2YG0A

Cbm62 from clostridium thermocellum xyl5a
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
139
structure length
139
Chain Sequence
YPKLTGTVIGTQGSWNNIGNTIHKAFDGDLNTFFDGPTANGCWLGLDFGEGVRNVITQIKFCPRSGYEQRMIGGIFQGANKEDFSDAVTLFTITSLPGSGTLTSVDVDNPTGFRYVRYLSPDGSNGNIAELQFFGTPAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Novel, Noncatalytic Carbohydrate-Binding Module Displays Specificity for Galactose-Containing Polysaccharides Through Calcium-Mediated Oligomerization.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Sugar binding protein
molecule keywords CARBOHYDRATE BINDING FAMILY 6
total genus 30
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2011-04-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2yg0A00
3HNYM 4OUEA 4MOAA 1JZ8A 3MUY1 3SKVA 2J1AA 3CZJA 3WF2A 2E32A 3OBAA 2VMEA 4QX2A 5A1AA 1XNAA 1YQ2A 1W9TA 1UY3A 3A7QA 1GU3A 4OYUA 1OD3A 3HNMA 3C7EA 3T08A 4LKSA 3C7OA 2RVAA 2YFUA 1US3A 2VZQA 2R7EB 2DCJA 1H6YA 2QQIA 1W8OA 4DUVA 3LEKA 2VM9A 3NNGA 4CUCA 2C26A 1UMHA 2EIDA 2VZ1A 2QQKA 4P00B 4AG4A 4D8MA 3VD4A 2BGPA 2VC9A 2W92A 3MV01 3SKJE 3HOBA 3HJRA 3WEZA 2ORZA 2V72A 3FHQA 1J84A 3OGVA 2C4XA 2J22A 3D3AA 5B4XA 3PUIA 1O8SA 3WQBA 1D7PM 2WABA 3LPGA 1US2A 2WN3A 2V5DA 2WO1A 2XQXA 3K77A 5DMYA 2XONA 4QX3A 1O8PA 2W1QA 4W4ZA 3CIHA 1F4HA 4W50A 5J1XA 3CMGA 3IAPA 2ZEZA 4UOJA 4A3ZA 2VZ3A 5CYYA 5EIYB 4QB2A 1R64A 2J1UA 4MO3M 4GZ9A 4A41A 1JZ5A 1TVGA 1BHGA 3WNKA 2XOMA 1JYXA 4BJ0A 4JHZA 5JUVA 3WSOA 3WNLA 3PUHA 2W1SA 3EB7A 4RYDA 4DEVA 3C8XA 3K4AA 3THCA 1PMHX 1XNTA 4QX0A 3GM8A 2JKXA 4ZY9A 4BXSV 4RN5A 4CU9A 4JKLA 4XURA 2X09A 2B9VA 2W9XA 4QX1A 3GDBA 3CQOA 3WF3A 4HG6B 4Z2AA 2VCCA 2QBXA 3WF1A 1JYWA 4MADA 1UYXA 2JDAA 4OMDA 3OB8A 1L7RA 2Y6JA 1O59A 1SHWB 2BBAA 2JD9A 5G05L 2YG0A 1XPWA 4LPLA 3UETA 2EIEA 1PX3A 4QDQA 2C9KA 3AC0A 3LEIA 2VZUA 1JU4A 3I2KA 4E8DA 2W3JA 4DXRA 1UY4A 3C7GA 4P5YA 1CZSA 3W5MA 1GUIA 2WYSA 2W95A 4XUPA 4XUNA 1CZVA 2QQMA 4P02B 2CDPA 1KGYA 1NUKA 2CDOA 3WF4A 3ETPA 2W47A 2W87A 3I97A 4MGSA 1UY1A 2ORXA 5JXGA 3ABZA 1UXZA 2OKXA 2ZEXA 3C7FA 2Y64A 4KWUA 4ARYA 4LHSA 3HNBM 1L7QA 5JXHA 1SDDB 3FN9A 3WNMA 1UYYA 1RYYA 1OT5A 2QQOA 1UXXX 3GXUA 2V4VA 3DECA 4GWIA 2J1SA 5IFTA 4DEQA 3CDZB 4DXSA 2B4KA 5C70A 2LS6A 2WQ8A 3IDAA 5IYYA 5LA0A 4UAPA 3THDA 1OF4A 3VD7A 3CKHA 2WO3A 2XHNA 3ZM8A 1ULOA 4A42A 4DXTA 3WNNA 3NRUA 3DYOA 3T0DA 4XUOA 1W0NA 2WDBA 2Y6KA 4KI5M 2ID4A 4CU7A 1F4AA 3OEBA 4KMQA 2ZEYA 2VQUA 3I2JA 1JYVA 3T2OA 5I0DA 3SEEA 3T0AA 4QB1A 3IAQA 5CZKA 2KD7A 1I5PA 3WNOA 3I3BA 2VMFA 1HN1A 4M4RA 4JX0A 1T2XA 4QB6A 3A21A 5JXIA 4IUGA 1LNSA 4A4AA 4CU6A 2Y6GA 5HXMA 3LE0A 3OGRA 2LW8A 4JKKA 2E33A 3WF0A 4D0QA 1UX7A 1K12A 2E31A 2WBKA 3ECQA 4BK4A 3W5NA 1JU3A 5LA2A 1DYOA 5JXJA 3K46A 2VL4A 3ACHA 3K75B 2VZSA 1PX4A 2VZRA 3FL7A 1GMMA 1W9SA 1UY2A 1WKYA 3UNPA 1UYZA 2WZEA 3LPFA 4A45A 1K42A 3WNPA 1OH4A 2W91A 4M4PA 2VZOA 2Y6HA 2VZTA 4MGQA 3I3DA 2QQLA 3I2IA 4YPJA 4GWJA 4ARXA 1IQDC 2VMCA 3T09A 1TG7A 3OEAA 3VD3A 3HPNA 3I2GA 1JZ4A 4XUTA 4CUBA 3UESA 3A23A 2W1WA 1CZTA 4CVUA 2BZDA 3NJXA 2J1EA 2VCAA 1JI6A 2BERA 1UMIA 3LEGA 1K3IA 2EICA 4PF1A 2YC2A 1JZ2A 2WAAA 1UWWA 4FI9A 3C7HA 1GNYA 2WN2A 3K4DA 2L9LA 5HPOA 5DPNA 4JKMA 4OMCA 3FHAA 4TXWA 3HN3A 3VD5A 1KEXA 1ULPA 3I3EA 5G04L 5FUIA 3VDAA 3DYMA 2ZEWA 3NJVA 2VO5A 4LQRA 2VOTA 3A22A 2WUHA 2VR4A 4UI9L 3IB3A 2J1VA 5DQ0A 3BN6A 4PQQA 2EIBA 2PQSA 4PT6A 2J1TA 4XUQA 3VDCA 3T2QA 4DUXA 1H6XA 2WZ8A 4OZOA 2X05A 4ZZ5A 4TTGA 5IJRA 1XC6A 5EJ1B 1GQPA 3MV11 5IHRA 3VDBA 3DYPA 1W99A 4ZXEA 1EUTA 3GGLA 3ACFA 4ET7A 3IIIA 3VD9A 1NX9A 3I2FA 4A6OA 1W9WA 2Y8KA 3K4ZA 5LCWL 2RJ2A 3MUZ1 5C71A 4E8CA 1W8NA 4QAWA 5LA1A 5C7GA 2YFZA 5B4NA 3OGSA 4BDVB 3MBWA 4XZUG 1DP0A 2VTFA 3E1F1 2BGOA 2VCBA 1DLCA 2DDUA 1CIYA 5JMOA 3ACIA 1WCQA 4W8JA 3P1IA 1GOHA 3P6BA 1JZ6A 2YB7A 3U37A 1JHJA 4CU8A 2ZXQA 5DN2A 2W94A 1J83A 3SEPA 1PMJX 2RV9A 1OF3A 5F7UA 3J7HA 4QPWA 2E26A 4A44A 2WO2A 2X10A 1UZ0A 2HYXA 2DCKA 4L0PA 3T2PA 2QQJA 3NQHA 3CZUA 1GOFA 2W5FA 2YC4A 3LQCA 2VMDA 2Y6LA 3HEIA 2VJXA 1JZ3A 2HLEA 1NAEA 1JYNA 5JR2A 2Z4FA 2VZPA 1JZ7A 3T0BA 3OG2A 3ACGA 4QDRA 1CX1A 2VQTA 4P08A 3EYPA 2W46A 3JXSA 2WAOA 2VZVA 1SG3A 1UY0A 2J7MA 4QDSA 2W1UA 3I2HA 4XVHA 2JE8A 3BGAA 1GOGA 1NKGA 4CUAA 1P8JA 5EJZB 4BK5A 4AAXA 4DUWA 1K45A 1MPXA 5IFPA 2QQNA 4ZZ8A 1EUUA 3F2ZA 2J1RA 3MO4A
chains in the Genus database with same CATH superfamily
1LJ7A 3ZYJB 4OUEA 3HBKA 3AJYA 1JZ8A 1VBC3 4XDPA 5C33A 2LROA 3NNLA 3RWKX 3WUCA 1S0CA 4WM8B 1UMZA 5I8TA 2G4IA 3WW1A 2E32A 5FYVA 2VMEA 4JDMA 4NPLA 4QX2A 4RQPB 1FPN3 4RL7A 4L8QA 4IERA 4XYXA 3WW3A 5A1AA 2YBPA 1KJLA 4AE2A 1ENQA 3LD8A 4WVMA 4YM2A 5SV8A 1MQTA 1HQWA 3EXUA 1B35C 1OD3A 1RUJ3 3OBRA 3M7AA 2VMIA 5C5TA 1WW5A 1GQGA 1DZTA 2JEMA 3WDVA 1V6OA 4LOSA 5LRSA 1UW8A 5J36A 2YGLA 4KNCA 1H6YA 2ETEA 3KGZA 3LDBA 4L97A 5A6YA 1S0EA 2XVKA 4DUVA 4CPBA 2VM9A 2RS32 3NNGA 2C26A 1UMHA 1VAKA 4XF3A 4EROA 5FWEA 5DDJ2 3LWCA 2ATFA 4P00B 4QQ2A 4FOWA 3HR9A 1ZBA1 1ZZCA 4IV3A 3MIFA 5FCCA 5DG1A 5LASA 2W92A 3SKJE 2WSUA 4AFBA 5GZGA 1O3SA 4LBQB 3HJRA 2A71A 1VMFA 1PGW2 3OGVA 3LF7A 4CEWB 3PMSA 5FWJA 1LULA 4W6WA 5DDJ3 5B4XA 3PUIA 3R4DB 3AMNA 4WVMB 3WQBA 1D7PM 2Q30A 3ZXGA 1V9U2 3LPGA 1RUI2 2D6OX 1BJQA 2HWE3 1PK6B 2OZ6A 2VVFA 3LGRA 3B00A 4XJWA 2WN3A 2P6CA 1S4CA 3H8UA 3MLLA 4K20A 3D82A 1OFSA 2V5DA 4MVTA 4UFKA 5IK5A 1JOBA 4G9SB 1S55A 3E6DA 2XQXA 3K77A 5FBZA 2OQ6A 1POV0 1NY71 5FFOC 2B46X 5FY0A 4BQ3A 2ENRA 2NZ9A 2W1QA 3JB4C 3SQOA 3V0BA 1C5HA 1HB4A 2C9AA 4LK7A 2GDFA 3Q8EA 5JSOA 1CJDA 4CTEA 3UGFA 4DY5A 3AYDA 4CDQA 2WO7A 1DG6A 3IAPA 4JQTA 4FXKB 1MZFA 3ZYRA 2BBVA 3LDRA 2ZEZA 1RUG2 4JGZC 2D6LX 3BODA 1EAH3 4FP3A 3UKTA 5FO7B 1TME2 1VMHA 2E53A 2J1UA 2BEOA 5FKBA 3VZOA 1A3KA 1KS4A 1TVGA 1WMXA 1PGSA 1VBC1 4HPKB 4TLFA 3RZHA 2JX9A 4FBFA 2XMLA 1ZBE2 1W6NA 4BJ0A 3POSA 5KHHA 5FYZA 4O61A 4XBLA 3PMEA 4JVAA 4B4QA 2ZX3A 1AL22 2JG9A 2XDVA 3MFAA 1X8MA 1H4HA 3OD0A 4FPFA 4QPIA 3K4AA 2DVBA 1SCRA 4DOUA 4K40A 5K0UC 1DCSA 1K5JA 5T5LA 4BXSV 1LGBA 1RUD3 4XFHA 3HT2A 1YFYA 3VKNA 2VTXA 4NAOA 1YO8A 4TYSA 1S2BA 3DPRA 4XURA 2X09A 4QPGC 2PHLA 5FUPA 3GDBA 5ISLA 3FUOA 4PDWC 3BIWE 1Z0HA 2A1XA 1YIPA 1XE7A 3CL1A 5L9RA 2VCCA 2QBXA 4XQDA 1H9WA 3RRDA 4C1XA 2JDAA 3MIGA 1MEC1 3OB8A 4GH4B 1QJFA 1RUH1 4O9EA 3NAPC 4O9GA 4BQ2A 3GZTB 1FOD1 2JD9A 2DF7A 5DAVA 3OOXA 2ARBA 1QHDA 1AJKA 2YPDA 3T1LA 4QQOA 4QXCA 3VBRA 4XFAA 4PF5A 2JG8B 1PX3A 2Y0IA 2C1FA 2GSYA 4N53C 4QDQA 1OSGA 1N1SA 2AREA 2C9KA 3ELNA 3J26N 1HJGA 1YQ6A 3B5LB 4DXRA 5FZ3A 1UY4A 4AFMA 4P9LA 3Q8FA 4AVVA 1JMUB 4BMBA 2VQ0A 4JGYC 3W5MA 2WYSA 4WM8C 1ZBE3 4XUNA 1QF3A 1CZVA 2VD7A 3ZYHA 1IG3A 2CDPA 3TB0A 3ZN5A 4IV1C 4EE2A 4MX3A 4OHWA 4HVQA 1Q3EA 1UD1A 3JD72 4XTMA 3T30A 2W47A 3PVEA 5A7WB 3I97A 1D4VB 4MGSA 1OA4A 5I0UA 3MW4A 4HKLA 5FLIA 1PVC3 3VDDC 2VUCA 4W65A 3OY8B 1NXD1 5AFEA 1YNAA 1SFPA 3ABZA 2OKXA 4BQYA 3L9JT 4M3CF 4LLFA 1XSRA 4URTA 3ZXLA 1URXA 4E2SA 2HWD1 5JDBA 1AXKA 3EQEA 1ODNA 2Y64A 4QU2A 4KWUA 1XYPA 3RMXA 3AVRA 5LK5A 3DXUA 1IHMA 3HNBM 4WBBA 5JXHA 1X82A 4RGKA 2BVVA 4AK3A 4C0BA 1ACCA 4XIOA 3WNMA 2NQYA 1XNKA 1FXZA 4EN9B 2ZGKA 3KV9A 2V4VA 1JXNA 3DECA 4HVOA 1PO11 1AR71 3OPZA 5C8WA 3N9MA 1ULGA 4K21A 2BJSA 5FZOB 4S2FA 1W06A 1M4WA 1GSLA 5FZ8A 4DEQA 2B4KA 2WQ8A 4XZPA 5LA0A 3VL9A 2BFUS 5EQUA 2QNKA 1RUF3 2G9FA 4GB33 2VQAA 1BLZA 3ZYFA 2WT2A 1DQ5A 4DXTA 3PVOA 2MEV2 5FDBA 2BPA2 5A7PA 1Y4WA 4FAGA 3IPVA 3T0DA 1BK0A 3TN91 1UOFA 2ZGNA 3P3PA 4XETA 5FZ4A 4XUOA 2UYBA 1DLLA 3K2OA 1CESA 1PO21 4MGIE 5I0TA 4KGGA 3VZKA 3DKWA 4YFWA 2V4AA 2SBAA 1F4AA 4AI1A 3D0SA 3CU7A 3M3QA 4KMQA 2WNVA 2DTYA 2H0VA 1J3PA 2K9ZA 5CKNA 1JYVA 1GWKA 2R49A 5FMBA 4GWNA 1Y43B 3TAYA 4EZ4A 4RFRB 1W04A 1MEC3 5FY9A 3I3BA 2VMFA 4M4RA 2ZX0A 3SLIA 1OVPA 5KHKA 1PGL1 4RHV2 3RZLA 3FBMA 5ABJC 5LATA 1FOD3 1GNZA 1T2XA 1W8FA 3V64A 1CD3G 5C3SA 3U4XA 1RMU2 1O6UA 2LM3A 1HB2A 4QU1A 4CU6A 4X6RB 4ASKA 3PIGA 3SC7X 1ND2A 1RVF2 2LW8A 4JKKA 2WBKA 1K12A 3ECQA 4JZRA 3H8RA 5FXVA 5L36A 5LA2A 1DYOA 4BOWA 3MDPA 5HV0A 4YFZA 3KLSA 2XUEA 4E27A 3POGA 3B3QE 5GZEA 4OI1A 2TUNA 2XLAA 4OUSA 4PBOA 3BB6A 1SLCA 4O7XA 2FCTA 3NJZA 2B42B 5FPAA 1WKYA 2RM21 3R05A 5DAXA 1CX4A 2WZEA 3WOGA 4CCJA 2WZR1 1BYHA 1W0PA 3LPFA 5FR3A 3ALQA 4LUKA 5C4WC 3V0AA 2MPFA 1CONA 2BDRA 2UU8A 2W91A 2DFCA 4JC1A 2HWD3 2VZOA 2ZGRA 3OPWA 3LOBA 4OQ9A 4GJZA 4QX5A 3HT1A 3ZFEB 3ZX7A 4HVRA 1LECA 2DV9A 3FLRA 5E6HA 4ARXA 4GJYA 4PLMA 1W8WA 5C8CB 3T09A 3VKMA 1FV3A 3OEAA 3W59A 4NHYA 3HPNA 1QKQA 3QH6A 4AVTA 4XUTA 4NHXA 1PO13 1LHUA 1YJLA 1IKPA 2XQRA 4HK8A 1ASJ2 1U5YA 1ZRIA 3PTYA 4AQSA 3NV3A 1W8ZA 4COZA 5K8SA 1RUJ1 1V9U3 4OZXA 4HN1A 5I0RA 1OQ1A 4XCBA 1ZX5A 3RZJA 3NJXA 2ZGPA 3AKQA 4AEMA 1EV13 2VCAA 2Q5TA 3AX4A 4X8PA 1CVNA 5BNNB 5FTTC 3IMMA 2B45X 3NJYA 3QBQA 4QKDA 2BRTA 1CWPA 2EICA 2P37A 3MICA 4XC9A 4AF9A 3V65A 1GYKA 1PIV1 2XJSA 2ZX1A 5FYIA 3K4DA 1QNYA 3RJ2X 2L9LA 3UYJA 4COWA 1VMJA 4AGRA 3VBOB 3CLPA 4CCEA 2WS92 1RUI1 3MF9A 1COV3 2RMU1 1QJZA 2BV4A 3KZ4C 4C90A 3H3ZA 3HN3A 5G04L 1N1YA 1VAVA 2FMYA 1EP0A 3M8LA 1LAJA 3DYMA 4ITCA 3UK9A 2A6ZA 3USUA 2ZEWA 1DYPA 3N36A 4XACA 4LQRA 3EBRA 3DKQA 2XJVA 2E6VA 2XJTA 5IATA 4CEWA 4TLGA 5IVCA 1OH3A 3AZWA 3IDEA 4LHLA 5EP9A 4QPYA 2Q8DA 3JB8A 3VDCA 3T2QA 2D44A 3POWA 5E16A 1VLNA 1RUD2 5BXXA 4AI2A 3VHNA 2X05A 3USUB 2XL7A 1PK6A 1JOJA 3QOPA 1BVVA 4N7IA 1QQP3 5IJRA 4IEWA 3T2TA 2IVJA 3AYCA 1OOPA 4IEZA 1WBLA 3VB9A 5F3IA 1W99A 2QDRA 2I2SA 4ZXEA 4AWDA 4NHMA 1Y9GA 2O0OA 1FMD1 2CHHA 2PLV3 3USSA 3NKGA 3ACFA 5A33A 1GR3A 4F83A 1ASJ1 4YLZA 1Y3TA 1NX9A 3I2FA 4A6OA 1NQJA 2OPKA 1RUC1 5C9AC 2Y8KA 4ZXKA 2EAKA 1ENXA 2IXKA 4ZPIA 5FYMA 1IG0A 1LEMA 2WS93 5LA1A 3LAGA 1O91A 3ZFGA 2CY6A 1GZTA 1RITA 4H14A 1AX1A 3VUOA 4DB5A 4NPRA 3WDYA 1IPSA 4YVSC 5LW9A 3AFGA 3NNJA 5FO8B 3MPBA 4HPKA 4FPGA 4Y1ZA 4BQXA 2D6PA 1DLCA 3MHZA 4OVEA 5FK7A 1N47A 4DQAA 4W8JA 4KU7A 3POEA 1GOHA 1UZWA 4EJRA 1AR83 1QU0A 3AKPA 4R9DA 4YGBA 3CF6E 1S0FA 4GULA 1NA1C 5JVVA 3PIJA 4CU8A 2UWCA 3E6BA 5JZGA 4FFFA 3SEPA 3RYKA 1AX2A 1OF3A 1KFUL 2XKOA 5FKCA 5AC93 2VOWA 2ZHNA 1DZRA 1DIWA 2GH8A 2XH6A 3LA7A 4CA9A 4QPWA 1D2SA 3OGJA 2E26A 4PI0A 1UQXA 4QM8A 3LZZA 4GH4A 4RS5C 5A6XA 1GP5A 1V6LA 1PIV3 1RHI2 3S7IA 2BVBA 2VBPA 2D6NA 2MEV1 1XNDA 2Q8OA 3S5AA 4L0PA 2HJIA 2QQJA 1I9RA 2W5FA 5FZCA 2VG9A 4Y4RA 3NKTA 4P9GA 3BI3A 1VBD3 3MZHA 3WQ7A 4L99A 3HEIA 5LRRA 5GJ6A 5ERLA 4OHXA 3FX3A 2EVXA 4R9BA 4FXGB 4RHV3 5JR2A 1FNZA 1FX5A 2BOJA 3OUIA 1S0GA 1HW5A 2VZPA 2EALA 4LBJA 3RWNA 3V56A 5DXDA 3OCPA 4A7KA 1AL0G 1CIWA 2YUEA 5L7OA 4FFIA 4P08A 1NCRC 2ADDA 2ADEA 3VBUB 1RVF3 4COYA 3EYPA 1BMV1 2WAOA 1V00A 1MACA 3C3VA 3N7JA 1LTEA 4B4RA 1TZOA 3M3EA 3PTRB 1SG3A 5F39A 1JTZX 3H42B 5LY2A 4AQ6A 4BIOA 4ES9A 2D98A 4LNVA 3I2HA 3ILFA 1FMD3 1Q5OA 1W2OA 3WP3A 5JXGA 1SQ4A 2HWC1 1VRH2 1UF2C 4UBGA 4IE6A 1LOEA 1WLDA 5FZBA 5T50A 4DUWA 5J3UA 3VN4A 5A3PA 5IFPA 4W6YA 3ZMNA 5F2WA 5CIRA 4JTNA 3JZVA 3ZXDA 3MO4A 1H1IA 1A6CA 1PM7A 2ET7A 4MOAA 1YQ8A 4XEZA 3I59B 2XVLA 4LK6A 1G9FA 4M00A 4FPKA 4CXYA 2J1AA 3CZJA 1VBD2 4Q27A 3WF2A 3S7EA 4AYUA 1RUOA 4DMIA 4MV2A 2FHRA 2A75A 1IS3A 4LO5B 5HV4A 1YQ2A 3DN7A 4BHPA 2HWF2 2QJVA 1O5UA 1O3QA 2JE9A 2JIJA 3VBFB 3X29B 4RR3A 1AR81 4LHKA 5IT6A 1QNWA 1RUH2 2QQUA 3T08A 4LKSA 3C7OA 1KDMA 3HBZA 3KWVA 3KV5A 2H6BA 3EHKA 2IFRA 1TMF1 3AKTA 2QQIA 5DABA 1W8OA 2JDMA 3LEKA 4BM8A 3SCFA 5GM0A 5FYHA 4JCKA 3S6PA 1H8TA 1PZ7A 1XYNA 1G6NA 2E63A 4BQWA 4XQ4A 4PDWB 2JG9B 4AI0A 1G9AA 2O1QA 3N7MA 3VD4A 4HT1T 4XXPA 4YZ3A 2RHPA 4AEJA 1HKDA 2BGPA 5T54A 1Z78A 3LSDA 3FC0A 1YWKA 4IGQA 2D6MA 4QKNA 3AZVA 3DCQA 4XFCA 3HOBA 1VBC2 4IEPA 3WEZA 1VBD1 2V72A 4FFGA 2UYAA 2ZMKA 2VOVA 3D8CA 3TNPB 1JH5A 2FDKA 4IE4A 2JDKA 2C4XA 2W08A 3BOWA 1RXFA 2BFUL 3D3AA 3N9OA 1W3XA 2BP6A 2WNUA 5IAVA 1WGPA 2X8KA 1FPN2 5A3MA 4E4ZA 5CAZA 5CFDA 1IZ3A 2XKPA 1G9CA 3W9AA 4DRRA 1WMDA 4GQ7A 1EAH1 2JD4A 2WO1A 1G8WA 4HKWA 4AQ2A 2ZMLA 4BYYA 4YARA 4AL9A 3H1YA 4IDZA 2FZ1A 3KD4A 1F5JA 2WNUB 4W4ZA 3DUIA 5LK7B 1GANA 2I74A 3NNFA 5FZ9A 3GHMA 3M3IA 2XJUA 4NUBA 1DGRN 3CMGA 3NV4A 1VIWB 3WNXA 1RMU1 3O1TA 4XDQA 1H30A 4Y3OA 3AL6A 4P9JA 4G3YC 4LXLA 4UOJA 5IVYA 5B2GB 4OI2A 5FREA 1GWLA 2G1MA 4QB2A 1LB2A 5JIAA 3THTA 3O1VA 4OI4A 2FZ2A 3OGGA 2A3WA 2XOMA 4DS0A 4G4FA 4HSLA 1VBB1 2R073 1OI6A 3GBGA 4QQPA 5K0UB 3RZMA 1GLHA 4YGCA 3WSOA 3WNLA 1XBFA 3EB7A 4Q2FA 2VOKA 3J7LA 5IK7A 1ZREA 3GM8A 3ZSLA 4ES8A 2JKXA 3ACLA 5AVAA 4RN5A 5BNNA 5HCAA 2B9VA 4CDWA 4UFLA 4Y5Z0 2JG8A 1XOYA 1ODMA 3CQOA 2C24A 4Z2AA 1RUI3 3I3MA 3ILRA 3WF1A 2PMWB 1NXMA 5CFCB 1UYXA 4E9KA 5D2AA 4CDUB 4Z92B 2DURA 2D40A 3VL8A 1O59A 4FQZA 2G9ZA 1WWYA 5GLZA 5H9QA 2BBAA 5FRAA 3E6CC 2YG0A 5C4WB 1XPWA 3RQ0A 2HH9A 4CZSA 4LUMA 3R0RA 5DUXA 4CDWB 1W6PA 4LPLA 1RXGA 1NA1B 2EIEA 3IBMA 5FUNA 1HQLA 4YZ4A 3ZFEA 3AC0A 1NCQA 1U5ZA 1W39A 1QIQA 2HEVF 2VZUA 2ZPXA 5FYYA 1ND3A 1WLCA 3VBSA 3SH5A 3LB9A 1HXS2 4FSJA 2K46A 1AR93 1RGSA 3B93A 3C7GA 4K8RB 2WZR2 3ORJA 3RI9A 2FDIA 4Q4W1 2QUOA 1GUIA 2RDQA 4QM9A 2R072 2ZGOA 4EV0A 3GZEA 1N3QA 1KGYA 3MFCA 2CDOA 2RS33 3D6EA 1LOFC 3N9NA 1VPHA 5LY1A 3ETPA 4M0HA 5FZFA 1W6OB 3WHTA 3BTZA 4CDUC 1UY1A 2VTXJ 1PO22 1WW7A 3VBSB 3IT8A 5JOYA 1ND2B 1FPN1 2XL9A 3K3OA 2QTWB 5JOZA 3EJKA 2YC0A 5FMCA 4CDXA 3UL2A 4RQPA 3ZYGA 1HDKA 3KV6A 1DFQA 4KQ7A 4NOTA 1L7LA 2ZEXA 3VBHC 4ARYA 5CFCA 1QH7A 1F8VA 3VBOA 4YSFA 3WDUA 2OA2A 5JOXA 5EYXA 3I8TA 3AKRA 3FN9A 4AHZA 3VKLA 4DY3A 4GB31 1LOAA 4U2AA 2GNTA 4ZS2A 1OT5A 3QCWA 4JHTA 3GALA 1Z7S2 1UXXX 2DUOA 1I3HA 3GXUA 3H1WA 2R1DA 5EPAA 1WMEA 4DPNA 4CDXB 1LGNA 4CXWA 3IKWA 2HEYF 5T5PA 3TN93 4NIHA 2C6SA 3AZYA 1JUHA 2XBO2 4JV4A 4QXHA 2A73B 2LS6A 3IDAA 4OCTA 4XAAA 4DRVA 5IYYA 4LTAA 5DG2A 4UAPA 3WR0A 1HRV2 1ZBA3 3KCXA 2OQ7A 3KGLA 2VW2A 2Y33A 3AYAA 4XJUA 5GLVA 2VUJA 3LEMA 5F6KA 3BOPA 3ZM8A 1ULOA 4IQPA 4HBNA 4JRAA 1W2NA 2ZX4A 1APNA 3FZ3A 3NRUA 2F4PA 3ZXEA 3DYOA 1SMVA 1IOAA 4Z07A 2OUHA 1E5IA 2DTWA 2LTNA 3CBNA 4D6RA 1IPKA 5FYTA 1Q8SA 1W0NA 3GNEA 5C8CA 5KHIA 1MQTC 4Y4YA 2VY0A 3EO6A 1B35A 2ID4A 5CB7A 4CU7A 1OLRA 2MEV3 4KBZA 1NCQB 2X5IC 3RFRA 3ZYPA 2GAUA 5LEJA 3ZXFA 5LZ6A 4BMEA 2TBVA 4AI3A 5F9TA 2ZKNA 3T2OA 2D6KA 3SEEA 3T0AA 5A3TA 1U5IA 1XE8A 5FK8A 5EJ3A 4FCAA 2KD7A 4CCKA 4DZGA 3TNQA 2ZA9A 4Y20A 2D3RA 4JX0A 5AC92 4QB6A 2FD8A 2HWB1 4RHV1 3AK0A 4EYUA 3FMGA 3A21A 1UU5A 5JPMB 4IV3C 2Y6GA 4FQ4A 1S0JA 2RM23 1WW4A 2DU1A 2E33A 5HCFA 3RZZA 1UX7A 5F8PA 3WF0A 2NMOA 3W5NA 1FOD2 4NIGA 2ZGTA 2WZR3 4YW6A 2JDHA 5ACA2 2VCMA 1XNCA 3L2HA 1C28A 1ZBA2 2PHWA 4BA6A 5BNOA 1YXWA 3INAA 4Q4W3 3K75B 4B29A 3GZUC 1PX4A 1W3VA 2R32A 3RVHA 2DVAA 4WV8A 3FL7A 4QMAA 5C3PA 2RS31 4GKYA 1A8DA 1CAWB 1UY2A 1BVP1 3SISA 4ATFA 2OUJA 1BBT3 3M3OA 4NJ4A 3UNPA 2YY1A 1NZIA 2EXIA 2VNOA 1OMIA 1YYNA 4RGGA 1QXRA 1LHWA 2A6YA 5FZ0A 1WA6X 3DV8A 2CGNA 2VUDA 5A80A 1S1AA 5A7QA 5CISA 5F1RA 4BIFA 1BEV1 2A3XA 3ROUA 1WCKA 4Y24A 1OURA 1RUD1 2JDZA 1VAMA 4KGQA 3R4UA 2Y6HA 2IXJA 1XJAA 4MGQA 4RS5B 3BALA 4COUA 1JODA 5I8YA 4YPJA 4LULA 1SBFA 4NVPA 3BCWA 4IXLA 4B3NA 3N9QA 4GWJA 3LKJA 5JWPA 2CAUA 2WKKA 1WBFA 2BNNA 2XVGA 1MEC2 1TG7A 4NIDA 2A70A 3A0KA 2JDYA 2JXAA 2VBDA 3S0MA 4XABA 1JZ4A 5I91A 4KG8A 3SITA 1RUH3 2ZOEB 4JGZA 4IEUA 3A23A 1XQNA 1UOGA 2HWD2 2W1WA 1CZTA 3ZYBA 1ENRA 4Q4V2 3W58A 2QQWA 5ACA3 1VBE2 2XG3A 2J1EA 4GA9A 3MLKA 1NE6A 2WSVA 2EXJA 1CR7A 4D3WA 5FY1A 1X33A 1IKQA 3S5QA 1ZA7A 1R092 4QQLA 3ZIXA 2JG9C 4PF1A 4QPIC 4ASMB 4IGPA 4JGZB 1GV9A 2TEPA 5FYUA 2WAAA 1ZBE1 2V73A 5A70A 3C7HA 3U75A 5FOBB 5HPOA 4MYEA 3VHPA 1TQ5A 4QPGA 5DPNA 4IV3B 1REDA 4TXWA 2NLRA 4XBNA 3VD5A 1CQ9A 4PDWA 1F5FA 1SLIA 1JW6A 4OHYA 3TEZA 1HB1A 4ZONA 1PVC1 4HFSA 5JPNB 3AJZA 5C9AB 2VOTA 2WUHA 1HIXA 3H3UA 4BLIA 4Q4Y2 2P3JA 4C91A 3BN6A 5DZEA 2HWB3 1JYIA 5IUQA 1ST8A 4PQQA 1YLLA 1SLLA 4YW1A 4QPGB 2EIBA 2PQSA 1NY72 2PLV1 4LKDA 2YU1A 1HV1A 4LORA 4N53A 2J1TA 4DUXA 2F4LA 1ASJ3 3IZOA 5FZHA 1V6JA 1CPMA 4OZOA 3VV1A 2YBKA 1QEXA 5LBFA 4BU2A 4MZUA 4TTGA 4RR3B 1AR73 4XJAA 1AR63 1GQPA 2RS11 2XBO3 2ZTNA 5L73A 4CEYA 1DQ4A 5LB6A 1GZ9A 2YPJA 3VDBA 1KS5A 2PHXA 3HQUA 1C8M3 5FZOA 5FXZA 3SNMA 1EUTA 5ABJB 1AUYA 1ZZ8A 4YM0A 3BUCA 5LBEA 3IIIA 1OPMA 4LR4A 3AKSA 2Y38A 2DVFA 3PDQA 4QHZA 4YW3A 3SMHA 1W9WA 5FP4A 1QOSA 4YM1A 3MYXA 3LSEA 2X53S 2RJ2A 4DFSA 5BNQA 4I2OA 1K5MA 4E8CA 4QAWA 5FXXA 5L9BA 4IE5A 2DWRA 1MS9A 4QX7A 2WINB 1YJKA 3LIHA 1JN2P 1TME1 2HWF1 3THPA 1AVBA 5B4NA 3J8F1 2GALA 1B09A 4BDVB 4WZFA 5FZ7A 1LEDA 2PTMA 1SFNA 1UIJA 2VTFA 3CHXA 1O3TA 2DDUA 3ACIA 3HD8B 4R9AA 4Q5OA 5A6ZA 4FTSA 1W6NB 3AMQA 4AXOA 3P1IA 2ZMNA 1MVEA 3VZMA 1MS4A 1KQRA 2R042 1H1AA 3O0WA 3WP5A 3ZMOA 1JHJA 4HLTA 4LBNA 1LCLA 2C5DA 2RJLA 2ZBJA 5DN2A 2Q1ZB 2W94A 3KQRA 1J83A 1S2EA 1PMJX 4FPOB 5F32A 4Y22B 1EAH2 1EPWA 3B9CA 4CP0A 5M0TA 1UU4A 2QE3A 3T1MA 1ZRDA 4RD7A 5A6QA 4XXAA 1N3OA 5E88A 1E5SA 2QVSB 2X10A 3ZSEA 2GMMA 5FPUA 4AGVA 3CJXA 3AMPA 3VBFA 1AX0A 1CAUA 1MQTB 3CZUA 2WNVC 3LQCA 4Q0VA 1Q8QA 2QCSB 4MSVA 3J8F2 2FBEA 2XJPA 3JBG3 2DCTA 4JAAA 3ZXKA 4A7YA 4HXCA 2VJXA 2HLEA 1NAEA 2VXJA 2EA7A 2Z4FA 1MS0A 1ZRCA 5ABJA 3UGHA 3OUHA 1H1MA 2WWJA 4MLOA 4J25A 1LODA 4AZZA 5KC6A 4I0WB 3AL5A 3T0BA 3OG2A 5T55A 3PVNA 2VQTA 2A6XA 3PU8A 1A34A 4U36A 1M06G 4IL7A 4Y22A 1RINA 1QMJA 1R1A3 4R4ZA 2R16A 1QDOA 3ZSMA 2J7MA 2XPJA 2VH9A 2WQZC 1O4ZA 2RR11 3NMBA 2VE1A 4LIVA 4UYBA 2D93A 4FPHA 4V1PA 2JE8A 4XVHA 3I2OA 3BGAA 2BOIA 1NKGA 3MLJA 4MXWB 4P14A 4UW3A 5FMOS 4C8DA 1YRZA 4Z2WA 3IM0A 1UL9A 3VDDB 4XHXA 3D4KA 5FP3A 2GNBA 3UT0A 4AAXA 2P2KA 4Y5TA 1PVXA 5KHGA 2W0XA 4COVA 3OF1A 5F2SA 4V2WA 4R52A 3F2ZA 3M4FA 5A1LA 4LKEA 5JLVA 1G9DA 3HNYM 5IAXA 4D94A 3VBRB 1GZCA 5CFDB 2ZZQA 2B7YA 1TME3 2HBUA 2OT7A 2VUAA 1OQEA 3J8F3 3SKVA 1XB9A 3OY8A 2RMU3 2AYHA 3KSCA 2KR2A 3URFA 4BLJA 2GN7A 1TMF3 5GALA 3GZAA 4H3WA 1SLBA 2JICA 1W9TA 4F8AA 4I30A 2PHDA 1UY3A 1V0AA 3BTAA 3A7QA 4OYUA 2PHTA 2ZGMA 2DUPA 3ETQA 3VZNA 5D8AA 4ZKTB 1S0BA 5CBLA 1HN0A 3ZSKA 5DAQA 2VW0A 3TEYA 1R1ZA 4CP9A 1H0BA 2D97A 1BEV2 5F3EA 2RVAA 4E4SA 3W20A 2FMDA 2VZQA 2DCJA 5FXWA 1ZZ7A 4Z1VA 1H2LA 1H2KA 1QJY2 4Q4V1 2WNVB 4XILA 1WCUA 5A3LA 1QJEA 3RYRA 2EXKA 1QQP1 2VZ1A 4YWAA 3N3HA 5CNAA 1F9KA 3O1UA 3OSDA 4D8MA 1W6MA 4Q4X1 1LOBA 3KCCA 4UF0A 2IWGB 4Q1PA 1QOOA 3NNMA 3MV01 1TNRA 2KM2A 5HBAA 4I02A 3ZKUA 3ZN6B 1SACA 3ILNA 2O8QA 2WQ4A 3FWEA 4SBVA 3UV9A 2P3KA 5IK4A 1A8MA 1UX6A 2CV6A 2JENA 5CG8A 2ZAAA 1DQ6A 3U4SA 3Q8AA 1VALA 5TSWA 2QZ3A 3ZFFC 1EV12 4MGKE 4J6GA 3UKVA 4CEWC 3BTXA 1TMF2 5D8AB 1OA2A 1OLME 3AP9A 1AR92 4NIAA 1RUE1 2WABA 5HCBA 1BBT1 2BNOA 3ZVXA 1SBDA 4NRPA 3IDCB 1SLAA 2UURA 1RMU3 3ZLIA 4K7JA 3I54A 3A4UA 4XW3A 1R1A1 1X9PA 1BEV3 1J1TA 2XONA 2Q8EA 2E7AA 4XMAA 2PHFA 3ZKYA 4X8NA 3R6SA 1RUNA 4LA2A 4FPCA 4W50A 3JUUA 4XFBA 3ZPYA 1VBB3 2ILMA 2R071 1IQAA 4AVAA 2UY9A 1UN1A 2WT1A 4MGYE 4PBPA 4KL1A 2Q1MA 4GKXA 4BQ5A 4UFJA 1C57A 2HWB2 3CJIC 3JQWA 2Y0OA 2VZ3A 4UF0B 3AMMA 5CYYA 5F3CA 2XLGA 3LFIA 3ZO0B 5K4LA 1W6OA 5EIYB 1FNYA 1V6KA 4P9XA 2PAEA 4GZ9A 3KT4A 3B9IA 4EZHA 4M3CA 1JZ5A 3I7DA 4QWNA 5EWSA 3ZFGC 3WNKA 1JYXA 5FYCA 4AEDA 1PNFA 4YVSA 3MIBA 4RA0A 2VVEA 3MI8A 5A3UA 1RUF2 2IZWA 2PQQA 1BZWA 2W1SA 1XNBA 2WRAA 1YI7A 4GB32 2JJ6A 4Q1RA 4RYDA 3C8XA 1PMHX 1XNTA 4GD4A 4QX0A 3W21A 3GF6A 4ZY9A 1D0HA 4OULA 1QOTA 4AW7A 4LHNA 1IS6A 2R063 5FY5A 4CU9A 1HQNA 1VBE1 4JKLA 1JUIA 5J09A 4PI2A 5I0SA 2VNGA 3RI8A 2W9XA 5FZAA 1NA1A 4QX1A 2P5BA 3KS7A 3ITQA 2VAUA 3WF3A 5JZGC 5DZFA 4FTEA 2ZX2A 2YMZA 3RNSA 2GH2A 3B02A 3P3NA 5FYBA 1JS9A 1JYWA 2KXLA 1OLQA 2ES3A 3PJQA 3G6JB 3DEMA 4OMDA 4RFT0 4UW4A 1EPZA 4Q4V3 5FQ0B 4F3JA 2Y6JA 5F5IA 1SHWB 2WA4A 4EWAA 2AENA 5C3OA 5G05L 2AR6A 3DXTA 4RS5A 2DU0A 4META 4YG3A 1IS4A 3U10A 1REEA 3UETA 4ASLA 2Y34A 2NP0A 1CJPA 3N9LA 4YW2A 3AM2A 3EMRA 1JU4A 2D43A 3I2KA 1ZZBA 1C4RA 2HWC3 4A7ZA 1HRI3 1UOJA 4YVWC 1HV0A 4YGDA 5IVEA 3O12A 1PM4A 4P5YA 3KVAA 4GMP0 1POV3 4P5HA 4AOCA 3DGTA 1UZVA 2W95A 1SZBA 4MGTA 1AXZA 5CU1A 4K9SA 4P02B 1PGL2 2CTVA 1ULCA 4L2NA 1JHNA 1V6NA 4WM7A 1OBNA 2RR12 1FAYA 1RL3A 2W87A 4N90A 3TOJA 2YDEA 4YW4A 3WDTA 4XTPA 1J1LA 2D5HA 1BBT2 2ORXA 3RGBA 5L7OC 3CEWA 4GXLA 2R30A 2R062 1UXZA 3R4SA 4QHBA 3ZR5A 1CAXA 2P17A 3H9AA 2GC0A 1RTVA 3C7FA 4LHSA 2UWBA 4FPEA 3M3CA 4QGLA 2PHRA 3H0OA 5JI7A 1L3JA 4XFFA 4BXFA 2DCYA 5BY5A 2ZACA 1UYYA 1A78A 3O7OA 2AC1A 4N43C 3RMYA 2R0HA 4BH9A 2ZJCA 2JDPA 1Y9QA 2OZJA 2QQOA 3DPRB 5A32A 1OOPB 1AR82 1UU6A 1QJX1 4GWIA 4AR2A 3FLPA 4BPZA 1H4GA 2J1SA 4QHOA 5EV7A 5FZEA 5IFTA 1IS5A 1NCRB 2RDSA 4XHBA 3VBUC 1RC6A 2WL1A 3ON7A 3TBDA 3CDZB 4DXSA 5A33B 1RIRA 3BPSA 3WDWA 2D5FA 3HQXA 1H8TB 2ARCA 4IW3A 5CG9A 4LITA 3THDA 1OF4A 5FZGA 3WD5A 3CKHA 5IW0A 1DDLA 1QJY1 2BU9A 4ISQA 4CSWA 1QH6A 2XHNA 4A42A 3U78A 1GBGA 3KM5A 2CWSA 2A5ZA 2JB4A 1H2MA 1PNGA 2XUMA 3UJOA 3WNNA 4NR1A 1DZQA 2RS51 1UOBA 3ATGA 1OPOA 5A3OA 2WDBA 3WXPA 4AEKA 1VBE3 1XXNA 3J7MA 1C3HA 2P34A 3O1RA 2WFPA 4A3XA 2CGPA 3I4IA 3OUJA 4PHZA 4Z8BA 1WZXA 5BNPA 1ENSA 1EYBA 3I2JA 5I0DA 4FO9A 4QB1A 3IAQA 2CNAA 1Z7S1 1BMV2 1QWRA 3I2DA 4HL0A 1I5PA 1C1FA 3WNOA 1HN1A 1PMIA 1MS8A 3IIAA 4AVSA 3AB0A 1C1LA 4ZU4A 2JECA 2Q4SA 2WZPP 4D69A 5LEKA 1UPIA 5FPZA 3N7KA 5FZ1A 3G7DA 1GFF2 4IUGA 3WV6A 1NQDA 2GMPA 3KV4A 1MS5A 5HXMA 4R8HA 3LE0A 4YGEA 3WY6A 4CYDA 4D0QA 5JAXA 2Y26A 2E31A 3NL1A 4BK4A 4QXKA 1LGCA 5L9VA 5LWBA 1RJ8A 1JU3A 2VVDA 5JXJA 2GU9A 1VRH1 2BWAA 3K46A 5KXCA 2VL4A 2BNMA 1GZWB 2CAVA 2WFF3 3AMHA 5E8AA 4NHLA 3TYJA 2VZSA 2ZKLA 2VZRA 4OUMA 2VECA 3MIHA 5H9PA 3WW4A 1GMMA 1Q8PA 1W9SA 2QKDA 2WNUC 4FPJA 1E5HA 1BCXA 1N1VA 4MHUA 1AF9A 1UYZA 3KHBA 1RHI1 3LIGA 4Q4W2 3WZ1A 1IPJA 4MXWA 4YG6A 2A6VA 1K42A 3WNPA 1ONAA 3JBG2 4KBBA 1X36A 3OD4A 4M4PA 1LU1A 2FCVA 4AAPA 4AFCA 4XJZA 1YI9A 1QJU2 4CDQB 3I3DA 3I2IA 4TSVA 4WVZA 3WG4A 1YFXA 3E5XA 4I3PA 4JTOA 4XE9A 4AHXA 1IQDC 1LOGA 4QGNA 5T3NA 4OHZA 2VMCA 2JB8A 3NV1A 5JCTA 5JI9A 2FDGA 5C3RA 2D3PA 3I2GA 1LESA 1RUC2 2XHKA 4N9IA 3H3LA 5CVRA 5FYSA 4LBOA 4SLIA 1UAIA 4NIIA 2O8OA 4CP9B 4YW7A 4I09A 3ENRA 5BNOB 1JYTA 1GZWA 1QJY3 2JDNA 4QXBA 2BGCA 1KXGA 4LMFA 5FJHA 1JI6A 5FP8A 2BERA 3U14A 4EWDA 1KITA 3TWIA 4CCDA 3WT3A 2TNFA 1UMIA 3LA3A 3KHCA 2WWUA 2RDNA 2ZABA 1W9YA 3HVDA 1G86A 3ES4A 1DHKB 1VBB2 3K51A 4FI9A 3J4UH 1GNYA 5GLUA 3WG2A 4AVCA 1SLTA 2AH2A 2RG4A 1CN1A 4NPMA 2PAKA 4CDWC 4Q4X3 5FO9B 5J37A 4OMCA 3BU0A 5BPXA 1Q8OA 1RUE2 1HXS1 2K2SA 4N53B 1KEXA 3I3EA 2AUYA 5F6LB 1DQ1A 4FOYA 5JZGB 1W8HA 1ZNPA 2C0ZA 4K6BA 5EFUA 3ZXAC 4JDNA 3GJBA 3SCHA 3VBHB 2DBNA 2VO5A 3NAPB 2CSGA 2CWMA 3A22A 1WD3A 3E5QA 3QH7A 3SHRA 2RS13 2XBO1 2BUKA 4EWEA 2GMEA 2P3IA 5DQ0A 1S0DA 2WYFA 1VB2A 4AGGA 1C8M1 4CCOA 5CA6A 1OUSA 4MHRA 3H7JA 3POBA 1ZZ6A 1XE0A 1ULDA 4E4HA 4F7ZA 4Q8LA 2WZ8A 4YZ5A 1NE4A 5JMCA 2PHUA 1ND3C 2NPIA 5CKQA 2GNDA 4ZZ5A 3F95A 2VNRA 1VRBA 4JGYB 5C3QA 4TN7A 5KWRA 3HAGA 2LALA 2WFF1 5DUUA 2FQPA 2RS12 3NSTA 1Y7BA 3WDXA 5IHRA 5FY7A 4JDOA 2OIIA 2RMU2 2Z2SB 5HI0A 3WINE 3LFMA 3WCSA 2ZHMA 4CDQC 5AFBA 4HKOA 3VD9A 4XPVA 4XOGA 1LOFA 2ZGSA 1NLSA 4BQ4A 1KD7A 3ZPOA 1SDWA 3MUZ1 5C71A 3ST7A 3OTFA 1W8NA 4HOOA 2IXHA 5C7GA 1NLRA 4XFGA 1PO12 4Q4Y1 4AI8A 2OVUA 1HRI2 1QJU1 1ZYBA 1QGLA 3VBHA 4EN0A 3OPTA 4NMIA 4EN6B 5CFCC 1S2KA 3RZGA 1DP0A 5E89A 3WQ0A 1QY4A 1B35B 4M0NA 2HWE1 2Y60A 2MNGA 5T52A 1CIYA 2JWPA 5K0UA 5JMOA 1SPPA 1VE0A 5KHJA 1WCQA 2HBTA 2PYTA 3GYDA 3QLQA 1YFWA 5CKMA 1RJ7A 1TE1B 4EQVA 1UPSA 1ZM1A 3DPRC 4JQRA 3GHNA 3IN9A 5IVVA 2VBBA 1JZ6A 2XR4A 3T4HB 2R061 4BB3A 4NAMA 2ZXQA 1REFA 5LA9A 1ZRFA 2WNOA 3RJRA 4QKBA 1AXYA 2JE7A 2WC2A 4IE7A 3GBFA 3I49A 1DGWA 4LBKA 2QQVA 4GMP1 4ONUA 5CEHA 3NAPA 2GNMA 3PUSA 3GJAA 1YC61 3JBG1 4A44A 1PZ8A 2WO2A 2X5IB 3VBRC 5FQ0A 5HCHA 1DF0A 3AP5A 4Y26A 3FLTA 3N4MA 1XU1A 3BPZA 4NRMA 1UZ0A 1UYPA 2HYXA 5C8CC 2QDNA 1W6QA 2JIGA 4B4PA 3OYWA 4LEJA 2X5IA 3NQHA 1HXS3 3PNAA 1GOFA 2YGMA 4GWMA 2YZ4A 4L9BA 4LBLA 5SV5A 1RB8G 1HRI1 4JGYA 5FPVA 2YBSA 4OHVA 4WM8A 1AYM3 1JZ3A 1JYNA 2K0GA 4YNIA 4IV1A 4LO8A 4I0BA 2OXBA 4B1MA 4IEOA 1MVQA 4HZFA 2RR13 1AYN3 2N7GA 1GKBA 4Y1UA 1JZ7A 2XB6C 2JKBA 1HLCA 4B8EA 1WCSA 5H9SA 3ACGA 1E5RA 4QDRA 2P4EA 3VDDA 1KRIA 3K48A 4YW5A 5F5AA 2W46A 4Y1VA 4D7TA 1T6BX 2HYKA 5FP7A 3CNAA 2UWAA 4H7LA 1KDKA 5FPBA 2VZVA 1DBNA 4PLOA 5GLTA 1UY0A 2YYOA 3O0XA 4YZ2A 5BNOC 5IVBA 2HWC2 4YYOA 1NZCA 4IEXA 4J1WA 1W8UA 2ZGLA 3AZZA 3N35A 4N43B 4XFIA 1HB3A 3M70A 4XMIA 1C5IA 5FMDA 1XYOA 4E2GA 3WW2A 3MIEA 3POYA 5ACA1 4FOVA 3UJQA 4OI0A 5EJZB 4GIQA 2JDUA 1SPPB 5K7PA 2G19A 4BK5A 4ATEA 4DNYA 1K45A 4PCRA 5T5OA 1DU3D 1MPXA 2W39A 2QQNA 2DBIA 2RS52 1O4YA 1H8VA 1W6QB 1EUUA 2J42A 4DINB 3S57A 1ULEA 4M01A 1OC1A 2PELA 3MIDA 4YM3A 3MUY1 3VHOA 1OA3A 1W6PB 2WLQA 5FZMA 5EYYA 3O1SA 1QJU3 3DL3A 3PLQA 4ORFA 4PLNA 1XU2A 4Y5SA 3OBAA 1J59A 3P5BA 3AFKA 4IV1B 1ND3B 1BK1A 1XNAA 3WCRA 1GU3A 5JSRA 2RS53 4MGZE 1YFUA 5FBJA 1UCXA 4AQTA 3MW3A 2GC1A 1JYCA 1NLQA 3HNMA 4NE9A 3C7EA 4AHWA 4BE3A 3I3QA 5KR7A 4L11A 2NN8A 2QZ2A 3OYWB 4IEYA 2VMGA 2Q1FA 4M3CB 4Y1YA 1YQCA 2XJQA 1AZDA 1US3A 2YFUA 2OYZA 3HIFA 2R7EB 4LLOA 3JQXA 3J9SA 1W28A 1NOVA 1W2UA 1W90A 1F35A 1O4TA 2XLFA 5GZFA 4CUCA 2LUWA 1CAXB 2DYCA 2EIDA 5I93A 5F37A 1AR61 2QQKA 2A6WA 3RPQA 4AG4A 4CXXA 3RSJA 3H7YA 4K3UA 4X6QB 4XDOA 2ZCWA 4URAA 3JD71 3D0JA 1RUF1 1GP6A 2B5HA 1ND2C 2AEYA 1ZVFA 4B7EA 2VC9A 3AP4A 2GC3A 4JRLA 2GC2A 4KWKA 3PL0A 5BUVA 1H9PA 1U12A 2I45A 3NVCA 1U0AA 4BQ1A 2ORZA 4Q0UA 4QT6A 3FHQA 1J84A 1KJRA 2VXRA 4ISRA 1X50A 1UKGA 2J22A 2AACA 2HWE2 1D2QA 2HWF3 1K5MB 1MZ6A 3H50A 4IE0A 2GN3A 1O8SA 4UXAA 1W8TA 2ZGUA 4W6XA 3ZFGB 3VLBB 4TZDA 4QKFA 3VGIA 5C4WA 2FDHA 1FI2A 1PIV2 1RHI3 1US2A 5FZLA 5FZDA 4PQ9A 4WVWA 5KXBA 4LOTA 1AJOA 1VB4A 1YQ5A 4FAHA 2YHJA 1X8EA 2YROA 1QDCA 1POQA 2YU2A 3SXWA 3ZIWA 5DMYA 3KCYA 2DUQA 4QX3A 4LO4B 4EN7B 1O8PA 2OX0A 3VKOA 2IC1A 1T6GC 4CEYC 5J98B 3ZYIB 3CIHA 2VW1A 2EAAA 1F4HA 3JU9A 3ME2A 3AXDA 4OLLA 1YIFA 5D1IA 4FPLA 3HWJA 5J1XA 3MPPG 4LO7A 4XF4A 3M2MA 2WFF2 2WA3A 4A2UA 4H55A 4Q0QA 2G9GA 3PURA 1GNHA 3BYWA 4A3ZA 1I5ZA 4TWTA 4UWDA 5HXVA 1W2TA 4XAEA 3HQRA 1NYWA 1K5MC 1R64A 1MZEA 3B94A 4MO3M 4A41A 2GP5A 3NV2A 4KU8A 1BHGA 4PIZA 4HMZA 2EXHA 2XJRA 2WT0A 4FP2A 4D7SA 1AHSA 2CYFA 3RZKA 4XF0A 4JHZA 4NWVA 1ZRRA 5JUVA 1AR62 3PUHA 1CPNA 1LENA 3V0BB 1BKZA 3FJSA 4XCAA 5FLHA 4DEVA 1GQHA 1G9BA 4KWLA 3THCA 2GP3A 1FMD2 4UW6A 3POJA 3TEWA 5FZIA 1CAVA 5FY4A 2Q0AA 4IGOA 1O3RA 1YUDA 2PAMA 5FLJA 5A7NA 2MHFA 2IFWA 4HG6B 3WLUA 2FDFA 3VKFC 2IVIB 4FOQA 1GICA 1D4M3 3BTYA 4LA3A 4HANA 4MADA 1QXPA 2WNEA 4S2GA 1LRHA 1FT9A 4MG2A 5F5QA 5FJKA 1LR5A 1L7RA 4HSJA 1POV1 1V6IA 5BYNA 4WZCA 5APAA 1V9U1 5KBFA 3WUDA 4H7MA 3IMNA 2E7TA 2IXIA 4XIKA 3LEIA 3MEPA 3VBFC 4CCMA 5LBCA 4IEVA 5IVJA 1FATA 2D3SA 4HK9A 3ZOIA 2W3JA 4C0HA 5DAWA 1PK6C 3IWZA 5EHDA 4NROA 3S30A 4E8DA 5KC5A 4AFAA 3VZJA 3GCWA 1CZSA 1PHMA 2ZHLA 4RSUA 1EY2A 2ZS6B 4DO0A 1OOPC 1YCIA 4EN8B 1PZ9A 4XJ9A 3AYEA 4XUPA 1OHFA 4LE3A 4YVSB 2QQMA 3ZR6A 2RE9A 5J48A 4FTBA 2VNVA 1NUKA 2W52A 1W2AX 1I1EA 2P3YA 1COV1 3DF0A 3O5SA 3WF4A 2DVDA 5FY8A 5CADA 4DIQA 5C9AA 2I07B 3SH3A 2CL2A 2X29A 5LBBA 4L92A 3J7NA 3TN92 1QJX3 1R081 1SEFA 4UW5A 2EF6A 4E2QA 4M3CE 4QD2A 3AXEA 5K9YA 1RUJ2 4CCLA 1HRV3 2D7FA 2P6HA 3KMHA 2ZAHA 1OQDA 5JSPA 3AP7A 1L7QA 1SDDB 3E5UA 2WR9A 3SH4A 4UT5A 4I0AA 3C2UA 2ZZJA 2V5YA 3BU7A 1RYYA 1N1TA 3APBA 3KF3A 4XF1A 2W2IA 3JCIA 2NM1A 2R043 5D21A 3T4VA 1OKQA 2NYYA 3I59A 4S2HA 4B7KA 5IK8A 1C8M2 1CAVB 1QJX2 2Y6FA 3KB5A 5T5JA 3ZDSA 5GZDA 1HJFA 2XWJB 1G7YA 1UZYA 5C70A 4YG0A 1I6XA 3KT1A 4Q4X2 2YV8A 1OVSA 2PN5A 5A3NA 1MS3A 4CCCA 1F2NA 4LIUA 3KQ4B 3VD7A 2AZ5A 1JOPA 4KH9A 4XBQA 5AVPA 2H0BA 2WO3A 1RUC3 3PJYA 1W6MB 4I01A 5A3WA 2O14A 4GAZA 3A0NA 1OD5A 3LOIA 1MZ5A 4GH4C 5EZWA 1Z7S3 2VULA 2NMNA 4V2VA 3BKZA 2RJKA 5ANQA 5C5UA 2Z5WA 3MF6A 3ZN6A 1BQPA 3OJBA 5KXEA 5D8AC 2Y6KA 4KI5M 1FV2A 3QACA 4PIXA 2ARAA 5JR7B 1V70A 3OEBA 2ET1A 2IXLA 4UBHA 2ZEYA 2VMHA 3QD6A 2VQUA 1RUE3 3FHIB 1COV2 3O1MA 2V09A 3IDBB 5CZKA 4ZS3A 4D6SA 1LHNA 1V6MA 4I3GA 4K1ZA 3L2YA 1AYM1 4FT8A 3LDKA 4ZU5A 2OW4A 3WG1A 1RUG1 1BXHA 2DFBA 4YRDA 4Q8KA 2PA7A 1PGW1 4LKFA 1WA4A 5JXIA 3O0VA 1AYN1 4HN0A 4A4AA 1LNSA 5AC91 4GALA 2CU5A 4O65A 1NCRA 1VR3A 2ARXA 1W05A 3OGRA 5FAXA 5FIXA 4UFMA 4N9HA 2AEZA 3GBWA 4YZ1A 2DCZA 3NWKA 4UFIA 4QPIB 2VGDA 4CRQA 5FP9A 1SFYA 1HX6A 3ASIA 3ACHA 3TEXA 1CAUB 4B1LA 5DDJ1 4BCUA 5FV3A 5DUWA 3ZFFA 4AVBA 1F15A 3UKNA 4BWOA 3WG3A 2WIIB 1OUXA 4K1YA 4CP2A 3HN1A 3WVJA 3K3NA 1VJ2A 2EIGA 4A45A 2FCUA 1ALYA 1LHOA 3FE5A 5FPXA 1WCDJ 2Z69A 2AGSA 4MXVA 1R083 3RYPA 4WVVA 3O1PA 1OH4A 4QQHA 5FMOL 4BZ4A 3U07A 5BNPB 1SCSA 3POIA 3HMYA 4PJYA 1HRV1 2VZTA 2ERFA 2QQLA 1LOCA 5J7MA 1J3QA 3H1MA 3KT7A 2F6BA 4P9IA 2QQPA 1X9TA 1WLWA 3FFQA 2WLPA 2B9UA 3WQ1A 4C1WA 4RR3C 2E9QA 3AZXA 3VD3A 1FYUA 3CO2A 1S0IA 3PUAA 1GP4A 3SCGA 4CUBA 3CJIA 3UESA 2H6CA 1XSQA 3PUQA 3Q8BA 4R9CA 2FDJA 4CVUA 1NG0A 2BZDA 5FPLA 5A1FA 4BISA 5C6CA 3E97A 2R1BA 1TEIA 4P9YA 1O7FA 1DQ0A 4AEDC 1WW6A 5A7OA 3O1OA 5A7SA 3B01A 3ZXJA 2HKXA 5EXOA 1H8TC 5E1RA 1STMA 1Q56A 4Q29A 3LEGA 1K3IA 2VU9A 4S2DA 3VHRA 2XGXA 4OQ8A 2YC2A 2BYVE 3CJIB 1JZ2A 1UWWA 1UNBA 2WN2A 3LCPA 4IEQA 5DAPA 1GWMA 3FBYA 2XWBB 3FFZA 1ZZ9A 2YXSA 3JD73 5I8SA 5H9RA 4JKMA 4ZU7A 2PFWA 3AP6A 3FHAA 1EV11 2IXCA 1ULPA 1WUVA 5FUIA 3VDAA 1VBA1 5BV6A 1PVC2 3PHMA 3M1HA 3ZDVA 5KXDA 5F5CA 4WM7B 3U11A 1VBA2 3NJVA 4AFDA 4ZHNA 5GLWA 2VR4A 4UI9L 1AYM2 3IB3A 1MS1A 2J1VA 4CE8A 3ZFFB 1RUG3 2KA3A 2PLV2 1AR72 4KWJA 4NWWA 1KFXL 3WX5A 5L19A 3Q9OA 4PT6A 5CFDC 5GKAC 3VZLA 2VPVA 4XUQA 5DZGA 3RS6A 2HEWF 3V0AB 1H6XA 4XJ8A 1SBEA 4Q26A 4CP1A 3ES1A 2SLIA 4QX8A 4YVWA 2P1BA 4R4XA 2Z42A 1XC6A 2Q8CA 5EJ1B 5A32B 1IGOA 3MV11 1YEWA 3DYPA 3MGUA 4FPYA 4Q4Y3 2F17A 1R093 3OBZA 1DGRA 1UKRA 2B39A 2LRPA 1D0GA 3KF5A 5FZ6A 3GGLA 2XXZA 3KVBA 5A7WA 4ET7A 1AL21 4N8MA 4CUGA 1ZA4A 1X7NA 4WM7C 2RDRA 1UO9A 1R1A2 3K4ZA 5LCWL 3GCXA 4YVWB 1OFNA 2BQPA 3NW4A 1WMFA 3RDIA 4Y20B 4Z82A 4Y33A 2DVGA 1F31A 3T3YA 2YFZA 4H2AA 4D7YA 4LBQD 1DYKA 3OGSA 4Q0SA 1WD4A 1H2NA 3MBWA 1E57A 4XZUG 1QXJA 1MR5A 3B69A 4P9WA 3E1F1 2BGOA 1NT0A 2A3YA 2VCBA 3AVSA 5ANNA 4QGMA 4GMP3 4N43A 4LBMA 1UZZA 4Y1XA 3U1XA 4AEDB 1YHFA 2WS91 5BNNC 1C8NA 4KG0A 3UGGA 1J58A 3P6BA 2VOXA 4INDA 1LHVA 2YB7A 5F3GA 3U37A 4LT5A 1R082 2JG8C 2WJSA 2ZHKA 1W9FA 2B8MA 3VBUA 5JIUA 3NO8A 2QFEA 2Z79A 1N3PA 2RV9A 4NO4A 1CGPA 2IUWA 1D4M2 2PXJA 3N9PA 1LU2A 4RGAA 5FZKA 5F7UA 5GZCA 1VP6A 4UFHA 2CGOA 4K8FA 1D4M1 3J7HA 1OXCA 3IPVB 4LE4A 4MUVA 4MH0E 4FFHA 4AI9A 4N7UA 3WHUA 1VRH3 3BIEA 1PO23 1OKOA 2R0FA 1AYN2 2E7QA 3ZFEC 1Q8VA 2W68A 1NCQC 2DCKA 5IVFA 3ZSJA 3T2PA 4HONA 1JBCA 2ZGQA 3VBSC 3H8XA 2A7AA 1DQ2A 1U5XA 2YC4A 4CEYB 1TNFA 1W0OA 4XF9A 5DUVA 2VMDA 1VBA3 5BNPC 2Y6LA 3O14A 3TRSB 3RG0A 5FOJB 3OBTA 1WLTA 2R6QA 1DGLA 1OLMA 2E51A 4IETA 4CPBD 1UIKA 3N7LA 1J3RA 1QQP2 4DXZA 3H8OA 4NHKA 5IWFA 3ZN4A 4A6SA 5JOWA 3POFA 4FVVA 4Q0PA 3BVCA 3PVBB 4CDUA 4XQWA 3B7MA 1Q43A 1XRUA 1CX1A 4NRQA 2BTVC 2WWSA 3WP4A 3WP6A 2OPWA 2RM22 4CDXC 4RQPC 4LO6B 4LBQA 3JXSA 4AHYA 2OS2A 3MW2A 5J96B 4PIYA 3VBOC 4CCNA 3U0ZA 3PU3A 2GZWA 2W1UA 4OFGA 4QDSA 1ULFA 1CAWA 1O5LA 3Q8CA 1R091 1GOGA 4CUAA 1P8JA 1W03A 2BWCA 4D6QA 1AL23 4E4DX 1LKNA 5L7OB 1RVF1 2BW8A 3FUQA 3LA2A 1AR91 3D5OA 4HETA 4IESA 4NN0A 1Y9MA 2R041 4LJHA 4ZZ8A 4J1XA 2J1RA 2UY8A 1DGWX
chains in the Genus database with same CATH topology
3HNYM 4OUEA 4MOAA 1JZ8A 3MUY1 3SKVA 2J1AA 3CZJA 3WF2A 2E32A 3OBAA 2VMEA 4QX2A 5A1AA 1XNAA 1YQ2A 1W9TA 1UY3A 3A7QA 1GU3A 4OYUA 1OD3A 3HNMA 3C7EA 3T08A 4LKSA 3C7OA 2RVAA 2YFUA 1US3A 2VZQA 2R7EB 2DCJA 1H6YA 2QQIA 1W8OA 4DUVA 3LEKA 2VM9A 3NNGA 4CUCA 2C26A 1UMHA 2EIDA 2VZ1A 2QQKA 4P00B 4AG4A 4D8MA 3VD4A 2BGPA 2VC9A 2W92A 3MV01 3SKJE 3HOBA 3HJRA 3WEZA 2ORZA 2V72A 3FHQA 1J84A 3OGVA 2C4XA 2J22A 3D3AA 5B4XA 3PUIA 1O8SA 3WQBA 1D7PM 2WABA 3LPGA 1US2A 2WN3A 2V5DA 2WO1A 2XQXA 3K77A 5DMYA 2XONA 4QX3A 1O8PA 2W1QA 4W4ZA 3CIHA 1F4HA 4W50A 5J1XA 3CMGA 3IAPA 2ZEZA 4UOJA 4A3ZA 2VZ3A 5CYYA 5EIYB 4QB2A 1R64A 2J1UA 4MO3M 4GZ9A 4A41A 1JZ5A 1TVGA 1BHGA 3WNKA 2XOMA 1JYXA 4BJ0A 4JHZA 5JUVA 3WSOA 3WNLA 3PUHA 2W1SA 3EB7A 4RYDA 4DEVA 3C8XA 3K4AA 3THCA 1PMHX 1XNTA 4QX0A 3GM8A 2JKXA 4ZY9A 4BXSV 4RN5A 4CU9A 4JKLA 4XURA 2X09A 2B9VA 2W9XA 4QX1A 3GDBA 3CQOA 3WF3A 4HG6B 4Z2AA 2VCCA 2QBXA 3WF1A 1JYWA 4MADA 1UYXA 2JDAA 4OMDA 3OB8A 1L7RA 2Y6JA 1O59A 1SHWB 2BBAA 2JD9A 5G05L 2YG0A 1XPWA 4LPLA 3UETA 2EIEA 1PX3A 4QDQA 2C9KA 3AC0A 3LEIA 2VZUA 1JU4A 3I2KA 4E8DA 2W3JA 4DXRA 1UY4A 3C7GA 4P5YA 1CZSA 3W5MA 1GUIA 2WYSA 2W95A 4XUPA 4XUNA 1CZVA 2QQMA 4P02B 2CDPA 1KGYA 1NUKA 2CDOA 3WF4A 3ETPA 2W47A 2W87A 3I97A 4MGSA 1UY1A 2ORXA 5JXGA 3ABZA 1UXZA 2OKXA 2ZEXA 3C7FA 2Y64A 4KWUA 4ARYA 4LHSA 3HNBM 1L7QA 5JXHA 1SDDB 3FN9A 3WNMA 1UYYA 1RYYA 1OT5A 2QQOA 1UXXX 3GXUA 2V4VA 3DECA 4GWIA 2J1SA 5IFTA 4DEQA 3CDZB 4DXSA 2B4KA 5C70A 2LS6A 2WQ8A 3IDAA 5IYYA 5LA0A 4UAPA 3THDA 1OF4A 3VD7A 3CKHA 2WO3A 2XHNA 3ZM8A 1ULOA 4A42A 4DXTA 3WNNA 3NRUA 3DYOA 3T0DA 4XUOA 1W0NA 2WDBA 2Y6KA 4KI5M 2ID4A 4CU7A 1F4AA 3OEBA 4KMQA 2ZEYA 2VQUA 3I2JA 1JYVA 3T2OA 5I0DA 3SEEA 3T0AA 4QB1A 3IAQA 5CZKA 2KD7A 1I5PA 3WNOA 3I3BA 2VMFA 1HN1A 4M4RA 4JX0A 1T2XA 4QB6A 3A21A 5JXIA 4IUGA 1LNSA 4A4AA 4CU6A 2Y6GA 5HXMA 3LE0A 3OGRA 2LW8A 4JKKA 2E33A 3WF0A 4D0QA 1UX7A 1K12A 2E31A 2WBKA 3ECQA 4BK4A 3W5NA 1JU3A 5LA2A 1DYOA 5JXJA 3K46A 2VL4A 3ACHA 3K75B 2VZSA 1PX4A 2VZRA 3FL7A 1GMMA 1W9SA 1UY2A 1WKYA 3UNPA 1UYZA 2WZEA 3LPFA 4A45A 1K42A 3WNPA 1OH4A 2W91A 4M4PA 2VZOA 2Y6HA 2VZTA 4MGQA 3I3DA 2QQLA 3I2IA 4YPJA 4GWJA 4ARXA 1IQDC 2VMCA 3T09A 1TG7A 3OEAA 3VD3A 3HPNA 3I2GA 1JZ4A 4XUTA 4CUBA 3UESA 3A23A 2W1WA 1CZTA 4CVUA 2BZDA 3NJXA 2J1EA 2VCAA 1JI6A 2BERA 1UMIA 3LEGA 1K3IA 2EICA 4PF1A 2YC2A 1JZ2A 2WAAA 1UWWA 4FI9A 3C7HA 1GNYA 2WN2A 3K4DA 2L9LA 5HPOA 5DPNA 4JKMA 4OMCA 3FHAA 4TXWA 3HN3A 3VD5A 1KEXA 1ULPA 3I3EA 5G04L 5FUIA 3VDAA 3DYMA 2ZEWA 3NJVA 2VO5A 4LQRA 2VOTA 3A22A 2WUHA 2VR4A 4UI9L 3IB3A 2J1VA 5DQ0A 3BN6A 4PQQA 2EIBA 2PQSA 4PT6A 2J1TA 4XUQA 3VDCA 3T2QA 4DUXA 1H6XA 2WZ8A 4OZOA 2X05A 4ZZ5A 4TTGA 5IJRA 1XC6A 5EJ1B 1GQPA 3MV11 5IHRA 3VDBA 3DYPA 1W99A 4ZXEA 1EUTA 3GGLA 3ACFA 4ET7A 3IIIA 3VD9A 1NX9A 3I2FA 4A6OA 1W9WA 2Y8KA 3K4ZA 5LCWL 2RJ2A 3MUZ1 5C71A 4E8CA 1W8NA 4QAWA 5LA1A 5C7GA 2YFZA 5B4NA 3OGSA 4BDVB 3MBWA 4XZUG 1DP0A 2VTFA 3E1F1 2BGOA 2VCBA 1DLCA 2DDUA 1CIYA 5JMOA 3ACIA 1WCQA 4W8JA 3P1IA 1GOHA 3P6BA 1JZ6A 2YB7A 3U37A 1JHJA 4CU8A 2ZXQA 5DN2A 2W94A 1J83A 3SEPA 1PMJX 2RV9A 1OF3A 5F7UA 3J7HA 4QPWA 2E26A 4A44A 2WO2A 2X10A 1UZ0A 2HYXA 2DCKA 4L0PA 3T2PA 2QQJA 3NQHA 3CZUA 1GOFA 2W5FA 2YC4A 3LQCA 2VMDA 2Y6LA 3HEIA 2VJXA 1JZ3A 2HLEA 1NAEA 1JYNA 5JR2A 2Z4FA 2VZPA 1JZ7A 3T0BA 3OG2A 3ACGA 4QDRA 1CX1A 2VQTA 4P08A 3EYPA 2W46A 3JXSA 2WAOA 2VZVA 1SG3A 1UY0A 2J7MA 4QDSA 2W1UA 3I2HA 4XVHA 2JE8A 3BGAA 1GOGA 1NKGA 4CUAA 1P8JA 5EJZB 4BK5A 4AAXA 4DUWA 1K45A 1MPXA 5IFPA 2QQNA 4ZZ8A 1EUUA 3F2ZA 2J1RA 3MO4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HNY M;  4OUE A;  4MOA A;  1JZ8 A;  3MUY 1;  3SKV A;  2J1A A;  3CZJ A;  3WF2 A;  2E32 A;  3OBA A;  2VME A;  4QX2 A;  5A1A A;  1XNA A;  1YQ2 A;  1W9T A;  1UY3 A;  3A7Q A;  1GU3 A;  4OYU A;  1OD3 A;  3HNM A;  3C7E A;  3T08 A;  4LKS A;  3C7O A;  2RVA A;  2YFU A;  1US3 A;  2VZQ A;  2R7E B;  2DCJ A;  1H6Y A;  2QQI A;  1W8O A;  4DUV A;  3LEK A;  2VM9 A;  3NNG A;  4CUC A;  2C26 A;  1UMH A;  2EID A;  2VZ1 A;  2QQK A;  4P00 B;  4AG4 A;  4D8M A;  3VD4 A;  2BGP A;  2VC9 A;  2W92 A;  3MV0 1;  3SKJ E;  3HOB A;  3HJR A;  3WEZ A;  2ORZ A;  2V72 A;  3FHQ A;  1J84 A;  3OGV A;  2C4X A;  2J22 A;  3D3A A;  5B4X A;  3PUI A;  1O8S A;  3WQB A;  1D7P M;  2WAB A;  3LPG A;  1US2 A;  2WN3 A;  2V5D A;  2WO1 A;  2XQX A;  3K77 A;  5DMY A;  2XON A;  4QX3 A;  1O8P A;  2W1Q A;  4W4Z A;  3CIH A;  1F4H A;  4W50 A;  5J1X A;  3CMG A;  3IAP A;  2ZEZ A;  4UOJ A;  4A3Z A;  2VZ3 A;  5CYY A;  5EIY B;  4QB2 A;  1R64 A;  2J1U A;  4MO3 M;  4GZ9 A;  4A41 A;  1JZ5 A;  1TVG A;  1BHG A;  3WNK A;  2XOM A;  1JYX A;  4BJ0 A;  4JHZ A;  5JUV A;  3WSO A;  3WNL A;  3PUH A;  2W1S A;  3EB7 A;  4RYD A;  4DEV A;  3C8X A;  3K4A A;  3THC A;  1PMH X;  1XNT A;  4QX0 A;  3GM8 A;  2JKX A;  4ZY9 A;  4BXS V;  4RN5 A;  4CU9 A;  4JKL A;  4XUR A;  2X09 A;  2B9V A;  2W9X A;  4QX1 A;  3GDB A;  3CQO A;  3WF3 A;  4HG6 B;  4Z2A A;  2VCC A;  2QBX A;  3WF1 A;  1JYW A;  4MAD A;  1UYX A;  2JDA A;  4OMD A;  3OB8 A;  1L7R A;  2Y6J A;  1O59 A;  1SHW B;  2BBA A;  2JD9 A;  5G05 L;  2YG0 A;  1XPW A;  4LPL A;  3UET A;  2EIE A;  1PX3 A;  4QDQ A;  2C9K A;  3AC0 A;  3LEI A;  2VZU A;  1JU4 A;  3I2K A;  4E8D A;  2W3J A;  4DXR A;  1UY4 A;  3C7G A;  4P5Y A;  1CZS A;  3W5M A;  1GUI A;  2WYS A;  2W95 A;  4XUP A;  4XUN A;  1CZV A;  2QQM A;  4P02 B;  2CDP A;  1KGY A;  1NUK A;  2CDO A;  3WF4 A;  3ETP A;  2W47 A;  2W87 A;  3I97 A;  4MGS A;  1UY1 A;  2ORX A;  5JXG A;  3ABZ A;  1UXZ A;  2OKX A;  2ZEX A;  3C7F A;  2Y64 A;  4KWU A;  4ARY A;  4LHS A;  3HNB M;  1L7Q A;  5JXH A;  1SDD B;  3FN9 A;  3WNM A;  1UYY A;  1RYY A;  1OT5 A;  2QQO A;  1UXX X;  3GXU A;  2V4V A;  3DEC A;  4GWI A;  2J1S A;  5IFT A;  4DEQ A;  3CDZ B;  4DXS A;  2B4K A;  5C70 A;  2LS6 A;  2WQ8 A;  3IDA A;  5IYY A;  5LA0 A;  4UAP A;  3THD A;  1OF4 A;  3VD7 A;  3CKH A;  2WO3 A;  2XHN A;  3ZM8 A;  1ULO A;  4A42 A;  4DXT A;  3WNN A;  3NRU A;  3DYO A;  3T0D A;  4XUO A;  1W0N A;  2WDB A;  2Y6K A;  4KI5 M;  2ID4 A;  4CU7 A;  1F4A A;  3OEB A;  4KMQ A;  2ZEY A;  2VQU A;  3I2J A;  1JYV A;  3T2O A;  5I0D A;  3SEE A;  3T0A A;  4QB1 A;  3IAQ A;  5CZK A;  2KD7 A;  1I5P A;  3WNO A;  3I3B A;  2VMF A;  1HN1 A;  4M4R A;  4JX0 A;  1T2X A;  4QB6 A;  3A21 A;  5JXI A;  4IUG A;  1LNS A;  4A4A A;  4CU6 A;  2Y6G A;  5HXM A;  3LE0 A;  3OGR A;  2LW8 A;  4JKK A;  2E33 A;  3WF0 A;  4D0Q A;  1UX7 A;  1K12 A;  2E31 A;  2WBK A;  3ECQ A;  4BK4 A;  3W5N A;  1JU3 A;  5LA2 A;  1DYO A;  5JXJ A;  3K46 A;  2VL4 A;  3ACH A;  3K75 B;  2VZS A;  1PX4 A;  2VZR A;  3FL7 A;  1GMM A;  1W9S A;  1UY2 A;  1WKY A;  3UNP A;  1UYZ A;  2WZE A;  3LPF A;  4A45 A;  1K42 A;  3WNP A;  1OH4 A;  2W91 A;  4M4P A;  2VZO A;  2Y6H A;  2VZT A;  4MGQ A;  3I3D A;  2QQL A;  3I2I A;  4YPJ A;  4GWJ A;  4ARX A;  1IQD C;  2VMC A;  3T09 A;  1TG7 A;  3OEA A;  3VD3 A;  3HPN A;  3I2G A;  1JZ4 A;  4XUT A;  4CUB A;  3UES A;  3A23 A;  2W1W A;  1CZT A;  4CVU A;  2BZD A;  3NJX A;  2J1E A;  2VCA A;  1JI6 A;  2BER A;  1UMI A;  3LEG A;  1K3I A;  2EIC A;  4PF1 A;  2YC2 A;  1JZ2 A;  2WAA A;  1UWW A;  4FI9 A;  3C7H A;  1GNY A;  2WN2 A;  3K4D A;  2L9L A;  5HPO A;  5DPN A;  4JKM A;  4OMC A;  3FHA A;  4TXW A;  3HN3 A;  3VD5 A;  1KEX A;  1ULP A;  3I3E A;  5G04 L;  5FUI A;  3VDA A;  3DYM A;  2ZEW A;  3NJV A;  2VO5 A;  4LQR A;  2VOT A;  3A22 A;  2WUH A;  2VR4 A;  4UI9 L;  3IB3 A;  2J1V A;  5DQ0 A;  3BN6 A;  4PQQ A;  2EIB A;  2PQS A;  4PT6 A;  2J1T A;  4XUQ A;  3VDC A;  3T2Q A;  4DUX A;  1H6X A;  2WZ8 A;  4OZO A;  2X05 A;  4ZZ5 A;  4TTG A;  5IJR A;  1XC6 A;  5EJ1 B;  1GQP A;  3MV1 1;  5IHR A;  3VDB A;  3DYP A;  1W99 A;  4ZXE A;  1EUT A;  3GGL A;  3ACF A;  4ET7 A;  3III A;  3VD9 A;  1NX9 A;  3I2F A;  4A6O A;  1W9W A;  2Y8K A;  3K4Z A;  5LCW L;  2RJ2 A;  3MUZ 1;  5C71 A;  4E8C A;  1W8N A;  4QAW A;  5LA1 A;  5C7G A;  2YFZ A;  5B4N A;  3OGS A;  4BDV B;  3MBW A;  4XZU G;  1DP0 A;  2VTF A;  3E1F 1;  2BGO A;  2VCB A;  1DLC A;  2DDU A;  1CIY A;  5JMO A;  3ACI A;  1WCQ A;  4W8J A;  3P1I A;  1GOH A;  3P6B A;  1JZ6 A;  2YB7 A;  3U37 A;  1JHJ A;  4CU8 A;  2ZXQ A;  5DN2 A;  2W94 A;  1J83 A;  3SEP A;  1PMJ X;  2RV9 A;  1OF3 A;  5F7U A;  3J7H A;  4QPW A;  2E26 A;  4A44 A;  2WO2 A;  2X10 A;  1UZ0 A;  2HYX A;  2DCK A;  4L0P A;  3T2P A;  2QQJ A;  3NQH A;  3CZU A;  1GOF A;  2W5F A;  2YC4 A;  3LQC A;  2VMD A;  2Y6L A;  3HEI A;  2VJX A;  1JZ3 A;  2HLE A;  1NAE A;  1JYN A;  5JR2 A;  2Z4F A;  2VZP A;  1JZ7 A;  3T0B A;  3OG2 A;  3ACG A;  4QDR A;  1CX1 A;  2VQT A;  4P08 A;  3EYP A;  2W46 A;  3JXS A;  2WAO A;  2VZV A;  1SG3 A;  1UY0 A;  2J7M A;  4QDS A;  2W1U A;  3I2H A;  4XVH A;  2JE8 A;  3BGA A;  1GOG A;  1NKG A;  4CUA A;  1P8J A;  5EJZ B;  4BK5 A;  4AAX A;  4DUW A;  1K45 A;  1MPX A;  5IFP A;  2QQN A;  4ZZ8 A;  1EUU A;  3F2Z A;  2J1R A;  3MO4 A; 
#chains in the Genus database with same CATH topology
 1LJ7 A;  3ZYJ B;  4OUE A;  3HBK A;  3AJY A;  1JZ8 A;  1VBC 3;  4XDP A;  5C33 A;  2LRO A;  3NNL A;  3RWK X;  3WUC A;  1S0C A;  4WM8 B;  1UMZ A;  5I8T A;  2G4I A;  3WW1 A;  2E32 A;  5FYV A;  2VME A;  4JDM A;  4NPL A;  4QX2 A;  4RQP B;  1FPN 3;  4RL7 A;  4L8Q A;  4IER A;  4XYX A;  3WW3 A;  5A1A A;  2YBP A;  1KJL A;  4AE2 A;  1ENQ A;  3LD8 A;  4WVM A;  4YM2 A;  5SV8 A;  1MQT A;  1HQW A;  3EXU A;  1B35 C;  1OD3 A;  1RUJ 3;  3OBR A;  3M7A A;  2VMI A;  5C5T A;  1WW5 A;  1GQG A;  1DZT A;  2JEM A;  3WDV A;  1V6O A;  4LOS A;  5LRS A;  1UW8 A;  5J36 A;  2YGL A;  4KNC A;  1H6Y A;  2ETE A;  3KGZ A;  3LDB A;  4L97 A;  5A6Y A;  1S0E A;  2XVK A;  4DUV A;  4CPB A;  2VM9 A;  2RS3 2;  3NNG A;  2C26 A;  1UMH A;  1VAK A;  4XF3 A;  4ERO A;  5FWE A;  5DDJ 2;  3LWC A;  2ATF A;  4P00 B;  4QQ2 A;  4FOW A;  3HR9 A;  1ZBA 1;  1ZZC A;  4IV3 A;  3MIF A;  5FCC A;  5DG1 A;  5LAS A;  2W92 A;  3SKJ E;  2WSU A;  4AFB A;  5GZG A;  1O3S A;  4LBQ B;  3HJR A;  2A71 A;  1VMF A;  1PGW 2;  3OGV A;  3LF7 A;  4CEW B;  3PMS A;  5FWJ A;  1LUL A;  4W6W A;  5DDJ 3;  5B4X A;  3PUI A;  3R4D B;  3AMN A;  4WVM B;  3WQB A;  1D7P M;  2Q30 A;  3ZXG A;  1V9U 2;  3LPG A;  1RUI 2;  2D6O X;  1BJQ A;  2HWE 3;  1PK6 B;  2OZ6 A;  2VVF A;  3LGR A;  3B00 A;  4XJW A;  2WN3 A;  2P6C A;  1S4C A;  3H8U A;  3MLL A;  4K20 A;  3D82 A;  1OFS A;  2V5D A;  4MVT A;  4UFK A;  5IK5 A;  1JOB A;  4G9S B;  1S55 A;  3E6D A;  2XQX A;  3K77 A;  5FBZ A;  2OQ6 A;  1POV 0;  1NY7 1;  5FFO C;  2B46 X;  5FY0 A;  4BQ3 A;  2ENR A;  2NZ9 A;  2W1Q A;  3JB4 C;  3SQO A;  3V0B A;  1C5H A;  1HB4 A;  2C9A A;  4LK7 A;  2GDF A;  3Q8E A;  5JSO A;  1CJD A;  4CTE A;  3UGF A;  4DY5 A;  3AYD A;  4CDQ A;  2WO7 A;  1DG6 A;  3IAP A;  4JQT A;  4FXK B;  1MZF A;  3ZYR A;  2BBV A;  3LDR A;  2ZEZ A;  1RUG 2;  4JGZ C;  2D6L X;  3BOD A;  1EAH 3;  4FP3 A;  3UKT A;  5FO7 B;  1TME 2;  1VMH A;  2E53 A;  2J1U A;  2BEO A;  5FKB A;  3VZO A;  1A3K A;  1KS4 A;  1TVG A;  1WMX A;  1PGS A;  1VBC 1;  4HPK B;  4TLF A;  3RZH A;  2JX9 A;  4FBF A;  2XML A;  1ZBE 2;  1W6N A;  4BJ0 A;  3POS A;  5KHH A;  5FYZ A;  4O61 A;  4XBL A;  3PME A;  4JVA A;  4B4Q A;  2ZX3 A;  1AL2 2;  2JG9 A;  2XDV A;  3MFA A;  1X8M A;  1H4H A;  3OD0 A;  4FPF A;  4QPI A;  3K4A A;  2DVB A;  1SCR A;  4DOU A;  4K40 A;  5K0U C;  1DCS A;  1K5J A;  5T5L A;  4BXS V;  1LGB A;  1RUD 3;  4XFH A;  3HT2 A;  1YFY A;  3VKN A;  2VTX A;  4NAO A;  1YO8 A;  4TYS A;  1S2B A;  3DPR A;  4XUR A;  2X09 A;  4QPG C;  2PHL A;  5FUP A;  3GDB A;  5ISL A;  3FUO A;  4PDW C;  3BIW E;  1Z0H A;  2A1X A;  1YIP A;  1XE7 A;  3CL1 A;  5L9R A;  2VCC A;  2QBX A;  4XQD A;  1H9W A;  3RRD A;  4C1X A;  2JDA A;  3MIG A;  1MEC 1;  3OB8 A;  4GH4 B;  1QJF A;  1RUH 1;  4O9E A;  3NAP C;  4O9G A;  4BQ2 A;  3GZT B;  1FOD 1;  2JD9 A;  2DF7 A;  5DAV A;  3OOX A;  2ARB A;  1QHD A;  1AJK A;  2YPD A;  3T1L A;  4QQO A;  4QXC A;  3VBR A;  4XFA A;  4PF5 A;  2JG8 B;  1PX3 A;  2Y0I A;  2C1F A;  2GSY A;  4N53 C;  4QDQ A;  1OSG A;  1N1S A;  2ARE A;  2C9K A;  3ELN A;  3J26 N;  1HJG A;  1YQ6 A;  3B5L B;  4DXR A;  5FZ3 A;  1UY4 A;  4AFM A;  4P9L A;  3Q8F A;  4AVV A;  1JMU B;  4BMB A;  2VQ0 A;  4JGY C;  3W5M A;  2WYS A;  4WM8 C;  1ZBE 3;  4XUN A;  1QF3 A;  1CZV A;  2VD7 A;  3ZYH A;  1IG3 A;  2CDP A;  3TB0 A;  3ZN5 A;  4IV1 C;  4EE2 A;  4MX3 A;  4OHW A;  4HVQ A;  1Q3E A;  1UD1 A;  3JD7 2;  4XTM A;  3T30 A;  2W47 A;  3PVE A;  5A7W B;  3I97 A;  1D4V B;  4MGS A;  1OA4 A;  5I0U A;  3MW4 A;  4HKL A;  5FLI A;  1PVC 3;  3VDD C;  2VUC A;  4W65 A;  3OY8 B;  1NXD 1;  5AFE A;  1YNA A;  1SFP A;  3ABZ A;  2OKX A;  4BQY A;  3L9J T;  4M3C F;  4LLF A;  1XSR A;  4URT A;  3ZXL A;  1URX A;  4E2S A;  2HWD 1;  5JDB A;  1AXK A;  3EQE A;  1ODN A;  2Y64 A;  4QU2 A;  4KWU A;  1XYP A;  3RMX A;  3AVR A;  5LK5 A;  3DXU A;  1IHM A;  3HNB M;  4WBB A;  5JXH A;  1X82 A;  4RGK A;  2BVV A;  4AK3 A;  4C0B A;  1ACC A;  4XIO A;  3WNM A;  2NQY A;  1XNK A;  1FXZ A;  4EN9 B;  2ZGK A;  3KV9 A;  2V4V A;  1JXN A;  3DEC A;  4HVO A;  1PO1 1;  1AR7 1;  3OPZ A;  5C8W A;  3N9M A;  1ULG A;  4K21 A;  2BJS A;  5FZO B;  4S2F A;  1W06 A;  1M4W A;  1GSL A;  5FZ8 A;  4DEQ A;  2B4K A;  2WQ8 A;  4XZP A;  5LA0 A;  3VL9 A;  2BFU S;  5EQU A;  2QNK A;  1RUF 3;  2G9F A;  4GB3 3;  2VQA A;  1BLZ A;  3ZYF A;  2WT2 A;  1DQ5 A;  4DXT A;  3PVO A;  2MEV 2;  5FDB A;  2BPA 2;  5A7P A;  1Y4W A;  4FAG A;  3IPV A;  3T0D A;  1BK0 A;  3TN9 1;  1UOF A;  2ZGN A;  3P3P A;  4XET A;  5FZ4 A;  4XUO A;  2UYB A;  1DLL A;  3K2O A;  1CES A;  1PO2 1;  4MGI E;  5I0T A;  4KGG A;  3VZK A;  3DKW A;  4YFW A;  2V4A A;  2SBA A;  1F4A A;  4AI1 A;  3D0S A;  3CU7 A;  3M3Q A;  4KMQ A;  2WNV A;  2DTY A;  2H0V A;  1J3P A;  2K9Z A;  5CKN A;  1JYV A;  1GWK A;  2R49 A;  5FMB A;  4GWN A;  1Y43 B;  3TAY A;  4EZ4 A;  4RFR B;  1W04 A;  1MEC 3;  5FY9 A;  3I3B A;  2VMF A;  4M4R A;  2ZX0 A;  3SLI A;  1OVP A;  5KHK A;  1PGL 1;  4RHV 2;  3RZL A;  3FBM A;  5ABJ C;  5LAT A;  1FOD 3;  1GNZ A;  1T2X A;  1W8F A;  3V64 A;  1CD3 G;  5C3S A;  3U4X A;  1RMU 2;  1O6U A;  2LM3 A;  1HB2 A;  4QU1 A;  4CU6 A;  4X6R B;  4ASK A;  3PIG A;  3SC7 X;  1ND2 A;  1RVF 2;  2LW8 A;  4JKK A;  2WBK A;  1K12 A;  3ECQ A;  4JZR A;  3H8R A;  5FXV A;  5L36 A;  5LA2 A;  1DYO A;  4BOW A;  3MDP A;  5HV0 A;  4YFZ A;  3KLS A;  2XUE A;  4E27 A;  3POG A;  3B3Q E;  5GZE A;  4OI1 A;  2TUN A;  2XLA A;  4OUS A;  4PBO A;  3BB6 A;  1SLC A;  4O7X A;  2FCT A;  3NJZ A;  2B42 B;  5FPA A;  1WKY A;  2RM2 1;  3R05 A;  5DAX A;  1CX4 A;  2WZE A;  3WOG A;  4CCJ A;  2WZR 1;  1BYH A;  1W0P A;  3LPF A;  5FR3 A;  3ALQ A;  4LUK A;  5C4W C;  3V0A A;  2MPF A;  1CON A;  2BDR A;  2UU8 A;  2W91 A;  2DFC A;  4JC1 A;  2HWD 3;  2VZO A;  2ZGR A;  3OPW A;  3LOB A;  4OQ9 A;  4GJZ A;  4QX5 A;  3HT1 A;  3ZFE B;  3ZX7 A;  4HVR A;  1LEC A;  2DV9 A;  3FLR A;  5E6H A;  4ARX A;  4GJY A;  4PLM A;  1W8W A;  5C8C B;  3T09 A;  3VKM A;  1FV3 A;  3OEA A;  3W59 A;  4NHY A;  3HPN A;  1QKQ A;  3QH6 A;  4AVT A;  4XUT A;  4NHX A;  1PO1 3;  1LHU A;  1YJL A;  1IKP A;  2XQR A;  4HK8 A;  1ASJ 2;  1U5Y A;  1ZRI A;  3PTY A;  4AQS A;  3NV3 A;  1W8Z A;  4COZ A;  5K8S A;  1RUJ 1;  1V9U 3;  4OZX A;  4HN1 A;  5I0R A;  1OQ1 A;  4XCB A;  1ZX5 A;  3RZJ A;  3NJX A;  2ZGP A;  3AKQ A;  4AEM A;  1EV1 3;  2VCA A;  2Q5T A;  3AX4 A;  4X8P A;  1CVN A;  5BNN B;  5FTT C;  3IMM A;  2B45 X;  3NJY A;  3QBQ A;  4QKD A;  2BRT A;  1CWP A;  2EIC A;  2P37 A;  3MIC A;  4XC9 A;  4AF9 A;  3V65 A;  1GYK A;  1PIV 1;  2XJS A;  2ZX1 A;  5FYI A;  3K4D A;  1QNY A;  3RJ2 X;  2L9L A;  3UYJ A;  4COW A;  1VMJ A;  4AGR A;  3VBO B;  3CLP A;  4CCE A;  2WS9 2;  1RUI 1;  3MF9 A;  1COV 3;  2RMU 1;  1QJZ A;  2BV4 A;  3KZ4 C;  4C90 A;  3H3Z A;  3HN3 A;  5G04 L;  1N1Y A;  1VAV A;  2FMY A;  1EP0 A;  3M8L A;  1LAJ A;  3DYM A;  4ITC A;  3UK9 A;  2A6Z A;  3USU A;  2ZEW A;  1DYP A;  3N36 A;  4XAC A;  4LQR A;  3EBR A;  3DKQ A;  2XJV A;  2E6V A;  2XJT A;  5IAT A;  4CEW A;  4TLG A;  5IVC A;  1OH3 A;  3AZW A;  3IDE A;  4LHL A;  5EP9 A;  4QPY A;  2Q8D A;  3JB8 A;  3VDC A;  3T2Q A;  2D44 A;  3POW A;  5E16 A;  1VLN A;  1RUD 2;  5BXX A;  4AI2 A;  3VHN A;  2X05 A;  3USU B;  2XL7 A;  1PK6 A;  1JOJ A;  3QOP A;  1BVV A;  4N7I A;  1QQP 3;  5IJR A;  4IEW A;  3T2T A;  2IVJ A;  3AYC A;  1OOP A;  4IEZ A;  1WBL A;  3VB9 A;  5F3I A;  1W99 A;  2QDR A;  2I2S A;  4ZXE A;  4AWD A;  4NHM A;  1Y9G A;  2O0O A;  1FMD 1;  2CHH A;  2PLV 3;  3USS A;  3NKG A;  3ACF A;  5A33 A;  1GR3 A;  4F83 A;  1ASJ 1;  4YLZ A;  1Y3T A;  1NX9 A;  3I2F A;  4A6O A;  1NQJ A;  2OPK A;  1RUC 1;  5C9A C;  2Y8K A;  4ZXK A;  2EAK A;  1ENX A;  2IXK A;  4ZPI A;  5FYM A;  1IG0 A;  1LEM A;  2WS9 3;  5LA1 A;  3LAG A;  1O91 A;  3ZFG A;  2CY6 A;  1GZT A;  1RIT A;  4H14 A;  1AX1 A;  3VUO A;  4DB5 A;  4NPR A;  3WDY A;  1IPS A;  4YVS C;  5LW9 A;  3AFG A;  3NNJ A;  5FO8 B;  3MPB A;  4HPK A;  4FPG A;  4Y1Z A;  4BQX A;  2D6P A;  1DLC A;  3MHZ A;  4OVE A;  5FK7 A;  1N47 A;  4DQA A;  4W8J A;  4KU7 A;  3POE A;  1GOH A;  1UZW A;  4EJR A;  1AR8 3;  1QU0 A;  3AKP A;  4R9D A;  4YGB A;  3CF6 E;  1S0F A;  4GUL A;  1NA1 C;  5JVV A;  3PIJ A;  4CU8 A;  2UWC A;  3E6B A;  5JZG A;  4FFF A;  3SEP A;  3RYK A;  1AX2 A;  1OF3 A;  1KFU L;  2XKO A;  5FKC A;  5AC9 3;  2VOW A;  2ZHN A;  1DZR A;  1DIW A;  2GH8 A;  2XH6 A;  3LA7 A;  4CA9 A;  4QPW A;  1D2S A;  3OGJ A;  2E26 A;  4PI0 A;  1UQX A;  4QM8 A;  3LZZ A;  4GH4 A;  4RS5 C;  5A6X A;  1GP5 A;  1V6L A;  1PIV 3;  1RHI 2;  3S7I A;  2BVB A;  2VBP A;  2D6N A;  2MEV 1;  1XND A;  2Q8O A;  3S5A A;  4L0P A;  2HJI A;  2QQJ A;  1I9R A;  2W5F A;  5FZC A;  2VG9 A;  4Y4R A;  3NKT A;  4P9G A;  3BI3 A;  1VBD 3;  3MZH A;  3WQ7 A;  4L99 A;  3HEI A;  5LRR A;  5GJ6 A;  5ERL A;  4OHX A;  3FX3 A;  2EVX A;  4R9B A;  4FXG B;  4RHV 3;  5JR2 A;  1FNZ A;  1FX5 A;  2BOJ A;  3OUI A;  1S0G A;  1HW5 A;  2VZP A;  2EAL A;  4LBJ A;  3RWN A;  3V56 A;  5DXD A;  3OCP A;  4A7K A;  1AL0 G;  1CIW A;  2YUE A;  5L7O A;  4FFI A;  4P08 A;  1NCR C;  2ADD A;  2ADE A;  3VBU B;  1RVF 3;  4COY A;  3EYP A;  1BMV 1;  2WAO A;  1V00 A;  1MAC A;  3C3V A;  3N7J A;  1LTE A;  4B4R A;  1TZO A;  3M3E A;  3PTR B;  1SG3 A;  5F39 A;  1JTZ X;  3H42 B;  5LY2 A;  4AQ6 A;  4BIO A;  4ES9 A;  2D98 A;  4LNV A;  3I2H A;  3ILF A;  1FMD 3;  1Q5O A;  1W2O A;  3WP3 A;  5JXG A;  1SQ4 A;  2HWC 1;  1VRH 2;  1UF2 C;  4UBG A;  4IE6 A;  1LOE A;  1WLD A;  5FZB A;  5T50 A;  4DUW A;  5J3U A;  3VN4 A;  5A3P A;  5IFP A;  4W6Y A;  3ZMN A;  5F2W A;  5CIR A;  4JTN A;  3JZV A;  3ZXD A;  3MO4 A;  1H1I A;  1A6C A;  1PM7 A;  2ET7 A;  4MOA A;  1YQ8 A;  4XEZ A;  3I59 B;  2XVL A;  4LK6 A;  1G9F A;  4M00 A;  4FPK A;  4CXY A;  2J1A A;  3CZJ A;  1VBD 2;  4Q27 A;  3WF2 A;  3S7E A;  4AYU A;  1RUO A;  4DMI A;  4MV2 A;  2FHR A;  2A75 A;  1IS3 A;  4LO5 B;  5HV4 A;  1YQ2 A;  3DN7 A;  4BHP A;  2HWF 2;  2QJV A;  1O5U A;  1O3Q A;  2JE9 A;  2JIJ A;  3VBF B;  3X29 B;  4RR3 A;  1AR8 1;  4LHK A;  5IT6 A;  1QNW A;  1RUH 2;  2QQU A;  3T08 A;  4LKS A;  3C7O A;  1KDM A;  3HBZ A;  3KWV A;  3KV5 A;  2H6B A;  3EHK A;  2IFR A;  1TMF 1;  3AKT A;  2QQI A;  5DAB A;  1W8O A;  2JDM A;  3LEK A;  4BM8 A;  3SCF A;  5GM0 A;  5FYH A;  4JCK A;  3S6P A;  1H8T A;  1PZ7 A;  1XYN A;  1G6N A;  2E63 A;  4BQW A;  4XQ4 A;  4PDW B;  2JG9 B;  4AI0 A;  1G9A A;  2O1Q A;  3N7M A;  3VD4 A;  4HT1 T;  4XXP A;  4YZ3 A;  2RHP A;  4AEJ A;  1HKD A;  2BGP A;  5T54 A;  1Z78 A;  3LSD A;  3FC0 A;  1YWK A;  4IGQ A;  2D6M A;  4QKN A;  3AZV A;  3DCQ A;  4XFC A;  3HOB A;  1VBC 2;  4IEP A;  3WEZ A;  1VBD 1;  2V72 A;  4FFG A;  2UYA A;  2ZMK A;  2VOV A;  3D8C A;  3TNP B;  1JH5 A;  2FDK A;  4IE4 A;  2JDK A;  2C4X A;  2W08 A;  3BOW A;  1RXF A;  2BFU L;  3D3A A;  3N9O A;  1W3X A;  2BP6 A;  2WNU A;  5IAV A;  1WGP A;  2X8K A;  1FPN 2;  5A3M A;  4E4Z A;  5CAZ A;  5CFD A;  1IZ3 A;  2XKP A;  1G9C A;  3W9A A;  4DRR A;  1WMD A;  4GQ7 A;  1EAH 1;  2JD4 A;  2WO1 A;  1G8W A;  4HKW A;  4AQ2 A;  2ZML A;  4BYY A;  4YAR A;  4AL9 A;  3H1Y A;  4IDZ A;  2FZ1 A;  3KD4 A;  1F5J A;  2WNU B;  4W4Z A;  3DUI A;  5LK7 B;  1GAN A;  2I74 A;  3NNF A;  5FZ9 A;  3GHM A;  3M3I A;  2XJU A;  4NUB A;  1DGR N;  3CMG A;  3NV4 A;  1VIW B;  3WNX A;  1RMU 1;  3O1T A;  4XDQ A;  1H30 A;  4Y3O A;  3AL6 A;  4P9J A;  4G3Y C;  4LXL A;  4UOJ A;  5IVY A;  5B2G B;  4OI2 A;  5FRE A;  1GWL A;  2G1M A;  4QB2 A;  1LB2 A;  5JIA A;  3THT A;  3O1V A;  4OI4 A;  2FZ2 A;  3OGG A;  2A3W A;  2XOM A;  4DS0 A;  4G4F A;  4HSL A;  1VBB 1;  2R07 3;  1OI6 A;  3GBG A;  4QQP A;  5K0U B;  3RZM A;  1GLH A;  4YGC A;  3WSO A;  3WNL A;  1XBF A;  3EB7 A;  4Q2F A;  2VOK A;  3J7L A;  5IK7 A;  1ZRE A;  3GM8 A;  3ZSL A;  4ES8 A;  2JKX A;  3ACL A;  5AVA A;  4RN5 A;  5BNN A;  5HCA A;  2B9V A;  4CDW A;  4UFL A;  4Y5Z 0;  2JG8 A;  1XOY A;  1ODM A;  3CQO A;  2C24 A;  4Z2A A;  1RUI 3;  3I3M A;  3ILR A;  3WF1 A;  2PMW B;  1NXM A;  5CFC B;  1UYX A;  4E9K A;  5D2A A;  4CDU B;  4Z92 B;  2DUR A;  2D40 A;  3VL8 A;  1O59 A;  4FQZ A;  2G9Z A;  1WWY A;  5GLZ A;  5H9Q A;  2BBA A;  5FRA A;  3E6C C;  2YG0 A;  5C4W B;  1XPW A;  3RQ0 A;  2HH9 A;  4CZS A;  4LUM A;  3R0R A;  5DUX A;  4CDW B;  1W6P A;  4LPL A;  1RXG A;  1NA1 B;  2EIE A;  3IBM A;  5FUN A;  1HQL A;  4YZ4 A;  3ZFE A;  3AC0 A;  1NCQ A;  1U5Z A;  1W39 A;  1QIQ A;  2HEV F;  2VZU A;  2ZPX A;  5FYY A;  1ND3 A;  1WLC A;  3VBS A;  3SH5 A;  3LB9 A;  1HXS 2;  4FSJ A;  2K46 A;  1AR9 3;  1RGS A;  3B93 A;  3C7G A;  4K8R B;  2WZR 2;  3ORJ A;  3RI9 A;  2FDI A;  4Q4W 1;  2QUO A;  1GUI A;  2RDQ A;  4QM9 A;  2R07 2;  2ZGO A;  4EV0 A;  3GZE A;  1N3Q A;  1KGY A;  3MFC A;  2CDO A;  2RS3 3;  3D6E A;  1LOF C;  3N9N A;  1VPH A;  5LY1 A;  3ETP A;  4M0H A;  5FZF A;  1W6O B;  3WHT A;  3BTZ A;  4CDU C;  1UY1 A;  2VTX J;  1PO2 2;  1WW7 A;  3VBS B;  3IT8 A;  5JOY A;  1ND2 B;  1FPN 1;  2XL9 A;  3K3O A;  2QTW B;  5JOZ A;  3EJK A;  2YC0 A;  5FMC A;  4CDX A;  3UL2 A;  4RQP A;  3ZYG A;  1HDK A;  3KV6 A;  1DFQ A;  4KQ7 A;  4NOT A;  1L7L A;  2ZEX A;  3VBH C;  4ARY A;  5CFC A;  1QH7 A;  1F8V A;  3VBO A;  4YSF A;  3WDU A;  2OA2 A;  5JOX A;  5EYX A;  3I8T A;  3AKR A;  3FN9 A;  4AHZ A;  3VKL A;  4DY3 A;  4GB3 1;  1LOA A;  4U2A A;  2GNT A;  4ZS2 A;  1OT5 A;  3QCW A;  4JHT A;  3GAL A;  1Z7S 2;  1UXX X;  2DUO A;  1I3H A;  3GXU A;  3H1W A;  2R1D A;  5EPA A;  1WME A;  4DPN A;  4CDX B;  1LGN A;  4CXW A;  3IKW A;  2HEY F;  5T5P A;  3TN9 3;  4NIH A;  2C6S A;  3AZY A;  1JUH A;  2XBO 2;  4JV4 A;  4QXH A;  2A73 B;  2LS6 A;  3IDA A;  4OCT A;  4XAA A;  4DRV A;  5IYY A;  4LTA A;  5DG2 A;  4UAP A;  3WR0 A;  1HRV 2;  1ZBA 3;  3KCX A;  2OQ7 A;  3KGL A;  2VW2 A;  2Y33 A;  3AYA A;  4XJU A;  5GLV A;  2VUJ A;  3LEM A;  5F6K A;  3BOP A;  3ZM8 A;  1ULO A;  4IQP A;  4HBN A;  4JRA A;  1W2N A;  2ZX4 A;  1APN A;  3FZ3 A;  3NRU A;  2F4P A;  3ZXE A;  3DYO A;  1SMV A;  1IOA A;  4Z07 A;  2OUH A;  1E5I A;  2DTW A;  2LTN A;  3CBN A;  4D6R A;  1IPK A;  5FYT A;  1Q8S A;  1W0N A;  3GNE A;  5C8C A;  5KHI A;  1MQT C;  4Y4Y A;  2VY0 A;  3EO6 A;  1B35 A;  2ID4 A;  5CB7 A;  4CU7 A;  1OLR A;  2MEV 3;  4KBZ A;  1NCQ B;  2X5I C;  3RFR A;  3ZYP A;  2GAU A;  5LEJ A;  3ZXF A;  5LZ6 A;  4BME A;  2TBV A;  4AI3 A;  5F9T A;  2ZKN A;  3T2O A;  2D6K A;  3SEE A;  3T0A A;  5A3T A;  1U5I A;  1XE8 A;  5FK8 A;  5EJ3 A;  4FCA A;  2KD7 A;  4CCK A;  4DZG A;  3TNQ A;  2ZA9 A;  4Y20 A;  2D3R A;  4JX0 A;  5AC9 2;  4QB6 A;  2FD8 A;  2HWB 1;  4RHV 1;  3AK0 A;  4EYU A;  3FMG A;  3A21 A;  1UU5 A;  5JPM B;  4IV3 C;  2Y6G A;  4FQ4 A;  1S0J A;  2RM2 3;  1WW4 A;  2DU1 A;  2E33 A;  5HCF A;  3RZZ A;  1UX7 A;  5F8P A;  3WF0 A;  2NMO A;  3W5N A;  1FOD 2;  4NIG A;  2ZGT A;  2WZR 3;  4YW6 A;  2JDH A;  5ACA 2;  2VCM A;  1XNC A;  3L2H A;  1C28 A;  1ZBA 2;  2PHW A;  4BA6 A;  5BNO A;  1YXW A;  3INA A;  4Q4W 3;  3K75 B;  4B29 A;  3GZU C;  1PX4 A;  1W3V A;  2R32 A;  3RVH A;  2DVA A;  4WV8 A;  3FL7 A;  4QMA A;  5C3P A;  2RS3 1;  4GKY A;  1A8D A;  1CAW B;  1UY2 A;  1BVP 1;  3SIS A;  4ATF A;  2OUJ A;  1BBT 3;  3M3O A;  4NJ4 A;  3UNP A;  2YY1 A;  1NZI A;  2EXI A;  2VNO A;  1OMI A;  1YYN A;  4RGG A;  1QXR A;  1LHW A;  2A6Y A;  5FZ0 A;  1WA6 X;  3DV8 A;  2CGN A;  2VUD A;  5A80 A;  1S1A A;  5A7Q A;  5CIS A;  5F1R A;  4BIF A;  1BEV 1;  2A3X A;  3ROU A;  1WCK A;  4Y24 A;  1OUR A;  1RUD 1;  2JDZ A;  1VAM A;  4KGQ A;  3R4U A;  2Y6H A;  2IXJ A;  1XJA A;  4MGQ A;  4RS5 B;  3BAL A;  4COU A;  1JOD A;  5I8Y A;  4YPJ A;  4LUL A;  1SBF A;  4NVP A;  3BCW A;  4IXL A;  4B3N A;  3N9Q A;  4GWJ A;  3LKJ A;  5JWP A;  2CAU A;  2WKK A;  1WBF A;  2BNN A;  2XVG A;  1MEC 2;  1TG7 A;  4NID A;  2A70 A;  3A0K A;  2JDY A;  2JXA A;  2VBD A;  3S0M A;  4XAB A;  1JZ4 A;  5I91 A;  4KG8 A;  3SIT A;  1RUH 3;  2ZOE B;  4JGZ A;  4IEU A;  3A23 A;  1XQN A;  1UOG A;  2HWD 2;  2W1W A;  1CZT A;  3ZYB A;  1ENR A;  4Q4V 2;  3W58 A;  2QQW A;  5ACA 3;  1VBE 2;  2XG3 A;  2J1E A;  4GA9 A;  3MLK A;  1NE6 A;  2WSV A;  2EXJ A;  1CR7 A;  4D3W A;  5FY1 A;  1X33 A;  1IKQ A;  3S5Q A;  1ZA7 A;  1R09 2;  4QQL A;  3ZIX A;  2JG9 C;  4PF1 A;  4QPI C;  4ASM B;  4IGP A;  4JGZ B;  1GV9 A;  2TEP A;  5FYU A;  2WAA A;  1ZBE 1;  2V73 A;  5A70 A;  3C7H A;  3U75 A;  5FOB B;  5HPO A;  4MYE A;  3VHP A;  1TQ5 A;  4QPG A;  5DPN A;  4IV3 B;  1RED A;  4TXW A;  2NLR A;  4XBN A;  3VD5 A;  1CQ9 A;  4PDW A;  1F5F A;  1SLI A;  1JW6 A;  4OHY A;  3TEZ A;  1HB1 A;  4ZON A;  1PVC 1;  4HFS A;  5JPN B;  3AJZ A;  5C9A B;  2VOT A;  2WUH A;  1HIX A;  3H3U A;  4BLI A;  4Q4Y 2;  2P3J A;  4C91 A;  3BN6 A;  5DZE A;  2HWB 3;  1JYI A;  5IUQ A;  1ST8 A;  4PQQ A;  1YLL A;  1SLL A;  4YW1 A;  4QPG B;  2EIB A;  2PQS A;  1NY7 2;  2PLV 1;  4LKD A;  2YU1 A;  1HV1 A;  4LOR A;  4N53 A;  2J1T A;  4DUX A;  2F4L A;  1ASJ 3;  3IZO A;  5FZH A;  1V6J A;  1CPM A;  4OZO A;  3VV1 A;  2YBK A;  1QEX A;  5LBF A;  4BU2 A;  4MZU A;  4TTG A;  4RR3 B;  1AR7 3;  4XJA A;  1AR6 3;  1GQP A;  2RS1 1;  2XBO 3;  2ZTN A;  5L73 A;  4CEY A;  1DQ4 A;  5LB6 A;  1GZ9 A;  2YPJ A;  3VDB A;  1KS5 A;  2PHX A;  3HQU A;  1C8M 3;  5FZO A;  5FXZ A;  3SNM A;  1EUT A;  5ABJ B;  1AUY A;  1ZZ8 A;  4YM0 A;  3BUC A;  5LBE A;  3III A;  1OPM A;  4LR4 A;  3AKS A;  2Y38 A;  2DVF A;  3PDQ A;  4QHZ A;  4YW3 A;  3SMH A;  1W9W A;  5FP4 A;  1QOS A;  4YM1 A;  3MYX A;  3LSE A;  2X53 S;  2RJ2 A;  4DFS A;  5BNQ A;  4I2O A;  1K5M A;  4E8C A;  4QAW A;  5FXX A;  5L9B A;  4IE5 A;  2DWR A;  1MS9 A;  4QX7 A;  2WIN B;  1YJK A;  3LIH A;  1JN2 P;  1TME 1;  2HWF 1;  3THP A;  1AVB A;  5B4N A;  3J8F 1;  2GAL A;  1B09 A;  4BDV B;  4WZF A;  5FZ7 A;  1LED A;  2PTM A;  1SFN A;  1UIJ A;  2VTF A;  3CHX A;  1O3T A;  2DDU A;  3ACI A;  3HD8 B;  4R9A A;  4Q5O A;  5A6Z A;  4FTS A;  1W6N B;  3AMQ A;  4AXO A;  3P1I A;  2ZMN A;  1MVE A;  3VZM A;  1MS4 A;  1KQR A;  2R04 2;  1H1A A;  3O0W A;  3WP5 A;  3ZMO A;  1JHJ A;  4HLT A;  4LBN A;  1LCL A;  2C5D A;  2RJL A;  2ZBJ A;  5DN2 A;  2Q1Z B;  2W94 A;  3KQR A;  1J83 A;  1S2E A;  1PMJ X;  4FPO B;  5F32 A;  4Y22 B;  1EAH 2;  1EPW A;  3B9C A;  4CP0 A;  5M0T A;  1UU4 A;  2QE3 A;  3T1M A;  1ZRD A;  4RD7 A;  5A6Q A;  4XXA A;  1N3O A;  5E88 A;  1E5S A;  2QVS B;  2X10 A;  3ZSE A;  2GMM A;  5FPU A;  4AGV A;  3CJX A;  3AMP A;  3VBF A;  1AX0 A;  1CAU A;  1MQT B;  3CZU A;  2WNV C;  3LQC A;  4Q0V A;  1Q8Q A;  2QCS B;  4MSV A;  3J8F 2;  2FBE A;  2XJP A;  3JBG 3;  2DCT A;  4JAA A;  3ZXK A;  4A7Y A;  4HXC A;  2VJX A;  2HLE A;  1NAE A;  2VXJ A;  2EA7 A;  2Z4F A;  1MS0 A;  1ZRC A;  5ABJ A;  3UGH A;  3OUH A;  1H1M A;  2WWJ A;  4MLO A;  4J25 A;  1LOD A;  4AZZ A;  5KC6 A;  4I0W B;  3AL5 A;  3T0B A;  3OG2 A;  5T55 A;  3PVN A;  2VQT A;  2A6X A;  3PU8 A;  1A34 A;  4U36 A;  1M06 G;  4IL7 A;  4Y22 A;  1RIN A;  1QMJ A;  1R1A 3;  4R4Z A;  2R16 A;  1QDO A;  3ZSM A;  2J7M A;  2XPJ A;  2VH9 A;  2WQZ C;  1O4Z A;  2RR1 1;  3NMB A;  2VE1 A;  4LIV A;  4UYB A;  2D93 A;  4FPH A;  4V1P A;  2JE8 A;  4XVH A;  3I2O A;  3BGA A;  2BOI A;  1NKG A;  3MLJ A;  4MXW B;  4P14 A;  4UW3 A;  5FMO S;  4C8D A;  1YRZ A;  4Z2W A;  3IM0 A;  1UL9 A;  3VDD B;  4XHX A;  3D4K A;  5FP3 A;  2GNB A;  3UT0 A;  4AAX A;  2P2K A;  4Y5T A;  1PVX A;  5KHG A;  2W0X A;  4COV A;  3OF1 A;  5F2S A;  4V2W A;  4R52 A;  3F2Z A;  3M4F A;  5A1L A;  4LKE A;  5JLV A;  1G9D A;  3HNY M;  5IAX A;  4D94 A;  3VBR B;  1GZC A;  5CFD B;  2ZZQ A;  2B7Y A;  1TME 3;  2HBU A;  2OT7 A;  2VUA A;  1OQE A;  3J8F 3;  3SKV A;  1XB9 A;  3OY8 A;  2RMU 3;  2AYH A;  3KSC A;  2KR2 A;  3URF A;  4BLJ A;  2GN7 A;  1TMF 3;  5GAL A;  3GZA A;  4H3W A;  1SLB A;  2JIC A;  1W9T A;  4F8A A;  4I30 A;  2PHD A;  1UY3 A;  1V0A A;  3BTA A;  3A7Q A;  4OYU A;  2PHT A;  2ZGM A;  2DUP A;  3ETQ A;  3VZN A;  5D8A A;  4ZKT B;  1S0B A;  5CBL A;  1HN0 A;  3ZSK A;  5DAQ A;  2VW0 A;  3TEY A;  1R1Z A;  4CP9 A;  1H0B A;  2D97 A;  1BEV 2;  5F3E A;  2RVA A;  4E4S A;  3W20 A;  2FMD A;  2VZQ A;  2DCJ A;  5FXW A;  1ZZ7 A;  4Z1V A;  1H2L A;  1H2K A;  1QJY 2;  4Q4V 1;  2WNV B;  4XIL A;  1WCU A;  5A3L A;  1QJE A;  3RYR A;  2EXK A;  1QQP 1;  2VZ1 A;  4YWA A;  3N3H A;  5CNA A;  1F9K A;  3O1U A;  3OSD A;  4D8M A;  1W6M A;  4Q4X 1;  1LOB A;  3KCC A;  4UF0 A;  2IWG B;  4Q1P A;  1QOO A;  3NNM A;  3MV0 1;  1TNR A;  2KM2 A;  5HBA A;  4I02 A;  3ZKU A;  3ZN6 B;  1SAC A;  3ILN A;  2O8Q A;  2WQ4 A;  3FWE A;  4SBV A;  3UV9 A;  2P3K A;  5IK4 A;  1A8M A;  1UX6 A;  2CV6 A;  2JEN A;  5CG8 A;  2ZAA A;  1DQ6 A;  3U4S A;  3Q8A A;  1VAL A;  5TSW A;  2QZ3 A;  3ZFF C;  1EV1 2;  4MGK E;  4J6G A;  3UKV A;  4CEW C;  3BTX A;  1TMF 2;  5D8A B;  1OA2 A;  1OLM E;  3AP9 A;  1AR9 2;  4NIA A;  1RUE 1;  2WAB A;  5HCB A;  1BBT 1;  2BNO A;  3ZVX A;  1SBD A;  4NRP A;  3IDC B;  1SLA A;  2UUR A;  1RMU 3;  3ZLI A;  4K7J A;  3I54 A;  3A4U A;  4XW3 A;  1R1A 1;  1X9P A;  1BEV 3;  1J1T A;  2XON A;  2Q8E A;  2E7A A;  4XMA A;  2PHF A;  3ZKY A;  4X8N A;  3R6S A;  1RUN A;  4LA2 A;  4FPC A;  4W50 A;  3JUU A;  4XFB A;  3ZPY A;  1VBB 3;  2ILM A;  2R07 1;  1IQA A;  4AVA A;  2UY9 A;  1UN1 A;  2WT1 A;  4MGY E;  4PBP A;  4KL1 A;  2Q1M A;  4GKX A;  4BQ5 A;  4UFJ A;  1C57 A;  2HWB 2;  3CJI C;  3JQW A;  2Y0O A;  2VZ3 A;  4UF0 B;  3AMM A;  5CYY A;  5F3C A;  2XLG A;  3LFI A;  3ZO0 B;  5K4L A;  1W6O A;  5EIY B;  1FNY A;  1V6K A;  4P9X A;  2PAE A;  4GZ9 A;  3KT4 A;  3B9I A;  4EZH A;  4M3C A;  1JZ5 A;  3I7D A;  4QWN A;  5EWS A;  3ZFG C;  3WNK A;  1JYX A;  5FYC A;  4AED A;  1PNF A;  4YVS A;  3MIB A;  4RA0 A;  2VVE A;  3MI8 A;  5A3U A;  1RUF 2;  2IZW A;  2PQQ A;  1BZW A;  2W1S A;  1XNB A;  2WRA A;  1YI7 A;  4GB3 2;  2JJ6 A;  4Q1R A;  4RYD A;  3C8X A;  1PMH X;  1XNT A;  4GD4 A;  4QX0 A;  3W21 A;  3GF6 A;  4ZY9 A;  1D0H A;  4OUL A;  1QOT A;  4AW7 A;  4LHN A;  1IS6 A;  2R06 3;  5FY5 A;  4CU9 A;  1HQN A;  1VBE 1;  4JKL A;  1JUI A;  5J09 A;  4PI2 A;  5I0S A;  2VNG A;  3RI8 A;  2W9X A;  5FZA A;  1NA1 A;  4QX1 A;  2P5B A;  3KS7 A;  3ITQ A;  2VAU A;  3WF3 A;  5JZG C;  5DZF A;  4FTE A;  2ZX2 A;  2YMZ A;  3RNS A;  2GH2 A;  3B02 A;  3P3N A;  5FYB A;  1JS9 A;  1JYW A;  2KXL A;  1OLQ A;  2ES3 A;  3PJQ A;  3G6J B;  3DEM A;  4OMD A;  4RFT 0;  4UW4 A;  1EPZ A;  4Q4V 3;  5FQ0 B;  4F3J A;  2Y6J A;  5F5I A;  1SHW B;  2WA4 A;  4EWA A;  2AEN A;  5C3O A;  5G05 L;  2AR6 A;  3DXT A;  4RS5 A;  2DU0 A;  4MET A;  4YG3 A;  1IS4 A;  3U10 A;  1REE A;  3UET A;  4ASL A;  2Y34 A;  2NP0 A;  1CJP A;  3N9L A;  4YW2 A;  3AM2 A;  3EMR A;  1JU4 A;  2D43 A;  3I2K A;  1ZZB A;  1C4R A;  2HWC 3;  4A7Z A;  1HRI 3;  1UOJ A;  4YVW C;  1HV0 A;  4YGD A;  5IVE A;  3O12 A;  1PM4 A;  4P5Y A;  3KVA A;  4GMP 0;  1POV 3;  4P5H A;  4AOC A;  3DGT A;  1UZV A;  2W95 A;  1SZB A;  4MGT A;  1AXZ A;  5CU1 A;  4K9S A;  4P02 B;  1PGL 2;  2CTV A;  1ULC A;  4L2N A;  1JHN A;  1V6N A;  4WM7 A;  1OBN A;  2RR1 2;  1FAY A;  1RL3 A;  2W87 A;  4N90 A;  3TOJ A;  2YDE A;  4YW4 A;  3WDT A;  4XTP A;  1J1L A;  2D5H A;  1BBT 2;  2ORX A;  3RGB A;  5L7O C;  3CEW A;  4GXL A;  2R30 A;  2R06 2;  1UXZ A;  3R4S A;  4QHB A;  3ZR5 A;  1CAX A;  2P17 A;  3H9A A;  2GC0 A;  1RTV A;  3C7F A;  4LHS A;  2UWB A;  4FPE A;  3M3C A;  4QGL A;  2PHR A;  3H0O A;  5JI7 A;  1L3J A;  4XFF A;  4BXF A;  2DCY A;  5BY5 A;  2ZAC A;  1UYY A;  1A78 A;  3O7O A;  2AC1 A;  4N43 C;  3RMY A;  2R0H A;  4BH9 A;  2ZJC A;  2JDP A;  1Y9Q A;  2OZJ A;  2QQO A;  3DPR B;  5A32 A;  1OOP B;  1AR8 2;  1UU6 A;  1QJX 1;  4GWI A;  4AR2 A;  3FLP A;  4BPZ A;  1H4G A;  2J1S A;  4QHO A;  5EV7 A;  5FZE A;  5IFT A;  1IS5 A;  1NCR B;  2RDS A;  4XHB A;  3VBU C;  1RC6 A;  2WL1 A;  3ON7 A;  3TBD A;  3CDZ B;  4DXS A;  5A33 B;  1RIR A;  3BPS A;  3WDW A;  2D5F A;  3HQX A;  1H8T B;  2ARC A;  4IW3 A;  5CG9 A;  4LIT A;  3THD A;  1OF4 A;  5FZG A;  3WD5 A;  3CKH A;  5IW0 A;  1DDL A;  1QJY 1;  2BU9 A;  4ISQ A;  4CSW A;  1QH6 A;  2XHN A;  4A42 A;  3U78 A;  1GBG A;  3KM5 A;  2CWS A;  2A5Z A;  2JB4 A;  1H2M A;  1PNG A;  2XUM A;  3UJO A;  3WNN A;  4NR1 A;  1DZQ A;  2RS5 1;  1UOB A;  3ATG A;  1OPO A;  5A3O A;  2WDB A;  3WXP A;  4AEK A;  1VBE 3;  1XXN A;  3J7M A;  1C3H A;  2P34 A;  3O1R A;  2WFP A;  4A3X A;  2CGP A;  3I4I A;  3OUJ A;  4PHZ A;  4Z8B A;  1WZX A;  5BNP A;  1ENS A;  1EYB A;  3I2J A;  5I0D A;  4FO9 A;  4QB1 A;  3IAQ A;  2CNA A;  1Z7S 1;  1BMV 2;  1QWR A;  3I2D A;  4HL0 A;  1I5P A;  1C1F A;  3WNO A;  1HN1 A;  1PMI A;  1MS8 A;  3IIA A;  4AVS A;  3AB0 A;  1C1L A;  4ZU4 A;  2JEC A;  2Q4S A;  2WZP P;  4D69 A;  5LEK A;  1UPI A;  5FPZ A;  3N7K A;  5FZ1 A;  3G7D A;  1GFF 2;  4IUG A;  3WV6 A;  1NQD A;  2GMP A;  3KV4 A;  1MS5 A;  5HXM A;  4R8H A;  3LE0 A;  4YGE A;  3WY6 A;  4CYD A;  4D0Q A;  5JAX A;  2Y26 A;  2E31 A;  3NL1 A;  4BK4 A;  4QXK A;  1LGC A;  5L9V A;  5LWB A;  1RJ8 A;  1JU3 A;  2VVD A;  5JXJ A;  2GU9 A;  1VRH 1;  2BWA A;  3K46 A;  5KXC A;  2VL4 A;  2BNM A;  1GZW B;  2CAV A;  2WFF 3;  3AMH A;  5E8A A;  4NHL A;  3TYJ A;  2VZS A;  2ZKL A;  2VZR A;  4OUM A;  2VEC A;  3MIH A;  5H9P A;  3WW4 A;  1GMM A;  1Q8P A;  1W9S A;  2QKD A;  2WNU C;  4FPJ A;  1E5H A;  1BCX A;  1N1V A;  4MHU A;  1AF9 A;  1UYZ A;  3KHB A;  1RHI 1;  3LIG A;  4Q4W 2;  3WZ1 A;  1IPJ A;  4MXW A;  4YG6 A;  2A6V A;  1K42 A;  3WNP A;  1ONA A;  3JBG 2;  4KBB A;  1X36 A;  3OD4 A;  4M4P A;  1LU1 A;  2FCV A;  4AAP A;  4AFC A;  4XJZ A;  1YI9 A;  1QJU 2;  4CDQ B;  3I3D A;  3I2I A;  4TSV A;  4WVZ A;  3WG4 A;  1YFX A;  3E5X A;  4I3P A;  4JTO A;  4XE9 A;  4AHX A;  1IQD C;  1LOG A;  4QGN A;  5T3N A;  4OHZ A;  2VMC A;  2JB8 A;  3NV1 A;  5JCT A;  5JI9 A;  2FDG A;  5C3R A;  2D3P A;  3I2G A;  1LES A;  1RUC 2;  2XHK A;  4N9I A;  3H3L A;  5CVR A;  5FYS A;  4LBO A;  4SLI A;  1UAI A;  4NII A;  2O8O A;  4CP9 B;  4YW7 A;  4I09 A;  3ENR A;  5BNO B;  1JYT A;  1GZW A;  1QJY 3;  2JDN A;  4QXB A;  2BGC A;  1KXG A;  4LMF A;  5FJH A;  1JI6 A;  5FP8 A;  2BER A;  3U14 A;  4EWD A;  1KIT A;  3TWI A;  4CCD A;  3WT3 A;  2TNF A;  1UMI A;  3LA3 A;  3KHC A;  2WWU A;  2RDN A;  2ZAB A;  1W9Y A;  3HVD A;  1G86 A;  3ES4 A;  1DHK B;  1VBB 2;  3K51 A;  4FI9 A;  3J4U H;  1GNY A;  5GLU A;  3WG2 A;  4AVC A;  1SLT A;  2AH2 A;  2RG4 A;  1CN1 A;  4NPM A;  2PAK A;  4CDW C;  4Q4X 3;  5FO9 B;  5J37 A;  4OMC A;  3BU0 A;  5BPX A;  1Q8O A;  1RUE 2;  1HXS 1;  2K2S A;  4N53 B;  1KEX A;  3I3E A;  2AUY A;  5F6L B;  1DQ1 A;  4FOY A;  5JZG B;  1W8H A;  1ZNP A;  2C0Z A;  4K6B A;  5EFU A;  3ZXA C;  4JDN A;  3GJB A;  3SCH A;  3VBH B;  2DBN A;  2VO5 A;  3NAP B;  2CSG A;  2CWM A;  3A22 A;  1WD3 A;  3E5Q A;  3QH7 A;  3SHR A;  2RS1 3;  2XBO 1;  2BUK A;  4EWE A;  2GME A;  2P3I A;  5DQ0 A;  1S0D A;  2WYF A;  1VB2 A;  4AGG A;  1C8M 1;  4CCO A;  5CA6 A;  1OUS A;  4MHR A;  3H7J A;  3POB A;  1ZZ6 A;  1XE0 A;  1ULD A;  4E4H A;  4F7Z A;  4Q8L A;  2WZ8 A;  4YZ5 A;  1NE4 A;  5JMC A;  2PHU A;  1ND3 C;  2NPI A;  5CKQ A;  2GND A;  4ZZ5 A;  3F95 A;  2VNR A;  1VRB A;  4JGY B;  5C3Q A;  4TN7 A;  5KWR A;  3HAG A;  2LAL A;  2WFF 1;  5DUU A;  2FQP A;  2RS1 2;  3NST A;  1Y7B A;  3WDX A;  5IHR A;  5FY7 A;  4JDO A;  2OII A;  2RMU 2;  2Z2S B;  5HI0 A;  3WIN E;  3LFM A;  3WCS A;  2ZHM A;  4CDQ C;  5AFB A;  4HKO A;  3VD9 A;  4XPV A;  4XOG A;  1LOF A;  2ZGS A;  1NLS A;  4BQ4 A;  1KD7 A;  3ZPO A;  1SDW A;  3MUZ 1;  5C71 A;  3ST7 A;  3OTF A;  1W8N A;  4HOO A;  2IXH A;  5C7G A;  1NLR A;  4XFG A;  1PO1 2;  4Q4Y 1;  4AI8 A;  2OVU A;  1HRI 2;  1QJU 1;  1ZYB A;  1QGL A;  3VBH A;  4EN0 A;  3OPT A;  4NMI A;  4EN6 B;  5CFC C;  1S2K A;  3RZG A;  1DP0 A;  5E89 A;  3WQ0 A;  1QY4 A;  1B35 B;  4M0N A;  2HWE 1;  2Y60 A;  2MNG A;  5T52 A;  1CIY A;  2JWP A;  5K0U A;  5JMO A;  1SPP A;  1VE0 A;  5KHJ A;  1WCQ A;  2HBT A;  2PYT A;  3GYD A;  3QLQ A;  1YFW A;  5CKM A;  1RJ7 A;  1TE1 B;  4EQV A;  1UPS A;  1ZM1 A;  3DPR C;  4JQR A;  3GHN A;  3IN9 A;  5IVV A;  2VBB A;  1JZ6 A;  2XR4 A;  3T4H B;  2R06 1;  4BB3 A;  4NAM A;  2ZXQ A;  1REF A;  5LA9 A;  1ZRF A;  2WNO A;  3RJR A;  4QKB A;  1AXY A;  2JE7 A;  2WC2 A;  4IE7 A;  3GBF A;  3I49 A;  1DGW A;  4LBK A;  2QQV A;  4GMP 1;  4ONU A;  5CEH A;  3NAP A;  2GNM A;  3PUS A;  3GJA A;  1YC6 1;  3JBG 1;  4A44 A;  1PZ8 A;  2WO2 A;  2X5I B;  3VBR C;  5FQ0 A;  5HCH A;  1DF0 A;  3AP5 A;  4Y26 A;  3FLT A;  3N4M A;  1XU1 A;  3BPZ A;  4NRM A;  1UZ0 A;  1UYP A;  2HYX A;  5C8C C;  2QDN A;  1W6Q A;  2JIG A;  4B4P A;  3OYW A;  4LEJ A;  2X5I A;  3NQH A;  1HXS 3;  3PNA A;  1GOF A;  2YGM A;  4GWM A;  2YZ4 A;  4L9B A;  4LBL A;  5SV5 A;  1RB8 G;  1HRI 1;  4JGY A;  5FPV A;  2YBS A;  4OHV A;  4WM8 A;  1AYM 3;  1JZ3 A;  1JYN A;  2K0G A;  4YNI A;  4IV1 A;  4LO8 A;  4I0B A;  2OXB A;  4B1M A;  4IEO A;  1MVQ A;  4HZF A;  2RR1 3;  1AYN 3;  2N7G A;  1GKB A;  4Y1U A;  1JZ7 A;  2XB6 C;  2JKB A;  1HLC A;  4B8E A;  1WCS A;  5H9S A;  3ACG A;  1E5R A;  4QDR A;  2P4E A;  3VDD A;  1KRI A;  3K48 A;  4YW5 A;  5F5A A;  2W46 A;  4Y1V A;  4D7T A;  1T6B X;  2HYK A;  5FP7 A;  3CNA A;  2UWA A;  4H7L A;  1KDK A;  5FPB A;  2VZV A;  1DBN A;  4PLO A;  5GLT A;  1UY0 A;  2YYO A;  3O0X A;  4YZ2 A;  5BNO C;  5IVB A;  2HWC 2;  4YYO A;  1NZC A;  4IEX A;  4J1W A;  1W8U A;  2ZGL A;  3AZZ A;  3N35 A;  4N43 B;  4XFI A;  1HB3 A;  3M70 A;  4XMI A;  1C5I A;  5FMD A;  1XYO A;  4E2G A;  3WW2 A;  3MIE A;  3POY A;  5ACA 1;  4FOV A;  3UJQ A;  4OI0 A;  5EJZ B;  4GIQ A;  2JDU A;  1SPP B;  5K7P A;  2G19 A;  4BK5 A;  4ATE A;  4DNY A;  1K45 A;  4PCR A;  5T5O A;  1DU3 D;  1MPX A;  2W39 A;  2QQN A;  2DBI A;  2RS5 2;  1O4Y A;  1H8V A;  1W6Q B;  1EUU A;  2J42 A;  4DIN B;  3S57 A;  1ULE A;  4M01 A;  1OC1 A;  2PEL A;  3MID A;  4YM3 A;  3MUY 1;  3VHO A;  1OA3 A;  1W6P B;  2WLQ A;  5FZM A;  5EYY A;  3O1S A;  1QJU 3;  3DL3 A;  3PLQ A;  4ORF A;  4PLN A;  1XU2 A;  4Y5S A;  3OBA A;  1J59 A;  3P5B A;  3AFK A;  4IV1 B;  1ND3 B;  1BK1 A;  1XNA A;  3WCR A;  1GU3 A;  5JSR A;  2RS5 3;  4MGZ E;  1YFU A;  5FBJ A;  1UCX A;  4AQT A;  3MW3 A;  2GC1 A;  1JYC A;  1NLQ A;  3HNM A;  4NE9 A;  3C7E A;  4AHW A;  4BE3 A;  3I3Q A;  5KR7 A;  4L11 A;  2NN8 A;  2QZ2 A;  3OYW B;  4IEY A;  2VMG A;  2Q1F A;  4M3C B;  4Y1Y A;  1YQC A;  2XJQ A;  1AZD A;  1US3 A;  2YFU A;  2OYZ A;  3HIF A;  2R7E B;  4LLO A;  3JQX A;  3J9S A;  1W28 A;  1NOV A;  1W2U A;  1W90 A;  1F35 A;  1O4T A;  2XLF A;  5GZF A;  4CUC A;  2LUW A;  1CAX B;  2DYC A;  2EID A;  5I93 A;  5F37 A;  1AR6 1;  2QQK A;  2A6W A;  3RPQ A;  4AG4 A;  4CXX A;  3RSJ A;  3H7Y A;  4K3U A;  4X6Q B;  4XDO A;  2ZCW A;  4URA A;  3JD7 1;  3D0J A;  1RUF 1;  1GP6 A;  2B5H A;  1ND2 C;  2AEY A;  1ZVF A;  4B7E A;  2VC9 A;  3AP4 A;  2GC3 A;  4JRL A;  2GC2 A;  4KWK A;  3PL0 A;  5BUV A;  1H9P A;  1U12 A;  2I45 A;  3NVC A;  1U0A A;  4BQ1 A;  2ORZ A;  4Q0U A;  4QT6 A;  3FHQ A;  1J84 A;  1KJR A;  2VXR A;  4ISR A;  1X50 A;  1UKG A;  2J22 A;  2AAC A;  2HWE 2;  1D2Q A;  2HWF 3;  1K5M B;  1MZ6 A;  3H50 A;  4IE0 A;  2GN3 A;  1O8S A;  4UXA A;  1W8T A;  2ZGU A;  4W6X A;  3ZFG B;  3VLB B;  4TZD A;  4QKF A;  3VGI A;  5C4W A;  2FDH A;  1FI2 A;  1PIV 2;  1RHI 3;  1US2 A;  5FZL A;  5FZD A;  4PQ9 A;  4WVW A;  5KXB A;  4LOT A;  1AJO A;  1VB4 A;  1YQ5 A;  4FAH A;  2YHJ A;  1X8E A;  2YRO A;  1QDC A;  1POQ A;  2YU2 A;  3SXW A;  3ZIW A;  5DMY A;  3KCY A;  2DUQ A;  4QX3 A;  4LO4 B;  4EN7 B;  1O8P A;  2OX0 A;  3VKO A;  2IC1 A;  1T6G C;  4CEY C;  5J98 B;  3ZYI B;  3CIH A;  2VW1 A;  2EAA A;  1F4H A;  3JU9 A;  3ME2 A;  3AXD A;  4OLL A;  1YIF A;  5D1I A;  4FPL A;  3HWJ A;  5J1X A;  3MPP G;  4LO7 A;  4XF4 A;  3M2M A;  2WFF 2;  2WA3 A;  4A2U A;  4H55 A;  4Q0Q A;  2G9G A;  3PUR A;  1GNH A;  3BYW A;  4A3Z A;  1I5Z A;  4TWT A;  4UWD A;  5HXV A;  1W2T A;  4XAE A;  3HQR A;  1NYW A;  1K5M C;  1R64 A;  1MZE A;  3B94 A;  4MO3 M;  4A41 A;  2GP5 A;  3NV2 A;  4KU8 A;  1BHG A;  4PIZ A;  4HMZ A;  2EXH A;  2XJR A;  2WT0 A;  4FP2 A;  4D7S A;  1AHS A;  2CYF A;  3RZK A;  4XF0 A;  4JHZ A;  4NWV A;  1ZRR A;  5JUV A;  1AR6 2;  3PUH A;  1CPN A;  1LEN A;  3V0B B;  1BKZ A;  3FJS A;  4XCA A;  5FLH A;  4DEV A;  1GQH A;  1G9B A;  4KWL A;  3THC A;  2GP3 A;  1FMD 2;  4UW6 A;  3POJ A;  3TEW A;  5FZI A;  1CAV A;  5FY4 A;  2Q0A A;  4IGO A;  1O3R A;  1YUD A;  2PAM A;  5FLJ A;  5A7N A;  2MHF A;  2IFW A;  4HG6 B;  3WLU A;  2FDF A;  3VKF C;  2IVI B;  4FOQ A;  1GIC A;  1D4M 3;  3BTY A;  4LA3 A;  4HAN A;  4MAD A;  1QXP A;  2WNE A;  4S2G A;  1LRH A;  1FT9 A;  4MG2 A;  5F5Q A;  5FJK A;  1LR5 A;  1L7R A;  4HSJ A;  1POV 1;  1V6I A;  5BYN A;  4WZC A;  5APA A;  1V9U 1;  5KBF A;  3WUD A;  4H7M A;  3IMN A;  2E7T A;  2IXI A;  4XIK A;  3LEI A;  3MEP A;  3VBF C;  4CCM A;  5LBC A;  4IEV A;  5IVJ A;  1FAT A;  2D3S A;  4HK9 A;  3ZOI A;  2W3J A;  4C0H A;  5DAW A;  1PK6 C;  3IWZ A;  5EHD A;  4NRO A;  3S30 A;  4E8D A;  5KC5 A;  4AFA A;  3VZJ A;  3GCW A;  1CZS A;  1PHM A;  2ZHL A;  4RSU A;  1EY2 A;  2ZS6 B;  4DO0 A;  1OOP C;  1YCI A;  4EN8 B;  1PZ9 A;  4XJ9 A;  3AYE A;  4XUP A;  1OHF A;  4LE3 A;  4YVS B;  2QQM A;  3ZR6 A;  2RE9 A;  5J48 A;  4FTB A;  2VNV A;  1NUK A;  2W52 A;  1W2A X;  1I1E A;  2P3Y A;  1COV 1;  3DF0 A;  3O5S A;  3WF4 A;  2DVD A;  5FY8 A;  5CAD A;  4DIQ A;  5C9A A;  2I07 B;  3SH3 A;  2CL2 A;  2X29 A;  5LBB A;  4L92 A;  3J7N A;  3TN9 2;  1QJX 3;  1R08 1;  1SEF A;  4UW5 A;  2EF6 A;  4E2Q A;  4M3C E;  4QD2 A;  3AXE A;  5K9Y A;  1RUJ 2;  4CCL A;  1HRV 3;  2D7F A;  2P6H A;  3KMH A;  2ZAH A;  1OQD A;  5JSP A;  3AP7 A;  1L7Q A;  1SDD B;  3E5U A;  2WR9 A;  3SH4 A;  4UT5 A;  4I0A A;  3C2U A;  2ZZJ A;  2V5Y A;  3BU7 A;  1RYY A;  1N1T A;  3APB A;  3KF3 A;  4XF1 A;  2W2I A;  3JCI A;  2NM1 A;  2R04 3;  5D21 A;  3T4V A;  1OKQ A;  2NYY A;  3I59 A;  4S2H A;  4B7K A;  5IK8 A;  1C8M 2;  1CAV B;  1QJX 2;  2Y6F A;  3KB5 A;  5T5J A;  3ZDS A;  5GZD A;  1HJF A;  2XWJ B;  1G7Y A;  1UZY A;  5C70 A;  4YG0 A;  1I6X A;  3KT1 A;  4Q4X 2;  2YV8 A;  1OVS A;  2PN5 A;  5A3N A;  1MS3 A;  4CCC A;  1F2N A;  4LIU A;  3KQ4 B;  3VD7 A;  2AZ5 A;  1JOP A;  4KH9 A;  4XBQ A;  5AVP A;  2H0B A;  2WO3 A;  1RUC 3;  3PJY A;  1W6M B;  4I01 A;  5A3W A;  2O14 A;  4GAZ A;  3A0N A;  1OD5 A;  3LOI A;  1MZ5 A;  4GH4 C;  5EZW A;  1Z7S 3;  2VUL A;  2NMN A;  4V2V A;  3BKZ A;  2RJK A;  5ANQ A;  5C5U A;  2Z5W A;  3MF6 A;  3ZN6 A;  1BQP A;  3OJB A;  5KXE A;  5D8A C;  2Y6K A;  4KI5 M;  1FV2 A;  3QAC A;  4PIX A;  2ARA A;  5JR7 B;  1V70 A;  3OEB A;  2ET1 A;  2IXL A;  4UBH A;  2ZEY A;  2VMH A;  3QD6 A;  2VQU A;  1RUE 3;  3FHI B;  1COV 2;  3O1M A;  2V09 A;  3IDB B;  5CZK A;  4ZS3 A;  4D6S A;  1LHN A;  1V6M A;  4I3G A;  4K1Z A;  3L2Y A;  1AYM 1;  4FT8 A;  3LDK A;  4ZU5 A;  2OW4 A;  3WG1 A;  1RUG 1;  1BXH A;  2DFB A;  4YRD A;  4Q8K A;  2PA7 A;  1PGW 1;  4LKF A;  1WA4 A;  5JXI A;  3O0V A;  1AYN 1;  4HN0 A;  4A4A A;  1LNS A;  5AC9 1;  4GAL A;  2CU5 A;  4O65 A;  1NCR A;  1VR3 A;  2ARX A;  1W05 A;  3OGR A;  5FAX A;  5FIX A;  4UFM A;  4N9H A;  2AEZ A;  3GBW A;  4YZ1 A;  2DCZ A;  3NWK A;  4UFI A;  4QPI B;  2VGD A;  4CRQ A;  5FP9 A;  1SFY A;  1HX6 A;  3ASI A;  3ACH A;  3TEX A;  1CAU B;  4B1L A;  5DDJ 1;  4BCU A;  5FV3 A;  5DUW A;  3ZFF A;  4AVB A;  1F15 A;  3UKN A;  4BWO A;  3WG3 A;  2WII B;  1OUX A;  4K1Y A;  4CP2 A;  3HN1 A;  3WVJ A;  3K3N A;  1VJ2 A;  2EIG A;  4A45 A;  2FCU A;  1ALY A;  1LHO A;  3FE5 A;  5FPX A;  1WCD J;  2Z69 A;  2AGS A;  4MXV A;  1R08 3;  3RYP A;  4WVV A;  3O1P A;  1OH4 A;  4QQH A;  5FMO L;  4BZ4 A;  3U07 A;  5BNP B;  1SCS A;  3POI A;  3HMY A;  4PJY A;  1HRV 1;  2VZT A;  2ERF A;  2QQL A;  1LOC A;  5J7M A;  1J3Q A;  3H1M A;  3KT7 A;  2F6B A;  4P9I A;  2QQP A;  1X9T A;  1WLW A;  3FFQ A;  2WLP A;  2B9U A;  3WQ1 A;  4C1W A;  4RR3 C;  2E9Q A;  3AZX A;  3VD3 A;  1FYU A;  3CO2 A;  1S0I A;  3PUA A;  1GP4 A;  3SCG A;  4CUB A;  3CJI A;  3UES A;  2H6C A;  1XSQ A;  3PUQ A;  3Q8B A;  4R9C A;  2FDJ A;  4CVU A;  1NG0 A;  2BZD A;  5FPL A;  5A1F A;  4BIS A;  5C6C A;  3E97 A;  2R1B A;  1TEI A;  4P9Y A;  1O7F A;  1DQ0 A;  4AED C;  1WW6 A;  5A7O A;  3O1O A;  5A7S A;  3B01 A;  3ZXJ A;  2HKX A;  5EXO A;  1H8T C;  5E1R A;  1STM A;  1Q56 A;  4Q29 A;  3LEG A;  1K3I A;  2VU9 A;  4S2D A;  3VHR A;  2XGX A;  4OQ8 A;  2YC2 A;  2BYV E;  3CJI B;  1JZ2 A;  1UWW A;  1UNB A;  2WN2 A;  3LCP A;  4IEQ A;  5DAP A;  1GWM A;  3FBY A;  2XWB B;  3FFZ A;  1ZZ9 A;  2YXS A;  3JD7 3;  5I8S A;  5H9R A;  4JKM A;  4ZU7 A;  2PFW A;  3AP6 A;  3FHA A;  1EV1 1;  2IXC A;  1ULP A;  1WUV A;  5FUI A;  3VDA A;  1VBA 1;  5BV6 A;  1PVC 2;  3PHM A;  3M1H A;  3ZDV A;  5KXD A;  5F5C A;  4WM7 B;  3U11 A;  1VBA 2;  3NJV A;  4AFD A;  4ZHN A;  5GLW A;  2VR4 A;  4UI9 L;  1AYM 2;  3IB3 A;  1MS1 A;  2J1V A;  4CE8 A;  3ZFF B;  1RUG 3;  2KA3 A;  2PLV 2;  1AR7 2;  4KWJ A;  4NWW A;  1KFX L;  3WX5 A;  5L19 A;  3Q9O A;  4PT6 A;  5CFD C;  5GKA C;  3VZL A;  2VPV A;  4XUQ A;  5DZG A;  3RS6 A;  2HEW F;  3V0A B;  1H6X A;  4XJ8 A;  1SBE A;  4Q26 A;  4CP1 A;  3ES1 A;  2SLI A;  4QX8 A;  4YVW A;  2P1B A;  4R4X A;  2Z42 A;  1XC6 A;  2Q8C A;  5EJ1 B;  5A32 B;  1IGO A;  3MV1 1;  1YEW A;  3DYP A;  3MGU A;  4FPY A;  4Q4Y 3;  2F17 A;  1R09 3;  3OBZ A;  1DGR A;  1UKR A;  2B39 A;  2LRP A;  1D0G A;  3KF5 A;  5FZ6 A;  3GGL A;  2XXZ A;  3KVB A;  5A7W A;  4ET7 A;  1AL2 1;  4N8M A;  4CUG A;  1ZA4 A;  1X7N A;  4WM7 C;  2RDR A;  1UO9 A;  1R1A 2;  3K4Z A;  5LCW L;  3GCX A;  4YVW B;  1OFN A;  2BQP A;  3NW4 A;  1WMF A;  3RDI A;  4Y20 B;  4Z82 A;  4Y33 A;  2DVG A;  1F31 A;  3T3Y A;  2YFZ A;  4H2A A;  4D7Y A;  4LBQ D;  1DYK A;  3OGS A;  4Q0S A;  1WD4 A;  1H2N A;  3MBW A;  1E57 A;  4XZU G;  1QXJ A;  1MR5 A;  3B69 A;  4P9W A;  3E1F 1;  2BGO A;  1NT0 A;  2A3Y A;  2VCB A;  3AVS A;  5ANN A;  4QGM A;  4GMP 3;  4N43 A;  4LBM A;  1UZZ A;  4Y1X A;  3U1X A;  4AED B;  1YHF A;  2WS9 1;  5BNN C;  1C8N A;  4KG0 A;  3UGG A;  1J58 A;  3P6B A;  2VOX A;  4IND A;  1LHV A;  2YB7 A;  5F3G A;  3U37 A;  4LT5 A;  1R08 2;  2JG8 C;  2WJS A;  2ZHK A;  1W9F A;  2B8M A;  3VBU A;  5JIU A;  3NO8 A;  2QFE A;  2Z79 A;  1N3P A;  2RV9 A;  4NO4 A;  1CGP A;  2IUW A;  1D4M 2;  2PXJ A;  3N9P A;  1LU2 A;  4RGA A;  5FZK A;  5F7U A;  5GZC A;  1VP6 A;  4UFH A;  2CGO A;  4K8F A;  1D4M 1;  3J7H A;  1OXC A;  3IPV B;  4LE4 A;  4MUV A;  4MH0 E;  4FFH A;  4AI9 A;  4N7U A;  3WHU A;  1VRH 3;  3BIE A;  1PO2 3;  1OKO A;  2R0F A;  1AYN 2;  2E7Q A;  3ZFE C;  1Q8V A;  2W68 A;  1NCQ C;  2DCK A;  5IVF A;  3ZSJ A;  3T2P A;  4HON A;  1JBC A;  2ZGQ A;  3VBS C;  3H8X A;  2A7A A;  1DQ2 A;  1U5X A;  2YC4 A;  4CEY B;  1TNF A;  1W0O A;  4XF9 A;  5DUV A;  2VMD A;  1VBA 3;  5BNP C;  2Y6L A;  3O14 A;  3TRS B;  3RG0 A;  5FOJ B;  3OBT A;  1WLT A;  2R6Q A;  1DGL A;  1OLM A;  2E51 A;  4IET A;  4CPB D;  1UIK A;  3N7L A;  1J3R A;  1QQP 2;  4DXZ A;  3H8O A;  4NHK A;  5IWF A;  3ZN4 A;  4A6S A;  5JOW A;  3POF A;  4FVV A;  4Q0P A;  3BVC A;  3PVB B;  4CDU A;  4XQW A;  3B7M A;  1Q43 A;  1XRU A;  1CX1 A;  4NRQ A;  2BTV C;  2WWS A;  3WP4 A;  3WP6 A;  2OPW A;  2RM2 2;  4CDX C;  4RQP C;  4LO6 B;  4LBQ A;  3JXS A;  4AHY A;  2OS2 A;  3MW2 A;  5J96 B;  4PIY A;  3VBO C;  4CCN A;  3U0Z A;  3PU3 A;  2GZW A;  2W1U A;  4OFG A;  4QDS A;  1ULF A;  1CAW A;  1O5L A;  3Q8C A;  1R09 1;  1GOG A;  4CUA A;  1P8J A;  1W03 A;  2BWC A;  4D6Q A;  1AL2 3;  4E4D X;  1LKN A;  5L7O B;  1RVF 1;  2BW8 A;  3FUQ A;  3LA2 A;  1AR9 1;  3D5O A;  4HET A;  4IES A;  4NN0 A;  1Y9M A;  2R04 1;  4LJH A;  4ZZ8 A;  4J1X A;  2J1R A;  2UY8 A;  1DGW X; 
#chains in the Genus database with same CATH homology
 3HNY M;  4OUE A;  4MOA A;  1JZ8 A;  3MUY 1;  3SKV A;  2J1A A;  3CZJ A;  3WF2 A;  2E32 A;  3OBA A;  2VME A;  4QX2 A;  5A1A A;  1XNA A;  1YQ2 A;  1W9T A;  1UY3 A;  3A7Q A;  1GU3 A;  4OYU A;  1OD3 A;  3HNM A;  3C7E A;  3T08 A;  4LKS A;  3C7O A;  2RVA A;  2YFU A;  1US3 A;  2VZQ A;  2R7E B;  2DCJ A;  1H6Y A;  2QQI A;  1W8O A;  4DUV A;  3LEK A;  2VM9 A;  3NNG A;  4CUC A;  2C26 A;  1UMH A;  2EID A;  2VZ1 A;  2QQK A;  4P00 B;  4AG4 A;  4D8M A;  3VD4 A;  2BGP A;  2VC9 A;  2W92 A;  3MV0 1;  3SKJ E;  3HOB A;  3HJR A;  3WEZ A;  2ORZ A;  2V72 A;  3FHQ A;  1J84 A;  3OGV A;  2C4X A;  2J22 A;  3D3A A;  5B4X A;  3PUI A;  1O8S A;  3WQB A;  1D7P M;  2WAB A;  3LPG A;  1US2 A;  2WN3 A;  2V5D A;  2WO1 A;  2XQX A;  3K77 A;  5DMY A;  2XON A;  4QX3 A;  1O8P A;  2W1Q A;  4W4Z A;  3CIH A;  1F4H A;  4W50 A;  5J1X A;  3CMG A;  3IAP A;  2ZEZ A;  4UOJ A;  4A3Z A;  2VZ3 A;  5CYY A;  5EIY B;  4QB2 A;  1R64 A;  2J1U A;  4MO3 M;  4GZ9 A;  4A41 A;  1JZ5 A;  1TVG A;  1BHG A;  3WNK A;  2XOM A;  1JYX A;  4BJ0 A;  4JHZ A;  5JUV A;  3WSO A;  3WNL A;  3PUH A;  2W1S A;  3EB7 A;  4RYD A;  4DEV A;  3C8X A;  3K4A A;  3THC A;  1PMH X;  1XNT A;  4QX0 A;  3GM8 A;  2JKX A;  4ZY9 A;  4BXS V;  4RN5 A;  4CU9 A;  4JKL A;  4XUR A;  2X09 A;  2B9V A;  2W9X A;  4QX1 A;  3GDB A;  3CQO A;  3WF3 A;  4HG6 B;  4Z2A A;  2VCC A;  2QBX A;  3WF1 A;  1JYW A;  4MAD A;  1UYX A;  2JDA A;  4OMD A;  3OB8 A;  1L7R A;  2Y6J A;  1O59 A;  1SHW B;  2BBA A;  2JD9 A;  5G05 L;  2YG0 A;  1XPW A;  4LPL A;  3UET A;  2EIE A;  1PX3 A;  4QDQ A;  2C9K A;  3AC0 A;  3LEI A;  2VZU A;  1JU4 A;  3I2K A;  4E8D A;  2W3J A;  4DXR A;  1UY4 A;  3C7G A;  4P5Y A;  1CZS A;  3W5M A;  1GUI A;  2WYS A;  2W95 A;  4XUP A;  4XUN A;  1CZV A;  2QQM A;  4P02 B;  2CDP A;  1KGY A;  1NUK A;  2CDO A;  3WF4 A;  3ETP A;  2W47 A;  2W87 A;  3I97 A;  4MGS A;  1UY1 A;  2ORX A;  5JXG A;  3ABZ A;  1UXZ A;  2OKX A;  2ZEX A;  3C7F A;  2Y64 A;  4KWU A;  4ARY A;  4LHS A;  3HNB M;  1L7Q A;  5JXH A;  1SDD B;  3FN9 A;  3WNM A;  1UYY A;  1RYY A;  1OT5 A;  2QQO A;  1UXX X;  3GXU A;  2V4V A;  3DEC A;  4GWI A;  2J1S A;  5IFT A;  4DEQ A;  3CDZ B;  4DXS A;  2B4K A;  5C70 A;  2LS6 A;  2WQ8 A;  3IDA A;  5IYY A;  5LA0 A;  4UAP A;  3THD A;  1OF4 A;  3VD7 A;  3CKH A;  2WO3 A;  2XHN A;  3ZM8 A;  1ULO A;  4A42 A;  4DXT A;  3WNN A;  3NRU A;  3DYO A;  3T0D A;  4XUO A;  1W0N A;  2WDB A;  2Y6K A;  4KI5 M;  2ID4 A;  4CU7 A;  1F4A A;  3OEB A;  4KMQ A;  2ZEY A;  2VQU A;  3I2J A;  1JYV A;  3T2O A;  5I0D A;  3SEE A;  3T0A A;  4QB1 A;  3IAQ A;  5CZK A;  2KD7 A;  1I5P A;  3WNO A;  3I3B A;  2VMF A;  1HN1 A;  4M4R A;  4JX0 A;  1T2X A;  4QB6 A;  3A21 A;  5JXI A;  4IUG A;  1LNS A;  4A4A A;  4CU6 A;  2Y6G A;  5HXM A;  3LE0 A;  3OGR A;  2LW8 A;  4JKK A;  2E33 A;  3WF0 A;  4D0Q A;  1UX7 A;  1K12 A;  2E31 A;  2WBK A;  3ECQ A;  4BK4 A;  3W5N A;  1JU3 A;  5LA2 A;  1DYO A;  5JXJ A;  3K46 A;  2VL4 A;  3ACH A;  3K75 B;  2VZS A;  1PX4 A;  2VZR A;  3FL7 A;  1GMM A;  1W9S A;  1UY2 A;  1WKY A;  3UNP A;  1UYZ A;  2WZE A;  3LPF A;  4A45 A;  1K42 A;  3WNP A;  1OH4 A;  2W91 A;  4M4P A;  2VZO A;  2Y6H A;  2VZT A;  4MGQ A;  3I3D A;  2QQL A;  3I2I A;  4YPJ A;  4GWJ A;  4ARX A;  1IQD C;  2VMC A;  3T09 A;  1TG7 A;  3OEA A;  3VD3 A;  3HPN A;  3I2G A;  1JZ4 A;  4XUT A;  4CUB A;  3UES A;  3A23 A;  2W1W A;  1CZT A;  4CVU A;  2BZD A;  3NJX A;  2J1E A;  2VCA A;  1JI6 A;  2BER A;  1UMI A;  3LEG A;  1K3I A;  2EIC A;  4PF1 A;  2YC2 A;  1JZ2 A;  2WAA A;  1UWW A;  4FI9 A;  3C7H A;  1GNY A;  2WN2 A;  3K4D A;  2L9L A;  5HPO A;  5DPN A;  4JKM A;  4OMC A;  3FHA A;  4TXW A;  3HN3 A;  3VD5 A;  1KEX A;  1ULP A;  3I3E A;  5G04 L;  5FUI A;  3VDA A;  3DYM A;  2ZEW A;  3NJV A;  2VO5 A;  4LQR A;  2VOT A;  3A22 A;  2WUH A;  2VR4 A;  4UI9 L;  3IB3 A;  2J1V A;  5DQ0 A;  3BN6 A;  4PQQ A;  2EIB A;  2PQS A;  4PT6 A;  2J1T A;  4XUQ A;  3VDC A;  3T2Q A;  4DUX A;  1H6X A;  2WZ8 A;  4OZO A;  2X05 A;  4ZZ5 A;  4TTG A;  5IJR A;  1XC6 A;  5EJ1 B;  1GQP A;  3MV1 1;  5IHR A;  3VDB A;  3DYP A;  1W99 A;  4ZXE A;  1EUT A;  3GGL A;  3ACF A;  4ET7 A;  3III A;  3VD9 A;  1NX9 A;  3I2F A;  4A6O A;  1W9W A;  2Y8K A;  3K4Z A;  5LCW L;  2RJ2 A;  3MUZ 1;  5C71 A;  4E8C A;  1W8N A;  4QAW A;  5LA1 A;  5C7G A;  2YFZ A;  5B4N A;  3OGS A;  4BDV B;  3MBW A;  4XZU G;  1DP0 A;  2VTF A;  3E1F 1;  2BGO A;  2VCB A;  1DLC A;  2DDU A;  1CIY A;  5JMO A;  3ACI A;  1WCQ A;  4W8J A;  3P1I A;  1GOH A;  3P6B A;  1JZ6 A;  2YB7 A;  3U37 A;  1JHJ A;  4CU8 A;  2ZXQ A;  5DN2 A;  2W94 A;  1J83 A;  3SEP A;  1PMJ X;  2RV9 A;  1OF3 A;  5F7U A;  3J7H A;  4QPW A;  2E26 A;  4A44 A;  2WO2 A;  2X10 A;  1UZ0 A;  2HYX A;  2DCK A;  4L0P A;  3T2P A;  2QQJ A;  3NQH A;  3CZU A;  1GOF A;  2W5F A;  2YC4 A;  3LQC A;  2VMD A;  2Y6L A;  3HEI A;  2VJX A;  1JZ3 A;  2HLE A;  1NAE A;  1JYN A;  5JR2 A;  2Z4F A;  2VZP A;  1JZ7 A;  3T0B A;  3OG2 A;  3ACG A;  4QDR A;  1CX1 A;  2VQT A;  4P08 A;  3EYP A;  2W46 A;  3JXS A;  2WAO A;  2VZV A;  1SG3 A;  1UY0 A;  2J7M A;  4QDS A;  2W1U A;  3I2H A;  4XVH A;  2JE8 A;  3BGA A;  1GOG A;  1NKG A;  4CUA A;  1P8J A;  5EJZ B;  4BK5 A;  4AAX A;  4DUW A;  1K45 A;  1MPX A;  5IFP A;  2QQN A;  4ZZ8 A;  1EUU A;  3F2Z A;  2J1R A;  3MO4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...