2YG0A

Cbm62 from clostridium thermocellum xyl5a
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
139
structure length
139
Chain Sequence
YPKLTGTVIGTQGSWNNIGNTIHKAFDGDLNTFFDGPTANGCWLGLDFGEGVRNVITQIKFCPRSGYEQRMIGGIFQGANKEDFSDAVTLFTITSLPGSGTLTSVDVDNPTGFRYVRYLSPDGSNGNIAELQFFGTPAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Novel, Noncatalytic Carbohydrate-Binding Module Displays Specificity for Galactose-Containing Polysaccharides Through Calcium-Mediated Oligomerization.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Sugar binding protein
molecule keywords CARBOHYDRATE BINDING FAMILY 6
total genus 30
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2011-04-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2yg0A00
2DCJA 4QX0A 2QQKA 3C7GA 4OYUA 3FL7A 1JYWA 3I97A 1JZ7A 3GXUA 4LPLA 1JYVA 3UETA 2B4KA 1XNAA 3GM8A 1LNSA 2VZTA 4PF1A 2QBXA 1EUUA 4OUEA 2VZQA 3P1IA 2W3JA 1W0NA 3PUIA 3NQHA 3MBWA 2RJ2A 3OGRA 2V72A 2X05A 2DCKA 1K42A 5EJZB 3C7OA 2W92A 4KI5M 2YFUA 4XURA 4MO3M 2VZVA 4MOAA 3ABZA 4QDQA 2Y6GA 2V4VA 1XNTA 2E31A 2BGPA 1JU3A 2ORXA 4QX1A 1UY4A 3A21A 3MUZ1 2VZRA 3ACGA 3WF0A 3HEIA 2VZ1A 1NUKA 2JKXA 2WDBA 5EIYB 3JXSA 1JHJA 2J1VA 2B9VA 3E1F1 3FHQA 2HLEA 1W9WA 4ZZ8A 3IB3A 1CIYA 1H6YA 4BJ0A 2W1SA 1JZ6A 1F4AA 2W46A 2QQNA 2ZEYA 3OEBA 5JMOA 3CMGA 3SKJE 5C7GA 3VDAA 2EIBA 2W1QA 2J1TA 3WEZA 4A45A 4MADA 4A6OA 4QX2A 2QQIA 1WCQA 3WNKA 2VMDA 3WF2A 1OT5A 3THDA 2YFZA 4LQRA 5F7UA 3HNYM 5LA0A 5JXGA 2VQTA 2J22A 1OF4A 1SG3A 3I2JA 4D8MA 3DYPA 4DUWA 3ECQA 2LW8A 1UYXA 2VCAA 4QB1A 4XVHA 3C7FA 3NNGA 4D0QA 4KMQA 3U37A 2W1WA 3CZUA 1J84A 3VD5A 5DMYA 1JZ5A 1D7PM 1UX7A 3CKHA 2Y6KA 2W9XA 3GDBA 3MUY1 4CU8A 4W4ZA 2VC9A 1YQ2A 2QQMA 5EJ1B 1JYNA 1NKGA 4XUTA 1PX4A 3K4ZA 5C71A 2W1UA 1JI6A 3VD4A 1PMJX 3MV11 2J1AA 2J1UA 5LA2A 2W87A 4ZZ5A 3ETPA 3T08A 2BBAA 4DEVA 1T2XA 1OH4A 4RYDA 3D3AA 3OBAA 2VMCA 4XUQA 2VMEA 3LQCA 2J7MA 2WBKA 2VOTA 3WQBA 1DLCA 4HG6B 4ET7A 4QAWA 3HJRA 3K77A 2E32A 1L7QA 5CYYA 4CUBA 2J1EA 3SKVA 5A1AA 4GWJA 4PQQA 5I0DA 3BGAA 5G04L 3F2ZA 5IFTA 3HNBM 3AC0A 4BK5A 1KEXA 1UYYA 2WO1A 1MPXA 2WABA 3WNPA 2WQ8A 3CZJA 3OG2A 4JX0A 1J83A 4CU6A 3LEIA 4DXSA 2CDPA 4CVUA 2YC4A 4LHSA 3I3BA 3WF4A 1CZSA 1KGYA 5FUIA 4DXRA 1JZ3A 3T0DA 3UESA 1W9SA 1GOHA 1NX9A 3IAPA 3I3EA 2V5DA 1O8PA 1DYOA 2C26A 3SEPA 1W99A 2WN2A 4DEQA 4CUCA 2YG0A 3WNMA 1JZ4A 1GOGA 2X10A 3ZM8A 4YPJA 1GUIA 2VZPA 2E33A 2KD7A 3EYPA 1UMIA 1HN1A 4ARXA 4CU7A 4ZY9A 2EIEA 3MO4A 4CU9A 4OMCA 4TXWA 1ULPA 2XHNA 4P00B 2W95A 2J1RA 3LEGA 2ZEXA 4A41A 3IAQA 3T0AA 2VZOA 5IHRA 4UOJA 1SDDB 1GQPA 3FHAA 4DUVA 2VMFA 2XOMA 4M4RA 4CUAA 2VO5A 3WF3A 5CZKA 1OD3A 3EB7A 3FN9A 4ZXEA 4OZOA 2QQOA 2VCBA 1I5PA 1NAEA 2WZEA 3C7HA 4PT6A 3HOBA 4QDSA 5DPNA 2W94A 3T2PA 2J1SA 1K12A 1UZ0A 4ARYA 2WO2A 3W5NA 3VD7A 4M4PA 2VZUA 5JXIA 1R64A 2VQUA 2XONA 1L7RA 2W5FA 4XUPA 5JXHA 2WO3A 1P8JA 4A3ZA 3VD9A 3NJXA 4GWIA 2VM9A 2ORZA 3UNPA 1CZVA 3SEEA 5IFPA 3WSOA 4W8JA 2WAOA 3T0BA 3ACIA 4E8CA 2BZDA 3HN3A 3MV01 3T2QA 1K45A 2HYXA 4XUOA 5J1XA 2C4XA 4XZUG 1O59A 3HNMA 3WNLA 2Y6JA 1UY3A 4IUGA 3IDAA 3I3DA 4BXSV 2Y6HA 1F4HA 4XUNA 1UY2A 2QQJA 3ACHA 2WUHA 1SHWB 3LEKA 4QB2A 1CX1A 1TVGA 5JUVA 2VCCA 3K4DA 3OB8A 5B4XA 2VZ3A 3NJVA 5B4NA 2JDAA 5DN2A 3C8XA 4KWUA 3P6BA 1JU4A 3LE0A 4GZ9A 4BDVB 3WNNA 4BK4A 3K46A 2JE8A 1W8OA 4JKLA 1K3IA 2LS6A 5C70A 3LPGA 2WAAA 2PQSA 4MGQA 3CQOA 4A4AA 1DP0A 3WNOA 2R7EB 1UYZA 2VJXA 2OKXA 4DUXA 2VR4A 4P02B 3HPNA 2Y8KA 2L9LA 2W47A 3CDZB 3IIIA 4QPWA 4L0PA 4E8DA 4RN5A 4OMDA 2ZXQA 2Y6LA 5IYYA 2E26A 4JKKA 3LPFA 4LKSA 1EUTA 3K75B 3A23A 2ZEZA 2WYSA 3I2KA 1UXZA 3J7HA 1TG7A 3ACFA 3DYMA 5HXMA 3WF1A 1PX3A 2WZ8A 3T09A 3I2HA 1JYXA 1UXXX 5JR2A 3K4AA 5HPOA 1IQDC 1OF3A 2VTFA 1W8NA 2DDUA 2YC2A 3DECA 1GNYA 2Y64A 4QB6A 3W5MA 3NRUA 4QDRA 5LCWL 1PMHX 4AAXA 1H6XA 3VDBA 2XQXA 3BN6A 3VDCA 3I2GA 3OGSA 1JZ8A 1GOFA 1O8SA 2CDOA 3A22A 2BGOA 2QQLA 2RV9A 2W91A 3CIHA 4UAPA 5LA1A 3OEAA 4FI9A 4QX3A 4AG4A 1US3A 5DQ0A 2JD9A 1UY0A 3OGVA 1US2A 2EIDA 2WN3A 4P08A 4DXTA 1W9TA 2RVAA 1UWWA 2VL4A 4TTGA 3GGLA 4UI9L 2BERA 4P5YA 4W50A 3THCA 4JKMA 4Z2AA 3PUHA 1ULOA 3DYOA 3I2FA 4JHZA 3C7EA 2EICA 3I2IA 2ZEWA 1XC6A 2X09A 1GMMA 5IJRA 1BHGA 2C9KA 3A7QA 5JXJA 2Z4FA 2ID4A 1XPWA 1UY1A 1JZ2A 2VZSA 1WKYA 1GU3A 4A42A 4MGSA 1RYYA 4A44A 2YB7A 1CZTA 5G05L 3VD3A 3T2OA 1UMHA
chains in the Genus database with same CATH superfamily
1RUF1 2GU9A 4K8FA 1WA4A 5L19A 3SCGA 3LDBA 2DCJA 1RUE3 2DCYA 2QZ2A 1V6MA 2XBO3 2Q4SA 5GJ6A 3KLSA 5JOXA 1SQ4A 1DQ1A 2W39A 4Q0VA 4WVMA 3S0MA 2NPIA 3FL7A 5IVFA 1JYWA 3O1VA 2DUPA 4Q4X1 4LPLA 3GJBA 2DU0A 4CEYB 5EYXA 4Z8BA 1XNAA 3ES1A 1LJ7A 1RUD2 2JDPA 4PF1A 5L73A 1MVEA 1W6NA 5FMOS 1D4M3 4GD4A 2D3RA 5BXXA 2ENRA 2VZQA 4RR3C 1AL21 3WW1A 4NHYA 2JDHA 2X8KA 1ZBA1 4AAPA 1WA6X 1AYM1 2XG3A 3H8OA 4BQ2A 4K40A 3ZSJA 4MGTA 2DCKA 2W92A 4W6WA 1PGW1 1SACA 2E7QA 4JTNA 3VKOA 3N3HA 5H9RA 4NRPA 1DZQA 2RDNA 4GQ7A 1KJLA 3ABZA 1A6CA 2Y6FA 2ZS6B 2YU1A 3POBA 4HSLA 4IV3B 3GZEA 4LUKA 2BGPA 3MIDA 3QOPA 4OQ8A 3LWCA 5A6YA 2JDKA 2YGMA 1ZBA3 2ZGQA 1REFA 1VBC2 3FE5A 1OI6A 3A21A 3GALA 1UF2C 4UXAA 4AFAA 4ASKA 2HWF3 4O9EA 5LBFA 2DFCA 1Z0HA 3URFA 2CV6A 1LULA 3DKWA 2P3JA 4AE2A 2ETEA 1Q8QA 2P1BA 3ILRA 3JBG3 2HEWF 1VBD3 3U10A 2EA7A 3U4SA 4NIGA 3FHQA 1X8EA 3KWVA 1W6OB 4ATFA 5FMOL 1GZWB 1W9WA 4TN7A 1VBD2 2YV8A 4RL7A 1HJFA 3POGA 5T55A 3VBOB 5A33B 2XJQA 1GZCA 1CIYA 1H6YA 4QPIA 4BJ0A 1JH5A 3S30A 3ZXDA 5GALA 2A6VA 4M0NA 4YZ5A 1PM4A 1F4AA 5FXXA 3VDDB 4DZGA 4OQ9A 4CEWC 2MHFA 5JMOA 3CMGA 3SKJE 3ZFEA 1ONAA 5HCHA 1H4HA 2W1QA 2G9ZA 2J1TA 5F9TA 2WFF1 1BBT3 3KVAA 2ES3A 4MZUA 2GNBA 4A6OA 1LOGA 3N9QA 2EXJA 2WA3A 4Q27A 1HB4A 3ZYGA 3J8F3 1TME3 4MGZE 2JEMA 3PTYA 4QX2A 2A71A 4IEWA 3VBOA 4PBOA 5ABJA 1XNKA 2O8QA 5A80A 2YFZA 4HK8A 1W8WA 3DPRA 1PVXA 3HNYM 3U07A 5FREA 1DBNA 5L9BA 1LU2A 4R9DA 1UU4A 3SH4A 5FJKA 3I2JA 3B5LB 4B1MA 5JZGA 3ECQA 2LW8A 3KV9A 4YM0A 1BBT1 1QU0A 1WMFA 2VCAA 1CD3G 3HMYA 1YXWA 1DZTA 3IIAA 3ZMNA 2HWC2 4KMQA 3U37A 2BRTA 1J84A 1NCRC 3VD5A 1Y7BA 4NIAA 1AR91 3AKQA 1WLWA 3RVHA 4AFMA 1ND2C 1EAH3 3DPRB 2LALA 3R6SA 5IVYA 2BUKA 1LOFA 2FCVA 3GDBA 3NWKA 3MUY1 3QLQA 2CYFA 2Z69A 1QQP3 4JRLA 3MZHA 5JZGB 3VGIA 4PJYA 1KS5A 2OQ7A 4BQWA 4CUGA 4E4SA 3RQ0A 4ES9A 4QD2A 3LFIA 3ZDVA 1LKNA 1MQTA 4IL7A 2IVJA 2JDNA 2ZZQA 3VDDC 4MGYE 1NCQA 2X5IB 3VD4A 2H0BA 3W59A 3B9IA 1XRUA 3T4HB 4KBZA 3PMEA 5LA2A 4KH9A 1AZDA 1NOVA 1OC1A 2ZGOA 3ETPA 3T08A 1TZOA 4MGKE 1SBEA 5FZDA 3BALA 3G6JB 4ZU7A 1W6QA 3K51A 4OFGA 4META 4QWNA 2UYBA 3ITQA 4RYDA 3WVJA 4A2UA 3VBUC 1F5FA 4HPKA 3OBAA 4AQTA 4XUQA 5FBJA 1ZBA2 2VMEA 4N7UA 2HBTA 3MW2A 1AR63 1UOGA 1X36A 2J7MA 3O7OA 2WBKA 3VKFC 4CP9B 4FSJA 1TEIA 1PVC3 1YIFA 2PLV1 4YM2A 4R8HA 5EZWA 4RA0A 3WQBA 1DLCA 4BISA 2HBUA 3BPSA 4HSJA 5DUUA 5FY4A 3OPZA 4HVRA 4WVWA 3WR0A 4ET7A 1G9DA 1KJRA 5BNNB 1FNYA 2RS53 3AYCA 1ASJ1 3CJIB 1UX6A 5FZLA 4LO8A 4DPNA 4AGVA 1C3HA 3GBWA 3NNLA 1MR5A 2XVGA 3HT1A 1OA3A 2MEV2 5E1RA 2NN8A 5KC6A 2PYTA 4JQRA 5AVAA 4D6RA 1FT9A 5GZDA 1IHMA 4CP2A 5DZEA 1S0BA 4Y1UA 4AHYA 2WO1A 5LK7B 1LB2A 3AMPA 2WABA 2OQ6A 1WCUA 1HKDA 2E53A 4XABA 1NZIA 3ZXKA 4PIYA 1YFYA 4JX0A 1J83A 1I9RA 3LEIA 1FMD3 2EXIA 4XETA 4P9LA 3OY8A 1KGYA 3DN7A 2C6SA 5A3NA 1Q8OA 3OJBA 2C0ZA 1JZ3A 3Q8EA 3U1XA 1BQPA 2YBSA 5CVRA 2A6XA 4GULA 4Q4W2 4P9IA 3TEWA 4COWA 4D6SA 1GOHA 4YYOA 4OVEA 4NPRA 5D8AB 3SH3A 4CEYC 3UGGA 4ES8A 3IAPA 3I3EA 3KV5A 2VW2A 2C26A 3ZFEC 1PO21 1PNFA 1C8M3 1DQ5A 4M0HA 5A3OA 1Q43A 4DEQA 4CUCA 1J58A 2YG0A 1JZ4A 1YHFA 5A3TA 1W3XA 1M06G 4XAAA 3KCCA 5FZ0A 5A6XA 2E33A 4EWAA 4HZFA 3TEYA 1AF9A 1NA1B 2WLQA 2VW1A 3ETQA 3OTFA 2JJ6A 4ZY9A 1POV1 5GKAC 5F5IA 2Q1FA 2EIEA 4I3PA 4XPVA 5GLWA 4IE4A 1O3QA 3FMGA 1CAXA 2XHNA 2X29A 4PIXA 4LOSA 5FZ6A 4G3YC 3FBMA 1GP5A 4BM8A 2Q30A 1J3PA 1LOEA 3PVOA 1HJGA 2VQAA 1W2AX 5FCCA 3QBQA 4HMZA 1D0GA 3IAQA 5FMCA 3UKTA 3WX5A 2VVEA 1VBE3 4XTMA 1S0GA 4BB3A 4UOJA 2NMOA 4FOQA 3ZXFA 1SDDB 1VBC3 3FHAA 5FXWA 2FDIA 5A3LA 1E5RA 5FP9A 1VMJA 2BPA2 2VO5A 1MS0A 3WF3A 4HKWA 3FN9A 3HBZA 2GMMA 1RVF1 2XWBB 2QQOA 2VMGA 1VAMA 4XAEA 3C7HA 1I5PA 4DRRA 4E9KA 5J7MA 5B2GB 4AEDB 3M8LA 4MUVA 2YBKA 1BCXA 1ND2A 4AQ2A 3RFRA 1VAKA 1C57A 1HV0A 1K12A 1R1A3 1D2QA 1EPZA 4FOWA 4ARYA 2WO2A 1PM7A 3W5NA 3RZMA 2OW4A 1LTEA 5DABA 1HRV1 4YWAA 1C1LA 3SCFA 2X5IA 5FZ1A 4QHOA 4YG3A 3TN91 4CCNA 5F6KA 4YVWC 1WW6A 5JXHA 1ZRDA 2WO3A 2BOJA 1P8JA 3V65A 1D4M2 5JOYA 2DWRA 1QIQA 1COV2 3LFMA 4LJHA 4OLLA 3H7JA 2JDYA 3DEMA 4GB31 3ZFGC 2SBAA 2VM9A 3UNPA 3FLTA 4LIUA 1H2MA 4OHWA 3WCRA 4Y1VA 4HN1A 2KXLA 3S7EA 3I3MA 3SITA 3AVRA 3N9MA 4Q4Y3 4JZRA 4V1PA 4EJRA 3H9AA 3BIWE 4CA9A 1QJEA 5E88A 1DG6A 1LESA 1W90A 3GHMA 4LLOA 5TSWA 4AFBA 5EPAA 2WSUA 1VRH2 2BZDA 3N7MA 4RGKA 3H1MA 2UY9A 3VBHA 3MV01 4BH9A 1WBFA 4FO9A 4XUOA 1UMZA 4L9BA 1DZRA 5A70A 1DQ6A 2ADDA 3LAGA 3OF1A 1O59A 4YLZA 2CAVA 2CWSA 1QJY3 2BEOA 3FUOA 4CEWB 3O1OA 2BQPA 2VTXA 1UY3A 5FZMA 3IDAA 1OOPA 5DAVA 4D6QA 4S2DA 3CJXA 5FZAA 3TN93 4E4ZA 1OQ1A 4XUNA 3UJQA 5JVVA 4QGNA 4QPGC 5DDJ1 1UY2A 3VBOC 2HEVF 2QQJA 3CO2A 4HVOA 3KHCA 4NO4A 2VU9A 2R32A 1LEMA 2WNVC 1EV12 1K5MA 4LO7A 4FBFA 2PA7A 3LEKA 2FCTA 4QB2A 1Q5OA 1MS1A 1WUVA 4D3WA 4KQ7A 5HV0A 5EXOA 3KM5A 3BVCA 1SFNA 2Z5WA 5FZOA 5B4XA 3H50A 4D7TA 4GH4B 4AGRA 2XJSA 3ZFFA 2JDAA 3QCWA 3GZAA 1RUNA 3NAPC 1XNBA 3P6BA 3ZOIA 1BMV1 4COZA 1DGWA 4FTEA 3NNJA 2VNVA 3ZIWA 1ENSA 3E6BA 3NMBA 1RJ8A 4XCBA 5D8AA 4AI8A 4BDVB 3WNNA 1ZRFA 2OIIA 2VOVA 3E6CC 5FO8B 4AVCA 1W8OA 4JDOA 3S5QA 2ADEA 3WHTA 2P3YA 1K3IA 2LS6A 2A6WA 5LK5A 3E97A 5IUQA 1PO11 5LBBA 3SC7X 3AKPA 1LOFC 2G19A 3H7YA 4V2WA 2FMDA 5FYZA 1PO12 3FFZA 1ENQA 2AGSA 3JBG1 5CKMA 1YJLA 2VVFA 4BZ4A 5HV4A 4YZ2A 2ARAA 1YCIA 4K21A 1DP0A 1LRHA 4BPZA 1PNGA 2RMU2 3OCPA 3V0BB 4DRVA 1JXNA 5CKNA 4CXXA 5L7OA 2XQRA 1BYHA 1OLRA 3O1MA 1ZZCA 5C5TA 1I1EA 2YY1A 4CDQA 2W47A 3AJYA 2H0VA 4XIKA 1VALA 4L0PA 2K2SA 1J1TA 1LOCA 2KR2A 1H9PA 1V9U2 1COV3 1U0AA 1GBGA 1XE0A 1G9FA 4JKKA 1HDKA 3BU0A 3PIGA 5IVBA 4XDOA 4BLIA 1EUTA 5CKQA 3WDYA 4P9YA 4LBMA 3WG1A 1U12A 4QPIC 5FBZA 2WYSA 4AHZA 4S2FA 3VBHB 3WINE 2W0XA 3VHOA 5C3PA 3BIEA 1TG7A 2TUNA 3AXEA 3GCWA 1PX3A 1O3SA 4XYXA 3B9CA 4GKYA 4CDQB 4XMAA 2DUQA 5JR2A 3ON7A 5GZCA 4KG8A 3FLRA 1HRI3 5FWJA 1IQDC 2VTFA 5HPOA 3JB8A 3MPPG 3VBRB 4AF9A 1LR5A 1SCRA 2ZGLA 4BCUA 4D69A 2WT1A 3LIGA 2ZPXA 4Q4V3 2IVIB 3CL1A 4F7ZA 4EN9B 4LK6A 2PFWA 1PMHX 2GNDA 1AL23 3B02A 3PTRB 4M01A 4NE9A 4O7XA 1LENA 5F5QA 1UQXA 3VDBA 4EZHA 1WWYA 3KF5A 3TN92 1VRBA 1VE0A 3I2GA 4R9BA 4X8NA 4C8DA 1JZ8A 1YIPA 5A1FA 3POYA 4K1ZA 3CIHA 1U5YA 5LA1A 4NAOA 4QPGB 4AG4A 1ZZ9A 1RMU1 3K3OA 3JZVA 5DQ0A 3VZJA 1CWPA 2JD9A 1RMU2 2FDKA 4XQ4A 2GNTA 1UY0A 2GN7A 5LEKA 2ATFA 1AX2A 2GMPA 1Y9GA 2QNKA 3T2TA 1X9PA 3I2OA 2D98A 3EMRA 2K9ZA 3GGLA 3WUCA 1ZRRA 2WZPP 4EN0A 4AK3A 4QU1A 4W50A 1HN0A 3THCA 2ZX0A 5GLZA 3AZWA 4OUMA 4XFAA 4KGGA 1OFSA 1WCSA 5FYBA 4LHLA 1RUG2 2EICA 4HKLA 4QHBA 4CSWA 4WVMB 5A1LA 3KHBA 1R082 4AL9A 4HXCA 3PDQA 1M4WA 3IM0A 3N35A 1R081 1AYN2 1PMIA 3WQ1A 4Y1XA 3POWA 2ZHKA 1JYTA 5IW0A 5JXJA 3NV2A 3R05A 1XPWA 3HVDA 1JZ2A 2P6CA 4TYSA 1C5IA 3DV8A 1Z7S2 1RYYA 3ZFGB 4K20A 3KQ4B 4A44A 3IKWA 4IXLA 4AI9A 2GC1A 4QXHA 1WMXA 4CP9A 3HT2A 4E4HA 1UMHA 1K5MC 2VH9A 3WQ0A 2JE9A 1LEDA 4NAMA 2ZKNA 4CPBA 5AC93 4NJ4A 1SLLA 1H8TB 5JSRA 4BIFA 4AI3A 3RPQA 1CAXB 4LBKA 1OLMA 4MXWA 5BNQA 5C8WA 5E89A 3LA2A 3ZPOA 4OI2A 2HWD2 5K0UB 2P17A 3I97A 2WZR2 1U5ZA 3UETA 2HKXA 3KVBA 3VKMA 2JG9B 4YG0A 1EY2A 2B4KA 3B94A 1H9WA 1LNSA 1X50A 1NXD1 5FP8A 4Q8KA 2PAKA 4XFHA 3N4MA 1D2SA 1EUUA 5A7QA 3B7MA 4RGAA 2ZHMA 4UF0A 3TNQA 4KWJA 4ZS3A 5JPNB 1W0NA 4RS5A 1ZZ8A 1AUYA 3RJRA 2ZCWA 4FPYA 1AR72 3KD4A 1MS9A 4Q4Y2 2AEZA 2GSYA 2TEPA 2NYYA 2X05A 4Q0SA 2D6OX 2ZHNA 3B00A 3RZZA 2VBDA 5FZGA 4ATEA 5L7OB 1SBFA 3W58A 4IEXA 5FZCA 4FAHA 5F39A 1DYKA 1H2NA 3GZTB 4FPLA 2Q5TA 4C1XA 3M1HA 5KXCA 4NHKA 4QDQA 1I3HA 2Y6GA 5LY2A 4IE6A 2HYKA 1VPHA 1XNTA 2P2KA 1SDWA 4HANA 1GWMA 1ENRA 2OS2A 5A7WB 3PNAA 2ORXA 3WLUA 5FQ0B 4PF5A 3O12A 4PBPA 2VZRA 2ZGTA 1CN1A 3W20A 5F37A 2WWSA 3I3QA 3ZYHA 3HEIA 2VZ1A 2A75A 1IKQA 1POV0 2JKXA 4W65A 5BV6A 5FK7A 2HWF2 3QH7A 3JXSA 1AL22 1KQRA 4K1YA 5IWFA 1JHJA 2Q1MA 4UBGA 1HXS3 2J1VA 1V6NA 3I49A 1G6NA 2NP0A 4LBQA 3ZN6B 5H9PA 2DCTA 1BJQA 2XXZA 2A6YA 4C90A 3C2UA 4ZZ8A 4DS0A 3BI3A 2ZGPA 2QZ3A 1OOPC 3LZZA 1Q3EA 5A32B 4WM7B 1DGRA 4ASLA 4LT5A 1ZA4A 2QJVA 1JZ6A 2BBVA 2ZEYA 3OEBA 4K7JA 3ALQA 1MS4A 3AYAA 1W6PB 2B9UA 2WNVA 3RI9A 2D6MA 4XFGA 1OOPB 4A45A 1WMEA 2ZGSA 4L92A 4TZDA 1QNWA 2VMHA 3I2DA 1O91A 2Z42A 4QQHA 5FAXA 5GZFA 3ZXJA 1AHSA 1MEC1 1PZ9A 2PLV3 3M3QA 5JSOA 3VBUA 1JN2P 1AR61 3FJSA 1OA4A 1N1TA 3EJKA 5CB7A 1WCQA 4GA9A 2VMDA 3WF2A 3DKQA 2RS32 4GH4A 4SLIA 4IEZA 4LQRA 4ITCA 1BEV3 3QACA 4UFHA 1MACA 1FI2A 1TNRA 4I0BA 3RS6A 5LA0A 4IESA 5CAZA 4IETA 5JXGA 1VMHA 3ZFFB 4LR4A 4DUWA 1UL9A 3NNMA 4XACA 1G9CA 4LEJA 5KXEA 3RZKA 2JXAA 1RUE2 3M3CA 1AYM3 2D93A 1W6MB 5F8PA 2W1WA 1QDOA 3UK9A 1ZREA 4YW5A 4NR1A 1JZ5A 4LHKA 1NCQB 1R091 4BYYA 2QQWA 1AYN1 4IE0A 2HWB3 4MHUA 2XUEA 1MQTB 1FOD3 1R092 2ET7A 2JG8C 2R072 2FQPA 2Y6KA 3FZ3A 5FIXA 3SQOA 5D1IA 5LW9A 5J48A 1JOJA 3H1YA 1H1AA 5FYVA 2CWMA 5J3UA 1W6QB 5EV7A 1ULCA 4W4ZA 1YQ2A 4CDXC 1GZ9A 1KFUL 4XJ8A 1AX0A 2C5DA 1ZM1A 1KDMA 2QQMA 4COVA 4JGZC 2DTWA 1JYNA 4L8QA 5ISLA 3BCWA 5D21A 1PX4A 4IV1B 1J59A 3E5UA 5I0UA 1H2LA 1WLCA 2WZR1 1GWKA 4WM8B 5FOJB 3IDBB 4EV0A 2FDFA 3H3UA 4UW5A 3SXWA 2ZABA 1O3TA 3M70A 2J1UA 5FP7A 1EP0A 3ELNA 2WS91 4ZZ5A 4DEVA 1GZWA 1T2XA 1OH4A 5I91A 2HWC1 5IT6A 2E51A 4BXFA 1NY71 5APAA 2JIGA 1S2EA 1H8TC 2VMCA 5CFCC 1LAJA 2A1XA 4XDPA 4LBQD 3LQCA 4FVVA 1YO8A 1W2OA 3CBNA 3IMMA 1AXZA 2YUEA 4J6GA 1F2NA 4Q4W1 4RR3A 5BNPB 5IVEA 1PGL1 4CYDA 3J9SA 3K77A 2CHHA 2YPJA 4I0AA 1V9U3 2BTVC 2BV4A 1L7QA 1SMVA 1OMIA 1HXS2 5CYYA 3ZSLA 3OSDA 4DNYA 4PQQA 3ZXLA 1N47A 5FUPA 1V6IA 3BGAA 4O9GA 4YVSA 3ZYJB 2VMIA 1H1IA 2B7YA 5EQUA 2QQPA 1RB8G 5FZ9A 3HNBM 5FY9A 4AQSA 5JI9A 3BB6A 1NXMA 2VAUA 2WA4A 3MF9A 2XJVA 1W39A 4XMIA 3W9AA 1W6OA 1FMD2 2GC3A 2MEV3 4Q5OA 3WP3A 5F2SA 3RWKX 4MGIE 1UZWA 3TEZA 3DCQA 5L36A 1DU3D 1ZZ6A 3OG2A 2IXJA 4AEMA 4CVUA 1TMF1 2AEYA 5AC91 3I3BA 4LKDA 3ZN5A 1OPOA 5IK5A 4PLOA 5CISA 2ZGNA 1K5JA 3HWJA 5FV3A 3UL2A 3NV4A 1RUJ2 5KXBA 2X53S 2DVGA 5FY1A 4NIIA 3SEPA 1NCRB 1W99A 2WQZC 4LK7A 4XFFA 1QY4A 4Y1YA 2NM1A 4AWDA 1C4RA 2BWAA 2VD7A 5I0SA 4UWDA 1UD1A 4XJWA 4YPJA 3AXDA 3ZM8A 4DXZA 1V70A 4E4DX 4BQ1A 2XMLA 2WR9A 3WW3A 3AZVA 4CU7A 4NPMA 3C3VA 4XXAA 4CP1A 3VBSC 1JOBA 1NZCA 1F31A 4CU9A 3VBHC 4QU2A 1ZNPA 2CU5A 4ZKTB 1ULPA 4YRDA 3PHMA 2R49A 2GH8A 2OPKA 1GWLA 4XIOA 1Y4WA 2ZEXA 5A32A 3CF6E 4GJYA 1LHVA 4COUA 1LHUA 2JIJA 5IHRA 5FY5A 1XXNA 5DG1A 1GP4A 2B46X 2XOMA 4AI2A 5ABJC 1AVBA 4YGDA 3SMHA 1RUE1 1ZZ7A 2ZX4A 2R062 4C1WA 5EP9A 2P4EA 1QGLA 4NMIA 4RR3B 3WDVA 5BNPA 3RZJA 2OT7A 2LM3A 5DAXA 3U11A 2OUJA 4I09A 4LE4A 1YEWA 2OXBA 1B35A 4AYUA 1HRI1 1JUHA 1J1LA 3N9OA 1XYNA 3UV9A 5C8CC 2DYCA 2JDZA 2ILMA 2J42A 3LA7A 3RG0A 1QF3A 2RG4A 4KGQA 3OGGA 2WZR3 3VD7A 4YM1A 4BE3A 1W28A 3U0ZA 2EAAA 2A7AA 3VUOA 5JXIA 1R64A 2VQUA 4PLMA 3BOPA 4JCKA 1L7RA 2W5FA 1V6KA 2FHRA 1UPSA 2QTWB 3RZGA 2XL9A 3OOXA 2ZX1A 3B69A 4A3ZA 1VBA3 2ZMNA 4FT8A 2XLFA 3GYDA 4HVQA 4GMP3 3MLJA 3SEEA 3NAPB 2Y38A 4H2AA 1W6NB 4IQPA 3VV1A 1KFXL 1C8NA 1H0BA 5IFPA 3WDUA 1IS5A 1UKGA 4Z2WA 3IN9A 3IDEA 3APBA 1RGSA 4RS5B 3T0BA 3ZXAC 1H8TA 2I45A 4GIQA 4E8CA 3BTZA 4U2AA 4Q1RA 2CGPA 4FPKA 5FYHA 3HQXA 3PU3A 2CTVA 3T2QA 3MF6A 3VZKA 3DXUA 2PHDA 4FTBA 1AR71 2JENA 5FPAA 1UCXA 1I5ZA 2WYFA 2VW0A 2AREA 3HNMA 2VULA 2ZGMA 4NROA 2A3XA 3KGZA 1C8M1 3H0OA 4IUGA 4GAZA 1H2KA 4WM7C 1STMA 2EALA 3EBRA 3IDCB 2ZX3A 1QJY2 4P9GA 4OI1A 3M3IA 1REEA 4CXYA 1OUSA 1H1MA 4NRQA 1W8FA 2WUHA 3DXTA 3EQEA 2R073 3SHRA 1W05A 4HKOA 4DQAA 1MZ5A 3QD6A 4CCLA 2BVVA 3PUAA 1FMD1 3U78A 2A6ZA 3LKJA 2VCCA 1CIWA 1XB9A 1CAUA 2VZ3A 4MV2A 3JB4C 1BXHA 4GXLA 2DCZA 5BY5A 3PUSA 3C8XA 5JIUA 1TMF2 2IUWA 4UFMA 1JU4A 3LE0A 4P9JA 3OBZA 1V0AA 5F3IA 5FLJA 3WG4A 4PIZA 1RL3A 1RUC3 4JKLA 2BU9A 2DBNA 4RQPC 5LRSA 1SFPA 1AR93 3VKNA 4N43A 4IDZA 5IK4A 4JGYB 3HR9A 2PTMA 4MGQA 5BPXA 3CQOA 5FYMA 4CDXA 2D5FA 3H8RA 1JHNA 2UYAA 5F5AA 2GN3A 3WNOA 4LBQB 1UYZA 2VJXA 4JQTA 5E6HA 3N7JA 1QDCA 1Q8SA 4P02B 1IQAA 3HPNA 2XGXA 2XVKA 3NV1A 4AW7A 3PJYA 3CDZB 1NLQA 1RUC1 1QKQA 3FHIB 3POSA 3JUUA 4KNCA 4PQ9A 4SBVA 2GC0A 5A6QA 5KR7A 3R0RA 3TBDA 4IE5A 4XQWA 4B8EA 2O14A 2ZXQA 3M7AA 3AMHA 2XH6A 1R1A2 1V00A 2OYZA 2XDVA 1AR83 2A73B 2CSGA 1SBDA 2YROA 3K75B 5EJ3A 1O4TA 1H4GA 2LROA 2R043 1LHOA 1Q8PA 2ZEZA 3B3QE 4FPCA 4JGYC 1NCQC 1IS6A 1VBB1 4QM9A 3WP6A 5K0UC 3I2KA 4LORA 4CDUC 3LB9A 4S2GA 1UXZA 3RNSA 1DFQA 3PMSA 3JD73 4MLOA 4DIQA 3DYMA 3BU7A 2H6CA 2P34A 3SISA 1DGWX 3WF1A 1JYXA 3T09A 2IXCA 3RMXA 1YQ6A 4URAA 1QQP2 3D0JA 3K4AA 4X6QB 3EXUA 3J7MA 4M3CF 1QQP1 1OF3A 4B3NA 5BUVA 3ZFFC 3ILFA 4FFHA 1VJ2A 1UIJA 2Y64A 5A33A 1EAH1 4LHNA 4IEUA 4KWLA 3O1SA 3AVSA 1CGPA 1LECA 1YI7A 2JB4A 5D8AC 4AAXA 2IXHA 5E8AA 3SNMA 5KBFA 4I2OA 1QJX2 1RUJ3 3VDCA 1RMU3 3LSDA 3OGSA 1V9U1 5FMBA 1W9YA 4ZS2A 2BGOA 3HQRA 2W91A 1DDLA 1SPPB 3OEAA 1JUIA 1XE7A 3KCYA 4Y4RA 3TWIA 4PLNA 4J1XA 4Y4YA 2X5IC 5T52A 4AHWA 2YU2A 1PHMA 3E5XA 3BUCA 2FMYA 1US2A 4P08A 1PO23 1LCLA 1UZZA 2RVAA 3J4UH 4LO5B 4Q4V1 4GWMA 5T3NA 1IS4A 2YGLA 4QGLA 4EYUA 1BK1A 3ZKYA 1YQCA 4RHV3 3RRDA 2ZA9A 5JZGC 2CGOA 4P5YA 3AP7A 4I01A 4IE7A 4JKMA 2AACA 3R4UA 3ZFGA 3BKZA 2W2IA 3I2FA 4JAAA 1OQEA 4ZONA 5FZBA 2PHXA 4X8PA 4IGQA 4OHZA 1GKBA 3AMMA 2X09A 1NCRA 1AR92 4HFSA 2C9KA 4NHMA 3A7QA 3KMHA 1RUG3 1YUDA 2ID4A 1ND3C 3VZMA 3I8TA 4AOCA 2WC2A 1UY1A 2RR12 1WKYA 4CEYA 4MGSA 1MEC3 2GC2A 2XBO2 4XILA 4ZXKA 2AH2A 3O0VA 4RFT0 2ARBA 1JYIA 4XF9A 3VLBB 4WBBA 1TME2 3THPA 2QQUA 3MFAA 3U14A 2JD4A 4XFIA 4CE8A 1SLTA 2GH2A 4BQ5A 1XNCA 3C7GA 4EZ4A 1TNFA 2D6PA 3V64A 1VAVA 1UZYA 1JZ7A 3GXUA 1SFYA 1RUD1 4URTA 3AL6A 3GM8A 1ZZBA 3N7LA 5FZEA 1G9AA 3WDWA 1G9BA 3WW4A 4XJUA 3LDRA 4OUEA 2IXKA 2E7TA 4UYBA 2HWF1 2W3JA 1AYM2 4FOYA 1HW5A 3UGFA 1CAWB 3PUIA 4CZSA 1RUH3 4XC9A 2FDGA 2RJ2A 3OGRA 3BPZA 1QXPA 2V72A 2A70A 3AKRA 1K42A 1E5IA 2CL2A 1MZEA 2A5ZA 1ENXA 2JG9C 2P37A 2PHRA 1RUH2 4D94A 5FWEA 2G1MA 4MO3M 1AJKA 4LNVA 4D7YA 2ZBJA 1N1VA 4MOAA 1ALYA 3TB0A 2BFUL 3AMQA 2O1QA 2V4VA 2BP6A 2ZACA 4N53C 3D0SA 3GF6A 2E31A 5T5OA 1W8ZA 2XJTA 5FKCA 5I0TA 2FDHA 1MS5A 3ACLA 1AXKA 5LASA 3MUZ1 2MNGA 3USUB 5BNOB 1KITA 3ACGA 3EHKA 2B5HA 4I3GA 3AMNA 2A3WA 4FXGB 4LBLA 2WDBA 4CCEA 2Q8CA 4A4AA 4CDQC 3RWNA 4DO0A 1UNBA 4R9AA 1R1ZA 4UW4A 1H30A 4OULA 3E1F1 2C9AA 3V0BA 3MGUA 5JCTA 2HLEA 1Y9QA 1WZXA 5A7PA 4XBLA 1N1YA 1H8VA 4Y20A 1BVVA 2ZMKA 2B39A 2R061 3IB3A 2WSVA 2W1SA 2KA3A 2YHJA 4Q0UA 1PVC1 2W46A 2QQNA 4LE3A 4XHXA 1IPJA 1QXRA 1G7YA 1PO22 2WNEA 3OY8B 3NNFA 2RMU1 1GYKA 5C7GA 4L99A 4IERA 2RR13 5DAWA 1GZTA 3ZN6A 4Q1PA 2WNUB 2IFRA 1Z7S3 1HB1A 2VBPA 5FRAA 4MADA 2V73A 1Q8VA 5CNAA 5K7PA 1YFWA 2VBBA 2RM23 3AYDA 4AVBA 4A7YA 2TNFA 1HX6A 2F4PA 2BFUS 2D3PA 2RDQA 5I8YA 1ND2B 3AL5A 2QQIA 2I07B 2WLPA 1IGOA 2HWE3 5JIAA 1GNHA 5F7UA 1HRV3 1EYBA 1FATA 1ZX5A 4H55A 3VBRA 3Q8AA 5BNPC 1G86A 5M0TA 5FKBA 4Y1ZA 2PAEA 1OF4A 2NLRA 4BIOA 1S1AA 3DYPA 4AVVA 1UYXA 3M2MA 1ZYBA 3D6EA 1F8VA 4XVHA 4RD7A 1O7FA 1AX1A 1X9TA 3C7FA 4GMP0 4D0QA 4XOGA 1NY72 4IV3C 2FCUA 3CZUA 5IATA 5DMYA 1CONA 2VOWA 2R042 3GCXA 3N36A 4JTOA 5DAPA 3LEMA 5KHJA 1ND3A 1OPMA 3QH6A 3K2OA 4KU7A 3DL3A 2WL1A 5J98B 4FPHA 5F6LB 4DB5A 1NG0A 5F1RA 3LA3A 2C1FA 4ZU4A 1R093 2VC9A 3FC0A 3ZN4A 3SCHA 5FLIA 2RJKA 3M3EA 4N9IA 4PCRA 1OQDA 4LKFA 2QQVA 4NPLA 5EJ1B 1NKGA 5FZOB 3WT3A 4A3XA 3K4ZA 3ZO0B 4KWKA 5L9RA 5C3SA 3UKNA 3RZHA 4LXLA 4G9SB 2ZMLA 4HL0A 1PGSA 3KF3A 1QEXA 3BTAA 1PK6C 3H42B 4Q4X2 4EN6B 2W1UA 1JI6A 2QUOA 2WS93 5K4LA 2JKBA 1LU1A 4K6BA 2ERFA 3MLLA 2QVSB 1NT0A 2W87A 3HAGA 4QX8A 4A7ZA 2BBAA 5FYTA 4YGCA 3WD5A 4FQ4A 2XUMA 5C5UA 1MZFA 2RMU3 3VZOA 1FPN2 4YVSB 1KS4A 1SEFA 2VOTA 2VY0A 1S55A 4JV4A 5C3OA 2VXRA 1FPN1 1TQ5A 2B8MA 2Y33A 4HG6B 4NWWA 4QAWA 5C4WC 3ZXEA 4UT5A 1RUH1 1ASJ2 5CG8A 5IVJA 3IWZA 1YNAA 1PZ8A 4CUBA 4AQ6A 2J1EA 4OI0A 3WDTA 4YVWB 2CNAA 4MX3A 4N53B 3O1RA 5G04L 4HN0A 3F2ZA 2AYHA 2E9QA 1RIRA 2R6QA 4FPOB 4QXKA 5CADA 2P5BA 4BK5A 4PI0A 1UYYA 4QT6A 5J37A 2VNOA 1IPSA 1OD5A 4XJ9A 5FMDA 2BNOA 3AJZA 4CCMA 3NKGA 1F9KA 5JI7A 1XBFA 4RQPA 4LITA 4BWOA 3RZLA 2RDSA 1F5JA 1ZBE1 3NAPA 4K8RB 4N43C 3ILNA 2VNGA 4Y26A 4CU6A 3JCIA 3DF0A 1BMV2 1ZBE2 2WT0A 4AGGA 3WF4A 1CZSA 1UN1A 3POEA 1RINA 5FZ3A 4DXRA 2GNMA 4XF0A 3T0DA 2OVUA 2D6NA 1UYPA 2F17A 2LRPA 2VGDA 1GLHA 3INAA 4NHXA 1V6LA 4UW3A 2PXJA 1YC61 2YZ4A 1NX9A 1REDA 4YNIA 1C1FA 2QDNA 2V5DA 2Z79A 3ZX7A 4BQ3A 3I4IA 3ZDSA 5F3EA 5BNNC 2ZKLA 4GJZA 3WNMA 1EAH2 4QHZA 4YSFA 1QOSA 5D2AA 1MS3A 1GUIA 2ZHLA 4OZXA 4ARXA 1UMIA 1ULEA 1QH6A 4IGOA 4QX7A 1JS9A 4W6YA 2QE3A 3LF7A 5FY7A 4CDUB 4TXWA 1FAYA 2HJIA 1B35B 1S0CA 2BYVE 3NO8A 4P00B 4U36A 3T4VA 1ZRCA 1V6OA 2J1RA 3LEGA 1DHKB 3Q9OA 1VP6A 3AYEA 3TAYA 3UYJA 1VLNA 4A41A 1BLZA 4E2GA 2DBIA 5I0RA 4AEDC 2W52A 5CU1A 2VPVA 1A8DA 1YJKA 3UKVA 3LD8A 2D5HA 2CGNA 2MPFA 2XLAA 4XQDA 4CUAA 4QGMA 3H3ZA 3HIFA 4CCDA 2K0GA 3EB7A 4H7MA 4RSUA 4DMIA 5C3QA 4ZU5A 1A3KA 5LWBA 3ENRA 3TYJA 2HH9A 1NAEA 4PT6A 3HOBA 5EFUA 4Q26A 1GP6A 2XB6C 3IT8A 4JDMA 4CDWA 1IPKA 3CNAA 3POIA 5T54A 3RSJA 4NN0A 2EXHA 4R9CA 4FFIA 5ACA3 1POQA 4N53A 1UZ0A 5C3RA 4BMEA 1D0HA 1OHFA 3ROUA 4NHLA 5DDJ3 4CRQA 1JMUB 1UOFA 4B7EA 4M4PA 2HWE1 2VZUA 3UGHA 5HCBA 4AFDA 2R1BA 1VBB3 2XONA 4FP3A 2Q8OA 3VL9A 1WLTA 4XUPA 4A6SA 5FPZA 1IKPA 5FPXA 5FQ0A 3CJIC 4LO4B 1TME1 1OUXA 1QJY1 3LDKA 5A7WA 1YWKA 4XJAA 3FUQA 4GWIA 5FFOC 4LKEA 5JSPA 4GB32 3VHRA 3KGLA 3WSOA 2RS52 3Q8CA 2WAOA 1T6GC 1ZRIA 3ZLIA 4JGZA 4BHPA 4RGGA 4UF0B 3AK0A 1EPWA 4YGEA 5LATA 4YM3A 3ACIA 2PMWB 1OURA 1FYUA 1GICA 1SLAA 2BNMA 2BNNA 5FYYA 1O4YA 4Y20B 3CEWA 1Y3TA 3HN3A 3USSA 1HRI2 2H6BA 3JQWA 3E6DA 4BLJA 2C4XA 3S5AA 1OVSA 5FYSA 4XZUG 3P5BA 5JAXA 3MIFA 1UZVA 2IWGB 4JHTA 1A34A 5FO7B 3D5OA 5FOBB 2FDJA 1WMDA 1VIWB 1YRZA 2JDUA 3I3DA 1QH7A 5ANNA 4BXSV 1ULDA 4F3JA 2Y6HA 2HWC3 1MZ6A 1ODMA 2AZ5A 5FPVA 4AHXA 4I30A 1PIV2 2ZTNA 5DZFA 3ACHA 3K48A 4CDUA 3PUQA 4NIDA 5IAVA 4IGPA 3AP9A 5FXVA 3AM2A 2C24A 1AR81 1FXZA 1GQHA 2VUCA 1IS3A 1EV11 3DPRC 4GWNA 1CX1A 4GALA 3X29B 1KDKA 1TVGA 4K3UA 4FOVA 3ZXGA 4PHZA 1R083 1Y43B 1QHDA 1TMF3 5HBAA 3A4UA 3OB8A 2UWAA 2WO7A 3NJVA 4BA6A 1CAVA 4OHYA 5FY0A 3J26N 4DINB 3ZIXA 5T5PA 1DQ2A 3GJAA 1R1A1 4KWUA 4RHV2 3NJYA 4S2HA 4WVVA 1VBE2 1K5MB 2P3IA 4NVPA 2JG9A 1VBE1 4BK4A 1RUI3 3K46A 1OH3A 2PQQA 1XQNA 2JE8A 4WZFA 4D7SA 5GLVA 5KXDA 1KRIA 5JR7B 1AYN3 3LIHA 2XLGA 2V5YA 2WAAA 3J8F2 2PQSA 2HWD3 4UFLA 5FPBA 1RITA 3I7DA 1KD7A 5FY8A 4I02A 4YW3A 3T1LA 1CX4A 3AKTA 4O61A 3WG3A 1PK6B 4K9SA 3WY6A 1CAWA 3KQRA 1RUD3 4Q8LA 5ANQA 5K8SA 4NIHA 5FZFA 2JG8A 4XHBA 2NMNA 1W9FA 3ZR5A 5CEHA 3I59B 1C28A 5CFDB 2WNUC 1XU1A 1HB2A 2BW8A 3LSEA 4PDWB 5ABJB 4XF3A 4XDQA 2D43A 3IIIA 2BDRA 4FPFA 2R16A 1DF0A 4QPWA 4XFBA 3VKLA 3WZ1A 2QFEA 4A7KA 4E8DA 1OKOA 4OMDA 4YG6A 5IYYA 2Y6LA 4JDNA 1QNYA 2AUYA 3I54A 2XKOA 1GQGA 4JRAA 3LPFA 1XSRA 2BJSA 4GKXA 4AEDA 4EN8B 2HWB2 2XHKA 5JOZA 2OZJA 4UFJA 3J7HA 1Z78A 3FX3A 1YYNA 2DVBA 2BGCA 1GFF2 2XJPA 4Y5SA 4CTEA 3ZSMA 2WZ8A 3I2HA 3IMNA 5F3GA 3LOIA 4QKDA 1VBA2 5KHKA 4P9XA 4UBHA 4BQYA 3ST7A 2DDUA 2YC2A 3DECA 2HEYF 1GNYA 1ZBE3 3B01A 1FV3A 1HQNA 3CLPA 3CU7A 3GBFA 3NRUA 3TEXA 2IC1A 3WDXA 5C33A 3S57A 4MG2A 4QDRA 2FZ2A 1HLCA 4Q4X3 2JWPA 5SV5A 3RMYA 1UKRA 1S4CA 2Y34A 4QQ2A 5DZGA 2XQXA 3BODA 2F6BA 4JVAA 2EAKA 4YVWA 5T5LA 2XBO1 3G7DA 2PHLA 1O8SA 1W6PA 2WNVB 3A22A 4DOUA 1A78A 5C8CA 3KT4A 4UAPA 3AP6A 4QX3A 2WWUA 5I8TA 4R4XA 4AZZA 2RS31 1WGPA 4TLFA 2VUAA 4OHXA 4OUSA 3AFKA 1O6UA 2RS51 2PHFA 3O5SA 1UWWA 1XNDA 2WKKA 4TTGA 4UI9L 4ORFA 2BERA 5AVPA 1QJU3 2UU8A 3ZSKA 5IVCA 4X6RB 3V0AA 1EV13 2JB8A 1GR3A 2EXKA 3PUHA 1F35A 1D4VB 1ULOA 1VRH1 4JHZA 4V2VA 4Z2AA 5JMCA 3KCXA 3C7EA 4Q2FA 1WW7A 4AVTA 3OBTA 4FPGA 4H7LA 1RUG1 5GM0A 5A3MA 1C5HA 3AP5A 4B7KA 3PURA 4IEYA 4XFCA 5IJRA 5FLHA 3RJ2X 1MS8A 4B4QA 1U5XA 2O8OA 2ZGKA 1X7NA 3MICA 5K0UA 5KHGA 1W0OA 2V09A 4CPBD 2VZSA 1GU3A 4Y22B 3PL0A 3VDDA 1IZ3A 4HPKB 1DCSA 1CZTA 2EF6A 2RS11 3OYWB 4ISQA 4OHVA 5BNOC 4NRMA 3VD3A 3PVBB 3T2OA 2KM2A 1SLBA 2R30A 1RHI3 3J7LA 2JDMA 4IEVA 3O1TA 3MIEA 4FXKB 3OUJA 3ZYPA 4QX0A 2QQKA 2RHPA 2ZAHA 2HWD1 4AEKA 1N3OA 2I2SA 4OYUA 4FAGA 1PO13 3N9PA 4HK9A 5AFBA 4TLGA 1HV1A 1QXJA 1VBC1 2G9FA 4FFFA 4IEQA 5F2WA 1JYVA 4EE2A 1FOD2 2GP3A 2DURA 2VZTA 3Q8FA 5GZEA 4YW6A 4CEWA 3WQ7A 2WRAA 1JBCA 2QBXA 4QQOA 5I8SA 4Q0PA 2RS13 5C4WA 3P1IA 2DFBA 2GDFA 4MXWB 3RGBA 1POV3 3ZR6A 2Z2SB 2WJSA 3MW3A 3NQHA 4LIVA 3MBWA 2YXSA 4Q4Y1 3WV6A 4CDXB 3LOBA 3IPVB 5HI0A 4BOWA 5EJZB 1URXA 3C7OA 4Y33A 5T50A 3VBFC 4KI5M 2YFUA 2IXLA 2QCSB 4KL1A 4XURA 3F95A 2WFPA 1CAUB 2OA2A 5H9SA 1B35C 5LY1A 1AL0G 1DLLA 1GSLA 2VZVA 2OUHA 4N7IA 5FJHA 1N3PA 2VTXJ 3OPWA 3PVEA 1X8MA 5J36A 2XKPA 4LTAA 2WQ4A 3FWEA 4HLTA 4HBNA 1JU3A 2PAMA 4QX1A 1UY4A 2RM21 5I93A 5H9QA 1QOOA 2DF7A 2D6LX 4M3CB 4XBQA 1APNA 1S2BA 1RC6A 3CHXA 4XTPA 2ZAAA 4Y24A 1W3VA 3IPVA 5FYUA 4FQZA 3WF0A 2R063 1NLRA 2NQYA 1NUKA 2WNOA 4IV1A 1B09A 5ERLA 5LZ6A 4FTSA 1X82A 3ZFEB 2R0FA 1LHNA 5JOWA 3D8CA 3PLQA 3BOWA 5EIYB 2HWB1 4C0BA 4Z82A 5CFCB 1E57A 2B9VA 3S7IA 4N90A 5A7NA 2FZ1A 3MIHA 1DGRN 3MLKA 5CIRA 1J3QA 3HN1A 3KV4A 4XXPA 5FZ4A 1DQ4A 1FNZA 3ZYBA 4P5HA 3GNEA 1PGW2 3T3YA 5JLVA 1HQLA 1RVF2 4E27A 5J09A 5T5JA 4YFWA 4KBBA 4EWEA 4QPGA 4W6XA 1OKQA 2ZZJA 1JOPA 3L2HA 2PHWA 4IW3A 3RDIA 5DUXA 3VDAA 2EIBA 5DG2A 3S6PA 3TOJA 2K46A 3WEZA 1XOYA 4AEJA 4GMP1 1MEC2 3ASIA 2XJUA 1CVNA 2HWE2 2Y26A 1ACCA 4QQLA 5CG9A 5J96B 1W6MA 1RHI2 3VZLA 5KWRA 2XVLA 2WINB 4QM8A 2WIIB 1COV1 3KT7A 3WNKA 4B29A 5FZ8A 1CAVB 4MVTA 3RYRA 1OT5A 1W2UA 3H8XA 1YFXA 3THDA 3U75A 4BU2A 1CPMA 1RXFA 1SLIA 4EROA 5C4WB 5DAQA 2VQTA 2J22A 1SG3A 4D8MA 2RS33 3MDPA 3KB5A 4CDWC 4HONA 1VB4A 4QB1A 3N9NA 2WWJA 4XBNA 3H1WA 5HXVA 5FDBA 4EQVA 3NNGA 5FYCA 3OBRA 1BK0A 2ET1A 3IZOA 2G4IA 2SLIA 1D7PM 1AR73 2QDRA 5FPUA 1UX7A 3VL8A 4LA3A 3CKHA 2WFF2 4MSVA 3T30A 1YQ5A 5L7OC 2W9XA 4FPEA 4QXBA 3NW4A 3WXPA 2CY6A 4AI1A 4COYA 1X33A 2RS12 4CU8A 2N7GA 2W08A 2R1DA 2VG9A 5JPMB 4WVZA 3R4SA 3BTYA 3VHNA 4M3CA 3AX4A 1LGNA 4HETA 3RYPA 4AFCA 4N8MA 4XUTA 1OLQA 1RUI1 2PN5A 5FYIA 1NA1A 1RUI2 2VNRA 5FPLA 2GALA 2O0OA 4XEZA 4YGBA 3ZKUA 5C71A 3OUHA 5DUVA 1QMJA 4CCJA 1PMJX 5FZHA 5FO9B 4CXWA 3MV11 2J1AA 5FZ7A 1OA2A 4QQPA 1HB3A 3U4XA 5BNNA 3LGRA 1QWRA 4RHV1 4CP0A 2WS92 3P3NA 1HQWA 1DIWA 4E2QA 3AZXA 3OD0A 3D3AA 2ARXA 4R4ZA 4XF1A 5F3CA 2JE7A 1FX5A 1V6JA 1XYPA 4RS5C 3VBSB 2GP5A 2R041 3B93A 4JGYA 4OCTA 2YPDA 1WCKA 4UW6A 3L9JT 1UU5A 3NSTA 3VBRC 5EYYA 2DVDA 3VBFA 3HJRA 2ZGRA 3D82A 4H3WA 4J1WA 2E32A 4FPJA 3JBG2 1SCSA 3HBKA 4B4RA 3P3PA 4Z92B 4Z1VA 2VXJA 3SKVA 3ZMOA 4QKFA 1S2KA 3MHZA 3OGJA 5A1AA 3VBUB 1HXS1 2P3KA 4GWJA 4QX5A 4C91A 5I0DA 4CCKA 4YZ1A 2BWCA 1ASJ3 2XJRA 2RJLA 3THTA 1NE6A 4LLFA 5IFTA 3AC0A 1OBNA 1KEXA 3WW2A 2RM22 3POFA 1LOBA 1TE1B 3VBFB 3JD72 5FUNA 5C8CB 2LTNA 1MPXA 1S0FA 4GB33 4Y5Z0 1L3JA 3WNPA 2LUWA 2WQ8A 4TSVA 2VOXA 1UW8A 3WHUA 3ZYRA 4AVAA 5FZKA 1O5LA 5A6ZA 3CZJA 3ZVXA 5AC92 2RDRA 4G4FA 4LBJA 4DXSA 2CDPA 2YC4A 4LHSA 4Q4W3 1Q56A 2JX9A 5FZIA 1DGLA 2PLV2 5FUIA 2D40A 2UWCA 1UO9A 5EHDA 1BZWA 4INDA 3HQUA 4PI2A 1HIXA 5A7SA 3TRSB 3UESA 1WBLA 1W9SA 2DUOA 2Y0IA 3KV6A 1BKZA 2WNUA 3V56A 4LULA 4AI0A 1O8PA 1DYOA 2GZWA 3USUA 3EO6A 4NWVA 4MYEA 2WN2A 1NQJA 2D3SA 2V4AA 1W8TA 4ZPIA 1JTZX 4DY5A 1WCDJ 5ACA1 3WG2A 1ULFA 1GOGA 3DGTA 2MEV1 3NKTA 2X10A 2W68A 4MH0E 4OI4A 4TWTA 3ZYFA 2VZPA 3PU8A 5FR3A 4RFRB 5DUWA 4QKBA 2AENA 2KD7A 1HN1A 3EYPA 3MIBA 3L2YA 4FFGA 3KZ4C 2DV9A 1BVP1 1CJPA 3M4FA 3KSCA 1RUC2 1O5UA 3MEPA 1RUOA 2JICA 1W03A 3MO4A 1W0PA 4OMCA 3OUIA 2YDEA 4GH4C 3W21A 3VB9A 4L11A 1D4M1 3A0NA 2E63A 2W95A 5JWPA 1RJ7A 5LRRA 2VOKA 3GZUC 5LB6A 2DVFA 3T0AA 4FCAA 4WM8C 5FP3A 1JODA 2VZOA 3NV3A 4LUMA 3SLIA 3SH5A 1GQPA 4DUVA 4YW1A 5LEJA 3VN4A 2VMFA 5CBLA 2UWBA 4M4RA 3BYWA 2OZ6A 1VBD1 4PDWC 1WD3A 5CZKA 4MXVA 1OD3A 2GMEA 4CCCA 4ZXEA 4OZOA 4Q0QA 1MVQA 2VCBA 1PZ7A 2WZEA 2ZOEB 3AZYA 4KG0A 2VQ0A 3BTXA 1PVC2 2VE1A 4Y22A 1N3QA 4QDSA 1E5HA 2R071 2W94A 2J1SA 2EVXA 3KT1A 5DPNA 5F32A 3T2PA 3FBYA 4AXOA 4YZ3A 2DU1A 1UU6A 2IZWA 4BMBA 4IV3A 3HD8B 4QKNA 4XF4A 1Z7S1 5A7OA 4XZPA 1QJX1 2RE9A 5A3PA 3K3NA 1RVF3 4BQ4A 2BOIA 1A8MA 1OFNA 3NL1A 4ONUA 5IVVA 2VVDA 4H14A 1OXCA 5DDJ2 1VR3A 1AXYA 4CDWB 3MFCA 3MI8A 4M00A 1XSQA 3VD9A 3NJXA 3MW4A 1AR82 2ORZA 1CZVA 5C6CA 3GBGA 3OYWA 2I74A 3AP4A 4W8JA 2E6VA 4Q4V2 3RYKA 1FOD1 5C9AB 4ZHNA 1O4ZA 3KS7A 4R52A 3ZYIB 5CFCA 1CJDA 1JW6A 4EN7B 4LA2A 2A3YA 3ORJA 4QPIB 1K45A 2HYXA 5LBCA 2OX0A 5J1XA 1I6XA 4NOTA 4IEPA 4EWDA 1WLDA 4LOTA 2YC0A 3AZZA 1OLME 1XU2A 1VMFA 2B45X 5GLUA 3O0XA 3WNLA 4AR2A 3Q8BA 4ASMB 4M3CE 2Y6JA 3ZPYA 4DFSA 5C9AA 1RXGA 4LO6B 4QPYA 3WP5A 5KHHA 1BEV1 1UAIA 1W06A 1RUF3 1E5SA 1C8M2 4JGZB 2UY8A 1QJX3 3AKSA 3VHPA 3WCSA 1F4HA 5CFDC 2Q0AA 3JQXA 1N1SA 1QJU2 1T6BX 3M3OA 2D6KA 3WUDA 1QJZA 1AR62 1RUF2 1SHWB 1W8UA 3O0WA 2CAUA 2XPJA 5GZGA 1NE4A 3JD71 2OPWA 5JUVA 1ZVFA 1AJOA 2VCMA 1LGCA 1VB2A 3K4DA 3MPBA 4HT1T 4C0HA 1S0DA 5B4NA 4ISRA 5DN2A 5SV8A 5IAXA 1ST8A 3OPTA 1LOAA 2DVAA 3NVCA 4WV8A 2R0HA 3ZSEA 3PIJA 3N9LA 3UJOA 3O1PA 1DYPA 5L9VA 3CJIA 2VECA 4GZ9A 3POJA 1S0EA 1J3RA 2Q8DA 4F83A 4LBNA 4B1LA 5F5CA 4B4PA 1RUJ1 2PHTA 5C70A 3LPGA 1ND3B 4P14A 1ODNA 1NQDA 1OSGA 2GAUA 4Y5TA 3AB0A 4FP2A 1CPNA 2ZJCA 1NYWA 1F15A 3A0KA 1XJAA 1XYOA 4Q29A 1KXGA 5FXZA 1PIV1 3GHNA 4CCOA 3NJZA 3ATGA 5ACA2 2R7EB 4KU8A 1SLCA 5KC5A 5JDBA 2OKXA 5KHIA 4DUXA 1FPN3 1IG3A 2G9GA 1IOAA 2VR4A 2D44A 3J7NA 1GNZA 2FBEA 4IV1C 4O65A 1LGBA 5LBEA 1S0IA 3H8UA 3UT0A 4DY3A 2Y8KA 2L9LA 4QXCA 2Y0OA 4YZ4A 4LMFA 4N43B 4Z07A 2JECA 5GLTA 1RHI1 1U5IA 4N9HA 3T1MA 2IXIA 4RN5A 5IK8A 4AVSA 5EWSA 5FK8A 2E26A 3ES4A 2XR4A 2NZ9A 1QOTA 4LKSA 4WM8A 3A23A 1MQTC 2JG8B 2BVBA 1LODA 2Q1ZB 1PK6A 3PJQA 2WFF3 2VUJA 4RQPB 1VBB2 1ZA7A 4PDWA 1RTVA 3E5QA 5BNOA 3ACFA 5HXMA 4MHRA 3I59A 3IBMA 1W04A 4E2SA 4YW7A 3DUIA 1UXXX 4NUBA 3J8F1 4YW2A 2Q8EA 1VRH3 1WW4A 4UFKA 3WP4A 3AFGA 1W8HA 1YLLA 4Y3OA 3TNPB 2UURA 1W8NA 4L2NA 4XJZA 1YFUA 2Y60A 3MYXA 3W5MA 4QB6A 4LBOA 4XW3A 2E7AA 1UOBA 3R4DB 2QKDA 4YVSC 2PELA 4YFZA 2ZX2A 3JU9A 1S0JA 1Y9MA 5LCWL 3LCPA 1UOJA 1H6XA 5FP4A 2YBPA 5K9YA 3BN6A 3O14A 4J25A 1W2TA 4XE9A 4BQXA 4QMAA 3N7KA 1GOFA 1PIV3 2CDOA 2QQLA 2RV9A 2DTYA 2YYOA 4HOOA 3MIGA 4YW4A 1FV2A 4FI9A 2B42B 4WZCA 5FTTC 1CR7A 5HCFA 3WNXA 4YARA 1US3A 1WW5A 2F4LA 1LHWA 2TBVA 3FLPA 1IG0A 3ME2A 1QJFA 1GV9A 1WD4A 1YI9A 1XE8A 4IEOA 1GANA 4XCAA 1NLSA 5CA6A 5HCAA 3OGVA 2EIDA 3D4KA 2WN3A 4DXTA 1W9TA 1CQ9A 5DXDA 2VL4A 3WOGA 2ARCA 2D7FA 5LA9A 2AC1A 5A3UA 5IK7A 1BBT2 1VBA1 1L7LA 1JYCA 2AR6A 1DQ0A 2IFWA 3DYOA 4JC1A 5A3WA 4F8AA 2VUDA 1UIKA 3I2IA 2XL7A 1O3RA 1ULGA 1SPPA 2ZEWA 1SZBA 5E16A 1XC6A 5BYNA 2FD8A 3RI8A 3O1UA 1GMMA 3FFQA 4UFIA 2P6HA 1BHGA 5C9AC 1G8WA 2RR11 1CESA 2WT2A 2Z4FA 3OD4A 2PHUA 4P9WA 1HRV2 1PGL2 1BEV2 4WM7A 2EIGA 4L97A 3PVNA 4A42A 5CFDA 2ZGUA 1NA1C 3V0AB 3VBSA 1W2NA 1YQ8A 1OVPA 2YB7A 5G05L 2YMZA 1QJU1 2D97A 4I0WB 2XWJB 1UPIA 3VZNA 3H3LA 5AFEA
chains in the Genus database with same CATH topology
2DCJA 4QX0A 2QQKA 3C7GA 4OYUA 3FL7A 1JYWA 3I97A 1JZ7A 3GXUA 4LPLA 1JYVA 3UETA 2B4KA 1XNAA 3GM8A 1LNSA 2VZTA 4PF1A 2QBXA 1EUUA 4OUEA 2VZQA 3P1IA 2W3JA 1W0NA 3PUIA 3NQHA 3MBWA 2RJ2A 3OGRA 2V72A 2X05A 2DCKA 1K42A 5EJZB 3C7OA 2W92A 4KI5M 2YFUA 4XURA 4MO3M 2VZVA 4MOAA 3ABZA 4QDQA 2Y6GA 2V4VA 1XNTA 2E31A 2BGPA 1JU3A 2ORXA 4QX1A 1UY4A 3A21A 3MUZ1 2VZRA 3ACGA 3WF0A 3HEIA 2VZ1A 1NUKA 2JKXA 2WDBA 5EIYB 3JXSA 1JHJA 2J1VA 2B9VA 3E1F1 3FHQA 2HLEA 1W9WA 4ZZ8A 3IB3A 1CIYA 1H6YA 4BJ0A 2W1SA 1JZ6A 1F4AA 2W46A 2QQNA 2ZEYA 3OEBA 5JMOA 3CMGA 3SKJE 5C7GA 3VDAA 2EIBA 2W1QA 2J1TA 3WEZA 4A45A 4MADA 4A6OA 4QX2A 2QQIA 1WCQA 3WNKA 2VMDA 3WF2A 1OT5A 3THDA 2YFZA 4LQRA 5F7UA 3HNYM 5LA0A 5JXGA 2VQTA 2J22A 1OF4A 1SG3A 3I2JA 4D8MA 3DYPA 4DUWA 3ECQA 2LW8A 1UYXA 2VCAA 4QB1A 4XVHA 3C7FA 3NNGA 4D0QA 4KMQA 3U37A 2W1WA 3CZUA 1J84A 3VD5A 5DMYA 1JZ5A 1D7PM 1UX7A 3CKHA 2Y6KA 2W9XA 3GDBA 3MUY1 4CU8A 4W4ZA 2VC9A 1YQ2A 2QQMA 5EJ1B 1JYNA 1NKGA 4XUTA 1PX4A 3K4ZA 5C71A 2W1UA 1JI6A 3VD4A 1PMJX 3MV11 2J1AA 2J1UA 5LA2A 2W87A 4ZZ5A 3ETPA 3T08A 2BBAA 4DEVA 1T2XA 1OH4A 4RYDA 3D3AA 3OBAA 2VMCA 4XUQA 2VMEA 3LQCA 2J7MA 2WBKA 2VOTA 3WQBA 1DLCA 4HG6B 4ET7A 4QAWA 3HJRA 3K77A 2E32A 1L7QA 5CYYA 4CUBA 2J1EA 3SKVA 5A1AA 4GWJA 4PQQA 5I0DA 3BGAA 5G04L 3F2ZA 5IFTA 3HNBM 3AC0A 4BK5A 1KEXA 1UYYA 2WO1A 1MPXA 2WABA 3WNPA 2WQ8A 3CZJA 3OG2A 4JX0A 1J83A 4CU6A 3LEIA 4DXSA 2CDPA 4CVUA 2YC4A 4LHSA 3I3BA 3WF4A 1CZSA 1KGYA 5FUIA 4DXRA 1JZ3A 3T0DA 3UESA 1W9SA 1GOHA 1NX9A 3IAPA 3I3EA 2V5DA 1O8PA 1DYOA 2C26A 3SEPA 1W99A 2WN2A 4DEQA 4CUCA 2YG0A 3WNMA 1JZ4A 1GOGA 2X10A 3ZM8A 4YPJA 1GUIA 2VZPA 2E33A 2KD7A 3EYPA 1UMIA 1HN1A 4ARXA 4CU7A 4ZY9A 2EIEA 3MO4A 4CU9A 4OMCA 4TXWA 1ULPA 2XHNA 4P00B 2W95A 2J1RA 3LEGA 2ZEXA 4A41A 3IAQA 3T0AA 2VZOA 5IHRA 4UOJA 1SDDB 1GQPA 3FHAA 4DUVA 2VMFA 2XOMA 4M4RA 4CUAA 2VO5A 3WF3A 5CZKA 1OD3A 3EB7A 3FN9A 4ZXEA 4OZOA 2QQOA 2VCBA 1I5PA 1NAEA 2WZEA 3C7HA 4PT6A 3HOBA 4QDSA 5DPNA 2W94A 3T2PA 2J1SA 1K12A 1UZ0A 4ARYA 2WO2A 3W5NA 3VD7A 4M4PA 2VZUA 5JXIA 1R64A 2VQUA 2XONA 1L7RA 2W5FA 4XUPA 5JXHA 2WO3A 1P8JA 4A3ZA 3VD9A 3NJXA 4GWIA 2VM9A 2ORZA 3UNPA 1CZVA 3SEEA 5IFPA 3WSOA 4W8JA 2WAOA 3T0BA 3ACIA 4E8CA 2BZDA 3HN3A 3MV01 3T2QA 1K45A 2HYXA 4XUOA 5J1XA 2C4XA 4XZUG 1O59A 3HNMA 3WNLA 2Y6JA 1UY3A 4IUGA 3IDAA 3I3DA 4BXSV 2Y6HA 1F4HA 4XUNA 1UY2A 2QQJA 3ACHA 2WUHA 1SHWB 3LEKA 4QB2A 1CX1A 1TVGA 5JUVA 2VCCA 3K4DA 3OB8A 5B4XA 2VZ3A 3NJVA 5B4NA 2JDAA 5DN2A 3C8XA 4KWUA 3P6BA 1JU4A 3LE0A 4GZ9A 4BDVB 3WNNA 4BK4A 3K46A 2JE8A 1W8OA 4JKLA 1K3IA 2LS6A 5C70A 3LPGA 2WAAA 2PQSA 4MGQA 3CQOA 4A4AA 1DP0A 3WNOA 2R7EB 1UYZA 2VJXA 2OKXA 4DUXA 2VR4A 4P02B 3HPNA 2Y8KA 2L9LA 2W47A 3CDZB 3IIIA 4QPWA 4L0PA 4E8DA 4RN5A 4OMDA 2ZXQA 2Y6LA 5IYYA 2E26A 4JKKA 3LPFA 4LKSA 1EUTA 3K75B 3A23A 2ZEZA 2WYSA 3I2KA 1UXZA 3J7HA 1TG7A 3ACFA 3DYMA 5HXMA 3WF1A 1PX3A 2WZ8A 3T09A 3I2HA 1JYXA 1UXXX 5JR2A 3K4AA 5HPOA 1IQDC 1OF3A 2VTFA 1W8NA 2DDUA 2YC2A 3DECA 1GNYA 2Y64A 4QB6A 3W5MA 3NRUA 4QDRA 5LCWL 1PMHX 4AAXA 1H6XA 3VDBA 2XQXA 3BN6A 3VDCA 3I2GA 3OGSA 1JZ8A 1GOFA 1O8SA 2CDOA 3A22A 2BGOA 2QQLA 2RV9A 2W91A 3CIHA 4UAPA 5LA1A 3OEAA 4FI9A 4QX3A 4AG4A 1US3A 5DQ0A 2JD9A 1UY0A 3OGVA 1US2A 2EIDA 2WN3A 4P08A 4DXTA 1W9TA 2RVAA 1UWWA 2VL4A 4TTGA 3GGLA 4UI9L 2BERA 4P5YA 4W50A 3THCA 4JKMA 4Z2AA 3PUHA 1ULOA 3DYOA 3I2FA 4JHZA 3C7EA 2EICA 3I2IA 2ZEWA 1XC6A 2X09A 1GMMA 5IJRA 1BHGA 2C9KA 3A7QA 5JXJA 2Z4FA 2ID4A 1XPWA 1UY1A 1JZ2A 2VZSA 1WKYA 1GU3A 4A42A 4MGSA 1RYYA 4A44A 2YB7A 1CZTA 5G05L 3VD3A 3T2OA 1UMHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DCJ A;  4QX0 A;  2QQK A;  3C7G A;  4OYU A;  3FL7 A;  1JYW A;  3I97 A;  1JZ7 A;  3GXU A;  4LPL A;  1JYV A;  3UET A;  2B4K A;  1XNA A;  3GM8 A;  1LNS A;  2VZT A;  4PF1 A;  2QBX A;  1EUU A;  4OUE A;  2VZQ A;  3P1I A;  2W3J A;  1W0N A;  3PUI A;  3NQH A;  3MBW A;  2RJ2 A;  3OGR A;  2V72 A;  2X05 A;  2DCK A;  1K42 A;  5EJZ B;  3C7O A;  2W92 A;  4KI5 M;  2YFU A;  4XUR A;  4MO3 M;  2VZV A;  4MOA A;  3ABZ A;  4QDQ A;  2Y6G A;  2V4V A;  1XNT A;  2E31 A;  2BGP A;  1JU3 A;  2ORX A;  4QX1 A;  1UY4 A;  3A21 A;  3MUZ 1;  2VZR A;  3ACG A;  3WF0 A;  3HEI A;  2VZ1 A;  1NUK A;  2JKX A;  2WDB A;  5EIY B;  3JXS A;  1JHJ A;  2J1V A;  2B9V A;  3E1F 1;  3FHQ A;  2HLE A;  1W9W A;  4ZZ8 A;  3IB3 A;  1CIY A;  1H6Y A;  4BJ0 A;  2W1S A;  1JZ6 A;  1F4A A;  2W46 A;  2QQN A;  2ZEY A;  3OEB A;  5JMO A;  3CMG A;  3SKJ E;  5C7G A;  3VDA A;  2EIB A;  2W1Q A;  2J1T A;  3WEZ A;  4A45 A;  4MAD A;  4A6O A;  4QX2 A;  2QQI A;  1WCQ A;  3WNK A;  2VMD A;  3WF2 A;  1OT5 A;  3THD A;  2YFZ A;  4LQR A;  5F7U A;  3HNY M;  5LA0 A;  5JXG A;  2VQT A;  2J22 A;  1OF4 A;  1SG3 A;  3I2J A;  4D8M A;  3DYP A;  4DUW A;  3ECQ A;  2LW8 A;  1UYX A;  2VCA A;  4QB1 A;  4XVH A;  3C7F A;  3NNG A;  4D0Q A;  4KMQ A;  3U37 A;  2W1W A;  3CZU A;  1J84 A;  3VD5 A;  5DMY A;  1JZ5 A;  1D7P M;  1UX7 A;  3CKH A;  2Y6K A;  2W9X A;  3GDB A;  3MUY 1;  4CU8 A;  4W4Z A;  2VC9 A;  1YQ2 A;  2QQM A;  5EJ1 B;  1JYN A;  1NKG A;  4XUT A;  1PX4 A;  3K4Z A;  5C71 A;  2W1U A;  1JI6 A;  3VD4 A;  1PMJ X;  3MV1 1;  2J1A A;  2J1U A;  5LA2 A;  2W87 A;  4ZZ5 A;  3ETP A;  3T08 A;  2BBA A;  4DEV A;  1T2X A;  1OH4 A;  4RYD A;  3D3A A;  3OBA A;  2VMC A;  4XUQ A;  2VME A;  3LQC A;  2J7M A;  2WBK A;  2VOT A;  3WQB A;  1DLC A;  4HG6 B;  4ET7 A;  4QAW A;  3HJR A;  3K77 A;  2E32 A;  1L7Q A;  5CYY A;  4CUB A;  2J1E A;  3SKV A;  5A1A A;  4GWJ A;  4PQQ A;  5I0D A;  3BGA A;  5G04 L;  3F2Z A;  5IFT A;  3HNB M;  3AC0 A;  4BK5 A;  1KEX A;  1UYY A;  2WO1 A;  1MPX A;  2WAB A;  3WNP A;  2WQ8 A;  3CZJ A;  3OG2 A;  4JX0 A;  1J83 A;  4CU6 A;  3LEI A;  4DXS A;  2CDP A;  4CVU A;  2YC4 A;  4LHS A;  3I3B A;  3WF4 A;  1CZS A;  1KGY A;  5FUI A;  4DXR A;  1JZ3 A;  3T0D A;  3UES A;  1W9S A;  1GOH A;  1NX9 A;  3IAP A;  3I3E A;  2V5D A;  1O8P A;  1DYO A;  2C26 A;  3SEP A;  1W99 A;  2WN2 A;  4DEQ A;  4CUC A;  2YG0 A;  3WNM A;  1JZ4 A;  1GOG A;  2X10 A;  3ZM8 A;  4YPJ A;  1GUI A;  2VZP A;  2E33 A;  2KD7 A;  3EYP A;  1UMI A;  1HN1 A;  4ARX A;  4CU7 A;  4ZY9 A;  2EIE A;  3MO4 A;  4CU9 A;  4OMC A;  4TXW A;  1ULP A;  2XHN A;  4P00 B;  2W95 A;  2J1R A;  3LEG A;  2ZEX A;  4A41 A;  3IAQ A;  3T0A A;  2VZO A;  5IHR A;  4UOJ A;  1SDD B;  1GQP A;  3FHA A;  4DUV A;  2VMF A;  2XOM A;  4M4R A;  4CUA A;  2VO5 A;  3WF3 A;  5CZK A;  1OD3 A;  3EB7 A;  3FN9 A;  4ZXE A;  4OZO A;  2QQO A;  2VCB A;  1I5P A;  1NAE A;  2WZE A;  3C7H A;  4PT6 A;  3HOB A;  4QDS A;  5DPN A;  2W94 A;  3T2P A;  2J1S A;  1K12 A;  1UZ0 A;  4ARY A;  2WO2 A;  3W5N A;  3VD7 A;  4M4P A;  2VZU A;  5JXI A;  1R64 A;  2VQU A;  2XON A;  1L7R A;  2W5F A;  4XUP A;  5JXH A;  2WO3 A;  1P8J A;  4A3Z A;  3VD9 A;  3NJX A;  4GWI A;  2VM9 A;  2ORZ A;  3UNP A;  1CZV A;  3SEE A;  5IFP A;  3WSO A;  4W8J A;  2WAO A;  3T0B A;  3ACI A;  4E8C A;  2BZD A;  3HN3 A;  3MV0 1;  3T2Q A;  1K45 A;  2HYX A;  4XUO A;  5J1X A;  2C4X A;  4XZU G;  1O59 A;  3HNM A;  3WNL A;  2Y6J A;  1UY3 A;  4IUG A;  3IDA A;  3I3D A;  4BXS V;  2Y6H A;  1F4H A;  4XUN A;  1UY2 A;  2QQJ A;  3ACH A;  2WUH A;  1SHW B;  3LEK A;  4QB2 A;  1CX1 A;  1TVG A;  5JUV A;  2VCC A;  3K4D A;  3OB8 A;  5B4X A;  2VZ3 A;  3NJV A;  5B4N A;  2JDA A;  5DN2 A;  3C8X A;  4KWU A;  3P6B A;  1JU4 A;  3LE0 A;  4GZ9 A;  4BDV B;  3WNN A;  4BK4 A;  3K46 A;  2JE8 A;  1W8O A;  4JKL A;  1K3I A;  2LS6 A;  5C70 A;  3LPG A;  2WAA A;  2PQS A;  4MGQ A;  3CQO A;  4A4A A;  1DP0 A;  3WNO A;  2R7E B;  1UYZ A;  2VJX A;  2OKX A;  4DUX A;  2VR4 A;  4P02 B;  3HPN A;  2Y8K A;  2L9L A;  2W47 A;  3CDZ B;  3III A;  4QPW A;  4L0P A;  4E8D A;  4RN5 A;  4OMD A;  2ZXQ A;  2Y6L A;  5IYY A;  2E26 A;  4JKK A;  3LPF A;  4LKS A;  1EUT A;  3K75 B;  3A23 A;  2ZEZ A;  2WYS A;  3I2K A;  1UXZ A;  3J7H A;  1TG7 A;  3ACF A;  3DYM A;  5HXM A;  3WF1 A;  1PX3 A;  2WZ8 A;  3T09 A;  3I2H A;  1JYX A;  1UXX X;  5JR2 A;  3K4A A;  5HPO A;  1IQD C;  1OF3 A;  2VTF A;  1W8N A;  2DDU A;  2YC2 A;  3DEC A;  1GNY A;  2Y64 A;  4QB6 A;  3W5M A;  3NRU A;  4QDR A;  5LCW L;  1PMH X;  4AAX A;  1H6X A;  3VDB A;  2XQX A;  3BN6 A;  3VDC A;  3I2G A;  3OGS A;  1JZ8 A;  1GOF A;  1O8S A;  2CDO A;  3A22 A;  2BGO A;  2QQL A;  2RV9 A;  2W91 A;  3CIH A;  4UAP A;  5LA1 A;  3OEA A;  4FI9 A;  4QX3 A;  4AG4 A;  1US3 A;  5DQ0 A;  2JD9 A;  1UY0 A;  3OGV A;  1US2 A;  2EID A;  2WN3 A;  4P08 A;  4DXT A;  1W9T A;  2RVA A;  1UWW A;  2VL4 A;  4TTG A;  3GGL A;  4UI9 L;  2BER A;  4P5Y A;  4W50 A;  3THC A;  4JKM A;  4Z2A A;  3PUH A;  1ULO A;  3DYO A;  3I2F A;  4JHZ A;  3C7E A;  2EIC A;  3I2I A;  2ZEW A;  1XC6 A;  2X09 A;  1GMM A;  5IJR A;  1BHG A;  2C9K A;  3A7Q A;  5JXJ A;  2Z4F A;  2ID4 A;  1XPW A;  1UY1 A;  1JZ2 A;  2VZS A;  1WKY A;  1GU3 A;  4A42 A;  4MGS A;  1RYY A;  4A44 A;  2YB7 A;  1CZT A;  5G05 L;  3VD3 A;  3T2O A;  1UMH A; 
#chains in the Genus database with same CATH topology
 1RUF 1;  2GU9 A;  4K8F A;  1WA4 A;  5L19 A;  3SCG A;  3LDB A;  2DCJ A;  1RUE 3;  2DCY A;  2QZ2 A;  1V6M A;  2XBO 3;  2Q4S A;  5GJ6 A;  3KLS A;  5JOX A;  1SQ4 A;  1DQ1 A;  2W39 A;  4Q0V A;  4WVM A;  3S0M A;  2NPI A;  3FL7 A;  5IVF A;  1JYW A;  3O1V A;  2DUP A;  4Q4X 1;  4LPL A;  3GJB A;  2DU0 A;  4CEY B;  5EYX A;  4Z8B A;  1XNA A;  3ES1 A;  1LJ7 A;  1RUD 2;  2JDP A;  4PF1 A;  5L73 A;  1MVE A;  1W6N A;  5FMO S;  1D4M 3;  4GD4 A;  2D3R A;  5BXX A;  2ENR A;  2VZQ A;  4RR3 C;  1AL2 1;  3WW1 A;  4NHY A;  2JDH A;  2X8K A;  1ZBA 1;  4AAP A;  1WA6 X;  1AYM 1;  2XG3 A;  3H8O A;  4BQ2 A;  4K40 A;  3ZSJ A;  4MGT A;  2DCK A;  2W92 A;  4W6W A;  1PGW 1;  1SAC A;  2E7Q A;  4JTN A;  3VKO A;  3N3H A;  5H9R A;  4NRP A;  1DZQ A;  2RDN A;  4GQ7 A;  1KJL A;  3ABZ A;  1A6C A;  2Y6F A;  2ZS6 B;  2YU1 A;  3POB A;  4HSL A;  4IV3 B;  3GZE A;  4LUK A;  2BGP A;  3MID A;  3QOP A;  4OQ8 A;  3LWC A;  5A6Y A;  2JDK A;  2YGM A;  1ZBA 3;  2ZGQ A;  1REF A;  1VBC 2;  3FE5 A;  1OI6 A;  3A21 A;  3GAL A;  1UF2 C;  4UXA A;  4AFA A;  4ASK A;  2HWF 3;  4O9E A;  5LBF A;  2DFC A;  1Z0H A;  3URF A;  2CV6 A;  1LUL A;  3DKW A;  2P3J A;  4AE2 A;  2ETE A;  1Q8Q A;  2P1B A;  3ILR A;  3JBG 3;  2HEW F;  1VBD 3;  3U10 A;  2EA7 A;  3U4S A;  4NIG A;  3FHQ A;  1X8E A;  3KWV A;  1W6O B;  4ATF A;  5FMO L;  1GZW B;  1W9W A;  4TN7 A;  1VBD 2;  2YV8 A;  4RL7 A;  1HJF A;  3POG A;  5T55 A;  3VBO B;  5A33 B;  2XJQ A;  1GZC A;  1CIY A;  1H6Y A;  4QPI A;  4BJ0 A;  1JH5 A;  3S30 A;  3ZXD A;  5GAL A;  2A6V A;  4M0N A;  4YZ5 A;  1PM4 A;  1F4A A;  5FXX A;  3VDD B;  4DZG A;  4OQ9 A;  4CEW C;  2MHF A;  5JMO A;  3CMG A;  3SKJ E;  3ZFE A;  1ONA A;  5HCH A;  1H4H A;  2W1Q A;  2G9Z A;  2J1T A;  5F9T A;  2WFF 1;  1BBT 3;  3KVA A;  2ES3 A;  4MZU A;  2GNB A;  4A6O A;  1LOG A;  3N9Q A;  2EXJ A;  2WA3 A;  4Q27 A;  1HB4 A;  3ZYG A;  3J8F 3;  1TME 3;  4MGZ E;  2JEM A;  3PTY A;  4QX2 A;  2A71 A;  4IEW A;  3VBO A;  4PBO A;  5ABJ A;  1XNK A;  2O8Q A;  5A80 A;  2YFZ A;  4HK8 A;  1W8W A;  3DPR A;  1PVX A;  3HNY M;  3U07 A;  5FRE A;  1DBN A;  5L9B A;  1LU2 A;  4R9D A;  1UU4 A;  3SH4 A;  5FJK A;  3I2J A;  3B5L B;  4B1M A;  5JZG A;  3ECQ A;  2LW8 A;  3KV9 A;  4YM0 A;  1BBT 1;  1QU0 A;  1WMF A;  2VCA A;  1CD3 G;  3HMY A;  1YXW A;  1DZT A;  3IIA A;  3ZMN A;  2HWC 2;  4KMQ A;  3U37 A;  2BRT A;  1J84 A;  1NCR C;  3VD5 A;  1Y7B A;  4NIA A;  1AR9 1;  3AKQ A;  1WLW A;  3RVH A;  4AFM A;  1ND2 C;  1EAH 3;  3DPR B;  2LAL A;  3R6S A;  5IVY A;  2BUK A;  1LOF A;  2FCV A;  3GDB A;  3NWK A;  3MUY 1;  3QLQ A;  2CYF A;  2Z69 A;  1QQP 3;  4JRL A;  3MZH A;  5JZG B;  3VGI A;  4PJY A;  1KS5 A;  2OQ7 A;  4BQW A;  4CUG A;  4E4S A;  3RQ0 A;  4ES9 A;  4QD2 A;  3LFI A;  3ZDV A;  1LKN A;  1MQT A;  4IL7 A;  2IVJ A;  2JDN A;  2ZZQ A;  3VDD C;  4MGY E;  1NCQ A;  2X5I B;  3VD4 A;  2H0B A;  3W59 A;  3B9I A;  1XRU A;  3T4H B;  4KBZ A;  3PME A;  5LA2 A;  4KH9 A;  1AZD A;  1NOV A;  1OC1 A;  2ZGO A;  3ETP A;  3T08 A;  1TZO A;  4MGK E;  1SBE A;  5FZD A;  3BAL A;  3G6J B;  4ZU7 A;  1W6Q A;  3K51 A;  4OFG A;  4MET A;  4QWN A;  2UYB A;  3ITQ A;  4RYD A;  3WVJ A;  4A2U A;  3VBU C;  1F5F A;  4HPK A;  3OBA A;  4AQT A;  4XUQ A;  5FBJ A;  1ZBA 2;  2VME A;  4N7U A;  2HBT A;  3MW2 A;  1AR6 3;  1UOG A;  1X36 A;  2J7M A;  3O7O A;  2WBK A;  3VKF C;  4CP9 B;  4FSJ A;  1TEI A;  1PVC 3;  1YIF A;  2PLV 1;  4YM2 A;  4R8H A;  5EZW A;  4RA0 A;  3WQB A;  1DLC A;  4BIS A;  2HBU A;  3BPS A;  4HSJ A;  5DUU A;  5FY4 A;  3OPZ A;  4HVR A;  4WVW A;  3WR0 A;  4ET7 A;  1G9D A;  1KJR A;  5BNN B;  1FNY A;  2RS5 3;  3AYC A;  1ASJ 1;  3CJI B;  1UX6 A;  5FZL A;  4LO8 A;  4DPN A;  4AGV A;  1C3H A;  3GBW A;  3NNL A;  1MR5 A;  2XVG A;  3HT1 A;  1OA3 A;  2MEV 2;  5E1R A;  2NN8 A;  5KC6 A;  2PYT A;  4JQR A;  5AVA A;  4D6R A;  1FT9 A;  5GZD A;  1IHM A;  4CP2 A;  5DZE A;  1S0B A;  4Y1U A;  4AHY A;  2WO1 A;  5LK7 B;  1LB2 A;  3AMP A;  2WAB A;  2OQ6 A;  1WCU A;  1HKD A;  2E53 A;  4XAB A;  1NZI A;  3ZXK A;  4PIY A;  1YFY A;  4JX0 A;  1J83 A;  1I9R A;  3LEI A;  1FMD 3;  2EXI A;  4XET A;  4P9L A;  3OY8 A;  1KGY A;  3DN7 A;  2C6S A;  5A3N A;  1Q8O A;  3OJB A;  2C0Z A;  1JZ3 A;  3Q8E A;  3U1X A;  1BQP A;  2YBS A;  5CVR A;  2A6X A;  4GUL A;  4Q4W 2;  4P9I A;  3TEW A;  4COW A;  4D6S A;  1GOH A;  4YYO A;  4OVE A;  4NPR A;  5D8A B;  3SH3 A;  4CEY C;  3UGG A;  4ES8 A;  3IAP A;  3I3E A;  3KV5 A;  2VW2 A;  2C26 A;  3ZFE C;  1PO2 1;  1PNF A;  1C8M 3;  1DQ5 A;  4M0H A;  5A3O A;  1Q43 A;  4DEQ A;  4CUC A;  1J58 A;  2YG0 A;  1JZ4 A;  1YHF A;  5A3T A;  1W3X A;  1M06 G;  4XAA A;  3KCC A;  5FZ0 A;  5A6X A;  2E33 A;  4EWA A;  4HZF A;  3TEY A;  1AF9 A;  1NA1 B;  2WLQ A;  2VW1 A;  3ETQ A;  3OTF A;  2JJ6 A;  4ZY9 A;  1POV 1;  5GKA C;  5F5I A;  2Q1F A;  2EIE A;  4I3P A;  4XPV A;  5GLW A;  4IE4 A;  1O3Q A;  3FMG A;  1CAX A;  2XHN A;  2X29 A;  4PIX A;  4LOS A;  5FZ6 A;  4G3Y C;  3FBM A;  1GP5 A;  4BM8 A;  2Q30 A;  1J3P A;  1LOE A;  3PVO A;  1HJG A;  2VQA A;  1W2A X;  5FCC A;  3QBQ A;  4HMZ A;  1D0G A;  3IAQ A;  5FMC A;  3UKT A;  3WX5 A;  2VVE A;  1VBE 3;  4XTM A;  1S0G A;  4BB3 A;  4UOJ A;  2NMO A;  4FOQ A;  3ZXF A;  1SDD B;  1VBC 3;  3FHA A;  5FXW A;  2FDI A;  5A3L A;  1E5R A;  5FP9 A;  1VMJ A;  2BPA 2;  2VO5 A;  1MS0 A;  3WF3 A;  4HKW A;  3FN9 A;  3HBZ A;  2GMM A;  1RVF 1;  2XWB B;  2QQO A;  2VMG A;  1VAM A;  4XAE A;  3C7H A;  1I5P A;  4DRR A;  4E9K A;  5J7M A;  5B2G B;  4AED B;  3M8L A;  4MUV A;  2YBK A;  1BCX A;  1ND2 A;  4AQ2 A;  3RFR A;  1VAK A;  1C57 A;  1HV0 A;  1K12 A;  1R1A 3;  1D2Q A;  1EPZ A;  4FOW A;  4ARY A;  2WO2 A;  1PM7 A;  3W5N A;  3RZM A;  2OW4 A;  1LTE A;  5DAB A;  1HRV 1;  4YWA A;  1C1L A;  3SCF A;  2X5I A;  5FZ1 A;  4QHO A;  4YG3 A;  3TN9 1;  4CCN A;  5F6K A;  4YVW C;  1WW6 A;  5JXH A;  1ZRD A;  2WO3 A;  2BOJ A;  1P8J A;  3V65 A;  1D4M 2;  5JOY A;  2DWR A;  1QIQ A;  1COV 2;  3LFM A;  4LJH A;  4OLL A;  3H7J A;  2JDY A;  3DEM A;  4GB3 1;  3ZFG C;  2SBA A;  2VM9 A;  3UNP A;  3FLT A;  4LIU A;  1H2M A;  4OHW A;  3WCR A;  4Y1V A;  4HN1 A;  2KXL A;  3S7E A;  3I3M A;  3SIT A;  3AVR A;  3N9M A;  4Q4Y 3;  4JZR A;  4V1P A;  4EJR A;  3H9A A;  3BIW E;  4CA9 A;  1QJE A;  5E88 A;  1DG6 A;  1LES A;  1W90 A;  3GHM A;  4LLO A;  5TSW A;  4AFB A;  5EPA A;  2WSU A;  1VRH 2;  2BZD A;  3N7M A;  4RGK A;  3H1M A;  2UY9 A;  3VBH A;  3MV0 1;  4BH9 A;  1WBF A;  4FO9 A;  4XUO A;  1UMZ A;  4L9B A;  1DZR A;  5A70 A;  1DQ6 A;  2ADD A;  3LAG A;  3OF1 A;  1O59 A;  4YLZ A;  2CAV A;  2CWS A;  1QJY 3;  2BEO A;  3FUO A;  4CEW B;  3O1O A;  2BQP A;  2VTX A;  1UY3 A;  5FZM A;  3IDA A;  1OOP A;  5DAV A;  4D6Q A;  4S2D A;  3CJX A;  5FZA A;  3TN9 3;  4E4Z A;  1OQ1 A;  4XUN A;  3UJQ A;  5JVV A;  4QGN A;  4QPG C;  5DDJ 1;  1UY2 A;  3VBO C;  2HEV F;  2QQJ A;  3CO2 A;  4HVO A;  3KHC A;  4NO4 A;  2VU9 A;  2R32 A;  1LEM A;  2WNV C;  1EV1 2;  1K5M A;  4LO7 A;  4FBF A;  2PA7 A;  3LEK A;  2FCT A;  4QB2 A;  1Q5O A;  1MS1 A;  1WUV A;  4D3W A;  4KQ7 A;  5HV0 A;  5EXO A;  3KM5 A;  3BVC A;  1SFN A;  2Z5W A;  5FZO A;  5B4X A;  3H50 A;  4D7T A;  4GH4 B;  4AGR A;  2XJS A;  3ZFF A;  2JDA A;  3QCW A;  3GZA A;  1RUN A;  3NAP C;  1XNB A;  3P6B A;  3ZOI A;  1BMV 1;  4COZ A;  1DGW A;  4FTE A;  3NNJ A;  2VNV A;  3ZIW A;  1ENS A;  3E6B A;  3NMB A;  1RJ8 A;  4XCB A;  5D8A A;  4AI8 A;  4BDV B;  3WNN A;  1ZRF A;  2OII A;  2VOV A;  3E6C C;  5FO8 B;  4AVC A;  1W8O A;  4JDO A;  3S5Q A;  2ADE A;  3WHT A;  2P3Y A;  1K3I A;  2LS6 A;  2A6W A;  5LK5 A;  3E97 A;  5IUQ A;  1PO1 1;  5LBB A;  3SC7 X;  3AKP A;  1LOF C;  2G19 A;  3H7Y A;  4V2W A;  2FMD A;  5FYZ A;  1PO1 2;  3FFZ A;  1ENQ A;  2AGS A;  3JBG 1;  5CKM A;  1YJL A;  2VVF A;  4BZ4 A;  5HV4 A;  4YZ2 A;  2ARA A;  1YCI A;  4K21 A;  1DP0 A;  1LRH A;  4BPZ A;  1PNG A;  2RMU 2;  3OCP A;  3V0B B;  4DRV A;  1JXN A;  5CKN A;  4CXX A;  5L7O A;  2XQR A;  1BYH A;  1OLR A;  3O1M A;  1ZZC A;  5C5T A;  1I1E A;  2YY1 A;  4CDQ A;  2W47 A;  3AJY A;  2H0V A;  4XIK A;  1VAL A;  4L0P A;  2K2S A;  1J1T A;  1LOC A;  2KR2 A;  1H9P A;  1V9U 2;  1COV 3;  1U0A A;  1GBG A;  1XE0 A;  1G9F A;  4JKK A;  1HDK A;  3BU0 A;  3PIG A;  5IVB A;  4XDO A;  4BLI A;  1EUT A;  5CKQ A;  3WDY A;  4P9Y A;  4LBM A;  3WG1 A;  1U12 A;  4QPI C;  5FBZ A;  2WYS A;  4AHZ A;  4S2F A;  3VBH B;  3WIN E;  2W0X A;  3VHO A;  5C3P A;  3BIE A;  1TG7 A;  2TUN A;  3AXE A;  3GCW A;  1PX3 A;  1O3S A;  4XYX A;  3B9C A;  4GKY A;  4CDQ B;  4XMA A;  2DUQ A;  5JR2 A;  3ON7 A;  5GZC A;  4KG8 A;  3FLR A;  1HRI 3;  5FWJ A;  1IQD C;  2VTF A;  5HPO A;  3JB8 A;  3MPP G;  3VBR B;  4AF9 A;  1LR5 A;  1SCR A;  2ZGL A;  4BCU A;  4D69 A;  2WT1 A;  3LIG A;  2ZPX A;  4Q4V 3;  2IVI B;  3CL1 A;  4F7Z A;  4EN9 B;  4LK6 A;  2PFW A;  1PMH X;  2GND A;  1AL2 3;  3B02 A;  3PTR B;  4M01 A;  4NE9 A;  4O7X A;  1LEN A;  5F5Q A;  1UQX A;  3VDB A;  4EZH A;  1WWY A;  3KF5 A;  3TN9 2;  1VRB A;  1VE0 A;  3I2G A;  4R9B A;  4X8N A;  4C8D A;  1JZ8 A;  1YIP A;  5A1F A;  3POY A;  4K1Z A;  3CIH A;  1U5Y A;  5LA1 A;  4NAO A;  4QPG B;  4AG4 A;  1ZZ9 A;  1RMU 1;  3K3O A;  3JZV A;  5DQ0 A;  3VZJ A;  1CWP A;  2JD9 A;  1RMU 2;  2FDK A;  4XQ4 A;  2GNT A;  1UY0 A;  2GN7 A;  5LEK A;  2ATF A;  1AX2 A;  2GMP A;  1Y9G A;  2QNK A;  3T2T A;  1X9P A;  3I2O A;  2D98 A;  3EMR A;  2K9Z A;  3GGL A;  3WUC A;  1ZRR A;  2WZP P;  4EN0 A;  4AK3 A;  4QU1 A;  4W50 A;  1HN0 A;  3THC A;  2ZX0 A;  5GLZ A;  3AZW A;  4OUM A;  4XFA A;  4KGG A;  1OFS A;  1WCS A;  5FYB A;  4LHL A;  1RUG 2;  2EIC A;  4HKL A;  4QHB A;  4CSW A;  4WVM B;  5A1L A;  3KHB A;  1R08 2;  4AL9 A;  4HXC A;  3PDQ A;  1M4W A;  3IM0 A;  3N35 A;  1R08 1;  1AYN 2;  1PMI A;  3WQ1 A;  4Y1X A;  3POW A;  2ZHK A;  1JYT A;  5IW0 A;  5JXJ A;  3NV2 A;  3R05 A;  1XPW A;  3HVD A;  1JZ2 A;  2P6C A;  4TYS A;  1C5I A;  3DV8 A;  1Z7S 2;  1RYY A;  3ZFG B;  4K20 A;  3KQ4 B;  4A44 A;  3IKW A;  4IXL A;  4AI9 A;  2GC1 A;  4QXH A;  1WMX A;  4CP9 A;  3HT2 A;  4E4H A;  1UMH A;  1K5M C;  2VH9 A;  3WQ0 A;  2JE9 A;  1LED A;  4NAM A;  2ZKN A;  4CPB A;  5AC9 3;  4NJ4 A;  1SLL A;  1H8T B;  5JSR A;  4BIF A;  4AI3 A;  3RPQ A;  1CAX B;  4LBK A;  1OLM A;  4MXW A;  5BNQ A;  5C8W A;  5E89 A;  3LA2 A;  3ZPO A;  4OI2 A;  2HWD 2;  5K0U B;  2P17 A;  3I97 A;  2WZR 2;  1U5Z A;  3UET A;  2HKX A;  3KVB A;  3VKM A;  2JG9 B;  4YG0 A;  1EY2 A;  2B4K A;  3B94 A;  1H9W A;  1LNS A;  1X50 A;  1NXD 1;  5FP8 A;  4Q8K A;  2PAK A;  4XFH A;  3N4M A;  1D2S A;  1EUU A;  5A7Q A;  3B7M A;  4RGA A;  2ZHM A;  4UF0 A;  3TNQ A;  4KWJ A;  4ZS3 A;  5JPN B;  1W0N A;  4RS5 A;  1ZZ8 A;  1AUY A;  3RJR A;  2ZCW A;  4FPY A;  1AR7 2;  3KD4 A;  1MS9 A;  4Q4Y 2;  2AEZ A;  2GSY A;  2TEP A;  2NYY A;  2X05 A;  4Q0S A;  2D6O X;  2ZHN A;  3B00 A;  3RZZ A;  2VBD A;  5FZG A;  4ATE A;  5L7O B;  1SBF A;  3W58 A;  4IEX A;  5FZC A;  4FAH A;  5F39 A;  1DYK A;  1H2N A;  3GZT B;  4FPL A;  2Q5T A;  4C1X A;  3M1H A;  5KXC A;  4NHK A;  4QDQ A;  1I3H A;  2Y6G A;  5LY2 A;  4IE6 A;  2HYK A;  1VPH A;  1XNT A;  2P2K A;  1SDW A;  4HAN A;  1GWM A;  1ENR A;  2OS2 A;  5A7W B;  3PNA A;  2ORX A;  3WLU A;  5FQ0 B;  4PF5 A;  3O12 A;  4PBP A;  2VZR A;  2ZGT A;  1CN1 A;  3W20 A;  5F37 A;  2WWS A;  3I3Q A;  3ZYH A;  3HEI A;  2VZ1 A;  2A75 A;  1IKQ A;  1POV 0;  2JKX A;  4W65 A;  5BV6 A;  5FK7 A;  2HWF 2;  3QH7 A;  3JXS A;  1AL2 2;  1KQR A;  4K1Y A;  5IWF A;  1JHJ A;  2Q1M A;  4UBG A;  1HXS 3;  2J1V A;  1V6N A;  3I49 A;  1G6N A;  2NP0 A;  4LBQ A;  3ZN6 B;  5H9P A;  2DCT A;  1BJQ A;  2XXZ A;  2A6Y A;  4C90 A;  3C2U A;  4ZZ8 A;  4DS0 A;  3BI3 A;  2ZGP A;  2QZ3 A;  1OOP C;  3LZZ A;  1Q3E A;  5A32 B;  4WM7 B;  1DGR A;  4ASL A;  4LT5 A;  1ZA4 A;  2QJV A;  1JZ6 A;  2BBV A;  2ZEY A;  3OEB A;  4K7J A;  3ALQ A;  1MS4 A;  3AYA A;  1W6P B;  2B9U A;  2WNV A;  3RI9 A;  2D6M A;  4XFG A;  1OOP B;  4A45 A;  1WME A;  2ZGS A;  4L92 A;  4TZD A;  1QNW A;  2VMH A;  3I2D A;  1O91 A;  2Z42 A;  4QQH A;  5FAX A;  5GZF A;  3ZXJ A;  1AHS A;  1MEC 1;  1PZ9 A;  2PLV 3;  3M3Q A;  5JSO A;  3VBU A;  1JN2 P;  1AR6 1;  3FJS A;  1OA4 A;  1N1T A;  3EJK A;  5CB7 A;  1WCQ A;  4GA9 A;  2VMD A;  3WF2 A;  3DKQ A;  2RS3 2;  4GH4 A;  4SLI A;  4IEZ A;  4LQR A;  4ITC A;  1BEV 3;  3QAC A;  4UFH A;  1MAC A;  1FI2 A;  1TNR A;  4I0B A;  3RS6 A;  5LA0 A;  4IES A;  5CAZ A;  4IET A;  5JXG A;  1VMH A;  3ZFF B;  4LR4 A;  4DUW A;  1UL9 A;  3NNM A;  4XAC A;  1G9C A;  4LEJ A;  5KXE A;  3RZK A;  2JXA A;  1RUE 2;  3M3C A;  1AYM 3;  2D93 A;  1W6M B;  5F8P A;  2W1W A;  1QDO A;  3UK9 A;  1ZRE A;  4YW5 A;  4NR1 A;  1JZ5 A;  4LHK A;  1NCQ B;  1R09 1;  4BYY A;  2QQW A;  1AYN 1;  4IE0 A;  2HWB 3;  4MHU A;  2XUE A;  1MQT B;  1FOD 3;  1R09 2;  2ET7 A;  2JG8 C;  2R07 2;  2FQP A;  2Y6K A;  3FZ3 A;  5FIX A;  3SQO A;  5D1I A;  5LW9 A;  5J48 A;  1JOJ A;  3H1Y A;  1H1A A;  5FYV A;  2CWM A;  5J3U A;  1W6Q B;  5EV7 A;  1ULC A;  4W4Z A;  1YQ2 A;  4CDX C;  1GZ9 A;  1KFU L;  4XJ8 A;  1AX0 A;  2C5D A;  1ZM1 A;  1KDM A;  2QQM A;  4COV A;  4JGZ C;  2DTW A;  1JYN A;  4L8Q A;  5ISL A;  3BCW A;  5D21 A;  1PX4 A;  4IV1 B;  1J59 A;  3E5U A;  5I0U A;  1H2L A;  1WLC A;  2WZR 1;  1GWK A;  4WM8 B;  5FOJ B;  3IDB B;  4EV0 A;  2FDF A;  3H3U A;  4UW5 A;  3SXW A;  2ZAB A;  1O3T A;  3M70 A;  2J1U A;  5FP7 A;  1EP0 A;  3ELN A;  2WS9 1;  4ZZ5 A;  4DEV A;  1GZW A;  1T2X A;  1OH4 A;  5I91 A;  2HWC 1;  5IT6 A;  2E51 A;  4BXF A;  1NY7 1;  5APA A;  2JIG A;  1S2E A;  1H8T C;  2VMC A;  5CFC C;  1LAJ A;  2A1X A;  4XDP A;  4LBQ D;  3LQC A;  4FVV A;  1YO8 A;  1W2O A;  3CBN A;  3IMM A;  1AXZ A;  2YUE A;  4J6G A;  1F2N A;  4Q4W 1;  4RR3 A;  5BNP B;  5IVE A;  1PGL 1;  4CYD A;  3J9S A;  3K77 A;  2CHH A;  2YPJ A;  4I0A A;  1V9U 3;  2BTV C;  2BV4 A;  1L7Q A;  1SMV A;  1OMI A;  1HXS 2;  5CYY A;  3ZSL A;  3OSD A;  4DNY A;  4PQQ A;  3ZXL A;  1N47 A;  5FUP A;  1V6I A;  3BGA A;  4O9G A;  4YVS A;  3ZYJ B;  2VMI A;  1H1I A;  2B7Y A;  5EQU A;  2QQP A;  1RB8 G;  5FZ9 A;  3HNB M;  5FY9 A;  4AQS A;  5JI9 A;  3BB6 A;  1NXM A;  2VAU A;  2WA4 A;  3MF9 A;  2XJV A;  1W39 A;  4XMI A;  3W9A A;  1W6O A;  1FMD 2;  2GC3 A;  2MEV 3;  4Q5O A;  3WP3 A;  5F2S A;  3RWK X;  4MGI E;  1UZW A;  3TEZ A;  3DCQ A;  5L36 A;  1DU3 D;  1ZZ6 A;  3OG2 A;  2IXJ A;  4AEM A;  4CVU A;  1TMF 1;  2AEY A;  5AC9 1;  3I3B A;  4LKD A;  3ZN5 A;  1OPO A;  5IK5 A;  4PLO A;  5CIS A;  2ZGN A;  1K5J A;  3HWJ A;  5FV3 A;  3UL2 A;  3NV4 A;  1RUJ 2;  5KXB A;  2X53 S;  2DVG A;  5FY1 A;  4NII A;  3SEP A;  1NCR B;  1W99 A;  2WQZ C;  4LK7 A;  4XFF A;  1QY4 A;  4Y1Y A;  2NM1 A;  4AWD A;  1C4R A;  2BWA A;  2VD7 A;  5I0S A;  4UWD A;  1UD1 A;  4XJW A;  4YPJ A;  3AXD A;  3ZM8 A;  4DXZ A;  1V70 A;  4E4D X;  4BQ1 A;  2XML A;  2WR9 A;  3WW3 A;  3AZV A;  4CU7 A;  4NPM A;  3C3V A;  4XXA A;  4CP1 A;  3VBS C;  1JOB A;  1NZC A;  1F31 A;  4CU9 A;  3VBH C;  4QU2 A;  1ZNP A;  2CU5 A;  4ZKT B;  1ULP A;  4YRD A;  3PHM A;  2R49 A;  2GH8 A;  2OPK A;  1GWL A;  4XIO A;  1Y4W A;  2ZEX A;  5A32 A;  3CF6 E;  4GJY A;  1LHV A;  4COU A;  1LHU A;  2JIJ A;  5IHR A;  5FY5 A;  1XXN A;  5DG1 A;  1GP4 A;  2B46 X;  2XOM A;  4AI2 A;  5ABJ C;  1AVB A;  4YGD A;  3SMH A;  1RUE 1;  1ZZ7 A;  2ZX4 A;  2R06 2;  4C1W A;  5EP9 A;  2P4E A;  1QGL A;  4NMI A;  4RR3 B;  3WDV A;  5BNP A;  3RZJ A;  2OT7 A;  2LM3 A;  5DAX A;  3U11 A;  2OUJ A;  4I09 A;  4LE4 A;  1YEW A;  2OXB A;  1B35 A;  4AYU A;  1HRI 1;  1JUH A;  1J1L A;  3N9O A;  1XYN A;  3UV9 A;  5C8C C;  2DYC A;  2JDZ A;  2ILM A;  2J42 A;  3LA7 A;  3RG0 A;  1QF3 A;  2RG4 A;  4KGQ A;  3OGG A;  2WZR 3;  3VD7 A;  4YM1 A;  4BE3 A;  1W28 A;  3U0Z A;  2EAA A;  2A7A A;  3VUO A;  5JXI A;  1R64 A;  2VQU A;  4PLM A;  3BOP A;  4JCK A;  1L7R A;  2W5F A;  1V6K A;  2FHR A;  1UPS A;  2QTW B;  3RZG A;  2XL9 A;  3OOX A;  2ZX1 A;  3B69 A;  4A3Z A;  1VBA 3;  2ZMN A;  4FT8 A;  2XLF A;  3GYD A;  4HVQ A;  4GMP 3;  3MLJ A;  3SEE A;  3NAP B;  2Y38 A;  4H2A A;  1W6N B;  4IQP A;  3VV1 A;  1KFX L;  1C8N A;  1H0B A;  5IFP A;  3WDU A;  1IS5 A;  1UKG A;  4Z2W A;  3IN9 A;  3IDE A;  3APB A;  1RGS A;  4RS5 B;  3T0B A;  3ZXA C;  1H8T A;  2I45 A;  4GIQ A;  4E8C A;  3BTZ A;  4U2A A;  4Q1R A;  2CGP A;  4FPK A;  5FYH A;  3HQX A;  3PU3 A;  2CTV A;  3T2Q A;  3MF6 A;  3VZK A;  3DXU A;  2PHD A;  4FTB A;  1AR7 1;  2JEN A;  5FPA A;  1UCX A;  1I5Z A;  2WYF A;  2VW0 A;  2ARE A;  3HNM A;  2VUL A;  2ZGM A;  4NRO A;  2A3X A;  3KGZ A;  1C8M 1;  3H0O A;  4IUG A;  4GAZ A;  1H2K A;  4WM7 C;  1STM A;  2EAL A;  3EBR A;  3IDC B;  2ZX3 A;  1QJY 2;  4P9G A;  4OI1 A;  3M3I A;  1REE A;  4CXY A;  1OUS A;  1H1M A;  4NRQ A;  1W8F A;  2WUH A;  3DXT A;  3EQE A;  2R07 3;  3SHR A;  1W05 A;  4HKO A;  4DQA A;  1MZ5 A;  3QD6 A;  4CCL A;  2BVV A;  3PUA A;  1FMD 1;  3U78 A;  2A6Z A;  3LKJ A;  2VCC A;  1CIW A;  1XB9 A;  1CAU A;  2VZ3 A;  4MV2 A;  3JB4 C;  1BXH A;  4GXL A;  2DCZ A;  5BY5 A;  3PUS A;  3C8X A;  5JIU A;  1TMF 2;  2IUW A;  4UFM A;  1JU4 A;  3LE0 A;  4P9J A;  3OBZ A;  1V0A A;  5F3I A;  5FLJ A;  3WG4 A;  4PIZ A;  1RL3 A;  1RUC 3;  4JKL A;  2BU9 A;  2DBN A;  4RQP C;  5LRS A;  1SFP A;  1AR9 3;  3VKN A;  4N43 A;  4IDZ A;  5IK4 A;  4JGY B;  3HR9 A;  2PTM A;  4MGQ A;  5BPX A;  3CQO A;  5FYM A;  4CDX A;  2D5F A;  3H8R A;  1JHN A;  2UYA A;  5F5A A;  2GN3 A;  3WNO A;  4LBQ B;  1UYZ A;  2VJX A;  4JQT A;  5E6H A;  3N7J A;  1QDC A;  1Q8S A;  4P02 B;  1IQA A;  3HPN A;  2XGX A;  2XVK A;  3NV1 A;  4AW7 A;  3PJY A;  3CDZ B;  1NLQ A;  1RUC 1;  1QKQ A;  3FHI B;  3POS A;  3JUU A;  4KNC A;  4PQ9 A;  4SBV A;  2GC0 A;  5A6Q A;  5KR7 A;  3R0R A;  3TBD A;  4IE5 A;  4XQW A;  4B8E A;  2O14 A;  2ZXQ A;  3M7A A;  3AMH A;  2XH6 A;  1R1A 2;  1V00 A;  2OYZ A;  2XDV A;  1AR8 3;  2A73 B;  2CSG A;  1SBD A;  2YRO A;  3K75 B;  5EJ3 A;  1O4T A;  1H4G A;  2LRO A;  2R04 3;  1LHO A;  1Q8P A;  2ZEZ A;  3B3Q E;  4FPC A;  4JGY C;  1NCQ C;  1IS6 A;  1VBB 1;  4QM9 A;  3WP6 A;  5K0U C;  3I2K A;  4LOR A;  4CDU C;  3LB9 A;  4S2G A;  1UXZ A;  3RNS A;  1DFQ A;  3PMS A;  3JD7 3;  4MLO A;  4DIQ A;  3DYM A;  3BU7 A;  2H6C A;  2P34 A;  3SIS A;  1DGW X;  3WF1 A;  1JYX A;  3T09 A;  2IXC A;  3RMX A;  1YQ6 A;  4URA A;  1QQP 2;  3D0J A;  3K4A A;  4X6Q B;  3EXU A;  3J7M A;  4M3C F;  1QQP 1;  1OF3 A;  4B3N A;  5BUV A;  3ZFF C;  3ILF A;  4FFH A;  1VJ2 A;  1UIJ A;  2Y64 A;  5A33 A;  1EAH 1;  4LHN A;  4IEU A;  4KWL A;  3O1S A;  3AVS A;  1CGP A;  1LEC A;  1YI7 A;  2JB4 A;  5D8A C;  4AAX A;  2IXH A;  5E8A A;  3SNM A;  5KBF A;  4I2O A;  1QJX 2;  1RUJ 3;  3VDC A;  1RMU 3;  3LSD A;  3OGS A;  1V9U 1;  5FMB A;  1W9Y A;  4ZS2 A;  2BGO A;  3HQR A;  2W91 A;  1DDL A;  1SPP B;  3OEA A;  1JUI A;  1XE7 A;  3KCY A;  4Y4R A;  3TWI A;  4PLN A;  4J1X A;  4Y4Y A;  2X5I C;  5T52 A;  4AHW A;  2YU2 A;  1PHM A;  3E5X A;  3BUC A;  2FMY A;  1US2 A;  4P08 A;  1PO2 3;  1LCL A;  1UZZ A;  2RVA A;  3J4U H;  4LO5 B;  4Q4V 1;  4GWM A;  5T3N A;  1IS4 A;  2YGL A;  4QGL A;  4EYU A;  1BK1 A;  3ZKY A;  1YQC A;  4RHV 3;  3RRD A;  2ZA9 A;  5JZG C;  2CGO A;  4P5Y A;  3AP7 A;  4I01 A;  4IE7 A;  4JKM A;  2AAC A;  3R4U A;  3ZFG A;  3BKZ A;  2W2I A;  3I2F A;  4JAA A;  1OQE A;  4ZON A;  5FZB A;  2PHX A;  4X8P A;  4IGQ A;  4OHZ A;  1GKB A;  3AMM A;  2X09 A;  1NCR A;  1AR9 2;  4HFS A;  2C9K A;  4NHM A;  3A7Q A;  3KMH A;  1RUG 3;  1YUD A;  2ID4 A;  1ND3 C;  3VZM A;  3I8T A;  4AOC A;  2WC2 A;  1UY1 A;  2RR1 2;  1WKY A;  4CEY A;  4MGS A;  1MEC 3;  2GC2 A;  2XBO 2;  4XIL A;  4ZXK A;  2AH2 A;  3O0V A;  4RFT 0;  2ARB A;  1JYI A;  4XF9 A;  3VLB B;  4WBB A;  1TME 2;  3THP A;  2QQU A;  3MFA A;  3U14 A;  2JD4 A;  4XFI A;  4CE8 A;  1SLT A;  2GH2 A;  4BQ5 A;  1XNC A;  3C7G A;  4EZ4 A;  1TNF A;  2D6P A;  3V64 A;  1VAV A;  1UZY A;  1JZ7 A;  3GXU A;  1SFY A;  1RUD 1;  4URT A;  3AL6 A;  3GM8 A;  1ZZB A;  3N7L A;  5FZE A;  1G9A A;  3WDW A;  1G9B A;  3WW4 A;  4XJU A;  3LDR A;  4OUE A;  2IXK A;  2E7T A;  4UYB A;  2HWF 1;  2W3J A;  1AYM 2;  4FOY A;  1HW5 A;  3UGF A;  1CAW B;  3PUI A;  4CZS A;  1RUH 3;  4XC9 A;  2FDG A;  2RJ2 A;  3OGR A;  3BPZ A;  1QXP A;  2V72 A;  2A70 A;  3AKR A;  1K42 A;  1E5I A;  2CL2 A;  1MZE A;  2A5Z A;  1ENX A;  2JG9 C;  2P37 A;  2PHR A;  1RUH 2;  4D94 A;  5FWE A;  2G1M A;  4MO3 M;  1AJK A;  4LNV A;  4D7Y A;  2ZBJ A;  1N1V A;  4MOA A;  1ALY A;  3TB0 A;  2BFU L;  3AMQ A;  2O1Q A;  2V4V A;  2BP6 A;  2ZAC A;  4N53 C;  3D0S A;  3GF6 A;  2E31 A;  5T5O A;  1W8Z A;  2XJT A;  5FKC A;  5I0T A;  2FDH A;  1MS5 A;  3ACL A;  1AXK A;  5LAS A;  3MUZ 1;  2MNG A;  3USU B;  5BNO B;  1KIT A;  3ACG A;  3EHK A;  2B5H A;  4I3G A;  3AMN A;  2A3W A;  4FXG B;  4LBL A;  2WDB A;  4CCE A;  2Q8C A;  4A4A A;  4CDQ C;  3RWN A;  4DO0 A;  1UNB A;  4R9A A;  1R1Z A;  4UW4 A;  1H30 A;  4OUL A;  3E1F 1;  2C9A A;  3V0B A;  3MGU A;  5JCT A;  2HLE A;  1Y9Q A;  1WZX A;  5A7P A;  4XBL A;  1N1Y A;  1H8V A;  4Y20 A;  1BVV A;  2ZMK A;  2B39 A;  2R06 1;  3IB3 A;  2WSV A;  2W1S A;  2KA3 A;  2YHJ A;  4Q0U A;  1PVC 1;  2W46 A;  2QQN A;  4LE3 A;  4XHX A;  1IPJ A;  1QXR A;  1G7Y A;  1PO2 2;  2WNE A;  3OY8 B;  3NNF A;  2RMU 1;  1GYK A;  5C7G A;  4L99 A;  4IER A;  2RR1 3;  5DAW A;  1GZT A;  3ZN6 A;  4Q1P A;  2WNU B;  2IFR A;  1Z7S 3;  1HB1 A;  2VBP A;  5FRA A;  4MAD A;  2V73 A;  1Q8V A;  5CNA A;  5K7P A;  1YFW A;  2VBB A;  2RM2 3;  3AYD A;  4AVB A;  4A7Y A;  2TNF A;  1HX6 A;  2F4P A;  2BFU S;  2D3P A;  2RDQ A;  5I8Y A;  1ND2 B;  3AL5 A;  2QQI A;  2I07 B;  2WLP A;  1IGO A;  2HWE 3;  5JIA A;  1GNH A;  5F7U A;  1HRV 3;  1EYB A;  1FAT A;  1ZX5 A;  4H55 A;  3VBR A;  3Q8A A;  5BNP C;  1G86 A;  5M0T A;  5FKB A;  4Y1Z A;  2PAE A;  1OF4 A;  2NLR A;  4BIO A;  1S1A A;  3DYP A;  4AVV A;  1UYX A;  3M2M A;  1ZYB A;  3D6E A;  1F8V A;  4XVH A;  4RD7 A;  1O7F A;  1AX1 A;  1X9T A;  3C7F A;  4GMP 0;  4D0Q A;  4XOG A;  1NY7 2;  4IV3 C;  2FCU A;  3CZU A;  5IAT A;  5DMY A;  1CON A;  2VOW A;  2R04 2;  3GCX A;  3N36 A;  4JTO A;  5DAP A;  3LEM A;  5KHJ A;  1ND3 A;  1OPM A;  3QH6 A;  3K2O A;  4KU7 A;  3DL3 A;  2WL1 A;  5J98 B;  4FPH A;  5F6L B;  4DB5 A;  1NG0 A;  5F1R A;  3LA3 A;  2C1F A;  4ZU4 A;  1R09 3;  2VC9 A;  3FC0 A;  3ZN4 A;  3SCH A;  5FLI A;  2RJK A;  3M3E A;  4N9I A;  4PCR A;  1OQD A;  4LKF A;  2QQV A;  4NPL A;  5EJ1 B;  1NKG A;  5FZO B;  3WT3 A;  4A3X A;  3K4Z A;  3ZO0 B;  4KWK A;  5L9R A;  5C3S A;  3UKN A;  3RZH A;  4LXL A;  4G9S B;  2ZML A;  4HL0 A;  1PGS A;  3KF3 A;  1QEX A;  3BTA A;  1PK6 C;  3H42 B;  4Q4X 2;  4EN6 B;  2W1U A;  1JI6 A;  2QUO A;  2WS9 3;  5K4L A;  2JKB A;  1LU1 A;  4K6B A;  2ERF A;  3MLL A;  2QVS B;  1NT0 A;  2W87 A;  3HAG A;  4QX8 A;  4A7Z A;  2BBA A;  5FYT A;  4YGC A;  3WD5 A;  4FQ4 A;  2XUM A;  5C5U A;  1MZF A;  2RMU 3;  3VZO A;  1FPN 2;  4YVS B;  1KS4 A;  1SEF A;  2VOT A;  2VY0 A;  1S55 A;  4JV4 A;  5C3O A;  2VXR A;  1FPN 1;  1TQ5 A;  2B8M A;  2Y33 A;  4HG6 B;  4NWW A;  4QAW A;  5C4W C;  3ZXE A;  4UT5 A;  1RUH 1;  1ASJ 2;  5CG8 A;  5IVJ A;  3IWZ A;  1YNA A;  1PZ8 A;  4CUB A;  4AQ6 A;  2J1E A;  4OI0 A;  3WDT A;  4YVW B;  2CNA A;  4MX3 A;  4N53 B;  3O1R A;  5G04 L;  4HN0 A;  3F2Z A;  2AYH A;  2E9Q A;  1RIR A;  2R6Q A;  4FPO B;  4QXK A;  5CAD A;  2P5B A;  4BK5 A;  4PI0 A;  1UYY A;  4QT6 A;  5J37 A;  2VNO A;  1IPS A;  1OD5 A;  4XJ9 A;  5FMD A;  2BNO A;  3AJZ A;  4CCM A;  3NKG A;  1F9K A;  5JI7 A;  1XBF A;  4RQP A;  4LIT A;  4BWO A;  3RZL A;  2RDS A;  1F5J A;  1ZBE 1;  3NAP A;  4K8R B;  4N43 C;  3ILN A;  2VNG A;  4Y26 A;  4CU6 A;  3JCI A;  3DF0 A;  1BMV 2;  1ZBE 2;  2WT0 A;  4AGG A;  3WF4 A;  1CZS A;  1UN1 A;  3POE A;  1RIN A;  5FZ3 A;  4DXR A;  2GNM A;  4XF0 A;  3T0D A;  2OVU A;  2D6N A;  1UYP A;  2F17 A;  2LRP A;  2VGD A;  1GLH A;  3INA A;  4NHX A;  1V6L A;  4UW3 A;  2PXJ A;  1YC6 1;  2YZ4 A;  1NX9 A;  1RED A;  4YNI A;  1C1F A;  2QDN A;  2V5D A;  2Z79 A;  3ZX7 A;  4BQ3 A;  3I4I A;  3ZDS A;  5F3E A;  5BNN C;  2ZKL A;  4GJZ A;  3WNM A;  1EAH 2;  4QHZ A;  4YSF A;  1QOS A;  5D2A A;  1MS3 A;  1GUI A;  2ZHL A;  4OZX A;  4ARX A;  1UMI A;  1ULE A;  1QH6 A;  4IGO A;  4QX7 A;  1JS9 A;  4W6Y A;  2QE3 A;  3LF7 A;  5FY7 A;  4CDU B;  4TXW A;  1FAY A;  2HJI A;  1B35 B;  1S0C A;  2BYV E;  3NO8 A;  4P00 B;  4U36 A;  3T4V A;  1ZRC A;  1V6O A;  2J1R A;  3LEG A;  1DHK B;  3Q9O A;  1VP6 A;  3AYE A;  3TAY A;  3UYJ A;  1VLN A;  4A41 A;  1BLZ A;  4E2G A;  2DBI A;  5I0R A;  4AED C;  2W52 A;  5CU1 A;  2VPV A;  1A8D A;  1YJK A;  3UKV A;  3LD8 A;  2D5H A;  2CGN A;  2MPF A;  2XLA A;  4XQD A;  4CUA A;  4QGM A;  3H3Z A;  3HIF A;  4CCD A;  2K0G A;  3EB7 A;  4H7M A;  4RSU A;  4DMI A;  5C3Q A;  4ZU5 A;  1A3K A;  5LWB A;  3ENR A;  3TYJ A;  2HH9 A;  1NAE A;  4PT6 A;  3HOB A;  5EFU A;  4Q26 A;  1GP6 A;  2XB6 C;  3IT8 A;  4JDM A;  4CDW A;  1IPK A;  3CNA A;  3POI A;  5T54 A;  3RSJ A;  4NN0 A;  2EXH A;  4R9C A;  4FFI A;  5ACA 3;  1POQ A;  4N53 A;  1UZ0 A;  5C3R A;  4BME A;  1D0H A;  1OHF A;  3ROU A;  4NHL A;  5DDJ 3;  4CRQ A;  1JMU B;  1UOF A;  4B7E A;  4M4P A;  2HWE 1;  2VZU A;  3UGH A;  5HCB A;  4AFD A;  2R1B A;  1VBB 3;  2XON A;  4FP3 A;  2Q8O A;  3VL9 A;  1WLT A;  4XUP A;  4A6S A;  5FPZ A;  1IKP A;  5FPX A;  5FQ0 A;  3CJI C;  4LO4 B;  1TME 1;  1OUX A;  1QJY 1;  3LDK A;  5A7W A;  1YWK A;  4XJA A;  3FUQ A;  4GWI A;  5FFO C;  4LKE A;  5JSP A;  4GB3 2;  3VHR A;  3KGL A;  3WSO A;  2RS5 2;  3Q8C A;  2WAO A;  1T6G C;  1ZRI A;  3ZLI A;  4JGZ A;  4BHP A;  4RGG A;  4UF0 B;  3AK0 A;  1EPW A;  4YGE A;  5LAT A;  4YM3 A;  3ACI A;  2PMW B;  1OUR A;  1FYU A;  1GIC A;  1SLA A;  2BNM A;  2BNN A;  5FYY A;  1O4Y A;  4Y20 B;  3CEW A;  1Y3T A;  3HN3 A;  3USS A;  1HRI 2;  2H6B A;  3JQW A;  3E6D A;  4BLJ A;  2C4X A;  3S5A A;  1OVS A;  5FYS A;  4XZU G;  3P5B A;  5JAX A;  3MIF A;  1UZV A;  2IWG B;  4JHT A;  1A34 A;  5FO7 B;  3D5O A;  5FOB B;  2FDJ A;  1WMD A;  1VIW B;  1YRZ A;  2JDU A;  3I3D A;  1QH7 A;  5ANN A;  4BXS V;  1ULD A;  4F3J A;  2Y6H A;  2HWC 3;  1MZ6 A;  1ODM A;  2AZ5 A;  5FPV A;  4AHX A;  4I30 A;  1PIV 2;  2ZTN A;  5DZF A;  3ACH A;  3K48 A;  4CDU A;  3PUQ A;  4NID A;  5IAV A;  4IGP A;  3AP9 A;  5FXV A;  3AM2 A;  2C24 A;  1AR8 1;  1FXZ A;  1GQH A;  2VUC A;  1IS3 A;  1EV1 1;  3DPR C;  4GWN A;  1CX1 A;  4GAL A;  3X29 B;  1KDK A;  1TVG A;  4K3U A;  4FOV A;  3ZXG A;  4PHZ A;  1R08 3;  1Y43 B;  1QHD A;  1TMF 3;  5HBA A;  3A4U A;  3OB8 A;  2UWA A;  2WO7 A;  3NJV A;  4BA6 A;  1CAV A;  4OHY A;  5FY0 A;  3J26 N;  4DIN B;  3ZIX A;  5T5P A;  1DQ2 A;  3GJA A;  1R1A 1;  4KWU A;  4RHV 2;  3NJY A;  4S2H A;  4WVV A;  1VBE 2;  1K5M B;  2P3I A;  4NVP A;  2JG9 A;  1VBE 1;  4BK4 A;  1RUI 3;  3K46 A;  1OH3 A;  2PQQ A;  1XQN A;  2JE8 A;  4WZF A;  4D7S A;  5GLV A;  5KXD A;  1KRI A;  5JR7 B;  1AYN 3;  3LIH A;  2XLG A;  2V5Y A;  2WAA A;  3J8F 2;  2PQS A;  2HWD 3;  4UFL A;  5FPB A;  1RIT A;  3I7D A;  1KD7 A;  5FY8 A;  4I02 A;  4YW3 A;  3T1L A;  1CX4 A;  3AKT A;  4O61 A;  3WG3 A;  1PK6 B;  4K9S A;  3WY6 A;  1CAW A;  3KQR A;  1RUD 3;  4Q8L A;  5ANQ A;  5K8S A;  4NIH A;  5FZF A;  2JG8 A;  4XHB A;  2NMN A;  1W9F A;  3ZR5 A;  5CEH A;  3I59 B;  1C28 A;  5CFD B;  2WNU C;  1XU1 A;  1HB2 A;  2BW8 A;  3LSE A;  4PDW B;  5ABJ B;  4XF3 A;  4XDQ A;  2D43 A;  3III A;  2BDR A;  4FPF A;  2R16 A;  1DF0 A;  4QPW A;  4XFB A;  3VKL A;  3WZ1 A;  2QFE A;  4A7K A;  4E8D A;  1OKO A;  4OMD A;  4YG6 A;  5IYY A;  2Y6L A;  4JDN A;  1QNY A;  2AUY A;  3I54 A;  2XKO A;  1GQG A;  4JRA A;  3LPF A;  1XSR A;  2BJS A;  4GKX A;  4AED A;  4EN8 B;  2HWB 2;  2XHK A;  5JOZ A;  2OZJ A;  4UFJ A;  3J7H A;  1Z78 A;  3FX3 A;  1YYN A;  2DVB A;  2BGC A;  1GFF 2;  2XJP A;  4Y5S A;  4CTE A;  3ZSM A;  2WZ8 A;  3I2H A;  3IMN A;  5F3G A;  3LOI A;  4QKD A;  1VBA 2;  5KHK A;  4P9X A;  4UBH A;  4BQY A;  3ST7 A;  2DDU A;  2YC2 A;  3DEC A;  2HEY F;  1GNY A;  1ZBE 3;  3B01 A;  1FV3 A;  1HQN A;  3CLP A;  3CU7 A;  3GBF A;  3NRU A;  3TEX A;  2IC1 A;  3WDX A;  5C33 A;  3S57 A;  4MG2 A;  4QDR A;  2FZ2 A;  1HLC A;  4Q4X 3;  2JWP A;  5SV5 A;  3RMY A;  1UKR A;  1S4C A;  2Y34 A;  4QQ2 A;  5DZG A;  2XQX A;  3BOD A;  2F6B A;  4JVA A;  2EAK A;  4YVW A;  5T5L A;  2XBO 1;  3G7D A;  2PHL A;  1O8S A;  1W6P A;  2WNV B;  3A22 A;  4DOU A;  1A78 A;  5C8C A;  3KT4 A;  4UAP A;  3AP6 A;  4QX3 A;  2WWU A;  5I8T A;  4R4X A;  4AZZ A;  2RS3 1;  1WGP A;  4TLF A;  2VUA A;  4OHX A;  4OUS A;  3AFK A;  1O6U A;  2RS5 1;  2PHF A;  3O5S A;  1UWW A;  1XND A;  2WKK A;  4TTG A;  4UI9 L;  4ORF A;  2BER A;  5AVP A;  1QJU 3;  2UU8 A;  3ZSK A;  5IVC A;  4X6R B;  3V0A A;  1EV1 3;  2JB8 A;  1GR3 A;  2EXK A;  3PUH A;  1F35 A;  1D4V B;  1ULO A;  1VRH 1;  4JHZ A;  4V2V A;  4Z2A A;  5JMC A;  3KCX A;  3C7E A;  4Q2F A;  1WW7 A;  4AVT A;  3OBT A;  4FPG A;  4H7L A;  1RUG 1;  5GM0 A;  5A3M A;  1C5H A;  3AP5 A;  4B7K A;  3PUR A;  4IEY A;  4XFC A;  5IJR A;  5FLH A;  3RJ2 X;  1MS8 A;  4B4Q A;  1U5X A;  2O8O A;  2ZGK A;  1X7N A;  3MIC A;  5K0U A;  5KHG A;  1W0O A;  2V09 A;  4CPB D;  2VZS A;  1GU3 A;  4Y22 B;  3PL0 A;  3VDD A;  1IZ3 A;  4HPK B;  1DCS A;  1CZT A;  2EF6 A;  2RS1 1;  3OYW B;  4ISQ A;  4OHV A;  5BNO C;  4NRM A;  3VD3 A;  3PVB B;  3T2O A;  2KM2 A;  1SLB A;  2R30 A;  1RHI 3;  3J7L A;  2JDM A;  4IEV A;  3O1T A;  3MIE A;  4FXK B;  3OUJ A;  3ZYP A;  4QX0 A;  2QQK A;  2RHP A;  2ZAH A;  2HWD 1;  4AEK A;  1N3O A;  2I2S A;  4OYU A;  4FAG A;  1PO1 3;  3N9P A;  4HK9 A;  5AFB A;  4TLG A;  1HV1 A;  1QXJ A;  1VBC 1;  2G9F A;  4FFF A;  4IEQ A;  5F2W A;  1JYV A;  4EE2 A;  1FOD 2;  2GP3 A;  2DUR A;  2VZT A;  3Q8F A;  5GZE A;  4YW6 A;  4CEW A;  3WQ7 A;  2WRA A;  1JBC A;  2QBX A;  4QQO A;  5I8S A;  4Q0P A;  2RS1 3;  5C4W A;  3P1I A;  2DFB A;  2GDF A;  4MXW B;  3RGB A;  1POV 3;  3ZR6 A;  2Z2S B;  2WJS A;  3MW3 A;  3NQH A;  4LIV A;  3MBW A;  2YXS A;  4Q4Y 1;  3WV6 A;  4CDX B;  3LOB A;  3IPV B;  5HI0 A;  4BOW A;  5EJZ B;  1URX A;  3C7O A;  4Y33 A;  5T50 A;  3VBF C;  4KI5 M;  2YFU A;  2IXL A;  2QCS B;  4KL1 A;  4XUR A;  3F95 A;  2WFP A;  1CAU B;  2OA2 A;  5H9S A;  1B35 C;  5LY1 A;  1AL0 G;  1DLL A;  1GSL A;  2VZV A;  2OUH A;  4N7I A;  5FJH A;  1N3P A;  2VTX J;  3OPW A;  3PVE A;  1X8M A;  5J36 A;  2XKP A;  4LTA A;  2WQ4 A;  3FWE A;  4HLT A;  4HBN A;  1JU3 A;  2PAM A;  4QX1 A;  1UY4 A;  2RM2 1;  5I93 A;  5H9Q A;  1QOO A;  2DF7 A;  2D6L X;  4M3C B;  4XBQ A;  1APN A;  1S2B A;  1RC6 A;  3CHX A;  4XTP A;  2ZAA A;  4Y24 A;  1W3V A;  3IPV A;  5FYU A;  4FQZ A;  3WF0 A;  2R06 3;  1NLR A;  2NQY A;  1NUK A;  2WNO A;  4IV1 A;  1B09 A;  5ERL A;  5LZ6 A;  4FTS A;  1X82 A;  3ZFE B;  2R0F A;  1LHN A;  5JOW A;  3D8C A;  3PLQ A;  3BOW A;  5EIY B;  2HWB 1;  4C0B A;  4Z82 A;  5CFC B;  1E57 A;  2B9V A;  3S7I A;  4N90 A;  5A7N A;  2FZ1 A;  3MIH A;  1DGR N;  3MLK A;  5CIR A;  1J3Q A;  3HN1 A;  3KV4 A;  4XXP A;  5FZ4 A;  1DQ4 A;  1FNZ A;  3ZYB A;  4P5H A;  3GNE A;  1PGW 2;  3T3Y A;  5JLV A;  1HQL A;  1RVF 2;  4E27 A;  5J09 A;  5T5J A;  4YFW A;  4KBB A;  4EWE A;  4QPG A;  4W6X A;  1OKQ A;  2ZZJ A;  1JOP A;  3L2H A;  2PHW A;  4IW3 A;  3RDI A;  5DUX A;  3VDA A;  2EIB A;  5DG2 A;  3S6P A;  3TOJ A;  2K46 A;  3WEZ A;  1XOY A;  4AEJ A;  4GMP 1;  1MEC 2;  3ASI A;  2XJU A;  1CVN A;  2HWE 2;  2Y26 A;  1ACC A;  4QQL A;  5CG9 A;  5J96 B;  1W6M A;  1RHI 2;  3VZL A;  5KWR A;  2XVL A;  2WIN B;  4QM8 A;  2WII B;  1COV 1;  3KT7 A;  3WNK A;  4B29 A;  5FZ8 A;  1CAV B;  4MVT A;  3RYR A;  1OT5 A;  1W2U A;  3H8X A;  1YFX A;  3THD A;  3U75 A;  4BU2 A;  1CPM A;  1RXF A;  1SLI A;  4ERO A;  5C4W B;  5DAQ A;  2VQT A;  2J22 A;  1SG3 A;  4D8M A;  2RS3 3;  3MDP A;  3KB5 A;  4CDW C;  4HON A;  1VB4 A;  4QB1 A;  3N9N A;  2WWJ A;  4XBN A;  3H1W A;  5HXV A;  5FDB A;  4EQV A;  3NNG A;  5FYC A;  3OBR A;  1BK0 A;  2ET1 A;  3IZO A;  2G4I A;  2SLI A;  1D7P M;  1AR7 3;  2QDR A;  5FPU A;  1UX7 A;  3VL8 A;  4LA3 A;  3CKH A;  2WFF 2;  4MSV A;  3T30 A;  1YQ5 A;  5L7O C;  2W9X A;  4FPE A;  4QXB A;  3NW4 A;  3WXP A;  2CY6 A;  4AI1 A;  4COY A;  1X33 A;  2RS1 2;  4CU8 A;  2N7G A;  2W08 A;  2R1D A;  2VG9 A;  5JPM B;  4WVZ A;  3R4S A;  3BTY A;  3VHN A;  4M3C A;  3AX4 A;  1LGN A;  4HET A;  3RYP A;  4AFC A;  4N8M A;  4XUT A;  1OLQ A;  1RUI 1;  2PN5 A;  5FYI A;  1NA1 A;  1RUI 2;  2VNR A;  5FPL A;  2GAL A;  2O0O A;  4XEZ A;  4YGB A;  3ZKU A;  5C71 A;  3OUH A;  5DUV A;  1QMJ A;  4CCJ A;  1PMJ X;  5FZH A;  5FO9 B;  4CXW A;  3MV1 1;  2J1A A;  5FZ7 A;  1OA2 A;  4QQP A;  1HB3 A;  3U4X A;  5BNN A;  3LGR A;  1QWR A;  4RHV 1;  4CP0 A;  2WS9 2;  3P3N A;  1HQW A;  1DIW A;  4E2Q A;  3AZX A;  3OD0 A;  3D3A A;  2ARX A;  4R4Z A;  4XF1 A;  5F3C A;  2JE7 A;  1FX5 A;  1V6J A;  1XYP A;  4RS5 C;  3VBS B;  2GP5 A;  2R04 1;  3B93 A;  4JGY A;  4OCT A;  2YPD A;  1WCK A;  4UW6 A;  3L9J T;  1UU5 A;  3NST A;  3VBR C;  5EYY A;  2DVD A;  3VBF A;  3HJR A;  2ZGR A;  3D82 A;  4H3W A;  4J1W A;  2E32 A;  4FPJ A;  3JBG 2;  1SCS A;  3HBK A;  4B4R A;  3P3P A;  4Z92 B;  4Z1V A;  2VXJ A;  3SKV A;  3ZMO A;  4QKF A;  1S2K A;  3MHZ A;  3OGJ A;  5A1A A;  3VBU B;  1HXS 1;  2P3K A;  4GWJ A;  4QX5 A;  4C91 A;  5I0D A;  4CCK A;  4YZ1 A;  2BWC A;  1ASJ 3;  2XJR A;  2RJL A;  3THT A;  1NE6 A;  4LLF A;  5IFT A;  3AC0 A;  1OBN A;  1KEX A;  3WW2 A;  2RM2 2;  3POF A;  1LOB A;  1TE1 B;  3VBF B;  3JD7 2;  5FUN A;  5C8C B;  2LTN A;  1MPX A;  1S0F A;  4GB3 3;  4Y5Z 0;  1L3J A;  3WNP A;  2LUW A;  2WQ8 A;  4TSV A;  2VOX A;  1UW8 A;  3WHU A;  3ZYR A;  4AVA A;  5FZK A;  1O5L A;  5A6Z A;  3CZJ A;  3ZVX A;  5AC9 2;  2RDR A;  4G4F A;  4LBJ A;  4DXS A;  2CDP A;  2YC4 A;  4LHS A;  4Q4W 3;  1Q56 A;  2JX9 A;  5FZI A;  1DGL A;  2PLV 2;  5FUI A;  2D40 A;  2UWC A;  1UO9 A;  5EHD A;  1BZW A;  4IND A;  3HQU A;  4PI2 A;  1HIX A;  5A7S A;  3TRS B;  3UES A;  1WBL A;  1W9S A;  2DUO A;  2Y0I A;  3KV6 A;  1BKZ A;  2WNU A;  3V56 A;  4LUL A;  4AI0 A;  1O8P A;  1DYO A;  2GZW A;  3USU A;  3EO6 A;  4NWV A;  4MYE A;  2WN2 A;  1NQJ A;  2D3S A;  2V4A A;  1W8T A;  4ZPI A;  1JTZ X;  4DY5 A;  1WCD J;  5ACA 1;  3WG2 A;  1ULF A;  1GOG A;  3DGT A;  2MEV 1;  3NKT A;  2X10 A;  2W68 A;  4MH0 E;  4OI4 A;  4TWT A;  3ZYF A;  2VZP A;  3PU8 A;  5FR3 A;  4RFR B;  5DUW A;  4QKB A;  2AEN A;  2KD7 A;  1HN1 A;  3EYP A;  3MIB A;  3L2Y A;  4FFG A;  3KZ4 C;  2DV9 A;  1BVP 1;  1CJP A;  3M4F A;  3KSC A;  1RUC 2;  1O5U A;  3MEP A;  1RUO A;  2JIC A;  1W03 A;  3MO4 A;  1W0P A;  4OMC A;  3OUI A;  2YDE A;  4GH4 C;  3W21 A;  3VB9 A;  4L11 A;  1D4M 1;  3A0N A;  2E63 A;  2W95 A;  5JWP A;  1RJ7 A;  5LRR A;  2VOK A;  3GZU C;  5LB6 A;  2DVF A;  3T0A A;  4FCA A;  4WM8 C;  5FP3 A;  1JOD A;  2VZO A;  3NV3 A;  4LUM A;  3SLI A;  3SH5 A;  1GQP A;  4DUV A;  4YW1 A;  5LEJ A;  3VN4 A;  2VMF A;  5CBL A;  2UWB A;  4M4R A;  3BYW A;  2OZ6 A;  1VBD 1;  4PDW C;  1WD3 A;  5CZK A;  4MXV A;  1OD3 A;  2GME A;  4CCC A;  4ZXE A;  4OZO A;  4Q0Q A;  1MVQ A;  2VCB A;  1PZ7 A;  2WZE A;  2ZOE B;  3AZY A;  4KG0 A;  2VQ0 A;  3BTX A;  1PVC 2;  2VE1 A;  4Y22 A;  1N3Q A;  4QDS A;  1E5H A;  2R07 1;  2W94 A;  2J1S A;  2EVX A;  3KT1 A;  5DPN A;  5F32 A;  3T2P A;  3FBY A;  4AXO A;  4YZ3 A;  2DU1 A;  1UU6 A;  2IZW A;  4BMB A;  4IV3 A;  3HD8 B;  4QKN A;  4XF4 A;  1Z7S 1;  5A7O A;  4XZP A;  1QJX 1;  2RE9 A;  5A3P A;  3K3N A;  1RVF 3;  4BQ4 A;  2BOI A;  1A8M A;  1OFN A;  3NL1 A;  4ONU A;  5IVV A;  2VVD A;  4H14 A;  1OXC A;  5DDJ 2;  1VR3 A;  1AXY A;  4CDW B;  3MFC A;  3MI8 A;  4M00 A;  1XSQ A;  3VD9 A;  3NJX A;  3MW4 A;  1AR8 2;  2ORZ A;  1CZV A;  5C6C A;  3GBG A;  3OYW A;  2I74 A;  3AP4 A;  4W8J A;  2E6V A;  4Q4V 2;  3RYK A;  1FOD 1;  5C9A B;  4ZHN A;  1O4Z A;  3KS7 A;  4R52 A;  3ZYI B;  5CFC A;  1CJD A;  1JW6 A;  4EN7 B;  4LA2 A;  2A3Y A;  3ORJ A;  4QPI B;  1K45 A;  2HYX A;  5LBC A;  2OX0 A;  5J1X A;  1I6X A;  4NOT A;  4IEP A;  4EWD A;  1WLD A;  4LOT A;  2YC0 A;  3AZZ A;  1OLM E;  1XU2 A;  1VMF A;  2B45 X;  5GLU A;  3O0X A;  3WNL A;  4AR2 A;  3Q8B A;  4ASM B;  4M3C E;  2Y6J A;  3ZPY A;  4DFS A;  5C9A A;  1RXG A;  4LO6 B;  4QPY A;  3WP5 A;  5KHH A;  1BEV 1;  1UAI A;  1W06 A;  1RUF 3;  1E5S A;  1C8M 2;  4JGZ B;  2UY8 A;  1QJX 3;  3AKS A;  3VHP A;  3WCS A;  1F4H A;  5CFD C;  2Q0A A;  3JQX A;  1N1S A;  1QJU 2;  1T6B X;  3M3O A;  2D6K A;  3WUD A;  1QJZ A;  1AR6 2;  1RUF 2;  1SHW B;  1W8U A;  3O0W A;  2CAU A;  2XPJ A;  5GZG A;  1NE4 A;  3JD7 1;  2OPW A;  5JUV A;  1ZVF A;  1AJO A;  2VCM A;  1LGC A;  1VB2 A;  3K4D A;  3MPB A;  4HT1 T;  4C0H A;  1S0D A;  5B4N A;  4ISR A;  5DN2 A;  5SV8 A;  5IAX A;  1ST8 A;  3OPT A;  1LOA A;  2DVA A;  3NVC A;  4WV8 A;  2R0H A;  3ZSE A;  3PIJ A;  3N9L A;  3UJO A;  3O1P A;  1DYP A;  5L9V A;  3CJI A;  2VEC A;  4GZ9 A;  3POJ A;  1S0E A;  1J3R A;  2Q8D A;  4F83 A;  4LBN A;  4B1L A;  5F5C A;  4B4P A;  1RUJ 1;  2PHT A;  5C70 A;  3LPG A;  1ND3 B;  4P14 A;  1ODN A;  1NQD A;  1OSG A;  2GAU A;  4Y5T A;  3AB0 A;  4FP2 A;  1CPN A;  2ZJC A;  1NYW A;  1F15 A;  3A0K A;  1XJA A;  1XYO A;  4Q29 A;  1KXG A;  5FXZ A;  1PIV 1;  3GHN A;  4CCO A;  3NJZ A;  3ATG A;  5ACA 2;  2R7E B;  4KU8 A;  1SLC A;  5KC5 A;  5JDB A;  2OKX A;  5KHI A;  4DUX A;  1FPN 3;  1IG3 A;  2G9G A;  1IOA A;  2VR4 A;  2D44 A;  3J7N A;  1GNZ A;  2FBE A;  4IV1 C;  4O65 A;  1LGB A;  5LBE A;  1S0I A;  3H8U A;  3UT0 A;  4DY3 A;  2Y8K A;  2L9L A;  4QXC A;  2Y0O A;  4YZ4 A;  4LMF A;  4N43 B;  4Z07 A;  2JEC A;  5GLT A;  1RHI 1;  1U5I A;  4N9H A;  3T1M A;  2IXI A;  4RN5 A;  5IK8 A;  4AVS A;  5EWS A;  5FK8 A;  2E26 A;  3ES4 A;  2XR4 A;  2NZ9 A;  1QOT A;  4LKS A;  4WM8 A;  3A23 A;  1MQT C;  2JG8 B;  2BVB A;  1LOD A;  2Q1Z B;  1PK6 A;  3PJQ A;  2WFF 3;  2VUJ A;  4RQP B;  1VBB 2;  1ZA7 A;  4PDW A;  1RTV A;  3E5Q A;  5BNO A;  3ACF A;  5HXM A;  4MHR A;  3I59 A;  3IBM A;  1W04 A;  4E2S A;  4YW7 A;  3DUI A;  1UXX X;  4NUB A;  3J8F 1;  4YW2 A;  2Q8E A;  1VRH 3;  1WW4 A;  4UFK A;  3WP4 A;  3AFG A;  1W8H A;  1YLL A;  4Y3O A;  3TNP B;  2UUR A;  1W8N A;  4L2N A;  4XJZ A;  1YFU A;  2Y60 A;  3MYX A;  3W5M A;  4QB6 A;  4LBO A;  4XW3 A;  2E7A A;  1UOB A;  3R4D B;  2QKD A;  4YVS C;  2PEL A;  4YFZ A;  2ZX2 A;  3JU9 A;  1S0J A;  1Y9M A;  5LCW L;  3LCP A;  1UOJ A;  1H6X A;  5FP4 A;  2YBP A;  5K9Y A;  3BN6 A;  3O14 A;  4J25 A;  1W2T A;  4XE9 A;  4BQX A;  4QMA A;  3N7K A;  1GOF A;  1PIV 3;  2CDO A;  2QQL A;  2RV9 A;  2DTY A;  2YYO A;  4HOO A;  3MIG A;  4YW4 A;  1FV2 A;  4FI9 A;  2B42 B;  4WZC A;  5FTT C;  1CR7 A;  5HCF A;  3WNX A;  4YAR A;  1US3 A;  1WW5 A;  2F4L A;  1LHW A;  2TBV A;  3FLP A;  1IG0 A;  3ME2 A;  1QJF A;  1GV9 A;  1WD4 A;  1YI9 A;  1XE8 A;  4IEO A;  1GAN A;  4XCA A;  1NLS A;  5CA6 A;  5HCA A;  3OGV A;  2EID A;  3D4K A;  2WN3 A;  4DXT A;  1W9T A;  1CQ9 A;  5DXD A;  2VL4 A;  3WOG A;  2ARC A;  2D7F A;  5LA9 A;  2AC1 A;  5A3U A;  5IK7 A;  1BBT 2;  1VBA 1;  1L7L A;  1JYC A;  2AR6 A;  1DQ0 A;  2IFW A;  3DYO A;  4JC1 A;  5A3W A;  4F8A A;  2VUD A;  1UIK A;  3I2I A;  2XL7 A;  1O3R A;  1ULG A;  1SPP A;  2ZEW A;  1SZB A;  5E16 A;  1XC6 A;  5BYN A;  2FD8 A;  3RI8 A;  3O1U A;  1GMM A;  3FFQ A;  4UFI A;  2P6H A;  1BHG A;  5C9A C;  1G8W A;  2RR1 1;  1CES A;  2WT2 A;  2Z4F A;  3OD4 A;  2PHU A;  4P9W A;  1HRV 2;  1PGL 2;  1BEV 2;  4WM7 A;  2EIG A;  4L97 A;  3PVN A;  4A42 A;  5CFD A;  2ZGU A;  1NA1 C;  3V0A B;  3VBS A;  1W2N A;  1YQ8 A;  1OVP A;  2YB7 A;  5G05 L;  2YMZ A;  1QJU 1;  2D97 A;  4I0W B;  2XWJ B;  1UPI A;  3VZN A;  3H3L A;  5AFE A; 
#chains in the Genus database with same CATH homology
 2DCJ A;  4QX0 A;  2QQK A;  3C7G A;  4OYU A;  3FL7 A;  1JYW A;  3I97 A;  1JZ7 A;  3GXU A;  4LPL A;  1JYV A;  3UET A;  2B4K A;  1XNA A;  3GM8 A;  1LNS A;  2VZT A;  4PF1 A;  2QBX A;  1EUU A;  4OUE A;  2VZQ A;  3P1I A;  2W3J A;  1W0N A;  3PUI A;  3NQH A;  3MBW A;  2RJ2 A;  3OGR A;  2V72 A;  2X05 A;  2DCK A;  1K42 A;  5EJZ B;  3C7O A;  2W92 A;  4KI5 M;  2YFU A;  4XUR A;  4MO3 M;  2VZV A;  4MOA A;  3ABZ A;  4QDQ A;  2Y6G A;  2V4V A;  1XNT A;  2E31 A;  2BGP A;  1JU3 A;  2ORX A;  4QX1 A;  1UY4 A;  3A21 A;  3MUZ 1;  2VZR A;  3ACG A;  3WF0 A;  3HEI A;  2VZ1 A;  1NUK A;  2JKX A;  2WDB A;  5EIY B;  3JXS A;  1JHJ A;  2J1V A;  2B9V A;  3E1F 1;  3FHQ A;  2HLE A;  1W9W A;  4ZZ8 A;  3IB3 A;  1CIY A;  1H6Y A;  4BJ0 A;  2W1S A;  1JZ6 A;  1F4A A;  2W46 A;  2QQN A;  2ZEY A;  3OEB A;  5JMO A;  3CMG A;  3SKJ E;  5C7G A;  3VDA A;  2EIB A;  2W1Q A;  2J1T A;  3WEZ A;  4A45 A;  4MAD A;  4A6O A;  4QX2 A;  2QQI A;  1WCQ A;  3WNK A;  2VMD A;  3WF2 A;  1OT5 A;  3THD A;  2YFZ A;  4LQR A;  5F7U A;  3HNY M;  5LA0 A;  5JXG A;  2VQT A;  2J22 A;  1OF4 A;  1SG3 A;  3I2J A;  4D8M A;  3DYP A;  4DUW A;  3ECQ A;  2LW8 A;  1UYX A;  2VCA A;  4QB1 A;  4XVH A;  3C7F A;  3NNG A;  4D0Q A;  4KMQ A;  3U37 A;  2W1W A;  3CZU A;  1J84 A;  3VD5 A;  5DMY A;  1JZ5 A;  1D7P M;  1UX7 A;  3CKH A;  2Y6K A;  2W9X A;  3GDB A;  3MUY 1;  4CU8 A;  4W4Z A;  2VC9 A;  1YQ2 A;  2QQM A;  5EJ1 B;  1JYN A;  1NKG A;  4XUT A;  1PX4 A;  3K4Z A;  5C71 A;  2W1U A;  1JI6 A;  3VD4 A;  1PMJ X;  3MV1 1;  2J1A A;  2J1U A;  5LA2 A;  2W87 A;  4ZZ5 A;  3ETP A;  3T08 A;  2BBA A;  4DEV A;  1T2X A;  1OH4 A;  4RYD A;  3D3A A;  3OBA A;  2VMC A;  4XUQ A;  2VME A;  3LQC A;  2J7M A;  2WBK A;  2VOT A;  3WQB A;  1DLC A;  4HG6 B;  4ET7 A;  4QAW A;  3HJR A;  3K77 A;  2E32 A;  1L7Q A;  5CYY A;  4CUB A;  2J1E A;  3SKV A;  5A1A A;  4GWJ A;  4PQQ A;  5I0D A;  3BGA A;  5G04 L;  3F2Z A;  5IFT A;  3HNB M;  3AC0 A;  4BK5 A;  1KEX A;  1UYY A;  2WO1 A;  1MPX A;  2WAB A;  3WNP A;  2WQ8 A;  3CZJ A;  3OG2 A;  4JX0 A;  1J83 A;  4CU6 A;  3LEI A;  4DXS A;  2CDP A;  4CVU A;  2YC4 A;  4LHS A;  3I3B A;  3WF4 A;  1CZS A;  1KGY A;  5FUI A;  4DXR A;  1JZ3 A;  3T0D A;  3UES A;  1W9S A;  1GOH A;  1NX9 A;  3IAP A;  3I3E A;  2V5D A;  1O8P A;  1DYO A;  2C26 A;  3SEP A;  1W99 A;  2WN2 A;  4DEQ A;  4CUC A;  2YG0 A;  3WNM A;  1JZ4 A;  1GOG A;  2X10 A;  3ZM8 A;  4YPJ A;  1GUI A;  2VZP A;  2E33 A;  2KD7 A;  3EYP A;  1UMI A;  1HN1 A;  4ARX A;  4CU7 A;  4ZY9 A;  2EIE A;  3MO4 A;  4CU9 A;  4OMC A;  4TXW A;  1ULP A;  2XHN A;  4P00 B;  2W95 A;  2J1R A;  3LEG A;  2ZEX A;  4A41 A;  3IAQ A;  3T0A A;  2VZO A;  5IHR A;  4UOJ A;  1SDD B;  1GQP A;  3FHA A;  4DUV A;  2VMF A;  2XOM A;  4M4R A;  4CUA A;  2VO5 A;  3WF3 A;  5CZK A;  1OD3 A;  3EB7 A;  3FN9 A;  4ZXE A;  4OZO A;  2QQO A;  2VCB A;  1I5P A;  1NAE A;  2WZE A;  3C7H A;  4PT6 A;  3HOB A;  4QDS A;  5DPN A;  2W94 A;  3T2P A;  2J1S A;  1K12 A;  1UZ0 A;  4ARY A;  2WO2 A;  3W5N A;  3VD7 A;  4M4P A;  2VZU A;  5JXI A;  1R64 A;  2VQU A;  2XON A;  1L7R A;  2W5F A;  4XUP A;  5JXH A;  2WO3 A;  1P8J A;  4A3Z A;  3VD9 A;  3NJX A;  4GWI A;  2VM9 A;  2ORZ A;  3UNP A;  1CZV A;  3SEE A;  5IFP A;  3WSO A;  4W8J A;  2WAO A;  3T0B A;  3ACI A;  4E8C A;  2BZD A;  3HN3 A;  3MV0 1;  3T2Q A;  1K45 A;  2HYX A;  4XUO A;  5J1X A;  2C4X A;  4XZU G;  1O59 A;  3HNM A;  3WNL A;  2Y6J A;  1UY3 A;  4IUG A;  3IDA A;  3I3D A;  4BXS V;  2Y6H A;  1F4H A;  4XUN A;  1UY2 A;  2QQJ A;  3ACH A;  2WUH A;  1SHW B;  3LEK A;  4QB2 A;  1CX1 A;  1TVG A;  5JUV A;  2VCC A;  3K4D A;  3OB8 A;  5B4X A;  2VZ3 A;  3NJV A;  5B4N A;  2JDA A;  5DN2 A;  3C8X A;  4KWU A;  3P6B A;  1JU4 A;  3LE0 A;  4GZ9 A;  4BDV B;  3WNN A;  4BK4 A;  3K46 A;  2JE8 A;  1W8O A;  4JKL A;  1K3I A;  2LS6 A;  5C70 A;  3LPG A;  2WAA A;  2PQS A;  4MGQ A;  3CQO A;  4A4A A;  1DP0 A;  3WNO A;  2R7E B;  1UYZ A;  2VJX A;  2OKX A;  4DUX A;  2VR4 A;  4P02 B;  3HPN A;  2Y8K A;  2L9L A;  2W47 A;  3CDZ B;  3III A;  4QPW A;  4L0P A;  4E8D A;  4RN5 A;  4OMD A;  2ZXQ A;  2Y6L A;  5IYY A;  2E26 A;  4JKK A;  3LPF A;  4LKS A;  1EUT A;  3K75 B;  3A23 A;  2ZEZ A;  2WYS A;  3I2K A;  1UXZ A;  3J7H A;  1TG7 A;  3ACF A;  3DYM A;  5HXM A;  3WF1 A;  1PX3 A;  2WZ8 A;  3T09 A;  3I2H A;  1JYX A;  1UXX X;  5JR2 A;  3K4A A;  5HPO A;  1IQD C;  1OF3 A;  2VTF A;  1W8N A;  2DDU A;  2YC2 A;  3DEC A;  1GNY A;  2Y64 A;  4QB6 A;  3W5M A;  3NRU A;  4QDR A;  5LCW L;  1PMH X;  4AAX A;  1H6X A;  3VDB A;  2XQX A;  3BN6 A;  3VDC A;  3I2G A;  3OGS A;  1JZ8 A;  1GOF A;  1O8S A;  2CDO A;  3A22 A;  2BGO A;  2QQL A;  2RV9 A;  2W91 A;  3CIH A;  4UAP A;  5LA1 A;  3OEA A;  4FI9 A;  4QX3 A;  4AG4 A;  1US3 A;  5DQ0 A;  2JD9 A;  1UY0 A;  3OGV A;  1US2 A;  2EID A;  2WN3 A;  4P08 A;  4DXT A;  1W9T A;  2RVA A;  1UWW A;  2VL4 A;  4TTG A;  3GGL A;  4UI9 L;  2BER A;  4P5Y A;  4W50 A;  3THC A;  4JKM A;  4Z2A A;  3PUH A;  1ULO A;  3DYO A;  3I2F A;  4JHZ A;  3C7E A;  2EIC A;  3I2I A;  2ZEW A;  1XC6 A;  2X09 A;  1GMM A;  5IJR A;  1BHG A;  2C9K A;  3A7Q A;  5JXJ A;  2Z4F A;  2ID4 A;  1XPW A;  1UY1 A;  1JZ2 A;  2VZS A;  1WKY A;  1GU3 A;  4A42 A;  4MGS A;  1RYY A;  4A44 A;  2YB7 A;  1CZT A;  5G05 L;  3VD3 A;  3T2O A;  1UMH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...