2YG9A

Structure of an unusual 3-methyladenine dna glycosylase ii (alka) from deinococcus radiodurans
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
207
structure length
207
Chain Sequence
LPAVLPPLTDHAGAVAHLSRDPVLAQVTSLCGELPVLAPTPDPFGRLVRSVAGQQLSVKAAQAIYGRLEGLPGGVVPAALLKVSGDDLRGVGLSWAKVRTVQAAAAAAVSGQIDFAHLSGQPDELVIAELVQLPGIGRWTAEMFLLFALARPDVFSSGDLALRQGVERLYPGEDWRDVTARWAPYRSLASRYLWANSARMQAGGAPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-3-methyladenine glycosidase II, putative
publication title Structure-function studies of an unusual 3-methyladenine DNA glycosylase II (AlkA) from Deinococcus radiodurans.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Hydrolase
total genus 68
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 2yg9A02
1.10.1670.40 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Endonuclease Iii, domain 2 2yg9A01
3IH7A 4EVVA 5CHZA 4E9EA 4E9GA 1YQRA 4YPHA 4EA4A 4HSBA 3CW7A 1ORNA 1LWYA 4B21A 3D4VA 4E9FA 5AN4A 4OFHA 5DPKA 1WEFA 1KQJA 2YG8A 1PU6A 1WEIA 3CWAA 1YQLA 1WEGA 3S6IA 1XQPA 1ORPA 1LMZA 1PVSA 4B23A 1EBMA 1MUNA 1KG7A 1FN7A 1KG6A 3N5NX 3KTUA 2H56A 3FHFA 1LWVA 3KNTA 1NGNA 3CWSA 1NKUA 4UOBA 2OFKA 2OFIA 1XQOA 4AI5A 1PU8A 3OGDA 1M3QA 4EA5A 4E9HA 3N0UA 2NOHA 1N39A 2ABKA 1MPGA 1KG3A 4DK9A 2NOBA 1M3HA 3F10A 2YG9A 2NOEA 1KG4A 2NOIA 4EJYA 4EW4A 1HU0A 1XG7A 3CWTA 3CVTA 3FHGA 2NOLA 3OH9A 1N3CA 4AIAA 4OFAA 4B22A 3CWUA 4EJZA 3I0WA 3F0ZA 2XHIA 4UNFA 1YQKA 1N3AA 3OH6A 4AI4A 1KG5A 5KN8A 5KN9A 1VRLA 1KG2A 1RRSA 3G0QA 2JG6A 1YQMA 1DIZA 1P7MA 1LWWA 2I5WA 3CVSA 1KO9A 4PIIA 1MUYA 4YPRA 1P59A 3FSPA 3IHOA 1KEAA 2NOFA 3I0XA 2JHJA 2NOZA 4EW0A 2JHNA 4B24A 4OFEA 1PU7A 4YOQA 1MUDA 1RRQA
chains in the Genus database with same CATH superfamily
3L2UA 3IH7A 3L2WA 4EVVA 5CHZA 4E9EA 3R2XC 4E9GA 1YQRA 4YPHA 4EA4A 4HSBA 3CW7A 1ORNA 1LWYA 4B21A 3D4VA 4E9FA 5AN4A 4OFHA 5DPKA 3OYCA 1WEFA 1KQJA 3OS0A 3S3NA 2YG8A 1PU6A 3OYHA 1WEIA 3OS1A 3OYEA 3CWAA 4E7HA 3OY9A 1YQLA 1WEGA 3S6IA 1XQPA 3L2RA 1U84A 4BE0A 1ORPA 3VW4A 1LMZA 3OYBA 1PVSA 4BE2A 4B23A 3NNQA 1EBMA 1MUNA 1KG7A 1FN7A 2V75A 3S3OA 1KG6A 3N5NX 3KTUA 2H56A 3FHFA 1LWVA 4NZGA 3KNTA 1NGNA 3OYJA 4BDYA 3CWSA 1NKUA 4UOBA 4BDZA 2OFKA 3L2QA 2OFIA 4E7JA 2W04A 1XQOA 4E7KA 4AI5A 3OYLA 1PU8A 4BE1A 3OGDA 1M3QA 4EA5A 4E9HA 5FRNA 3N0UA 4ZTJA 3L2VA 2NOHA 1N39A 2ABKA 3OYGA 3OYFA 1MPGA 4BACA 1KG3A 4DK9A 4E7IA 2NOBA 5FROA 1M3HA 3F10A 2YG9A 2NOEA 1KG4A 2NOIA 4EJYA 3OYAA 4EW4A 1HU0A 3OYMA 1XG7A 3CWTA 3CVTA 3FHGA 2NOLA 3OH9A 1N3CA 4AIAA 4OFAA 4B22A 3CWUA 4EJZA 3I0WA 5FRMA 3F0ZA 2XHIA 4UNFA 3OYKA 1YQKA 1N3AA 3OH6A 4AI4A 1KG5A 5KN8A 5KN9A 2JPSA 1KG2A 1VRLA 1RRSA 3G0QA 2JG6A 1YQMA 3LCNA 1DIZA 1P7MA 2W03A 1LWWA 2I5WA 3CVSA 1KO9A 4PIIA 3OS2A 1MUYA 4YPRA 3OYDA 3OYIA 1P59A 3FSPA 4E7LA 3IHOA 1KEAA 2NOFA 3I0XA 3S3MA 2JHJA 2NOZA 4EW0A 2JHNA 4IKFA 4B24A 3OYNA 4OFEA 1PU7A 4YOQA 4ZTFA 1MUDA 1RRQA
chains in the Genus database with same CATH topology
3IH7A 4EVVA 5CHZA 4E9EA 4E9GA 1YQRA 4YPHA 4EA4A 4HSBA 3CW7A 1ORNA 1LWYA 4B21A 3D4VA 4E9FA 5AN4A 4OFHA 5DPKA 1WEFA 1KQJA 2YG8A 1PU6A 1WEIA 3CWAA 1YQLA 1WEGA 3S6IA 1XQPA 1ORPA 1LMZA 1PVSA 4B23A 1EBMA 1MUNA 1KG7A 1FN7A 1KG6A 3N5NX 3KTUA 2H56A 3FHFA 1LWVA 3KNTA 1NGNA 3CWSA 1NKUA 4UOBA 2OFKA 2OFIA 1XQOA 4AI5A 1PU8A 3OGDA 1M3QA 4EA5A 4E9HA 3N0UA 2NOHA 1N39A 2ABKA 1MPGA 1KG3A 4DK9A 2NOBA 1M3HA 3F10A 2YG9A 2NOEA 1KG4A 2NOIA 4EJYA 4EW4A 1HU0A 1XG7A 3CWTA 3CVTA 3FHGA 2NOLA 3OH9A 1N3CA 4AIAA 4OFAA 4B22A 3CWUA 4EJZA 3I0WA 3F0ZA 2XHIA 4UNFA 1YQKA 1N3AA 3OH6A 4AI4A 1KG5A 5KN8A 5KN9A 1VRLA 1KG2A 1RRSA 3G0QA 2JG6A 1YQMA 1DIZA 1P7MA 1LWWA 2I5WA 3CVSA 1KO9A 4PIIA 1MUYA 4YPRA 1P59A 3FSPA 3IHOA 1KEAA 2NOFA 3I0XA 2JHJA 2NOZA 4EW0A 2JHNA 4B24A 4OFEA 1PU7A 4YOQA 1MUDA 1RRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IH7 A;  4EVV A;  5CHZ A;  4E9E A;  4E9G A;  1YQR A;  4YPH A;  4EA4 A;  4HSB A;  3CW7 A;  1ORN A;  1LWY A;  4B21 A;  3D4V A;  4E9F A;  5AN4 A;  4OFH A;  5DPK A;  1WEF A;  1KQJ A;  2YG8 A;  1PU6 A;  1WEI A;  3CWA A;  1YQL A;  1WEG A;  3S6I A;  1XQP A;  1ORP A;  1LMZ A;  1PVS A;  4B23 A;  1EBM A;  1MUN A;  1KG7 A;  1FN7 A;  1KG6 A;  3N5N X;  3KTU A;  2H56 A;  3FHF A;  1LWV A;  3KNT A;  1NGN A;  3CWS A;  1NKU A;  4UOB A;  2OFK A;  2OFI A;  1XQO A;  4AI5 A;  1PU8 A;  3OGD A;  1M3Q A;  4EA5 A;  4E9H A;  3N0U A;  2NOH A;  1N39 A;  2ABK A;  1MPG A;  1KG3 A;  4DK9 A;  2NOB A;  1M3H A;  3F10 A;  2YG9 A;  2NOE A;  1KG4 A;  2NOI A;  4EJY A;  4EW4 A;  1HU0 A;  1XG7 A;  3CWT A;  3CVT A;  3FHG A;  2NOL A;  3OH9 A;  1N3C A;  4AIA A;  4OFA A;  4B22 A;  3CWU A;  4EJZ A;  3I0W A;  3F0Z A;  2XHI A;  4UNF A;  1YQK A;  1N3A A;  3OH6 A;  4AI4 A;  1KG5 A;  5KN8 A;  5KN9 A;  1VRL A;  1KG2 A;  1RRS A;  3G0Q A;  2JG6 A;  1YQM A;  1DIZ A;  1P7M A;  1LWW A;  2I5W A;  3CVS A;  1KO9 A;  4PII A;  1MUY A;  4YPR A;  1P59 A;  3FSP A;  3IHO A;  1KEA A;  2NOF A;  3I0X A;  2JHJ A;  2NOZ A;  4EW0 A;  2JHN A;  4B24 A;  4OFE A;  1PU7 A;  4YOQ A;  1MUD A;  1RRQ A; 
#chains in the Genus database with same CATH topology
 3L2U A;  3IH7 A;  3L2W A;  4EVV A;  5CHZ A;  4E9E A;  3R2X C;  4E9G A;  1YQR A;  4YPH A;  4EA4 A;  4HSB A;  3CW7 A;  1ORN A;  1LWY A;  4B21 A;  3D4V A;  4E9F A;  5AN4 A;  4OFH A;  5DPK A;  3OYC A;  1WEF A;  1KQJ A;  3OS0 A;  3S3N A;  2YG8 A;  1PU6 A;  3OYH A;  1WEI A;  3OS1 A;  3OYE A;  3CWA A;  4E7H A;  3OY9 A;  1YQL A;  1WEG A;  3S6I A;  1XQP A;  3L2R A;  1U84 A;  4BE0 A;  1ORP A;  3VW4 A;  1LMZ A;  3OYB A;  1PVS A;  4BE2 A;  4B23 A;  3NNQ A;  1EBM A;  1MUN A;  1KG7 A;  1FN7 A;  2V75 A;  3S3O A;  1KG6 A;  3N5N X;  3KTU A;  2H56 A;  3FHF A;  1LWV A;  4NZG A;  3KNT A;  1NGN A;  3OYJ A;  4BDY A;  3CWS A;  1NKU A;  4UOB A;  4BDZ A;  2OFK A;  3L2Q A;  2OFI A;  4E7J A;  2W04 A;  1XQO A;  4E7K A;  4AI5 A;  3OYL A;  1PU8 A;  4BE1 A;  3OGD A;  1M3Q A;  4EA5 A;  4E9H A;  5FRN A;  3N0U A;  4ZTJ A;  3L2V A;  2NOH A;  1N39 A;  2ABK A;  3OYG A;  3OYF A;  1MPG A;  4BAC A;  1KG3 A;  4DK9 A;  4E7I A;  2NOB A;  5FRO A;  1M3H A;  3F10 A;  2YG9 A;  2NOE A;  1KG4 A;  2NOI A;  4EJY A;  3OYA A;  4EW4 A;  1HU0 A;  3OYM A;  1XG7 A;  3CWT A;  3CVT A;  3FHG A;  2NOL A;  3OH9 A;  1N3C A;  4AIA A;  4OFA A;  4B22 A;  3CWU A;  4EJZ A;  3I0W A;  5FRM A;  3F0Z A;  2XHI A;  4UNF A;  3OYK A;  1YQK A;  1N3A A;  3OH6 A;  4AI4 A;  1KG5 A;  5KN8 A;  5KN9 A;  2JPS A;  1KG2 A;  1VRL A;  1RRS A;  3G0Q A;  2JG6 A;  1YQM A;  3LCN A;  1DIZ A;  1P7M A;  2W03 A;  1LWW A;  2I5W A;  3CVS A;  1KO9 A;  4PII A;  3OS2 A;  1MUY A;  4YPR A;  3OYD A;  3OYI A;  1P59 A;  3FSP A;  4E7L A;  3IHO A;  1KEA A;  2NOF A;  3I0X A;  3S3M A;  2JHJ A;  2NOZ A;  4EW0 A;  2JHN A;  4IKF A;  4B24 A;  3OYN A;  4OFE A;  1PU7 A;  4YOQ A;  4ZTF A;  1MUD A;  1RRQ A; 
#chains in the Genus database with same CATH homology
 3IH7 A;  4EVV A;  5CHZ A;  4E9E A;  4E9G A;  1YQR A;  4YPH A;  4EA4 A;  4HSB A;  3CW7 A;  1ORN A;  1LWY A;  4B21 A;  3D4V A;  4E9F A;  5AN4 A;  4OFH A;  5DPK A;  1WEF A;  1KQJ A;  2YG8 A;  1PU6 A;  1WEI A;  3CWA A;  1YQL A;  1WEG A;  3S6I A;  1XQP A;  1ORP A;  1LMZ A;  1PVS A;  4B23 A;  1EBM A;  1MUN A;  1KG7 A;  1FN7 A;  1KG6 A;  3N5N X;  3KTU A;  2H56 A;  3FHF A;  1LWV A;  3KNT A;  1NGN A;  3CWS A;  1NKU A;  4UOB A;  2OFK A;  2OFI A;  1XQO A;  4AI5 A;  1PU8 A;  3OGD A;  1M3Q A;  4EA5 A;  4E9H A;  3N0U A;  2NOH A;  1N39 A;  2ABK A;  1MPG A;  1KG3 A;  4DK9 A;  2NOB A;  1M3H A;  3F10 A;  2YG9 A;  2NOE A;  1KG4 A;  2NOI A;  4EJY A;  4EW4 A;  1HU0 A;  1XG7 A;  3CWT A;  3CVT A;  3FHG A;  2NOL A;  3OH9 A;  1N3C A;  4AIA A;  4OFA A;  4B22 A;  3CWU A;  4EJZ A;  3I0W A;  3F0Z A;  2XHI A;  4UNF A;  1YQK A;  1N3A A;  3OH6 A;  4AI4 A;  1KG5 A;  5KN8 A;  5KN9 A;  1VRL A;  1KG2 A;  1RRS A;  3G0Q A;  2JG6 A;  1YQM A;  1DIZ A;  1P7M A;  1LWW A;  2I5W A;  3CVS A;  1KO9 A;  4PII A;  1MUY A;  4YPR A;  1P59 A;  3FSP A;  3IHO A;  1KEA A;  2NOF A;  3I0X A;  2JHJ A;  2NOZ A;  4EW0 A;  2JHN A;  4B24 A;  4OFE A;  1PU7 A;  4YOQ A;  1MUD A;  1RRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...