  2XQR A;  3A21 A;  4XUN A;  1JYC A;  1NCQ C;  1KDK A;  3PUH A;  5IWF A;  5I91 A;  3O12 A;  3POS A;  2ID4 A;  5FY8 A;  2AAC A;  2ZEZ A;  2VZ1 A;  4JGZ B;  5DAV A;  2PHD A;  4XDQ A;  4QQ2 A;  1DU3 D;  4IEZ A;  2XJV A;  2BRT A;  4BIO A;  5K9Y A;  1HIX A;  1VP6 A;  1PX4 A;  1IPJ A;  2W1S A;  3CF6 E;  1KS5 A;  3AJZ A;  1TNF A;  2XHK A;  5EV7 A;  1AL0 G;  4DB5 A;  3LGR A;  4HPK B;  4Z2W A;  1QXP A;  4QPW A;  4QB6 A;  2VEC A;  1R64 A;  3ENR A;  4XVH A;  5DZE A;  1OH3 A;  2QQL A;  4YVW A;  4JQR A;  5H9S A;  2R04 3;  2RMU 2;  4RSU A;  1UAI A;  3ZSE A;  5IAT A;  4Q4V 2;  3VBS C;  1COV 1;  3SH3 A;  1UPI A;  4FPF A;  3B00 A;  4BME A;  4XFF A;  2XXZ A;  5AC9 1;  1IS4 A;  4OVE A;  4GH4 C;  4DIQ A;  1V6M A;  1RUN A;  2R06 3;  1Q56 A;  3KMH A;  4CCN A;  1I3H A;  4QX3 A;  4XAE A;  4XHB A;  5J37 A;  5IYY A;  3D3A A;  4J1W A;  1HXS 3;  3ZVX A;  2W94 A;  3KGZ A;  2C6S A;  5A3N A;  1COV 2;  1VBA 1;  5J36 A;  1N1V A;  2HBU A;  4AGV A;  2WA3 A;  4YG3 A;  3IDA A;  2ZHK A;  2A3X A;  4WVZ A;  2XJT A;  2AUY A;  3NJV A;  4MG2 A;  1X8M A;  2D6M A;  1DQ1 A;  4QDR A;  5FZ0 A;  4ZXK A;  4LO6 B;  2VW2 A;  4LBM A;  2P6H A;  3AZZ A;  4JKL A;  5I0U A;  1AZD A;  1WD3 A;  3AX4 A;  4LLF A;  1JMU B;  2HWE 3;  4CCJ A;  2FZ1 A;  1JU4 A;  3B7M A;  1UZY A;  1QNW A;  4ZS2 A;  4HN0 A;  3VBR B;  3Q8F A;  5LRS A;  2WS9 1;  1CJD A;  3M4F A;  4YM0 A;  1POV 0;  1MEC 1;  2DCY A;  3MYX A;  4RR3 C;  4UFI A;  1NT0 A;  2HYX A;  5DQ0 A;  3LDR A;  1BLZ A;  4YVS C;  2W1W A;  1NAE A;  4JCK A;  3FMG A;  5L9V A;  1BEV 3;  1O91 A;  3M3I A;  1JYI A;  2WS9 2;  2ARX A;  3ZYB A;  4EWA A;  1JUI A;  4E4H A;  5FZF A;  3AXD A;  1C57 A;  4AYU A;  4O65 A;  1YYN A;  4Q8K A;  2GNM A;  1HJF A;  5FWE A;  5ERL A;  1DP0 A;  2E31 A;  4XXA A;  5E89 A;  3SC7 X;  4J6G A;  4HVO A;  3RYR A;  4N53 A;  2WA4 A;  5KC5 A;  5A7W B;  3V0A A;  3VLB B;  2WNU C;  4IV3 A;  1GSL A;  5FP4 A;  1WW5 A;  4IV3 B;  2CU5 A;  4AEJ A;  5CEH A;  4UF0 B;  1B35 A;  1DBN A;  3TNP B;  3GCX A;  3ZLI A;  4NO4 A;  1F5J A;  5GZF A;  3W21 A;  2EXK A;  4I09 A;  2JE9 A;  4FFG A;  3I8T A;  2NMN A;  1NLR A;  2ET1 A;  2BER A;  4KU8 A;  1RXF A;  4F8A A;  3ZPY A;  5C8C A;  3E5X A;  2OS2 A;  4AGG A;  3SCG A;  2VMF A;  4BQX A;  2C1F A;  1SFY A;  2PQQ A;  2PN5 A;  2BNO A;  5A1L A;  3MF9 A;  4COU A;  1XYP A;  1AYN 1;  3LB9 A;  1N1T A;  4XFA A;  3TAY A;  4AFA A;  1VAL A;  3SIT A;  4GKX A;  5E1R A;  4CDX B;  3EYP A;  3UL2 A;  5JZG C;  1D4M 2;  2DVD A;  1GR3 A;  2RG4 A;  3RG0 A;  4QU2 A;  3UKT A;  2FDF A;  3ZFG A;  3T0D A;  1MEC 2;  1UOG A;  4XUR A;  4XCA A;  1YQ6 A;  5C3R A;  1DIW A;  3AVS A;  1UMZ A;  2K2S A;  4FFH A;  4YM1 A;  1B35 B;  2R07 3;  1ULF A;  2HLE A;  3IMM A;  4WZC A;  1RGS A;  4L92 A;  2JG8 B;  2QQO A;  4M0H A;  4IEO A;  4OI1 A;  4ZON A;  3ZYG A;  5JPN B;  1DGW X;  5LEJ A;  1KGY A;  1ODM A;  2PAK A;  4LOR A;  4RHV 1;  3I2O A;  1DHK B;  1DQ4 A;  3TEZ A;  3AL5 A;  2VOK A;  2G9G A;  2GC3 A;  1AJO A;  2XJQ A;  1H30 A;  2VAU A;  3DL3 A;  3N3H A;  5A7N A;  1W06 A;  3B94 A;  3O1P A;  3K3O A;  4UW5 A;  4W65 A;  1W2T A;  3PL0 A;  1Y4W A;  3ZIW A;  2XJP A;  4BA6 A;  1I5P A;  2QDR A;  3ZFG C;  2YBK A;  3J9S A;  3LEM A;  1S0J A;  4COZ A;  3D6E A;  5FZL A;  3L2Y A;  2R04 2;  4DIN B;  3J7N A;  4XFI A;  4KGG A;  1XU1 A;  1RUC 3;  2WN3 A;  3LFM A;  1RUG 2;  4MXW B;  5FP7 A;  2BEO A;  4OQ9 A;  4K6B A;  4BMB A;  1WMX A;  1E5H A;  1ZA7 A;  1UL9 A;  3WG3 A;  4KWL A;  3DF0 A;  4GUL A;  2CYF A;  2GP3 A;  5JZG A;  5KHI A;  4PDW A;  4CP9 A;  2VZO A;  5BNP A;  1XPW A;  3I59 B;  1J58 A;  3SIS A;  1IOA A;  4UAP A;  2BFU S;  2UYB A;  1UCX A;  2XVK A;  1ND3 B;  2ZHL A;  2JDA A;  2E9Q A;  4I30 A;  5FV3 A;  4BQ5 A;  4FO9 A;  5GZG A;  1LKN A;  2R0F A;  4E2Q A;  1OUS A;  2YBS A;  2EAK A;  1C8M 3;  4L8Q A;  4ONU A;  1XQN A;  2E33 A;  2YZ4 A;  4Q26 A;  4CVU A;  2GMM A;  3K75 B;  4RQP A;  4ZS3 A;  3ALQ A;  4CEY A;  4CCE A;  4C91 A;  5M0T A;  3WLU A;  1PK6 C;  3OCP A;  4H14 A;  2AGS A;  3U1X A;  2D93 A;  1F35 A;  3O1T A;  1UPS A;  2PMW B;  4N53 C;  2JJ6 A;  1GWL A;  4Q0V A;  5JWP A;  1LEN A;  1KJR A;  1YXW A;  3R4D B;  3VZJ A;  2VE1 A;  4YVS A;  1W6M B;  1WGP A;  2A6V A;  2D6N A;  2GZW A;  3A23 A;  2J1A A;  1G6N A;  3ST7 A;  2ZKL A;  5C6C A;  4FQ4 A;  1G9B A;  1QXJ A;  2OKX A;  5FPZ A;  5FZE A;  2D6K A;  3O1S A;  3ZXL A;  2A70 A;  3UT0 A;  3NMB A;  5HV0 A;  1EY2 A;  2VMI A;  3V56 A;  5C7G A;  2CDO A;  5FCC A;  1VAV A;  4KBB A;  1JU3 A;  3K4A A;  3U75 A;  3LIG A;  1MS8 A;  1UN1 A;  3EJK A;  1RUE 2;  2RS5 2;  3ELN A;  3K3N A;  1XJA A;  3N9Q A;  4QQP A;  1FMD 3;  2A6Z A;  1WME A;  4X8N A;  1TMF 3;  5FYM A;  4JKM A;  4LKE A;  2RDN A;  1RB8 G;  1GMM A;  4DPN A;  4Y1Z A;  1DZT A;  1SZB A;  5CU1 A;  3ZSL A;  5FXW A;  3ZKU A;  2WR9 A;  1HX6 A;  1XC6 A;  3NW4 A;  2Q1M A;  3FWE A;  1VE0 A;  2Y6L A;  3RJR A;  3T2O A;  5LEK A;  1R1A 2;  2VR4 A;  2WN2 A;  2ZEY A;  3GNE A;  2JDM A;  3FFZ A;  3W5M A;  4DXT A;  5GLZ A;  5J96 B;  1AYM 3;  3H42 B;  1F15 A;  5FP9 A;  4YVW B;  2HWD 1;  4FPK A;  1A3K A;  3KVB A;  1SBF A;  2WDB A;  5H9Q A;  2O8O A;  4PQQ A;  4E4S A;  2Y8K A;  4N7I A;  3TEY A;  1CIW A;  2Y6F A;  2ZAA A;  4LJH A;  1MS9 A;  4HN1 A;  3VDA A;  1RHI 2;  2I07 B;  2GND A;  3I2H A;  2G1M A;  4KWK A;  2KM2 A;  4CU7 A;  4LKS A;  4JDN A;  1AF9 A;  1U5I A;  1PGL 2;  2GC1 A;  2W87 A;  4BQW A;  1SBE A;  2WAB A;  4NHL A;  1QY4 A;  2RHP A;  1X33 A;  1Q8P A;  2CGO A;  1YWK A;  4MVT A;  1S55 A;  3IZO A;  4K20 A;  4YFZ A;  1BZW A;  1H0B A;  4IV1 B;  2YMZ A;  5GLU A;  1K5J A;  2XKP A;  1A8D A;  4U2A A;  3IN9 A;  1SFP A;  2OPK A;  1KRI A;  1BK0 A;  5BNN C;  4YZ5 A;  4AOC A;  1PM4 A;  2RMU 3;  3LEG A;  4XIK A;  2NZ9 A;  4GIQ A;  1YUD A;  5JVV A;  3BKZ A;  4MET A;  5GZC A;  2WSV A;  3N7L A;  2IXJ A;  1K3I A;  1BEV 2;  2RM2 2;  2B42 B;  1D2S A;  1Q5O A;  2V5Y A;  2XGX A;  4LIT A;  3HWJ A;  4IEP A;  4KNC A;  4TZD A;  1NXM A;  4NR1 A;  4XXP A;  2N7G A;  2VY0 A;  2BU9 A;  1D4V B;  1LGN A;  4NWV A;  3I49 A;  3WNL A;  2MPF A;  3FBM A;  5JR2 A;  1ND2 C;  3GF6 A;  3IBM A;  3OD4 A;  3LDB A;  2CY6 A;  4ZKT B;  2R04 1;  3DEM A;  1OD3 A;  4YGD A;  2O8Q A;  4YG6 A;  5GZE A;  2PLV 3;  1F9K A;  5I0T A;  4MAD A;  4ASM B;  2GSY A;  5A3U A;  3NV4 A;  4GB3 3;  1UIJ A;  2EXJ A;  2WLQ A;  4FCA A;  2AEZ A;  2WUH A;  3ZDS A;  3PTY A;  3UK9 A;  2HWC 3;  5C5U A;  2E51 A;  1RVF 1;  2VMD A;  4CE8 A;  1OQ1 A;  1HJG A;  4MGS A;  4PIX A;  3M2M A;  4CZS A;  1EAH 2;  2QE3 A;  1UD1 A;  3AMH A;  4YG0 A;  5F39 A;  4UFM A;  2OW4 A;  1JZ4 A;  2XBO 1;  2QQI A;  4F3J A;  1DYP A;  3OUJ A;  4R9B A;  4E4Z A;  1NG0 A;  3WDV A;  2VQA A;  3MFA A;  1BVV A;  3OBA A;  1AX0 A;  2P2K A;  1MQT C;  3MW3 A;  3TN9 1;  3ZFE C;  3FUQ A;  4HK9 A;  5I0S A;  1CQ9 A;  1ACC A;  1QU0 A;  3WQ1 A;  2KD7 A;  1YO8 A;  2HEY F;  2AEN A;  2ZX0 A;  2QQW A;  3J8F 2;  3HBK A;  4D6R A;  4DMI A;  5BY5 A;  1W0P A;  2WFF 2;  4LK7 A;  3N9L A;  4JGY C;  3UNP A;  3VHR A;  1OLM E;  5FO8 B;  1WZX A;  1WA6 X;  2Q8E A;  5HPO A;  3WQ7 A;  1IKQ A;  1WBL A;  2CAU A;  5FY4 A;  3T0B A;  5IVB A;  3U4X A;  4IXL A;  5JOZ A;  3CJI B;  5IVE A;  3BN6 A;  1AR9 3;  2VM9 A;  4D94 A;  1K45 A;  4Q4W 2;  5I8S A;  2DUR A;  1W6O A;  5L7O C;  2C9A A;  2XHN A;  4PBO A;  1CR7 A;  4ATF A;  3WCR A;  1A34 A;  2CWS A;  1VMJ A;  4IE0 A;  2Z79 A;  1T2X A;  1FT9 A;  2VOW A;  3OG2 A;  5LAS A;  1RUI 3;  3OPZ A;  4Y33 A;  1OH4 A;  3VBF C;  4D69 A;  4M3C E;  1L7Q A;  1W6N B;  5DAQ A;  5T5J A;  1VBB 1;  3W59 A;  1SLI A;  1RUH 3;  4YPJ A;  3GBW A;  3VHO A;  3MPP G;  3PVB B;  1LEM A;  4WM8 A;  2YRO A;  4UYB A;  3ILN A;  1LES A;  1JOP A;  1W3V A;  1QDO A;  2UU8 A;  5FK7 A;  2QCS B;  2QDN A;  1SHW B;  1J83 A;  3KV9 A;  3GZA A;  3BYW A;  1RIR A;  1RJ8 A;  5A70 A;  3ZXE A;  4HFS A;  1NQD A;  4E8D A;  1UZ0 A;  4QQL A;  1O3T A;  1AYN 3;  4RL7 A;  1V6I A;  4UW4 A;  3AZY A;  3NNF A;  2YPJ A;  3CHX A;  4AHX A;  3HR9 A;  1GNY A;  5FZO B;  3AMP A;  2DVF A;  4Y20 B;  5F5I A;  4Q5O A;  4LIU A;  4XUP A;  3JD7 3;  3U14 A;  1LU2 A;  1PO2 2;  3AJY A;  4EN9 B;  3OSD A;  1PO1 3;  3D0J A;  4CEW C;  4HT1 T;  1YNA A;  5FY1 A;  3P1I A;  2ATF A;  1ZRR A;  2WO3 A;  2J1T A;  3APB A;  2ZZQ A;  4BXS V;  3HBZ A;  1LEC A;  2XLG A;  5FYZ A;  4QPG B;  3ZN5 A;  1DDL A;  3VZM A;  5J1X A;  1OUX A;  4E2G A;  3PUI A;  1O8S A;  1ALY A;  1GP6 A;  3MHZ A;  4QX0 A;  3ZFF B;  5GLT A;  4AF9 A;  2ZXQ A;  2YV8 A;  3S7E A;  3W20 A;  1AR6 2;  2HKX A;  2Q8C A;  4QPY A;  1BJQ A;  2QZ3 A;  5C3Q A;  1VBC 2;  5FJK A;  1EV1 1;  2DBN A;  4UF0 A;  4B7E A;  3JBG 2;  3DKQ A;  2PHU A;  4LBQ D;  5EP9 A;  2WAA A;  4ITC A;  2RS3 3;  4A7Z A;  4Q0P A;  5CFC B;  1YIP A;  3JQX A;  4RN5 A;  2DBI A;  5CG9 A;  1QKQ A;  4Y5S A;  5FZ6 A;  1F2N A;  1GOH A;  4R9A A;  4Y4R A;  1YFY A;  4OI4 A;  4URT A;  4MUV A;  2FDK A;  1ENX A;  5J48 A;  2J22 A;  1JZ2 A;  1DLL A;  2OUH A;  1VBE 1;  4Z92 B;  1JXN A;  1JOJ A;  4K7J A;  3BPZ A;  3ZX7 A;  2ZPX A;  4RS5 B;  3TEX A;  1I5Z A;  2H0V A;  4NPM A;  4PQ9 A;  4TN7 A;  1FAT A;  4ZU5 A;  5D8A A;  1H9P A;  1V6L A;  4OYU A;  3B01 A;  2ZGR A;  3ZYH A;  5F1R A;  1VBE 2;  3I2G A;  4PI0 A;  1XNB A;  5JIA A;  4BQY A;  2ZMN A;  4QX8 A;  1CON A;  1X36 A;  1X82 A;  1QOS A;  3EO6 A;  1HRI 1;  1O4T A;  1DFQ A;  3CZU A;  1XYO A;  3VGI A;  3MV1 1;  5F37 A;  2DDU A;  2YUE A;  1QNY A;  4IL7 A;  2BTV C;  1NCQ B;  2W47 A;  4XE9 A;  1UNB A;  4BE3 A;  3CEW A;  1LTE A;  1NKG A;  4R4Z A;  5BUV A;  3F95 A;  1D4M 1;  3PTR B;  1HRI 3;  1W90 A;  2GH2 A;  5FLI A;  5FP8 A;  1QJU 2;  1F4H A;  5AC9 3;  5EYX A;  1GV9 A;  1V00 A;  4AWD A;  1V9U 2;  2J1V A;  4C0H A;  4EYU A;  5BNO A;  1CX1 A;  4D0Q A;  3SKJ E;  5DAX A;  2ADE A;  2YU1 A;  1WKY A;  3WW2 A;  5LB6 A;  3POB A;  5JAX A;  1PMI A;  1ZZ9 A;  2WAO A;  3MO4 A;  4JGZ A;  1RUJ 3;  1VBA 2;  5CFD A;  1FNY A;  1K12 A;  2FBE A;  2R16 A;  2VQ0 A;  4Z1V A;  4QQO A;  4BOW A;  5IHR A;  5JR7 B;  1W3X A;  4BLI A;  1RUD 1;  3AFG A;  3AP5 A;  1YRZ A;  1GZ9 A;  4LKF A;  3GXU A;  4GZ9 A;  1X9P A;  2C5D A;  3WP4 A;  5EXO A;  4ERO A;  1RJ7 A;  2I2S A;  3HD8 B;  2OZJ A;  5CNA A;  1WW4 A;  4X6R B;  4DQA A;  4DY3 A;  2PHR A;  4XTP A;  4Q4V 3;  4YW1 A;  2R49 A;  2IWG B;  2A6W A;  1W6P B;  2I45 A;  4XFG A;  5IVF A;  2W5F A;  5JOX A;  1WCU A;  1GZW A;  4P9L A;  2XQX A;  4G3Y C;  2A3Y A;  3RZJ A;  4CCC A;  1RUO A;  4CCK A;  3LDK A;  4K3U A;  1UX7 A;  5JUV A;  4QXK A;  5FPB A;  5A32 A;  2QJV A;  1ASJ 2;  1HQW A;  1RL3 A;  2Y38 A;  4MHR A;  1JYN A;  2YC0 A;  4H7M A;  2FCV A;  2FMY A;  4KGQ A;  3ASI A;  2AEY A;  2RDR A;  1U5X A;  1XSQ A;  5K4L A;  3NKG A;  3L2H A;  1RMU 3;  2K9Z A;  3HNM A;  4HL0 A;  4NII A;  1H2K A;  2CTV A;  3KB5 A;  3H8U A;  3AL6 A;  4FBF A;  5FY9 A;  1PO1 1;  1CD3 G;  3O0V A;  3T2Q A;  4AEM A;  1R09 1;  1Q8O A;  3LAG A;  1YFW A;  4LHL A;  2BVV A;  3VZN A;  2ZMK A;  2E7T A;  2P37 A;  3D5O A;  4YFW A;  1S0D A;  3CLP A;  1NUK A;  2EXI A;  1JYV A;  4AI2 A;  4WM7 A;  3WQB A;  4LA2 A;  2D3P A;  4GJY A;  3RVH A;  4BIS A;  3CKH A;  1QJU 1;  2LW8 A;  3C7F A;  4QGN A;  1SBD A;  1POV 3;  1XYN A;  3I2K A;  2ZX1 A;  1JOD A;  4BIF A;  4FOV A;  3M70 A;  4MHU A;  2NN8 A;  3S7I A;  1UOB A;  1RUG 1;  3J7L A;  5IT6 A;  2PHT A;  1OA2 A;  2D7F A;  3R4S A;  3HIF A;  3ACG A;  4QU1 A;  3LSE A;  5FYV A;  1PIV 2;  4CDU B;  2PAE A;  3PMS A;  1FMD 1;  3J7M A;  1XU2 A;  2A1X A;  3KT4 A;  3CBN A;  2JKX A;  3OUH A;  4QQH A;  4XW3 A;  1XOY A;  3CL1 A;  4HON A;  5IK5 A;  3AB0 A;  4QPG A;  4UFH A;  3Q8B A;  3LSD A;  1PZ9 A;  2ARB A;  2IXC A;  2XWJ B;  5FZI A;  5A3M A;  1ZNP A;  4B29 A;  4W6Y A;  1JZ6 A;  1OSG A;  2D5H A;  3P5B A;  4DFS A;  3JB4 C;  2R7E B;  3ZXA C;  1QQP 1;  2VZR A;  4IEU A;  5KXB A;  3W58 A;  4LMF A;  4Q1P A;  5JXI A;  3B9C A;  1PVC 1;  2E7A A;  4PCR A;  4AI3 A;  3ACH A;  3NJY A;  3I2I A;  4ZPI A;  4D7S A;  3LEI A;  2J1E A;  1J84 A;  1H1A A;  2JDY A;  1QHD A;  1SLL A;  4LUM A;  3VBF A;  2FDI A;  1TNR A;  1YFX A;  3AVR A;  4WVM B;  3UJQ A;  1REF A;  4JVA A;  4JDM A;  2VJX A;  1S0I A;  4O61 A;  2VBP A;  5BPX A;  2YC2 A;  5SV5 A;  3SH5 A;  5FRA A;  1R1A 3;  2QQP A;  1J59 A;  3KHB A;  1AVB A;  1D2Q A;  3RI9 A;  4NMI A;  3QH6 A;  5L19 A;  3AZW A;  3SCF A;  2D43 A;  2PA7 A;  1OMI A;  5FR3 A;  2W3J A;  3QLQ A;  3TWI A;  1KIT A;  1EPW A;  4M00 A;  3IDC B;  1EUT A;  3RDI A;  5C8C B;  3GAL A;  2Y6K A;  4CUC A;  4C8D A;  2DCJ A;  2TUN A;  2VU9 A;  4JGY A;  4YNI A;  2LS6 A;  2D6L X;  4B4P A;  3DPR B;  3OBZ A;  1LAJ A;  1HB3 A;  3RQ0 A;  4DXS A;  3H8X A;  3MIB A;  5CBL A;  4OUM A;  1WLC A;  2V4V A;  3KV5 A;  2W68 A;  5KR7 A;  5IK7 A;  5BNO B;  3WUC A;  2DWR A;  3KZ4 C;  4RHV 3;  1LHV A;  3WW4 A;  4LQR A;  3CZJ A;  3N4M A;  1CAU A;  2QQK A;  3VBO B;  1ZRC A;  1KD7 A;  3ZYP A;  2YGL A;  4D8M A;  3ZFG B;  1W8F A;  4A45 A;  3E6D A;  3A0K A;  3M3E A;  4IER A;  4I3G A;  1CGP A;  1ULC A;  2VG9 A;  1OQE A;  4CU6 A;  3VKN A;  4BH9 A;  3J26 N;  1V6O A;  1Y9M A;  5A3P A;  2QVS B;  5KC6 A;  3W5N A;  4QHB A;  1DGW A;  3UET A;  3IAQ A;  2CAV A;  2RJL A;  4L2N A;  5F5A A;  4K1Z A;  5BYN A;  4LT5 A;  1XXN A;  3VD4 A;  4JQT A;  5CG8 A;  1AR7 1;  1U12 A;  2DV9 A;  3N9P A;  1FOD 1;  3M8L A;  1GQH A;  1SLT A;  3OYW B;  1LU1 A;  5CFD B;  5LY1 A;  5KBF A;  4I0A A;  2D3R A;  4TWT A;  4D6Q A;  5BNQ A;  2GMP A;  1RHI 1;  5FZ7 A;  5F7U A;  3OGJ A;  3MIF A;  2C4X A;  5L36 A;  1UMI A;  4FVV A;  4LBL A;  4FI9 A;  4ES8 A;  1IS6 A;  5T5L A;  1DF0 A;  1UU5 A;  5EJ1 B;  1S0E A;  4XFH A;  3WW3 A;  3QD6 A;  2OQ7 A;  5FZ9 A;  3KCX A;  3I59 A;  5JOY A;  3EMR A;  4ORF A;  4BZ4 A;  2IVI B;  1WCS A;  3SQO A;  4XQ4 A;  1OVS A;  2RM2 3;  1ULD A;  3PUR A;  4K40 A;  1UW8 A;  1LOF A;  1QJE A;  4MSV A;  3ILF A;  3WDY A;  1PNG A;  4YGB A;  2LRP A;  5C3S A;  1UY4 A;  4JV4 A;  5B4N A;  5B4X A;  1T6G C;  3P3P A;  1F31 A;  5BNN A;  2ZGL A;  3C3V A;  4KG0 A;  5FQ0 B;  2VUJ A;  1CZT A;  4YYO A;  2OA2 A;  4CDU A;  3N9N A;  1W39 A;  2EVX A;  2JEN A;  3ZYJ B;  4DY5 A;  4RS5 A;  4MH0 E;  2CSG A;  2JWP A;  3I97 A;  2NP0 A;  5IAV A;  4M3C A;  3BGA A;  2KXL A;  3FJS A;  4Q4Y 1;  2VOT A;  2RMU 1;  5L73 A;  4A42 A;  1BXH A;  4FOQ A;  4LHK A;  5E16 A;  1YCI A;  1LOB A;  2R1B A;  4AHW A;  3AYC A;  1CAX A;  2P3J A;  1W2U A;  3FX3 A;  2HWF 3;  1CES A;  2VUA A;  3WT3 A;  1MQT A;  3V65 A;  2XG3 A;  4QGL A;  5JIU A;  4XFC A;  2AYH A;  2ZKN A;  1YC6 1;  4K9S A;  5FLJ A;  3VBS A;  2XOM A;  2HWB 1;  2P5B A;  5C70 A;  5FOB B;  5CA6 A;  1ZBA 3;  2L9L A;  5CKQ A;  1YJL A;  1H8T B;  2DCK A;  2DTW A;  4XJU A;  5FQ0 A; 
#chains in the Genus database with same CATH homology
 2VQT A;  4QDS A;  4JKM A;  3HPN A;  4JKK A;  1GMM A;  1W0N A;  1XC6 A;  4BK5 A;  4IUG A;  3FHA A;  2Y6L A;  3T2O A;  2VR4 A;  2WQ8 A;  4TTG A;  2WN2 A;  2ZEY A;  2VZT A;  2ORZ A;  3W5M A;  4L0P A;  4DXT A;  4AAX A;  1UXZ A;  2WDB A;  2VO5 A;  1CIY A;  3K77 A;  4PQQ A;  3HN3 A;  1UYX A;  2Y8K A;  3VDA A;  3P6B A;  2JE8 A;  2YFZ A;  2EID A;  1MPX A;  3I2H A;  2V72 A;  4CU7 A;  2VQU A;  4LKS A;  4A41 A;  3HOB A;  2W87 A;  2WAB A;  2WO1 A;  5DMY A;  3OGV A;  2C26 A;  2QQM A;  4KI5 M;  4CUB A;  3WF2 A;  3LEG A;  3OEA A;  4JHZ A;  3VD3 A;  4CU9 A;  5LCW L;  1K3I A;  2VCB A;  4XUT A;  5EJZ B;  2VC9 A;  3ETP A;  3WNL A;  3AC0 A;  5JR2 A;  4ZZ5 A;  4OMC A;  1GQP A;  4A44 A;  4P02 B;  3C7O A;  2E32 A;  1OD3 A;  1OT5 A;  3GDB A;  1JYW A;  3ZM8 A;  2ZEX A;  4MAD A;  2YG0 A;  3JXS A;  3CQO A;  1W9S A;  4ZXE A;  4AG4 A;  2WUH A;  3E1F 1;  3WF1 A;  2VMD A;  1US2 A;  4MGS A;  1EUU A;  1JZ4 A;  2EIB A;  1H6Y A;  3SKV A;  2QQI A;  5LA1 A;  3CMG A;  2W1Q A;  2VZP A;  1UXX X;  2Y6H A;  3IAP A;  2V5D A;  1SDD B;  3ECQ A;  3LEK A;  3OBA A;  3WNP A;  2BGP A;  2VCA A;  2VCC A;  4BJ0 A;  2KD7 A;  3VD9 A;  3NQH A;  3LPF A;  3THD A;  5FUI A;  1D7P M;  2RV9 A;  3UNP A;  4DUW A;  2Y64 A;  3WF0 A;  5HPO A;  5I0D A;  4A3Z A;  3T0B A;  3ACF A;  4DEQ A;  1TVG A;  3BN6 A;  2VM9 A;  5JXH A;  1K45 A;  3I2F A;  3U37 A;  3VD7 A;  2RVA A;  1XNT A;  1UYZ A;  4W4Z A;  1JHJ A;  2XHN A;  2W9X A;  3THC A;  4KWU A;  1T2X A;  3OG2 A;  2BBA A;  1OH4 A;  1L7Q A;  5CYY A;  2PQS A;  4YPJ A;  2VZ3 A;  3WNO A;  1UY0 A;  3WSO A;  1SHW B;  1YQ2 A;  1J83 A;  4ZY9 A;  3GM8 A;  1CZV A;  1W8O A;  4QX2 A;  4E8D A;  1UZ0 A;  2WBK A;  2VZS A;  4M4R A;  2W1U A;  1JI6 A;  2VME A;  1DLC A;  1GNY A;  2ZEW A;  1H6X A;  2B9V A;  4XUP A;  4MOA A;  1K42 A;  3DYP A;  3P1I A;  2WO3 A;  2J1T A;  1DYO A;  2VMC A;  4ARX A;  4XUQ A;  4BXS V;  5J1X A;  2VZU A;  3C7G A;  3PUI A;  1O8S A;  4QX0 A;  4ARY A;  1XNA A;  4OMD A;  3UES A;  1JZ7 A;  2ZXQ A;  4P08 A;  2VZQ A;  3MV0 1;  2RJ2 A;  1GU3 A;  2YB7 A;  3VD5 A;  1UMH A;  1LNS A;  1P8J A;  2WAA A;  4RN5 A;  2VTF A;  4OZO A;  1CZS A;  3ABZ A;  1GOH A;  4XZU G;  3ACI A;  3C7H A;  3T2P A;  2J22 A;  1JZ2 A;  3NRU A;  3K4Z A;  2E26 A;  1JU3 A;  4JX0 A;  1IQD C;  2X10 A;  3LE0 A;  2EIE A;  4OYU A;  2VL4 A;  1GUI A;  3I2G A;  4XUO A;  4M4P A;  1JZ8 A;  3CZU A;  3MV1 1;  3K4D A;  3SEE A;  1UWW A;  2DDU A;  1PMJ X;  5A1A A;  2W47 A;  3A7Q A;  3C7E A;  1NKG A;  2XON A;  3I2J A;  4LPL A;  4PF1 A;  4CUA A;  4QX1 A;  5G04 L;  4QAW A;  1F4H A;  3MBW A;  4DEV A;  3T09 A;  2J1V A;  4MGQ A;  5JXJ A;  1CX1 A;  2W46 A;  4D0Q A;  3SKJ E;  1NX9 A;  2JD9 A;  1WKY A;  4GWI A;  3A21 A;  4XUN A;  1W9T A;  3PUH A;  2WAO A;  4BDV B;  4PT6 A;  2YC4 A;  3MO4 A;  2ID4 A;  4LHS A;  3T08 A;  2ZEZ A;  2VZ1 A;  1K12 A;  3K46 A;  5IHR A;  3A22 A;  1GOG A;  1PX4 A;  1UYY A;  3GXU A;  2W1S A;  2YFU A;  3MUZ 1;  4GZ9 A;  4W50 A;  3WNK A;  4QPW A;  1UY2 A;  4QB6 A;  1R64 A;  5JXG A;  4XVH A;  3IB3 A;  2QQL A;  2W5F A;  5DN2 A;  2XQX A;  1SG3 A;  1O59 A;  1UX7 A;  3DYO A;  5JUV A;  1OF3 A;  1JYN A;  3WNM A;  3T0A A;  3HNM A;  4QX3 A;  5IYY A;  3D3A A;  1KEX A;  2X09 A;  3C8X A;  1RYY A;  2W94 A;  3GGL A;  3T2Q A;  4BK4 A;  2W92 A;  3IDA A;  3FL7 A;  3WF3 A;  1NUK A;  2J1U A;  5JMO A;  1JYV A;  3NJV A;  4E8C A;  3WQB A;  4QDR A;  1PMH X;  3CKH A;  5IFP A;  4JKL A;  4KMQ A;  2LW8 A;  3C7F A;  3I2K A;  1JU4 A;  2BGO A;  3ACG A;  4DXR A;  5DQ0 A;  2HYX A;  2W1W A;  2WO2 A;  3HEI A;  3CIH A;  1NAE A;  3OGS A;  3DEC A;  5G05 L;  2JKX A;  2Y6G A;  4UOJ A;  4QB2 A;  4RYD A;  4HG6 B;  3III A;  2Z4F A;  4DUV A;  1UY3 A;  4QDQ A;  3LPG A;  3DYM A;  1JZ6 A;  1JZ3 A;  3I3E A;  1DP0 A;  2BZD A;  2E31 A;  2R7E B;  5C71 A;  2VZR A;  3VDC A;  5JXI A;  2X05 A;  3OEB A;  1TG7 A;  1HN1 A;  3ACH A;  3I2I A;  3LEI A;  2J1E A;  1J84 A;  2C9K A;  1W8N A;  5HXM A;  2EIC A;  1GOF A;  2BER A;  2VJX A;  1JZ5 A;  2YC2 A;  4MO3 M;  2VMF A;  3FHQ A;  3I3D A;  2QQJ A;  2W3J A;  1ULP A;  1EUT A;  3EYP A;  2Y6K A;  4CUC A;  2DCJ A;  4A6O A;  2LS6 A;  2VZV A;  4ZZ8 A;  3SEP A;  3T0D A;  4DXS A;  3FN9 A;  2V4V A;  4XUR A;  5IJR A;  1BHG A;  1PX3 A;  1W99 A;  3CZJ A;  4LQR A;  2QQK A;  2HLE A;  2QQO A;  4D8M A;  1KGY A;  3NJX A;  3OB8 A;  3WNN A;  4A45 A;  4W8J A;  3HJR A;  4CU6 A;  3HNY M;  3W5N A;  2J1S A;  3IAQ A;  4GWJ A;  3LQC A;  3UET A;  1OF4 A;  3VDB A;  1I5P A;  3VD4 A;  3WEZ A;  2J1R A;  2W91 A;  5LA2 A;  3J7H A;  1L7R A;  4Z2A A;  2WN3 A;  5F7U A;  2C4X A;  1UMI A;  4UI9 L;  4FI9 A;  2B4K A;  4P00 B;  5EJ1 B;  3F2Z A;  3HNB M;  3CDZ B;  5LA0 A;  2ORX A;  2CDP A;  2J7M A;  2VZO A;  1XPW A;  4CU8 A;  1O8P A;  4OUE A;  4UAP A;  2JDA A;  1UY4 A;  5B4N A;  2WZ8 A;  5B4X A;  1US3 A;  4A4A A;  5CZK A;  2E33 A;  4CVU A;  1CZT A;  3K75 B;  3I3B A;  1F4A A;  1WCQ A;  3I97 A;  1ULO A;  3BGA A;  4P5Y A;  1JYX A;  2VOT A;  2WYS A;  2Y6J A;  4A42 A;  5DPN A;  1UY1 A;  2W95 A;  4ET7 A;  5IFT A;  3A23 A;  2J1A A;  2OKX A;  2QBX A;  3OGR A;  2WZE A;  2QQN A;  4TXW A;  1W9W A;  2XOM A;  3WF4 A;  3NNG A;  5C70 A;  5C7G A;  2CDO A;  3MUY 1;  3EB7 A;  2L9L A;  2DCK A;  4DUX A;  3K4A A;  5EIY B;  4QB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...