2YG8A

Structure of an unusual 3-methyladenine dna glycosylase ii (alka) from deinococcus radiodurans
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
207
structure length
207
Chain Sequence
LPAVLPPLTDHAGAVAHLSRDPVLAQVTSLCGELPVLAPTPDPFGRLVRSVAGQQLSVKAAQAIYGRLEGLPGGVVPAALLKVSGDDLRGVGLSWAKVRTVQAAAAAAVSGQIDFAHLSGQPDELVIAELVQLPGIGRWTAEMFLLFALARPDVFSSGDLALRQGVERLYPGEDWRDVTARWAPYRSLASRYLWANSARMQAGGAPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-3-methyladenine glycosidase II, putative
publication title Structure-function studies of an unusual 3-methyladenine DNA glycosylase II (AlkA) from Deinococcus radiodurans.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Hydrolase
total genus 64
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 2yg8A02
1.10.1670.40 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Endonuclease Iii, domain 2 2yg8A01
4B24A 1MUNA 1LWWA 1NGNA 3CVSA 3G0QA 5KN9A 5AN4A 1YQLA 1EBMA 3N0UA 2NOEA 3D4VA 4B21A 5KN8A 1YQMA 3FHGA 4AI4A 3CW7A 1PU6A 1KG5A 2JG6A 1ORNA 3IH7A 1KO9A 4E9GA 2YG9A 1LMZA 1MUDA 4DK9A 1P7MA 2ABKA 3OH9A 4EJZA 4B23A 4YPRA 4EW4A 2JHNA 4UNFA 1YQKA 4EW0A 1FN7A 1KG2A 1KEAA 3CWSA 2OFKA 1WEFA 4E9EA 2YG8A 4OFEA 1DIZA 1N3CA 1MUYA 4E9FA 2NOLA 4HSBA 1HU0A 1ORPA 4YPHA 1KG4A 3N5NX 1N39A 1KG3A 2JHJA 2NOFA 3KTUA 3CVTA 2NOHA 1XG7A 3CWAA 3CWUA 4EJYA 2XHIA 2NOBA 3FSPA 4EA5A 1VRLA 3IHOA 1LWVA 4EA4A 1PVSA 4AIAA 3S6IA 3OH6A 1WEIA 1RRQA 3I0WA 1XQOA 1PU8A 1M3HA 3F0ZA 3OGDA 4E9HA 1P59A 1N3AA 3CWTA 1YQRA 1NKUA 1KG7A 3I0XA 5DPKA 1MPGA 2H56A 1KQJA 1RRSA 4OFHA 4AI5A 4EVVA 5CHZA 4UOBA 1XQPA 2NOZA 1WEGA 1LWYA 4YOQA 4B22A 4PIIA 3KNTA 2OFIA 1M3QA 2NOIA 1KG6A 3FHFA 3F10A 2I5WA 1PU7A 4OFAA
chains in the Genus database with same CATH superfamily
4B24A 2V75A 1MUNA 3S3MA 3OYJA 1LWWA 4ZTJA 1NGNA 3OYFA 3CVSA 4BE0A 3G0QA 5KN9A 3NNQA 3LCNA 3L2QA 4E7IA 5AN4A 1YQLA 1EBMA 3N0UA 2NOEA 3D4VA 4B21A 5KN8A 4BACA 1YQMA 3FHGA 4AI4A 3OYCA 3CW7A 1PU6A 1KG5A 5FRMA 2JG6A 1ORNA 3IH7A 1KO9A 3OS0A 4E9GA 2YG9A 1LMZA 1MUDA 4DK9A 1P7MA 2ABKA 3OH9A 4EJZA 4B23A 4YPRA 3OY9A 4EW4A 2JHNA 4UNFA 3OYNA 1U84A 1YQKA 4EW0A 1FN7A 1KG2A 3S3OA 1KEAA 3OS2A 4ZTFA 2OFKA 4BDZA 3CWSA 1WEFA 4E9EA 2YG8A 4OFEA 1DIZA 1N3CA 1MUYA 4E7HA 4E9FA 4E7LA 2NOLA 4HSBA 3OYBA 3L2VA 3S3NA 1HU0A 3OYHA 1ORPA 4YPHA 1KG4A 3N5NX 1N39A 1KG3A 2JHJA 2NOFA 3KTUA 3CVTA 2NOHA 1XG7A 3OYIA 3CWAA 3CWUA 4BDYA 4EJYA 4BE2A 2W04A 2XHIA 2NOBA 3FSPA 4EA5A 3OYEA 3IHOA 1VRLA 1LWVA 4EA4A 1PVSA 4AIAA 3OYLA 3OYAA 3S6IA 3OH6A 1WEIA 1RRQA 4NZGA 3OYKA 3I0WA 1XQOA 1PU8A 4BE1A 3OS1A 3L2RA 1M3HA 3OYDA 3F0ZA 3OGDA 4E9HA 3L2UA 3R2XC 1P59A 1N3AA 3CWTA 1YQRA 1NKUA 3OYMA 1KG7A 3I0XA 5DPKA 1MPGA 2H56A 1KQJA 1RRSA 3OYGA 4OFHA 4AI5A 4EVVA 4E7JA 2JPSA 5CHZA 4UOBA 1XQPA 3L2WA 5FRNA 2NOZA 1WEGA 1LWYA 4YOQA 4B22A 4PIIA 3KNTA 5FROA 4E7KA 2OFIA 1M3QA 2NOIA 1KG6A 3FHFA 3F10A 2I5WA 3VW4A 4IKFA 2W03A 1PU7A 4OFAA
chains in the Genus database with same CATH topology
4B24A 1MUNA 1LWWA 1NGNA 3CVSA 3G0QA 5KN9A 5AN4A 1YQLA 1EBMA 3N0UA 2NOEA 3D4VA 4B21A 5KN8A 1YQMA 3FHGA 4AI4A 3CW7A 1PU6A 1KG5A 2JG6A 1ORNA 3IH7A 1KO9A 4E9GA 2YG9A 1LMZA 1MUDA 4DK9A 1P7MA 2ABKA 3OH9A 4EJZA 4B23A 4YPRA 4EW4A 2JHNA 4UNFA 1YQKA 4EW0A 1FN7A 1KG2A 1KEAA 3CWSA 2OFKA 1WEFA 4E9EA 2YG8A 4OFEA 1DIZA 1N3CA 1MUYA 4E9FA 2NOLA 4HSBA 1HU0A 1ORPA 4YPHA 1KG4A 3N5NX 1N39A 1KG3A 2JHJA 2NOFA 3KTUA 3CVTA 2NOHA 1XG7A 3CWAA 3CWUA 4EJYA 2XHIA 2NOBA 3FSPA 4EA5A 1VRLA 3IHOA 1LWVA 4EA4A 1PVSA 4AIAA 3S6IA 3OH6A 1WEIA 1RRQA 3I0WA 1XQOA 1PU8A 1M3HA 3F0ZA 3OGDA 4E9HA 1P59A 1N3AA 3CWTA 1YQRA 1NKUA 1KG7A 3I0XA 5DPKA 1MPGA 2H56A 1KQJA 1RRSA 4OFHA 4AI5A 4EVVA 5CHZA 4UOBA 1XQPA 2NOZA 1WEGA 1LWYA 4YOQA 4B22A 4PIIA 3KNTA 2OFIA 1M3QA 2NOIA 1KG6A 3FHFA 3F10A 2I5WA 1PU7A 4OFAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B24 A;  1MUN A;  1LWW A;  1NGN A;  3CVS A;  3G0Q A;  5KN9 A;  5AN4 A;  1YQL A;  1EBM A;  3N0U A;  2NOE A;  3D4V A;  4B21 A;  5KN8 A;  1YQM A;  3FHG A;  4AI4 A;  3CW7 A;  1PU6 A;  1KG5 A;  2JG6 A;  1ORN A;  3IH7 A;  1KO9 A;  4E9G A;  2YG9 A;  1LMZ A;  1MUD A;  4DK9 A;  1P7M A;  2ABK A;  3OH9 A;  4EJZ A;  4B23 A;  4YPR A;  4EW4 A;  2JHN A;  4UNF A;  1YQK A;  4EW0 A;  1FN7 A;  1KG2 A;  1KEA A;  3CWS A;  2OFK A;  1WEF A;  4E9E A;  2YG8 A;  4OFE A;  1DIZ A;  1N3C A;  1MUY A;  4E9F A;  2NOL A;  4HSB A;  1HU0 A;  1ORP A;  4YPH A;  1KG4 A;  3N5N X;  1N39 A;  1KG3 A;  2JHJ A;  2NOF A;  3KTU A;  3CVT A;  2NOH A;  1XG7 A;  3CWA A;  3CWU A;  4EJY A;  2XHI A;  2NOB A;  3FSP A;  4EA5 A;  1VRL A;  3IHO A;  1LWV A;  4EA4 A;  1PVS A;  4AIA A;  3S6I A;  3OH6 A;  1WEI A;  1RRQ A;  3I0W A;  1XQO A;  1PU8 A;  1M3H A;  3F0Z A;  3OGD A;  4E9H A;  1P59 A;  1N3A A;  3CWT A;  1YQR A;  1NKU A;  1KG7 A;  3I0X A;  5DPK A;  1MPG A;  2H56 A;  1KQJ A;  1RRS A;  4OFH A;  4AI5 A;  4EVV A;  5CHZ A;  4UOB A;  1XQP A;  2NOZ A;  1WEG A;  1LWY A;  4YOQ A;  4B22 A;  4PII A;  3KNT A;  2OFI A;  1M3Q A;  2NOI A;  1KG6 A;  3FHF A;  3F10 A;  2I5W A;  1PU7 A;  4OFA A; 
#chains in the Genus database with same CATH topology
 4B24 A;  2V75 A;  1MUN A;  3S3M A;  3OYJ A;  1LWW A;  4ZTJ A;  1NGN A;  3OYF A;  3CVS A;  4BE0 A;  3G0Q A;  5KN9 A;  3NNQ A;  3LCN A;  3L2Q A;  4E7I A;  5AN4 A;  1YQL A;  1EBM A;  3N0U A;  2NOE A;  3D4V A;  4B21 A;  5KN8 A;  4BAC A;  1YQM A;  3FHG A;  4AI4 A;  3OYC A;  3CW7 A;  1PU6 A;  1KG5 A;  5FRM A;  2JG6 A;  1ORN A;  3IH7 A;  1KO9 A;  3OS0 A;  4E9G A;  2YG9 A;  1LMZ A;  1MUD A;  4DK9 A;  1P7M A;  2ABK A;  3OH9 A;  4EJZ A;  4B23 A;  4YPR A;  3OY9 A;  4EW4 A;  2JHN A;  4UNF A;  3OYN A;  1U84 A;  1YQK A;  4EW0 A;  1FN7 A;  1KG2 A;  3S3O A;  1KEA A;  3OS2 A;  4ZTF A;  2OFK A;  4BDZ A;  3CWS A;  1WEF A;  4E9E A;  2YG8 A;  4OFE A;  1DIZ A;  1N3C A;  1MUY A;  4E7H A;  4E9F A;  4E7L A;  2NOL A;  4HSB A;  3OYB A;  3L2V A;  3S3N A;  1HU0 A;  3OYH A;  1ORP A;  4YPH A;  1KG4 A;  3N5N X;  1N39 A;  1KG3 A;  2JHJ A;  2NOF A;  3KTU A;  3CVT A;  2NOH A;  1XG7 A;  3OYI A;  3CWA A;  3CWU A;  4BDY A;  4EJY A;  4BE2 A;  2W04 A;  2XHI A;  2NOB A;  3FSP A;  4EA5 A;  3OYE A;  3IHO A;  1VRL A;  1LWV A;  4EA4 A;  1PVS A;  4AIA A;  3OYL A;  3OYA A;  3S6I A;  3OH6 A;  1WEI A;  1RRQ A;  4NZG A;  3OYK A;  3I0W A;  1XQO A;  1PU8 A;  4BE1 A;  3OS1 A;  3L2R A;  1M3H A;  3OYD A;  3F0Z A;  3OGD A;  4E9H A;  3L2U A;  3R2X C;  1P59 A;  1N3A A;  3CWT A;  1YQR A;  1NKU A;  3OYM A;  1KG7 A;  3I0X A;  5DPK A;  1MPG A;  2H56 A;  1KQJ A;  1RRS A;  3OYG A;  4OFH A;  4AI5 A;  4EVV A;  4E7J A;  2JPS A;  5CHZ A;  4UOB A;  1XQP A;  3L2W A;  5FRN A;  2NOZ A;  1WEG A;  1LWY A;  4YOQ A;  4B22 A;  4PII A;  3KNT A;  5FRO A;  4E7K A;  2OFI A;  1M3Q A;  2NOI A;  1KG6 A;  3FHF A;  3F10 A;  2I5W A;  3VW4 A;  4IKF A;  2W03 A;  1PU7 A;  4OFA A; 
#chains in the Genus database with same CATH homology
 4B24 A;  1MUN A;  1LWW A;  1NGN A;  3CVS A;  3G0Q A;  5KN9 A;  5AN4 A;  1YQL A;  1EBM A;  3N0U A;  2NOE A;  3D4V A;  4B21 A;  5KN8 A;  1YQM A;  3FHG A;  4AI4 A;  3CW7 A;  1PU6 A;  1KG5 A;  2JG6 A;  1ORN A;  3IH7 A;  1KO9 A;  4E9G A;  2YG9 A;  1LMZ A;  1MUD A;  4DK9 A;  1P7M A;  2ABK A;  3OH9 A;  4EJZ A;  4B23 A;  4YPR A;  4EW4 A;  2JHN A;  4UNF A;  1YQK A;  4EW0 A;  1FN7 A;  1KG2 A;  1KEA A;  3CWS A;  2OFK A;  1WEF A;  4E9E A;  2YG8 A;  4OFE A;  1DIZ A;  1N3C A;  1MUY A;  4E9F A;  2NOL A;  4HSB A;  1HU0 A;  1ORP A;  4YPH A;  1KG4 A;  3N5N X;  1N39 A;  1KG3 A;  2JHJ A;  2NOF A;  3KTU A;  3CVT A;  2NOH A;  1XG7 A;  3CWA A;  3CWU A;  4EJY A;  2XHI A;  2NOB A;  3FSP A;  4EA5 A;  1VRL A;  3IHO A;  1LWV A;  4EA4 A;  1PVS A;  4AIA A;  3S6I A;  3OH6 A;  1WEI A;  1RRQ A;  3I0W A;  1XQO A;  1PU8 A;  1M3H A;  3F0Z A;  3OGD A;  4E9H A;  1P59 A;  1N3A A;  3CWT A;  1YQR A;  1NKU A;  1KG7 A;  3I0X A;  5DPK A;  1MPG A;  2H56 A;  1KQJ A;  1RRS A;  4OFH A;  4AI5 A;  4EVV A;  5CHZ A;  4UOB A;  1XQP A;  2NOZ A;  1WEG A;  1LWY A;  4YOQ A;  4B22 A;  4PII A;  3KNT A;  2OFI A;  1M3Q A;  2NOI A;  1KG6 A;  3FHF A;  3F10 A;  2I5W A;  1PU7 A;  4OFA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...