2YH6A

Structure of the n-terminal domain of bamc from e. coli
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
111
structure length
108
Chain Sequence
GDTASLLVENNTLWPQVVSVLQAKNYTITQRDDAGQTLTTDWVQWNRLDEDEQYRGRYQISVKPQGYQQAVTVKLLNLEQAGKPVADAASMQRYSTEMMNVISAGLDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIPOPROTEIN 34
publication title Structural Basis of Outer Membrane Protein Biogenesis in Bacteria.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lipid binding protein
total genus 28
structure length 108
sequence length 111
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-04-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.50 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 2yh6A00
5EKQC 3TGOC 2LAFA 2YH6A
chains in the Genus database with same CATH superfamily
3OJIA 2KCZA 3KLXA 3NMNA 4JHGA 4KPYA 4IGWA 3UIDA 1BV1A 2E3OA 2REZA 3GTSA 4RYVA 1LLTA 2KEWA 3KL1A 1X53A 5BRLA 3HO1A 2YH6A 4A8UA 1TXCA 1E09A 5E4MA 1KCMA 5E46A 3JRQB 4N41A 2N4AA 3K90A 4A80A 4A84A 1EM2A 2Z9YA 4IGXA 4A87A 4BK6A 3KAYA 3DLHA 2Q3QA 3GL2A 2LAKA 3F08A 4DSBA 2LF2A 4R7KA 4NCAA 3P51A 3W9KA 4M9WA 3Q6AA 2LE1A 3NJOA 3NR4A 3UJLA 2Z9ZA 3H3TA 5E4DA 3KB0A 3NJ1A 4QDFA 2K5GA 3F73A 3NEFA 4QDCA 4N0GC 4B9RA 2LDKA 1QMRA 1XFSA 4JHIA 3TFZA 4LGBA 2LIOA 3NJ0A 4REJA 1XDFA 3GKEA 1ICXA 4QDDA 1T17A 2K7HA 2E3RA 3TVQA 3Q63A 3GB4A 3GOBA 2LPXA 3NQNA 2KTEA 4N76A 1LN3A 3WG8A 4MNSA 3H3RA 4IH2A 4QIPA 4JHHA 4DSCA 3E85A 5E4BA 4A83A 3P0LA 1LN1A 1XN5A 5JO1A 3HJFA 3NEGA 4BTZA 2E3QA 2M89A 2BK0A 2NN5A 2FFSA 2N4BA 4GY9A 3OQUA 1UW5A 4A8GA 3KDHA 4IHRA 4QCKA 2A1LA 3GTEA 4Z3LA 3QSZA 4C9CA 1H2OA 2QIMA 2E3NA 2E3SA 3OH8A 3KB3A 3QN1A 4JDLA 3IE5A 4QDFB 4LGAA 4JHYA 3HVRA 3RT0C 2D4RA 3TL1A 4E6FA 4LG5A 4JDAA 1TW0A 1XN6A 5EKQC 1Z94A 2E3MA 3TVRA 4N3EA 2LAFA 2PCSA 2PSOA 2VQ5A 3NMHA 4FPWA 4M9BA 2RESA 3HXMA 4NCBA 2EJXA 5JO2A 3ELIA 5C9YA 5JNNA 3ZVUA 2L8OA 3KAZA 4PSBA 4XRWA 3HK2A 4Y31A 3NS2A 3KDIA 3NMPA 2L9PA 2LEQA 4N47A 2GKDA 2VNEA 4BKDA 4A81A 3C0VA 2IL5A 2MOUA 4IGVA 4OICA 4Q0KA 1LN2A 3HM9A 3RD6A 4C9IA 1IFVA 2RERA 4MAPA 5AMWA 3RT2A 3K3KA 1BTVA 2KF2A 2LGHA 2M47A 3JRSA 3KDJA 4A88A 1JSSA 4XRTA 4BKCA 4BK7A 4MA6A 4DS8A 3Q64A 2I9YA 3H3SA 2E3PA 3R6PA 4REIA 2QPVA 2R55A 4WVOA 3H3QA 4LA7A 1T27A 2FLHA 3NMTA 5I9JA 1XUVA 5I8FA 1VJHA 1ZXFA 4C94A 4IGYA 3GGNA 3W9RA 3DLBA 4IH0A 3IJTA 3NI8A 4REHA 4A86A 3GL0A 2LUZA 3NMVA 2ZYLA 3FO5A 3P9VA 3PUTA 4A8VA 2L65A 3CNWA 3OTLA 2LCGA 4A85A 1FSKA 3PU2A 3TGOC 2NS9A 1B6FA 3UQHA 1FM4A 2WQLA
chains in the Genus database with same CATH topology
3OJIA 2KCZA 3KLXA 3NMNA 4JHGA 4KPYA 4IGWA 3UIDA 1BV1A 2E3OA 2REZA 3GTSA 4RYVA 1LLTA 2KEWA 3KL1A 1X53A 5BRLA 3HO1A 2YH6A 4A8UA 1TXCA 1E09A 5E4MA 1KCMA 5E46A 3JRQB 4N41A 2N4AA 3K90A 4A80A 4A84A 1EM2A 2Z9YA 4IGXA 4A87A 4BK6A 3KAYA 3DLHA 2Q3QA 3GL2A 2LAKA 3F08A 4DSBA 2LF2A 4R7KA 4NCAA 3P51A 3W9KA 4M9WA 3Q6AA 2LE1A 3NJOA 3NR4A 3UJLA 2Z9ZA 3H3TA 5E4DA 3KB0A 3NJ1A 4QDFA 2K5GA 3F73A 3NEFA 4QDCA 4N0GC 4B9RA 2LDKA 1QMRA 1XFSA 4JHIA 3TFZA 4LGBA 2LIOA 3NJ0A 4REJA 1XDFA 3GKEA 1ICXA 4QDDA 1T17A 2K7HA 2E3RA 3TVQA 3Q63A 3GB4A 3GOBA 2LPXA 3NQNA 2KTEA 4N76A 1LN3A 3WG8A 4MNSA 3H3RA 4IH2A 4QIPA 4JHHA 4DSCA 3E85A 5E4BA 4A83A 3P0LA 1LN1A 1XN5A 5JO1A 3HJFA 3NEGA 4BTZA 2E3QA 2M89A 2BK0A 2NN5A 2FFSA 2N4BA 4GY9A 3OQUA 1UW5A 4A8GA 3KDHA 4IHRA 4QCKA 2A1LA 3GTEA 4Z3LA 3QSZA 4C9CA 1H2OA 2QIMA 2E3NA 2E3SA 3OH8A 3KB3A 3QN1A 4JDLA 3IE5A 4QDFB 4LGAA 4JHYA 3HVRA 3RT0C 2D4RA 3TL1A 4E6FA 4LG5A 4JDAA 1TW0A 1XN6A 5EKQC 1Z94A 2E3MA 3TVRA 4N3EA 2LAFA 2PCSA 2PSOA 2VQ5A 3NMHA 4FPWA 4M9BA 2RESA 3HXMA 4NCBA 2EJXA 5JO2A 3ELIA 5C9YA 5JNNA 3ZVUA 2L8OA 3KAZA 4PSBA 4XRWA 3HK2A 4Y31A 3NS2A 3KDIA 3NMPA 2L9PA 2LEQA 4N47A 2GKDA 2VNEA 4BKDA 4A81A 3C0VA 2IL5A 2MOUA 4IGVA 4OICA 4Q0KA 1LN2A 3HM9A 3RD6A 4C9IA 1IFVA 2RERA 4MAPA 5AMWA 3RT2A 3K3KA 1BTVA 2KF2A 2LGHA 2M47A 3JRSA 3KDJA 4A88A 1JSSA 4XRTA 4BKCA 4BK7A 4MA6A 4DS8A 3Q64A 2I9YA 3H3SA 2E3PA 3R6PA 4REIA 2QPVA 2R55A 4WVOA 3H3QA 4LA7A 1T27A 2FLHA 3NMTA 5I9JA 1XUVA 5I8FA 1VJHA 1ZXFA 4C94A 4IGYA 3GGNA 3W9RA 3DLBA 4IH0A 3IJTA 3NI8A 4REHA 4A86A 3GL0A 2LUZA 3NMVA 2ZYLA 3FO5A 3P9VA 3PUTA 4A8VA 2L65A 3CNWA 3OTLA 2LCGA 4A85A 1FSKA 3PU2A 3TGOC 2NS9A 1B6FA 3UQHA 1FM4A 2WQLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EKQ C;  3TGO C;  2LAF A;  2YH6 A; 
#chains in the Genus database with same CATH topology
 3OJI A;  2KCZ A;  3KLX A;  3NMN A;  4JHG A;  4KPY A;  4IGW A;  3UID A;  1BV1 A;  2E3O A;  2REZ A;  3GTS A;  4RYV A;  1LLT A;  2KEW A;  3KL1 A;  1X53 A;  5BRL A;  3HO1 A;  2YH6 A;  4A8U A;  1TXC A;  1E09 A;  5E4M A;  1KCM A;  5E46 A;  3JRQ B;  4N41 A;  2N4A A;  3K90 A;  4A80 A;  4A84 A;  1EM2 A;  2Z9Y A;  4IGX A;  4A87 A;  4BK6 A;  3KAY A;  3DLH A;  2Q3Q A;  3GL2 A;  2LAK A;  3F08 A;  4DSB A;  2LF2 A;  4R7K A;  4NCA A;  3P51 A;  3W9K A;  4M9W A;  3Q6A A;  2LE1 A;  3NJO A;  3NR4 A;  3UJL A;  2Z9Z A;  3H3T A;  5E4D A;  3KB0 A;  3NJ1 A;  4QDF A;  2K5G A;  3F73 A;  3NEF A;  4QDC A;  4N0G C;  4B9R A;  2LDK A;  1QMR A;  1XFS A;  4JHI A;  3TFZ A;  4LGB A;  2LIO A;  3NJ0 A;  4REJ A;  1XDF A;  3GKE A;  1ICX A;  4QDD A;  1T17 A;  2K7H A;  2E3R A;  3TVQ A;  3Q63 A;  3GB4 A;  3GOB A;  2LPX A;  3NQN A;  2KTE A;  4N76 A;  1LN3 A;  3WG8 A;  4MNS A;  3H3R A;  4IH2 A;  4QIP A;  4JHH A;  4DSC A;  3E85 A;  5E4B A;  4A83 A;  3P0L A;  1LN1 A;  1XN5 A;  5JO1 A;  3HJF A;  3NEG A;  4BTZ A;  2E3Q A;  2M89 A;  2BK0 A;  2NN5 A;  2FFS A;  2N4B A;  4GY9 A;  3OQU A;  1UW5 A;  4A8G A;  3KDH A;  4IHR A;  4QCK A;  2A1L A;  3GTE A;  4Z3L A;  3QSZ A;  4C9C A;  1H2O A;  2QIM A;  2E3N A;  2E3S A;  3OH8 A;  3KB3 A;  3QN1 A;  4JDL A;  3IE5 A;  4QDF B;  4LGA A;  4JHY A;  3HVR A;  3RT0 C;  2D4R A;  3TL1 A;  4E6F A;  4LG5 A;  4JDA A;  1TW0 A;  1XN6 A;  5EKQ C;  1Z94 A;  2E3M A;  3TVR A;  4N3E A;  2LAF A;  2PCS A;  2PSO A;  2VQ5 A;  3NMH A;  4FPW A;  4M9B A;  2RES A;  3HXM A;  4NCB A;  2EJX A;  5JO2 A;  3ELI A;  5C9Y A;  5JNN A;  3ZVU A;  2L8O A;  3KAZ A;  4PSB A;  4XRW A;  3HK2 A;  4Y31 A;  3NS2 A;  3KDI A;  3NMP A;  2L9P A;  2LEQ A;  4N47 A;  2GKD A;  2VNE A;  4BKD A;  4A81 A;  3C0V A;  2IL5 A;  2MOU A;  4IGV A;  4OIC A;  4Q0K A;  1LN2 A;  3HM9 A;  3RD6 A;  4C9I A;  1IFV A;  2RER A;  4MAP A;  5AMW A;  3RT2 A;  3K3K A;  1BTV A;  2KF2 A;  2LGH A;  2M47 A;  3JRS A;  3KDJ A;  4A88 A;  1JSS A;  4XRT A;  4BKC A;  4BK7 A;  4MA6 A;  4DS8 A;  3Q64 A;  2I9Y A;  3H3S A;  2E3P A;  3R6P A;  4REI A;  2QPV A;  2R55 A;  4WVO A;  3H3Q A;  4LA7 A;  1T27 A;  2FLH A;  3NMT A;  5I9J A;  1XUV A;  5I8F A;  1VJH A;  1ZXF A;  4C94 A;  4IGY A;  3GGN A;  3W9R A;  3DLB A;  4IH0 A;  3IJT A;  3NI8 A;  4REH A;  4A86 A;  3GL0 A;  2LUZ A;  3NMV A;  2ZYL A;  3FO5 A;  3P9V A;  3PUT A;  4A8V A;  2L65 A;  3CNW A;  3OTL A;  2LCG A;  4A85 A;  1FSK A;  3PU2 A;  3TGO C;  2NS9 A;  1B6F A;  3UQH A;  1FM4 A;  2WQL A; 
#chains in the Genus database with same CATH homology
 3OJI A;  2KCZ A;  3KLX A;  3NMN A;  4JHG A;  4KPY A;  4IGW A;  3UID A;  1BV1 A;  2E3O A;  2REZ A;  3GTS A;  4RYV A;  1LLT A;  2KEW A;  3KL1 A;  1X53 A;  5BRL A;  3HO1 A;  2YH6 A;  4A8U A;  1TXC A;  1E09 A;  5E4M A;  1KCM A;  5E46 A;  3JRQ B;  4N41 A;  2N4A A;  3K90 A;  4A80 A;  4A84 A;  1EM2 A;  2Z9Y A;  4IGX A;  4A87 A;  4BK6 A;  3KAY A;  3DLH A;  2Q3Q A;  3GL2 A;  2LAK A;  3F08 A;  4DSB A;  2LF2 A;  4R7K A;  4NCA A;  3P51 A;  3W9K A;  4M9W A;  3Q6A A;  2LE1 A;  3NJO A;  3NR4 A;  3UJL A;  2Z9Z A;  3H3T A;  5E4D A;  3KB0 A;  3NJ1 A;  4QDF A;  2K5G A;  3F73 A;  3NEF A;  4QDC A;  4N0G C;  4B9R A;  2LDK A;  1QMR A;  1XFS A;  4JHI A;  3TFZ A;  4LGB A;  2LIO A;  3NJ0 A;  4REJ A;  1XDF A;  3GKE A;  1ICX A;  4QDD A;  1T17 A;  2K7H A;  2E3R A;  3TVQ A;  3Q63 A;  3GB4 A;  3GOB A;  2LPX A;  3NQN A;  2KTE A;  4N76 A;  1LN3 A;  3WG8 A;  4MNS A;  3H3R A;  4IH2 A;  4QIP A;  4JHH A;  4DSC A;  3E85 A;  5E4B A;  4A83 A;  3P0L A;  1LN1 A;  1XN5 A;  5JO1 A;  3HJF A;  3NEG A;  4BTZ A;  2E3Q A;  2M89 A;  2BK0 A;  2NN5 A;  2FFS A;  2N4B A;  4GY9 A;  3OQU A;  1UW5 A;  4A8G A;  3KDH A;  4IHR A;  4QCK A;  2A1L A;  3GTE A;  4Z3L A;  3QSZ A;  4C9C A;  1H2O A;  2QIM A;  2E3N A;  2E3S A;  3OH8 A;  3KB3 A;  3QN1 A;  4JDL A;  3IE5 A;  4QDF B;  4LGA A;  4JHY A;  3HVR A;  3RT0 C;  2D4R A;  3TL1 A;  4E6F A;  4LG5 A;  4JDA A;  1TW0 A;  1XN6 A;  5EKQ C;  1Z94 A;  2E3M A;  3TVR A;  4N3E A;  2LAF A;  2PCS A;  2PSO A;  2VQ5 A;  3NMH A;  4FPW A;  4M9B A;  2RES A;  3HXM A;  4NCB A;  2EJX A;  5JO2 A;  3ELI A;  5C9Y A;  5JNN A;  3ZVU A;  2L8O A;  3KAZ A;  4PSB A;  4XRW A;  3HK2 A;  4Y31 A;  3NS2 A;  3KDI A;  3NMP A;  2L9P A;  2LEQ A;  4N47 A;  2GKD A;  2VNE A;  4BKD A;  4A81 A;  3C0V A;  2IL5 A;  2MOU A;  4IGV A;  4OIC A;  4Q0K A;  1LN2 A;  3HM9 A;  3RD6 A;  4C9I A;  1IFV A;  2RER A;  4MAP A;  5AMW A;  3RT2 A;  3K3K A;  1BTV A;  2KF2 A;  2LGH A;  2M47 A;  3JRS A;  3KDJ A;  4A88 A;  1JSS A;  4XRT A;  4BKC A;  4BK7 A;  4MA6 A;  4DS8 A;  3Q64 A;  2I9Y A;  3H3S A;  2E3P A;  3R6P A;  4REI A;  2QPV A;  2R55 A;  4WVO A;  3H3Q A;  4LA7 A;  1T27 A;  2FLH A;  3NMT A;  5I9J A;  1XUV A;  5I8F A;  1VJH A;  1ZXF A;  4C94 A;  4IGY A;  3GGN A;  3W9R A;  3DLB A;  4IH0 A;  3IJT A;  3NI8 A;  4REH A;  4A86 A;  3GL0 A;  2LUZ A;  3NMV A;  2ZYL A;  3FO5 A;  3P9V A;  3PUT A;  4A8V A;  2L65 A;  3CNW A;  3OTL A;  2LCG A;  4A85 A;  1FSK A;  3PU2 A;  3TGO C;  2NS9 A;  1B6F A;  3UQH A;  1FM4 A;  2WQL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...