2YHCA

Structure of bamd from e. coli
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
223
structure length
209
Chain Sequence
b'PPNEIYATAQQKLQDGNWRQAITQLEALDNRYPFGPYSQQVQLDLIYAYYKNADLPLAQAAIDRFIRLNPTHPNIDYVMYMRGLTNMALDDDPQQARAAFSDFSKLVRGYPNSQYTTDATKRLVFLKDRLAKYEYSVAEYYTERGAWVAVVNRVEGMLRDYPDTQATRDALPLMENAYRQMQMNAQAEKVAKIIAANSSNTLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0169 LIPOPROTEIN YFIO
publication title Structural Basis of Outer Membrane Protein Biogenesis in Bacteria.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 83
structure length 209
sequence length 223
ec nomenclature
pdb deposition date 2011-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2yhcA00
4J0UA 2YQ8A 1ELRA 2VGXA 5ARGA 4NRHB 4I9CA 3LY8A 3CVQA 5EKQD 4H7YA 2PQRA 1PC2A 4GZ5A 1IYGA 2NC9A 4N3AA 4WNEA 2VGYA 4HOQA 3ZN3A 5M72A 2XEVA 3CKCA 2P58C 5KJNA 3R9AB 2DBAA 3S7FA 5JJ7A 2IFUA 3QWWA 3IEGA 1Y8MA 3PE4A 4N3CA 3TG4A 4N2QA 2LSUA 1NA0A 5HQ8A 3RU0A 2KCVA 4G2VA 4I2WA 4UI9C 3QWVA 5JJ6A 3BEEA 4UQZA 3ZHEB 2UY1A 1ZBPA 3CK9A 4LEUA 4JA7A 3ASDA 3TG5A 4KBQA 5D0OD 1KT0A 3LY9A 3RKVA 4GYYA 3URZA 2MHKA 3AS5A 5FZQA 1W3BA 2XCBA 5LCWC 4RG9A 4WNDA 4G1TA 5CCLA 4I1AA 4WUYA 3CEQA 3U4TA 1ELWA 3CK7A 4GYOA 4GYWA 4CGVA 5FJYA 2AVPA 3UPVA 2VSNA 4BT8A 1QQEA 3RO3A 3LKUA 3CVLA 3N71A 1ZU2A 4CDRA 1E96B 1QZ2A 2VYIA 4G25A 2XGMA 3ZHEA 3Q47B 3UQ3A 2IF4A 3MA5A 2UWJG 5EX0A 3JYSA 4UI9J 1IHGA 3PE3A 5KJLA 3VTYA 1HH8A 4GZ3A 5FTPA 3U3WA 3CV0A 5G05J 5DBKA 3GZ1A 2Y4TA 2I6HA 4AIFA 4N5CA 3Q15A 2OOEA 4H7XA 4BT9A 3MEKA 4HORA 2R5SA 1P5QA 4U0UA 2KATA 5LCWJ 4RG6A 3KS2A 2JLBA 3ESKA 2XGSA 3GW4A 2HR2A 4KXKB 4HOUA 2FBNA 4WNFA 4U0SA 2PQNA 4CGWA 3MKRA 3TAXA 3CK8A 5AYWD 3ZFWA 3ASFA 3FFLA 3OXGA 4GA0A 5G05C 3CKBA 4WNGA 1XNFA 2PZIA 5ARFA 4XI9A 4HOSA 3AS8A 2XPIA 1KT1A 1TJCA 5C1DA 4YVQC 2FO7A 2HO1A 3ZPJA 2VQ2A 5JJTA 1B89A 5CHEE 3QDNA 2QFCA 4BWRA 3WXXA 1YA0A 4JHRA 4I9EA 3S7JA 3SZ7A 3LCAA 3CVNA 2FF4A 4G26A 5FZSA 2KCKA 4IN3B 4AY6A 4BTAA 2XCCA 2WPVA 3KD7A 3MV3B 3MV2B 3O48A 5HI7A 3VTXA 3LPZA 5D0QD 2WQHA 4Y6WA 2XGOA 5FZRA 3ZGQA 4UI9K 5CCMA 4U07A 2Q7FA 3HYMB 3RO2A 4JA9A 2HYZA 4G24A 4N2SA 5G04C 4EQFA 3ULQA 4ABNA 4AM9A 3QKYA 4U04A 3K9IA 4AY5A 2KCLA 1OUVA 3TGOA 4U0ZA 4GA1A 4GPKA 4I2ZA 1KLXA 4ME2A 3Q4AB 2VSYA 3OXLA 5A7DB 4GCNA 2FEZA 3EDTB 3SF4A 4N3BA 4YVOA 3OXFA 3KAEA 2C2LA 2C0MA 1HZ4A 3E4BA 1A17A 3NF1A 2PL2A 3Q5MA 1HXIA 1NZNA 2E2EA 3AS4A 4I17A 4J8EA 2ONDA 4J8FA 4A1SA 5KJKA 4J8DA 2V5FA 3PDNA 3GYZA 2VGXB 3QOUA 3FP3A 2LNIA 4UQXA 4BTBA 1FCHA 3S7DA 5FT9A 5BW8C 2J9QA 2BUGA 4G23A 3QWPA 3CVPA 3ASHA 3LYAA 2KC7A 4XI0A 1WAO1 3FWVA 4NQ0A 1NA3A 3RJVA 2LSVA 5G04J 4JL0A 3RIBA 2GW1A 3GZ2A 2Y4UA 4XIFA 4Y6CA 4GZ6A 4GCOA 4F3VA 5EX3A 4HOTA 3Q49B 3ASGA 2YHCA 3S7BA 5KJMA 4B94A 5BNWA 4APOA 3LY7A 5A6CA 4UQYA 3UUXA 4KYOB 5DIZA 2L6JA 5BT1A 4GA2A 2UY1B 2C0LA 4O6FA 4YNDA 1WM5A 4N39A 4W9RA 2FI7A
chains in the Genus database with same CATH superfamily
1TN7A 2VGXA 1YCSB 4I6JA 3Q73A 3QNKA 4I9CA 1OCOE 4H7YA 5KNGA 2PQRA 4GZ5A 1IYGA 1S70B 3UT7A 3FU3A 4B89A 2QYUA 3ZN3A 4WWOA 4A3TA 3R9AB 2ILRA 1U2VG 2DBAA 3PREA 3RRUA 3MCXA 1Z3YA 1N4QA 3S7FA 1O1TA 3EHRA 5D66A 3G2SA 5JJ7A 2IFUA 4AVXA 3D9PA 4N3CA 4ANUA 3C72A 1NA0A 3D9OA 5AJDA 3RU0A 3FUDA 2OVFA 3NB2A 4UQZA 1TNYA 1K3ZD 1UJKA 2DYRE 4LEUA 3MX3A 4A1GA 3D9MA 2AXUA 1N4PA 3TG5A 3JQ0A 1KT0A 3RKVA 3ML8A 3LXUX 3AS5A 3BQOA 2M63A 2ZU6B 2BKKB 4FP7A 5LCWC 5CCLA 4EZJA 3C3QA 4DK5A 4GYOA 2CHZA 4PUCA 5AARA 1HF8A 1YYHA 4DX1A 5J90A 1H6KA 4GYWA 3E33A 1JCSA 3C3RA 3QC1A 5FJYA 3QJZA 3HVEA 3CVVA 3CVLA 1PY1A 3N71A 3L54A 1DCQA 4ACKA 1E96B 3FU6A 1H2UA 4JEHA 5FWQA 4AV7A 3UKUG 3DRAA 2XGMA 1VDYA 2IF4A 2UWJG 2X38A 4UI9J 1IHGA 4UUCA 1Z5SC 4JEUA 1HH8A 4WWNA 5FTPA 2P9LG 3U3WA 3CV0A 3FH5A 4EZLA 5G05J 5DBKA 1EPUA 3GZ1A 2Y4TA 4BX8A 5LOZA 3T9KA 4J8YA 2OOEA 4TXPA 2I1KA 1IQRA 4U96D 4M3OA 3NOCD 2JLBA 3FTVA 5JHAA 3QB2A 4HOUA 4WNFA 2V5QC 4U0SA 3TAXA 1UW4B 3W9GA 3ASFA 4ILIA 4DLOA 3BUAA 4C0MA 4RVBA 4GTQA 2EIJE 3APCA 4XI9A 1ZB1A 1FT2A 3AS8A 3DSVA 2XPIA 5AIJA 1TJCA 2R05A 4K0RA 3CQGB 4YVQC 4B8AA 3IV0A 1TJFA 1TNOA 3SHFA 3UMVA 5JJTA 3LVRE 2P9NG 4DX6D 3QDNA 3WXXA 3CSTA 3J5QB 4HLEA 2EILE 4FC8A 3CVNA 3EHQA 4PS8A 3FTSA 4LUNU 4XE0A 4GMLA 4G26A 5FZSA 4IN3B 2XRYA 4CEMA 2VTBA 3HXFA 5AQAA 3MV3B 3T8KA 4QFVA 3O48A 3PZ4A 1DVPA 2CFUA 3EIQC 3HXCA 5D0QD 3IHVA 2QZAA 4Y6WA 2WXKA 4I43A 1BLXB 4CT4A 1IQUA 1U3CA 5FZRA 4AP2A 3ZW3A 3S2AA 1NFIE 3ZYQA 4G24A 4EQFA 3ULQA 2DYSE 4KVOA 4U04A 5ANLA 2KM4A 1DNPA 1OUVA 3F6QA 1OCCE 3CVYA 4JHJA 4F7AA 3FULA 2ZISA 2DCPA 3VLDA 1H0AA 2VSOE 3FU5A 1TN6A 2XRZA 3JXIA 3E32A 4XEIG 3NF1A 2YINA 1NZNA 2F0YA 3AS4A 4OYSA 4I1MA 2XHEA 4J8FA 4NIKA 4M7CA 3UI2A 5T3RA 4DRXE 2VGXB 2F8YA 3QOUA 5KBAA 1L5JA 4UQXA 4ACLA 1FCHA 2X6FA 2XQ0A 3S7DA 2J9QA 2YNQA 2BUGA 2WXOA 3PNLB 2XEEA 3DBSA 4K5AB 1O1SA 2J49A 1O5MA 4UWHA 3CVPA 3DSUA 4C0EA 3SFZA 3ENEA 3LDZA 2KC7A 1OXJA 5EYLA 2WXIA 1SZ9A 3ZXPA 3DSXA 4F53A 2BF0X 3D9NA 3LJ3A 4GAAA 2J8SD 5B1BE 3NOGD 4IULA 5KJMA 1AP7A 4L23A 2DIWA 4GA2A 3FUJA 3TXNA 3ML9A 4HS2A 3SGHA 4I6GA 3RRNB 2X6KA 1SQMA 3QAQA 4XX5A 5J08A 3JUIA 1X81A 2YQ8A 2H6HA 5ARGA 4NRHB 3LY8A 2I9CA 3CVQA 2LO6A 3VLEA 4AEZC 3HXEA 3FY4A 1D9SA 1E7UA 2VGYA 4O1OA 4G11A 4GPMA 3VLFA 2OVBA 5M72A 2XEVA 3CKCA 2P58C 5KJNA 2V0PA 3B95A 2Y0BG 4E85A 4FJYA 3QARA 3SFYA 5FQ8A 1HG2A 2AW6A 3PVLA 1LD8A 1SVXA 1Y8MA 3ASOE 5A23A 3APDA 2Y1LE 2KCVA 4I2WA 4UI9C 5ITZF 3HXDA 4OAVB 4D10C 2LXLA 2VSXE 3CK9A 3UM2A 3MJWA 3PRZA 3CSFA 4UWLA 2A4ZA 3FUEA 4GMJA 4JB8P 2R59A 3FTXA 5D0OD 4RQIA 2OV8A 1LD7A 1WY6A 3UXGA 3URZA 5FZQA 2BEDA 3E34A 4G1TA 1FVHA 4WUYA 3LEWA 3U4TA 5KCMA 1ELWA 3PZ1A 3ESLA 3CK7A 3L08A 3HRAA 1H6OA 2GRNB 1RW2A 3B13A 4CGVA 3FH8A 4CZ2D 3UPVA 4LNBA 3C3OA 4BT8A 5CERB 1OY3D 3V79K 4CDRA 1UN9A 4TXRA 4CDNA 3DPYA 2VYIA 1EYHA 3ZHEA 1E90A 2A5UA 3Q9NC 1E8YA 3MZLB 3DSTA 3CIAA 3EHMA 3EU5A 3SBTB 3CHQA 3PE3A 5KJLA 2I1JA 5CRUA 4BSXA 1BI8B 1SA5A 5G55A 4AIFA 2P9UG 3Q15A 5ENTD 2RFAA 4FADA 2MRIA 3UIOC 2R5SA 1YMPA 3EJNA 1D8EA 4I6EA 4U95D 3CVXA 4BFRA 2VTBB 4FLBA 3GW4A 2HR2A 3B7UX 4KXKB 2FBNA 3NBNB 2PQNA 4CGWA 3MKRA 3CVUA 3CK8A 1KZOA 2OEVA 3FFLA 2ZGGA 2F37A 1BI7B 4LCTA 5CMWA 2LAHA 5BXOA 3CKBA 2V4HC 1XNFA 5JA4D 2PZIA 4Q69A 4KT6B 1E8WA 1MYOA 3DSSA 1KT1A 5C1DA 2WMOA 1E8ZA 5EN5D 2FO7A 2VQ2A 3D9HA 5BPPA 2HE0A 3FUKA 5AQ9A 5KWDA 1TNUA 5CHEE 3APFA 3FH7A 1WG0A 4BWRA 2V4LA 1O1RA 3FUHA 3SZ7A 4ANXA 4U7EB 4APFA 2P9PG 3FDHA 2FF4A 2AJAA 2R17C 5ENOD 5IY5E 3E37A 3PUKA 3Q78A 5EIDA 5CBNA 1S64A 3VTXA 3LPZA 4WAFA 1QNFA 1NP7A 4QQIA 2WXHA 5CEAA 4PH4B 5FQ7A 5EDSA 1MX2A 4JXTA 3ZVVA 3TL5A 5ENNA 3AG3E 2WXLA 5CCMA 4U07A 2Q7FA 3HYMB 3RO2A 2WXJA 3FUNA 3CVWA 5CMYA 3K9IA 2X6JA 5CECB 1IKND 3KEAA 4KZ0A 4MLPA 2BKGA 4JD2G 3ONLA 4U0ZA 3RRMB 4GA1A 4A63B 1TYQG 1JUQA 4HBDA 4HXIA 3V2XA 1QBQA 4ANWA 4U8HA 1QYMA 2FEZA 2WVIA 5AJLA 1SZAA 2IY0C 3OXFA 1HFAA 4MKTA 3ZEFA 5CBOA 3E30A 4DLQA 1HXIA 2LUHA 2E2EA 4I17A 2LAIA 5H7PA 5ENSD 4B93B 3AG1E 2RG8A 2V5FA 2CG3A 1MHQA 4K5BA 5E76A 3RSEG 1E7VA 3IXEA 1LTXA 4YDOA 2LNIA 4BTBA 3PEVB 4L9PA 3QWPA 3ASHA 5HKPA 3L13A 4URKA 4L1BA 2XZTG 3ASNE 2LSVA 5G04J 5AQ7A 4EHMA 3RIBA 2GW1A 5BUZA 3PS6A 3GZ2A 2Y4UA 4LNUD 4BETA 4UWFA 4Y6CA 4MRUA 4GZ6A 4OVVA 3R7QA 1NI1A 4V3IA 3TWSA 5BV0A 2P9SG 5EX3A 4HOTA 3Q49B 3PNTB 1G3NB 3DEOA 4HRMB 5BNWA 4APOA 3WG7E 5BT1A 1K1BA 2C0LA 5CEDB 4O6FA 3CLJA 5EYPF 3CGHA 4YNDA 4G8LA 1WM5A 5ENPD 4J8SA 3HG0D 4ILGA 2HM8A 1ELRA 5D2MC 5B3SE 3AU4A 1OWNA 2NC9A 4BEPA 4NURA 4HLLA 2XZDG 4AJWA 4HOQA 1H2TC 2ETBA 1SW6A 4RSYA 3RAUA 2J09A 4WWPA 3C5RA 3ABME 1N95A 4N2QA 2XPYA 5HQ8A 4XKCA 1Z3XA 4G2VA 1JPLA 3QWVA 3ZNGA 3UT8A 3B7TA 4GZCA 3ZHEB 4KVMA 4GB9A 2UY1A 3CHOA 1ZBPA 2IEJA 1N54A 2GGFA 2X6IA 3UX4A 4Z68A 4KBQA 4U8VD 4GTVA 4GYYA 4X8QA 3I4GA 2MHKA 1H2VC 5CRVA 1KPSB 1HO8A 4F6RD 2XCBA 1N4RA 1Z6TA 1MJ0A 1TEZA 3G2TA 3SY2A 3PUJA 1IXVA 4JVSA 3U66A 2VSNA 2ZGDA 3JCKC 1QQEA 3O4ZA 3RO3A 3IHYA 3LKUA 4U8YD 2WMNA 3HXBA 4XKBA 4R7LA 3JQ1A 3ZU7B 3DWLG 4CCAA 4KZCA 4FLHA 4G25A 4XZ4A 2PM7A 4TUMA 1UOHA 3R7RA 1PAQA 3UQ3A 4BY6A 3JYSA 2IO2C 2GRMA 3QK0A 3RK6A 3ZRHA 3VTYA 2BTDA 4FJZA 1H19A 4GZ3A 5JMND 4DX2A 3LJNA 4HRLA 4Q94A 4TRQA 4TXQA 4LSZE 2FULA 2WXPA 4EZKA 4N5CA 1AWCB 2CFZA 4BT9A 5AN8A 1P5QA 5LX8A 1N11A 4U0UA 4RG6A 3FUIA 2KBXA 3ESKA 3NZSA 3U64A 3T8MA 2QY7A 3FTWA 5FINA 3JUEA 3SI5A 5EILA 2R03A 3ZFWA 1EDUA 2J4BA 3FHEA 4GA0A 2XEHA 5G05C 3JXJA 5C2YA 1JWGA 4WNGA 2WM9A 1MZCA 4DX5D 3G2UA 4JPSA 4GTPA 2HO1A 3ZPJA 3DEPA 4JC8A 4OAUC 1B89A 2ZXWE 1HE8A 4P29A 4DUIA 2DZOA 2OCCE 3ABKE 3J5PA 4OVUA 2GRPB 2VJ8A 1YA0A 3S7JA 1V55E 4GTTA 3LCAA 1MX6A 2RKKA 2GRRB 3DSWA 2X3MA 2A5EA 2KCKA 3L22A 4Q96A 4ZFHA 2ZIRA 4CRWA 2WPVA 3D9JA 3UM0A 3MV2B 3L17A 3TJPA 5T4YA 1FPPA 2XGOA 3ZYLA 5KNHD 1HU3A 2FO1E 1OWOA 4UI9K 2GROB 2MYOA 1RZ4A 2HYZA 5G04C 2H6FA 2H6IA 2KZTB 3TWXA 4FHJA 4UWKA 3TWWA 4AY5A 1K1AA 2KCLA 3L16A 4BSZB 3EU9A 3BG1B 2R02A 4GPKA 2CG2A 3Q4AB 2VSYA 2F8XK 3OXLA 4GCNA 3AG4E 1JCRA 1N94A 2XS1A 3I4RB 3UKRG 1OWMA 4RLYA 4N3BA 5AENA 4ZHBA 4YVOA 2WXFA 2C0MA 1HZ4A 1A17A 4FA6A 2V8SE 4J8EA 3L9TA 4DI4A 1HG5A 2ONDA 1H6PA 2EIKE 3PH0C 4GTSA 4HNAD 1D8DA 2Y3AA 3MYVA 1UJJA 5KJKA 2XPZA 3Q79A 3PDNA 4PS7A 3EHNA 3GYZA 3TWRA 4L2LA 5FQ6A 3ZIMA 4KMOA 2PM6A 5ENRD 3B7SA 3SQVA 5FT9A 5BW8C 2Y69E 4G23A 4HI9A 4A55A 3P2BA 2AWIA 4B8CB 3LYAA 3ZXSA 1WAO1 3FWVA 4HI8A 4GZDA 5ANRA 4NQ0A 1GW6A 1TNZA 4JL0A 1WDYA 1N0QA 4TV3A 3KSLA 4XIFA 1DC2A 4GCOA 4F3VA 2WXGA 3TWQA 1MX4A 2L0TB 2YHCA 3S7BA 5EIBE 2QYJA 3PZ3A 5A6CA 4UQYA 4TUUA 3LS8A 3B7RL 2UY1B 3TWTA 1LF8A 4JW1A 3I3NA 2EIME 4N39A 2H6GA 2FI7A 1NL4A 3D9LA 1N52A 4J0UA 2WXQA 4GTOA 5EKQD 4LERA 3CHPA 1PC2A 1JWFA 2X6HA 2WXRA 4N3AA 3D9IA 4HQDA 4WNEA 4K5CA 3CHSA 2YHEA 4YDYA 2L9BA 1BU9A 2AXZA 3D9KA 1HX8A 4LRZA 3PZDA 4HFGA 4U63A 3AAAC 4LNGA 2NSZA 4JHKA 5ENQD 3QWWA 1A5EA 3IEGA 2DZNA 3AG2E 3PE4A 3TG4A 2LSUA 4LG6A 4HVBA 4HRNA 5JJ6A 3BEEA 2DWZA 3AJIA 3DPDA 4PDXA 4GMRA 2WB2A 2IO3C 3FEYA 4JA7A 4CDMA 4B0ZA 4A3VA 3ASDA 3MKQA 3LY9A 1INZA 2KZTA 3Q7FA 5FQ4A 1W3BA 3B7BA 4C48B 4RG9A 2MOWA 4WNDA 4YDWA 4I1AA 3CEQA 3Q75A 4IYPA 5LP0A 4I1OB 2JABA 2B0OE 5JHBA 2JEKA 5HS0A 2E0IA 5HRYA 2LXMA 3FUMA 4HB5A 2AVPA 3UTMA 3PEUB 1FVFA 1ZU2A 2NXPA 1QZ2A 3GZSA 3ZYKA 4BX9A 2J4DA 2ETAA 3HDXA 3NZUA 4DJAA 3FTUA 3Q47B 3MGBA 2AXVA 3MA5A 4PS3A 5EX0A 3CR3A 1N0RA 1UN8A 5T8IA 2WXNA 2CHXA 4J7WA 3T5VA 2WQ7A 4FHKA 3IKOB 1EF1C 1BD8A 1U3DA 3DXKG 3CHMA 3I5PA 4E6HA 2I6HA 5LFAA 1S63A 3G2WA 3ZUVB 4H7XA 3L82A 3ISMC 3MEKA 4HORA 3FUFA 4C9BB 2KATA 4J6IA 5LCWJ 2P9KG 2J08A 2IU1A 3KS2A 4FULA 3ZKJA 2XGSA 4DPRA 2GRQB 1N9AA 3HIZA 1KZPA 3OTNA 4MS6A 4EBAG 1S0PA 5G2NA 5AYWD 4L7TA 2CHWA 2I2OA 3CHRA 3OXGA 3ONKA 3LVQE 3ULYA 4GTMA 3V31A 5ARFA 4F1SA 2DVWA 4ANVA 4HOSA 2IOLA 4GU5A 3L6AA 1Q2ZA 3TWVA 1JCQA 3U9WA 3P1UA 1BPOA 2IONA 4EECA 3UINC 3HHMA 2QFCA 1OT8A 5AAOA 1SA4A 4JHRA 3PZ2A 4I9EA 1UG3A 2RD0A 4IRUA 4F1PA 3FTZA 2EINE 3EUVA 4ATGA 3ABLE 4JZYA 3ULEG 4AY6A 4BTAA 2XCCA 5B1AE 3UIPC 1OWPA 3KD7A 3UM1A 4O60A 5HI7A 3AU5A 1OCRE 3X2QE 1V54E 2XENA 3SBSA 3KSQA 3SD5A 2WQHA 1FT1A 2B6CA 3SNXA 4AXHA 2GRLA 2P2CP 5FIOA 3OAWA 1XGWA 3ZGQA 5E75A 3UM3A 2VGEA 4JA9A 4N2SA 5BXUA 1MQSA 3D3MA 4CT0A 3V2OA 4ABNA 3FEXA 4AM9A 3QKYA 4YDEA 3BG0B 1Y6IA 1HS6A 3Q7AA 1DCEA 3TGOA 3FTYA 4I2ZA 4O1PA 1KLXA 1OCZE 3G2VA 1IHBA 3BU8A 4ME2A 3UT4A 3R9MA 4EPZA 2L6BA 5A7DB 3EDTB 3SF4A 3HVEB 4N5QA 4L2YA 2L0IA 3W9FA 3KAEA 2C2LA 2EQXA 2RFMA 4AOFA 3T5XA 3E4BA 3Q5MA 2PL2A 4DX7D 2NYJA 2P9IG 4CYMD 1ELKA 4A1SA 3KEZA 3CQCB 2IJGX 4J8DA 4ATZD 4MBGA 1TR4A 4FU3A 4ILHB 2WXMA 3SFXA 3C98A 3IBEA 3FU0A 3V30A 3FP3A 2IOSA 3EIJA 3TXMA 3ZYMA 4UWGA 4DI3A 2PNNA 1TNBA 1K8KG 2QC9A 4G8KA 2KXPC 4XI0A 3DXMG 4GTRA 3NQPA 1NA3A 3RJVA 2ETCA 4BESA 3SO8A 4NACA 2R2LA 4EBAA 1X5BA 5BV1A 3ASGA 4B94A 5AQBA 4K03A 2XS8A 1N4SA 3LY7A 3TWUA 3UUXA 4BERA 4KYOB 5DIZA 2L6JA 1OWLA 3NAWA 2J07A 3Q9UC 2WQ6A 4W9RA 3MKQB 2OEWA 1E8XA 1TN8A 2IQCA
chains in the Genus database with same CATH topology
1N52A 4ILGA 2YQ8A 2HM8A 1ELRA 4J0UA 2VGXA 5ARGA 2WXQA 4I6JA 4NRHB 3QNKA 4I9CA 3LY8A 2I9CA 3CVQA 3AU4A 2LO6A 4LERA 5EKQD 3VLEA 4H7YA 3CHPA 2PQRA 1PC2A 4GZ5A 4AEZC 1IYGA 1OWNA 1JWFA 2X6HA 2WXRA 2NC9A 3FY4A 4N3AA 3D9IA 4NURA 3UT7A 3FU3A 4B89A 1E7UA 4WNEA 4AJWA 2VGYA 4HOQA 3ZN3A 3CHSA 4G11A 3VLFA 2YHEA 2OVBA 1H2TC 5M72A 4WWOA 2XEVA 3CKCA 2P58C 4A3TA 5KJNA 2V0PA 3R9AB 4E85A 4RSYA 2L9BA 4FJYA 2ILRA 2AXZA 2DBAA 3PREA 3RRUA 3D9KA 3MCXA 1HX8A 1Z3YA 3QARA 2J09A 4WWPA 4LRZA 3PZDA 5FQ8A 4HFGA 4U63A 1HG2A 3S7FA 2AW6A 3G2SA 5JJ7A 3PVLA 2NSZA 2IFUA 4AVXA 4JHKA 3D9PA 3QWWA 3IEGA 1Y8MA 3PE4A 4N3CA 3TG4A 4N2QA 5A23A 4ANUA 2LSUA 1NA0A 2XPYA 3D9OA 5HQ8A 5AJDA 3APDA 3FUDA 4XKCA 3RU0A 1Z3XA 2KCVA 2OVFA 4G2VA 4I2WA 4UI9C 1JPLA 3QWVA 3UT8A 3B7TA 4HVBA 4GZCA 5JJ6A 3BEEA 4UQZA 4D10C 1UJKA 3DPDA 4PDXA 3JUIA 3ZHEB 4KVMA 4GB9A 2UY1A 3CHOA 1ZBPA 2WB2A 2VSXE 3FEYA 3CK9A 4LEUA 4JA7A 4CDMA 3MX3A 3MJWA 4A1GA 3PRZA 3CSFA 1N54A 2GGFA 4UWLA 4B0ZA 2X6IA 2A4ZA 3D9MA 3FUEA 3ASDA 3UX4A 4A3VA 4GMJA 2AXUA 3TG5A 2R59A 3FTXA 4KBQA 3JQ0A 3MKQA 5D0OD 2OV8A 1WY6A 1KT0A 3LY9A 1INZA 3RKVA 2KZTA 4GYYA 3ML8A 3URZA 3I4GA 2MHKA 3AS5A 1H2VC 1W3BA 3LXUX 5FQ4A 5FZQA 2M63A 1HO8A 2ZU6B 2XCBA 4FP7A 5LCWC 1Z6TA 4RG9A 2MOWA 4WNDA 1TEZA 4G1TA 5CCLA 1FVHA 4I1AA 4WUYA 3CEQA 4IYPA 5LP0A 4I1OB 3G2TA 4EZJA 3LEWA 4DK5A 3U4TA 5KCMA 1ELWA 3ESLA 3CK7A 4GYOA 2CHZA 5JHBA 2JEKA 3L08A 4PUCA 1HF8A 5J90A 3B13A 3PUJA 1H6KA 4GYWA 2E0IA 4JVSA 4CGVA 3QC1A 3FUMA 3FH8A 5FJYA 3QJZA 2AVPA 3HVEA 3U66A 3UPVA 2VSNA 3JCKC 4BT8A 1QQEA 3O4ZA 3RO3A 3IHYA 3CVVA 3LKUA 3CVLA 3PEUB 1PY1A 3N71A 2WMNA 1FVFA 3L54A 1ZU2A 4CDRA 2NXPA 4XKBA 1UN9A 4ACKA 1E96B 4R7LA 3JQ1A 1QZ2A 3GZSA 3ZYKA 3FU6A 4BX9A 1H2UA 4CCAA 4KZCA 2J4DA 4CDNA 3HDXA 4JEHA 3NZUA 5FWQA 4AV7A 4FLHA 4DJAA 2VYIA 4G25A 4XZ4A 1EYHA 2XGMA 1VDYA 2PM7A 3ZHEA 1E90A 3FTUA 2A5UA 3R7RA 1PAQA 1E8YA 3Q47B 3UQ3A 3MGBA 3MZLB 4BY6A 2AXVA 2IF4A 3MA5A 4PS3A 3CIAA 2UWJG 3EHMA 3CR3A 3JYSA 5EX0A 2X38A 1UN8A 4UI9J 3SBTB 5T8IA 1IHGA 2GRMA 3CHQA 3QK0A 2WXNA 2CHXA 3T5VA 4JEUA 3PE3A 3RK6A 2WQ7A 3ZRHA 5KJLA 2I1JA 4FHKA 3VTYA 1HH8A 2BTDA 3IKOB 4FJZA 1H19A 1EF1C 4WWNA 4BSXA 4GZ3A 1U3DA 5FTPA 3U3WA 3CV0A 3CHMA 3FH5A 4Q94A 4TRQA 5DBKA 5G05J 4EZLA 1EPUA 3GZ1A 3I5PA 2FULA 2Y4TA 4E6HA 2I6HA 5LFAA 2WXPA 3G2WA 5G55A 4EZKA 4AIFA 5LOZA 4BX8A 4N5CA 3Q15A 2OOEA 4H7XA 2I1KA 1IQRA 2CFZA 4BT9A 4FADA 2MRIA 3MEKA 4HORA 3FUFA 2R5SA 1P5QA 5LX8A 4C9BB 4U0UA 2KATA 3EJNA 4J6IA 4M3OA 4RG6A 4I6EA 5LCWJ 2J08A 2IU1A 3KS2A 3CVXA 2JLBA 3FUIA 3FTVA 4FULA 4BFRA 2VTBB 3ESKA 4FLBA 5JHAA 4DPRA 2XGSA 3NZSA 3GW4A 2HR2A 3QB2A 2QY7A 3B7UX 4KXKB 4HOUA 3T8MA 3U64A 3FTWA 2FBNA 3HIZA 4WNFA 3OTNA 4MS6A 3SI5A 4EBAG 4U0SA 2PQNA 4CGWA 3MKRA 1S0PA 3TAXA 3CVUA 3CK8A 5G2NA 5AYWD 1UW4B 3ZFWA 4L7TA 1EDUA 2CHWA 3ASFA 2I2OA 3FFLA 3CHRA 3OXGA 4LCTA 5CMWA 2J4BA 4ILIA 3FHEA 4GA0A 4DLOA 2LAHA 3ONKA 3LVQE 5G05C 4C0MA 5C2YA 3CKBA 1JWGA 4WNGA 1XNFA 4RVBA 2PZIA 2WM9A 4Q69A 5ARFA 4F1SA 3APCA 4KT6B 4XI9A 4ANVA 1E8WA 4HOSA 3G2UA 4JPSA 3AS8A 2IOLA 2XPIA 4GU5A 5AIJA 1KT1A 1TJCA 3L6AA 4K0RA 5C1DA 3CQGB 4YVQC 2WMOA 1E8ZA 4B8AA 3IV0A 1TJFA 2FO7A 2HO1A 3ZPJA 2VQ2A 4JC8A 3U9WA 5BPPA 3P1UA 3FUKA 1BPOA 3SHFA 2IONA 3UMVA 4EECA 5JJTA 3LVRE 1B89A 1HE8A 5CHEE 4P29A 3HHMA 4OVUA 3APFA 3QDNA 2QFCA 3FH7A 2VJ8A 4BWRA 2V4LA 3WXXA 1YA0A 4JHRA 4I9EA 1UG3A 3CSTA 3S7JA 3FUHA 2RD0A 4HLEA 4FC8A 4IRUA 3SZ7A 3LCAA 4ANXA 3CVNA 4APFA 3FTZA 4PS8A 3FTSA 2X3MA 3FDHA 4LUNU 2FF4A 4XE0A 4GMLA 4ATGA 4G26A 2R17C 4JZYA 5FZSA 2KCKA 3L22A 4Q96A 4IN3B 4AY6A 4BTAA 2XCCA 4CRWA 2XRYA 3PUKA 4CEMA 2VTBA 2WPVA 1OWPA 3KD7A 3MV3B 3D9JA 3MV2B 4QFVA 3O48A 5HI7A 3AU5A 3VTXA 1DVPA 3LPZA 4WAFA 1QNFA 1NP7A 2CFUA 3SBSA 3EIQC 3L17A 2WXHA 3SD5A 4PH4B 5D0QD 2WQHA 5FQ7A 3IHVA 3TJPA 4Y6WA 3SNXA 5T4YA 4AXHA 5EDSA 2GRLA 2WXKA 2XGOA 4I43A 4JXTA 3ZYLA 4CT4A 3ZVVA 1HU3A 1IQUA 3OAWA 5ENNA 1U3CA 3TL5A 1OWOA 1XGWA 5FZRA 4AP2A 3ZGQA 3ZW3A 5E75A 2WXLA 3S2AA 4UI9K 5CCMA 4U07A 2Q7FA 3HYMB 3RO2A 4JA9A 2WXJA 2HYZA 3ZYQA 4G24A 4N2SA 5G04C 3FUNA 4EQFA 3CVWA 1MQSA 3D3MA 5CMYA 3ULQA 4ABNA 4CT0A 2KZTB 3FEXA 4KVOA 4AM9A 3QKYA 4FHJA 4UWKA 3BG0B 4U04A 3K9IA 2X6JA 1Y6IA 5ANLA 4AY5A 2KM4A 4KZ0A 1DNPA 1HS6A 4MLPA 2KCLA 3L16A 3ONLA 1OUVA 3TGOA 3BG1B 4U0ZA 3RRMB 3FTYA 4GA1A 4GPKA 4I2ZA 1JUQA 1KLXA 3CVYA 2CG2A 3G2VA 4HXIA 4JHJA 4F7AA 4ME2A 3Q4AB 3FULA 4U8HA 2VSYA 3UT4A 4ANWA 4EPZA 3OXLA 5A7DB 2DCPA 4GCNA 2FEZA 3VLDA 2WVIA 1H0AA 3EDTB 3I4RB 5AJLA 3SF4A 1OWMA 5AENA 4N3BA 3HVEB 4L2YA 1SZAA 2L0IA 2VSOE 3FU5A 4YVOA 3OXFA 2WXFA 1HFAA 2C2LA 3KAEA 2XRZA 2EQXA 2C0MA 4MKTA 3ZEFA 1HZ4A 4AOFA 3T5XA 3E4BA 1A17A 3NF1A 2PL2A 3Q5MA 1HXIA 4DLQA 2YINA 1NZNA 2E2EA 4OYSA 3AS4A 4I17A 2LAIA 4FA6A 2V8SE 4I1MA 4J8EA 4DI4A 1HG5A 1ELKA 2ONDA 2XHEA 3PH0C 4J8FA 4A1SA 2Y3AA 3MYVA 1UJJA 3KEZA 3CQCB 2IJGX 2RG8A 4J8DA 2V5FA 5KJKA 4FU3A 2XPZA 4ILHB 3PDNA 4PS7A 2CG3A 1MHQA 3EHNA 5T3RA 3GYZA 2VGXB 2WXMA 5E76A 4L2LA 3C98A 3QOUA 3IBEA 3FU0A 1E7VA 5FQ6A 3ZIMA 1L5JA 4KMOA 3FP3A 2LNIA 2PM6A 4UQXA 4ACLA 4BTBA 1FCHA 2IOSA 2X6FA 3EIJA 2XQ0A 3B7SA 5FT9A 5BW8C 3S7DA 3PEVB 3TXMA 2J9QA 3ZYMA 2YNQA 2BUGA 2WXOA 3PNLB 4G23A 3DBSA 2J49A 4UWGA 3QWPA 3CVPA 4UWHA 4DI3A 4A55A 3P2BA 3ASHA 2AWIA 4C0EA 3SFZA 4B8CB 3LYAA 3ENEA 3LDZA 2KC7A 3L13A 4XI0A 3ZXSA 4URKA 2WXIA 1WAO1 3FWVA 1SZ9A 4GZDA 3NQPA 5ANRA 4L1BA 4F53A 4NQ0A 2BF0X 1NA3A 1GW6A 3RJVA 2LSVA 5G04J 4JL0A 3RIBA 2GW1A 5BUZA 3D9NA 3PS6A 4TV3A 3LJ3A 3GZ2A 4GAAA 2Y4UA 4UWFA 4XIFA 4Y6CA 4MRUA 4GZ6A 4OVVA 3R7QA 4GCOA 4F3VA 4V3IA 2WXGA 5BV0A 4NACA 5EX3A 4EBAA 4HOTA 3Q49B 1X5BA 5BV1A 3ASGA 2L0TB 2YHCA 3S7BA 4IULA 5KJMA 3PNTB 4B94A 4K03A 5BNWA 4APOA 3LY7A 5A6CA 4UQYA 3UUXA 4L23A 2DIWA 4KYOB 4TUUA 5DIZA 2L6JA 3LS8A 3B7RL 1OWLA 4GA2A 2UY1B 3FUJA 5BT1A 3TXNA 3ML9A 4HS2A 2C0LA 1LF8A 3SGHA 4I6GA 4JW1A 2J07A 3I3NA 4O6FA 3CLJA 3RRNB 3CGHA 4YNDA 2X6KA 1WM5A 1SQMA 3QAQA 4N39A 4W9RA 3MKQB 4XX5A 5J08A 2WQ6A 1E8XA 4J8SA 2IQCA 2FI7A 3D9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J0U A;  2YQ8 A;  1ELR A;  2VGX A;  5ARG A;  4NRH B;  4I9C A;  3LY8 A;  3CVQ A;  5EKQ D;  4H7Y A;  2PQR A;  1PC2 A;  4GZ5 A;  1IYG A;  2NC9 A;  4N3A A;  4WNE A;  2VGY A;  4HOQ A;  3ZN3 A;  5M72 A;  2XEV A;  3CKC A;  2P58 C;  5KJN A;  3R9A B;  2DBA A;  3S7F A;  5JJ7 A;  2IFU A;  3QWW A;  3IEG A;  1Y8M A;  3PE4 A;  4N3C A;  3TG4 A;  4N2Q A;  2LSU A;  1NA0 A;  5HQ8 A;  3RU0 A;  2KCV A;  4G2V A;  4I2W A;  4UI9 C;  3QWV A;  5JJ6 A;  3BEE A;  4UQZ A;  3ZHE B;  2UY1 A;  1ZBP A;  3CK9 A;  4LEU A;  4JA7 A;  3ASD A;  3TG5 A;  4KBQ A;  5D0O D;  1KT0 A;  3LY9 A;  3RKV A;  4GYY A;  3URZ A;  2MHK A;  3AS5 A;  5FZQ A;  1W3B A;  2XCB A;  5LCW C;  4RG9 A;  4WND A;  4G1T A;  5CCL A;  4I1A A;  4WUY A;  3CEQ A;  3U4T A;  1ELW A;  3CK7 A;  4GYO A;  4GYW A;  4CGV A;  5FJY A;  2AVP A;  3UPV A;  2VSN A;  4BT8 A;  1QQE A;  3RO3 A;  3LKU A;  3CVL A;  3N71 A;  1ZU2 A;  4CDR A;  1E96 B;  1QZ2 A;  2VYI A;  4G25 A;  2XGM A;  3ZHE A;  3Q47 B;  3UQ3 A;  2IF4 A;  3MA5 A;  2UWJ G;  5EX0 A;  3JYS A;  4UI9 J;  1IHG A;  3PE3 A;  5KJL A;  3VTY A;  1HH8 A;  4GZ3 A;  5FTP A;  3U3W A;  3CV0 A;  5G05 J;  5DBK A;  3GZ1 A;  2Y4T A;  2I6H A;  4AIF A;  4N5C A;  3Q15 A;  2OOE A;  4H7X A;  4BT9 A;  3MEK A;  4HOR A;  2R5S A;  1P5Q A;  4U0U A;  2KAT A;  5LCW J;  4RG6 A;  3KS2 A;  2JLB A;  3ESK A;  2XGS A;  3GW4 A;  2HR2 A;  4KXK B;  4HOU A;  2FBN A;  4WNF A;  4U0S A;  2PQN A;  4CGW A;  3MKR A;  3TAX A;  3CK8 A;  5AYW D;  3ZFW A;  3ASF A;  3FFL A;  3OXG A;  4GA0 A;  5G05 C;  3CKB A;  4WNG A;  1XNF A;  2PZI A;  5ARF A;  4XI9 A;  4HOS A;  3AS8 A;  2XPI A;  1KT1 A;  1TJC A;  5C1D A;  4YVQ C;  2FO7 A;  2HO1 A;  3ZPJ A;  2VQ2 A;  5JJT A;  1B89 A;  5CHE E;  3QDN A;  2QFC A;  4BWR A;  3WXX A;  1YA0 A;  4JHR A;  4I9E A;  3S7J A;  3SZ7 A;  3LCA A;  3CVN A;  2FF4 A;  4G26 A;  5FZS A;  2KCK A;  4IN3 B;  4AY6 A;  4BTA A;  2XCC A;  2WPV A;  3KD7 A;  3MV3 B;  3MV2 B;  3O48 A;  5HI7 A;  3VTX A;  3LPZ A;  5D0Q D;  2WQH A;  4Y6W A;  2XGO A;  5FZR A;  3ZGQ A;  4UI9 K;  5CCM A;  4U07 A;  2Q7F A;  3HYM B;  3RO2 A;  4JA9 A;  2HYZ A;  4G24 A;  4N2S A;  5G04 C;  4EQF A;  3ULQ A;  4ABN A;  4AM9 A;  3QKY A;  4U04 A;  3K9I A;  4AY5 A;  2KCL A;  1OUV A;  3TGO A;  4U0Z A;  4GA1 A;  4GPK A;  4I2Z A;  1KLX A;  4ME2 A;  3Q4A B;  2VSY A;  3OXL A;  5A7D B;  4GCN A;  2FEZ A;  3EDT B;  3SF4 A;  4N3B A;  4YVO A;  3OXF A;  3KAE A;  2C2L A;  2C0M A;  1HZ4 A;  3E4B A;  1A17 A;  3NF1 A;  2PL2 A;  3Q5M A;  1HXI A;  1NZN A;  2E2E A;  3AS4 A;  4I17 A;  4J8E A;  2OND A;  4J8F A;  4A1S A;  5KJK A;  4J8D A;  2V5F A;  3PDN A;  3GYZ A;  2VGX B;  3QOU A;  3FP3 A;  2LNI A;  4UQX A;  4BTB A;  1FCH A;  3S7D A;  5FT9 A;  5BW8 C;  2J9Q A;  2BUG A;  4G23 A;  3QWP A;  3CVP A;  3ASH A;  3LYA A;  2KC7 A;  4XI0 A;  1WAO 1;  3FWV A;  4NQ0 A;  1NA3 A;  3RJV A;  2LSV A;  5G04 J;  4JL0 A;  3RIB A;  2GW1 A;  3GZ2 A;  2Y4U A;  4XIF A;  4Y6C A;  4GZ6 A;  4GCO A;  4F3V A;  5EX3 A;  4HOT A;  3Q49 B;  3ASG A;  2YHC A;  3S7B A;  5KJM A;  4B94 A;  5BNW A;  4APO A;  3LY7 A;  5A6C A;  4UQY A;  3UUX A;  4KYO B;  5DIZ A;  2L6J A;  5BT1 A;  4GA2 A;  2UY1 B;  2C0L A;  4O6F A;  4YND A;  1WM5 A;  4N39 A;  4W9R A;  2FI7 A; 
#chains in the Genus database with same CATH topology
 1TN7 A;  2VGX A;  1YCS B;  4I6J A;  3Q73 A;  3QNK A;  4I9C A;  1OCO E;  4H7Y A;  5KNG A;  2PQR A;  4GZ5 A;  1IYG A;  1S70 B;  3UT7 A;  3FU3 A;  4B89 A;  2QYU A;  3ZN3 A;  4WWO A;  4A3T A;  3R9A B;  2ILR A;  1U2V G;  2DBA A;  3PRE A;  3RRU A;  3MCX A;  1Z3Y A;  1N4Q A;  3S7F A;  1O1T A;  3EHR A;  5D66 A;  3G2S A;  5JJ7 A;  2IFU A;  4AVX A;  3D9P A;  4N3C A;  4ANU A;  3C72 A;  1NA0 A;  3D9O A;  5AJD A;  3RU0 A;  3FUD A;  2OVF A;  3NB2 A;  4UQZ A;  1TNY A;  1K3Z D;  1UJK A;  2DYR E;  4LEU A;  3MX3 A;  4A1G A;  3D9M A;  2AXU A;  1N4P A;  3TG5 A;  3JQ0 A;  1KT0 A;  3RKV A;  3ML8 A;  3LXU X;  3AS5 A;  3BQO A;  2M63 A;  2ZU6 B;  2BKK B;  4FP7 A;  5LCW C;  5CCL A;  4EZJ A;  3C3Q A;  4DK5 A;  4GYO A;  2CHZ A;  4PUC A;  5AAR A;  1HF8 A;  1YYH A;  4DX1 A;  5J90 A;  1H6K A;  4GYW A;  3E33 A;  1JCS A;  3C3R A;  3QC1 A;  5FJY A;  3QJZ A;  3HVE A;  3CVV A;  3CVL A;  1PY1 A;  3N71 A;  3L54 A;  1DCQ A;  4ACK A;  1E96 B;  3FU6 A;  1H2U A;  4JEH A;  5FWQ A;  4AV7 A;  3UKU G;  3DRA A;  2XGM A;  1VDY A;  2IF4 A;  2UWJ G;  2X38 A;  4UI9 J;  1IHG A;  4UUC A;  1Z5S C;  4JEU A;  1HH8 A;  4WWN A;  5FTP A;  2P9L G;  3U3W A;  3CV0 A;  3FH5 A;  4EZL A;  5G05 J;  5DBK A;  1EPU A;  3GZ1 A;  2Y4T A;  4BX8 A;  5LOZ A;  3T9K A;  4J8Y A;  2OOE A;  4TXP A;  2I1K A;  1IQR A;  4U96 D;  4M3O A;  3NOC D;  2JLB A;  3FTV A;  5JHA A;  3QB2 A;  4HOU A;  4WNF A;  2V5Q C;  4U0S A;  3TAX A;  1UW4 B;  3W9G A;  3ASF A;  4ILI A;  4DLO A;  3BUA A;  4C0M A;  4RVB A;  4GTQ A;  2EIJ E;  3APC A;  4XI9 A;  1ZB1 A;  1FT2 A;  3AS8 A;  3DSV A;  2XPI A;  5AIJ A;  1TJC A;  2R05 A;  4K0R A;  3CQG B;  4YVQ C;  4B8A A;  3IV0 A;  1TJF A;  1TNO A;  3SHF A;  3UMV A;  5JJT A;  3LVR E;  2P9N G;  4DX6 D;  3QDN A;  3WXX A;  3CST A;  3J5Q B;  4HLE A;  2EIL E;  4FC8 A;  3CVN A;  3EHQ A;  4PS8 A;  3FTS A;  4LUN U;  4XE0 A;  4GML A;  4G26 A;  5FZS A;  4IN3 B;  2XRY A;  4CEM A;  2VTB A;  3HXF A;  5AQA A;  3MV3 B;  3T8K A;  4QFV A;  3O48 A;  3PZ4 A;  1DVP A;  2CFU A;  3EIQ C;  3HXC A;  5D0Q D;  3IHV A;  2QZA A;  4Y6W A;  2WXK A;  4I43 A;  1BLX B;  4CT4 A;  1IQU A;  1U3C A;  5FZR A;  4AP2 A;  3ZW3 A;  3S2A A;  1NFI E;  3ZYQ A;  4G24 A;  4EQF A;  3ULQ A;  2DYS E;  4KVO A;  4U04 A;  5ANL A;  2KM4 A;  1DNP A;  1OUV A;  3F6Q A;  1OCC E;  3CVY A;  4JHJ A;  4F7A A;  3FUL A;  2ZIS A;  2DCP A;  3VLD A;  1H0A A;  2VSO E;  3FU5 A;  1TN6 A;  2XRZ A;  3JXI A;  3E32 A;  4XEI G;  3NF1 A;  2YIN A;  1NZN A;  2F0Y A;  3AS4 A;  4OYS A;  4I1M A;  2XHE A;  4J8F A;  4NIK A;  4M7C A;  3UI2 A;  5T3R A;  4DRX E;  2VGX B;  2F8Y A;  3QOU A;  5KBA A;  1L5J A;  4UQX A;  4ACL A;  1FCH A;  2X6F A;  2XQ0 A;  3S7D A;  2J9Q A;  2YNQ A;  2BUG A;  2WXO A;  3PNL B;  2XEE A;  3DBS A;  4K5A B;  1O1S A;  2J49 A;  1O5M A;  4UWH A;  3CVP A;  3DSU A;  4C0E A;  3SFZ A;  3ENE A;  3LDZ A;  2KC7 A;  1OXJ A;  5EYL A;  2WXI A;  1SZ9 A;  3ZXP A;  3DSX A;  4F53 A;  2BF0 X;  3D9N A;  3LJ3 A;  4GAA A;  2J8S D;  5B1B E;  3NOG D;  4IUL A;  5KJM A;  1AP7 A;  4L23 A;  2DIW A;  4GA2 A;  3FUJ A;  3TXN A;  3ML9 A;  4HS2 A;  3SGH A;  4I6G A;  3RRN B;  2X6K A;  1SQM A;  3QAQ A;  4XX5 A;  5J08 A;  3JUI A;  1X81 A;  2YQ8 A;  2H6H A;  5ARG A;  4NRH B;  3LY8 A;  2I9C A;  3CVQ A;  2LO6 A;  3VLE A;  4AEZ C;  3HXE A;  3FY4 A;  1D9S A;  1E7U A;  2VGY A;  4O1O A;  4G11 A;  4GPM A;  3VLF A;  2OVB A;  5M72 A;  2XEV A;  3CKC A;  2P58 C;  5KJN A;  2V0P A;  3B95 A;  2Y0B G;  4E85 A;  4FJY A;  3QAR A;  3SFY A;  5FQ8 A;  1HG2 A;  2AW6 A;  3PVL A;  1LD8 A;  1SVX A;  1Y8M A;  3ASO E;  5A23 A;  3APD A;  2Y1L E;  2KCV A;  4I2W A;  4UI9 C;  5ITZ F;  3HXD A;  4OAV B;  4D10 C;  2LXL A;  2VSX E;  3CK9 A;  3UM2 A;  3MJW A;  3PRZ A;  3CSF A;  4UWL A;  2A4Z A;  3FUE A;  4GMJ A;  4JB8 P;  2R59 A;  3FTX A;  5D0O D;  4RQI A;  2OV8 A;  1LD7 A;  1WY6 A;  3UXG A;  3URZ A;  5FZQ A;  2BED A;  3E34 A;  4G1T A;  1FVH A;  4WUY A;  3LEW A;  3U4T A;  5KCM A;  1ELW A;  3PZ1 A;  3ESL A;  3CK7 A;  3L08 A;  3HRA A;  1H6O A;  2GRN B;  1RW2 A;  3B13 A;  4CGV A;  3FH8 A;  4CZ2 D;  3UPV A;  4LNB A;  3C3O A;  4BT8 A;  5CER B;  1OY3 D;  3V79 K;  4CDR A;  1UN9 A;  4TXR A;  4CDN A;  3DPY A;  2VYI A;  1EYH A;  3ZHE A;  1E90 A;  2A5U A;  3Q9N C;  1E8Y A;  3MZL B;  3DST A;  3CIA A;  3EHM A;  3EU5 A;  3SBT B;  3CHQ A;  3PE3 A;  5KJL A;  2I1J A;  5CRU A;  4BSX A;  1BI8 B;  1SA5 A;  5G55 A;  4AIF A;  2P9U G;  3Q15 A;  5ENT D;  2RFA A;  4FAD A;  2MRI A;  3UIO C;  2R5S A;  1YMP A;  3EJN A;  1D8E A;  4I6E A;  4U95 D;  3CVX A;  4BFR A;  2VTB B;  4FLB A;  3GW4 A;  2HR2 A;  3B7U X;  4KXK B;  2FBN A;  3NBN B;  2PQN A;  4CGW A;  3MKR A;  3CVU A;  3CK8 A;  1KZO A;  2OEV A;  3FFL A;  2ZGG A;  2F37 A;  1BI7 B;  4LCT A;  5CMW A;  2LAH A;  5BXO A;  3CKB A;  2V4H C;  1XNF A;  5JA4 D;  2PZI A;  4Q69 A;  4KT6 B;  1E8W A;  1MYO A;  3DSS A;  1KT1 A;  5C1D A;  2WMO A;  1E8Z A;  5EN5 D;  2FO7 A;  2VQ2 A;  3D9H A;  5BPP A;  2HE0 A;  3FUK A;  5AQ9 A;  5KWD A;  1TNU A;  5CHE E;  3APF A;  3FH7 A;  1WG0 A;  4BWR A;  2V4L A;  1O1R A;  3FUH A;  3SZ7 A;  4ANX A;  4U7E B;  4APF A;  2P9P G;  3FDH A;  2FF4 A;  2AJA A;  2R17 C;  5ENO D;  5IY5 E;  3E37 A;  3PUK A;  3Q78 A;  5EID A;  5CBN A;  1S64 A;  3VTX A;  3LPZ A;  4WAF A;  1QNF A;  1NP7 A;  4QQI A;  2WXH A;  5CEA A;  4PH4 B;  5FQ7 A;  5EDS A;  1MX2 A;  4JXT A;  3ZVV A;  3TL5 A;  5ENN A;  3AG3 E;  2WXL A;  5CCM A;  4U07 A;  2Q7F A;  3HYM B;  3RO2 A;  2WXJ A;  3FUN A;  3CVW A;  5CMY A;  3K9I A;  2X6J A;  5CEC B;  1IKN D;  3KEA A;  4KZ0 A;  4MLP A;  2BKG A;  4JD2 G;  3ONL A;  4U0Z A;  3RRM B;  4GA1 A;  4A63 B;  1TYQ G;  1JUQ A;  4HBD A;  4HXI A;  3V2X A;  1QBQ A;  4ANW A;  4U8H A;  1QYM A;  2FEZ A;  2WVI A;  5AJL A;  1SZA A;  2IY0 C;  3OXF A;  1HFA A;  4MKT A;  3ZEF A;  5CBO A;  3E30 A;  4DLQ A;  1HXI A;  2LUH A;  2E2E A;  4I17 A;  2LAI A;  5H7P A;  5ENS D;  4B93 B;  3AG1 E;  2RG8 A;  2V5F A;  2CG3 A;  1MHQ A;  4K5B A;  5E76 A;  3RSE G;  1E7V A;  3IXE A;  1LTX A;  4YDO A;  2LNI A;  4BTB A;  3PEV B;  4L9P A;  3QWP A;  3ASH A;  5HKP A;  3L13 A;  4URK A;  4L1B A;  2XZT G;  3ASN E;  2LSV A;  5G04 J;  5AQ7 A;  4EHM A;  3RIB A;  2GW1 A;  5BUZ A;  3PS6 A;  3GZ2 A;  2Y4U A;  4LNU D;  4BET A;  4UWF A;  4Y6C A;  4MRU A;  4GZ6 A;  4OVV A;  3R7Q A;  1NI1 A;  4V3I A;  3TWS A;  5BV0 A;  2P9S G;  5EX3 A;  4HOT A;  3Q49 B;  3PNT B;  1G3N B;  3DEO A;  4HRM B;  5BNW A;  4APO A;  3WG7 E;  5BT1 A;  1K1B A;  2C0L A;  5CED B;  4O6F A;  3CLJ A;  5EYP F;  3CGH A;  4YND A;  4G8L A;  1WM5 A;  5ENP D;  4J8S A;  3HG0 D;  4ILG A;  2HM8 A;  1ELR A;  5D2M C;  5B3S E;  3AU4 A;  1OWN A;  2NC9 A;  4BEP A;  4NUR A;  4HLL A;  2XZD G;  4AJW A;  4HOQ A;  1H2T C;  2ETB A;  1SW6 A;  4RSY A;  3RAU A;  2J09 A;  4WWP A;  3C5R A;  3ABM E;  1N95 A;  4N2Q A;  2XPY A;  5HQ8 A;  4XKC A;  1Z3X A;  4G2V A;  1JPL A;  3QWV A;  3ZNG A;  3UT8 A;  3B7T A;  4GZC A;  3ZHE B;  4KVM A;  4GB9 A;  2UY1 A;  3CHO A;  1ZBP A;  2IEJ A;  1N54 A;  2GGF A;  2X6I A;  3UX4 A;  4Z68 A;  4KBQ A;  4U8V D;  4GTV A;  4GYY A;  4X8Q A;  3I4G A;  2MHK A;  1H2V C;  5CRV A;  1KPS B;  1HO8 A;  4F6R D;  2XCB A;  1N4R A;  1Z6T A;  1MJ0 A;  1TEZ A;  3G2T A;  3SY2 A;  3PUJ A;  1IXV A;  4JVS A;  3U66 A;  2VSN A;  2ZGD A;  3JCK C;  1QQE A;  3O4Z A;  3RO3 A;  3IHY A;  3LKU A;  4U8Y D;  2WMN A;  3HXB A;  4XKB A;  4R7L A;  3JQ1 A;  3ZU7 B;  3DWL G;  4CCA A;  4KZC A;  4FLH A;  4G25 A;  4XZ4 A;  2PM7 A;  4TUM A;  1UOH A;  3R7R A;  1PAQ A;  3UQ3 A;  4BY6 A;  3JYS A;  2IO2 C;  2GRM A;  3QK0 A;  3RK6 A;  3ZRH A;  3VTY A;  2BTD A;  4FJZ A;  1H19 A;  4GZ3 A;  5JMN D;  4DX2 A;  3LJN A;  4HRL A;  4Q94 A;  4TRQ A;  4TXQ A;  4LSZ E;  2FUL A;  2WXP A;  4EZK A;  4N5C A;  1AWC B;  2CFZ A;  4BT9 A;  5AN8 A;  1P5Q A;  5LX8 A;  1N11 A;  4U0U A;  4RG6 A;  3FUI A;  2KBX A;  3ESK A;  3NZS A;  3U64 A;  3T8M A;  2QY7 A;  3FTW A;  5FIN A;  3JUE A;  3SI5 A;  5EIL A;  2R03 A;  3ZFW A;  1EDU A;  2J4B A;  3FHE A;  4GA0 A;  2XEH A;  5G05 C;  3JXJ A;  5C2Y A;  1JWG A;  4WNG A;  2WM9 A;  1MZC A;  4DX5 D;  3G2U A;  4JPS A;  4GTP A;  2HO1 A;  3ZPJ A;  3DEP A;  4JC8 A;  4OAU C;  1B89 A;  2ZXW E;  1HE8 A;  4P29 A;  4DUI A;  2DZO A;  2OCC E;  3ABK E;  3J5P A;  4OVU A;  2GRP B;  2VJ8 A;  1YA0 A;  3S7J A;  1V55 E;  4GTT A;  3LCA A;  1MX6 A;  2RKK A;  2GRR B;  3DSW A;  2X3M A;  2A5E A;  2KCK A;  3L22 A;  4Q96 A;  4ZFH A;  2ZIR A;  4CRW A;  2WPV A;  3D9J A;  3UM0 A;  3MV2 B;  3L17 A;  3TJP A;  5T4Y A;  1FPP A;  2XGO A;  3ZYL A;  5KNH D;  1HU3 A;  2FO1 E;  1OWO A;  4UI9 K;  2GRO B;  2MYO A;  1RZ4 A;  2HYZ A;  5G04 C;  2H6F A;  2H6I A;  2KZT B;  3TWX A;  4FHJ A;  4UWK A;  3TWW A;  4AY5 A;  1K1A A;  2KCL A;  3L16 A;  4BSZ B;  3EU9 A;  3BG1 B;  2R02 A;  4GPK A;  2CG2 A;  3Q4A B;  2VSY A;  2F8X K;  3OXL A;  4GCN A;  3AG4 E;  1JCR A;  1N94 A;  2XS1 A;  3I4R B;  3UKR G;  1OWM A;  4RLY A;  4N3B A;  5AEN A;  4ZHB A;  4YVO A;  2WXF A;  2C0M A;  1HZ4 A;  1A17 A;  4FA6 A;  2V8S E;  4J8E A;  3L9T A;  4DI4 A;  1HG5 A;  2OND A;  1H6P A;  2EIK E;  3PH0 C;  4GTS A;  4HNA D;  1D8D A;  2Y3A A;  3MYV A;  1UJJ A;  5KJK A;  2XPZ A;  3Q79 A;  3PDN A;  4PS7 A;  3EHN A;  3GYZ A;  3TWR A;  4L2L A;  5FQ6 A;  3ZIM A;  4KMO A;  2PM6 A;  5ENR D;  3B7S A;  3SQV A;  5FT9 A;  5BW8 C;  2Y69 E;  4G23 A;  4HI9 A;  4A55 A;  3P2B A;  2AWI A;  4B8C B;  3LYA A;  3ZXS A;  1WAO 1;  3FWV A;  4HI8 A;  4GZD A;  5ANR A;  4NQ0 A;  1GW6 A;  1TNZ A;  4JL0 A;  1WDY A;  1N0Q A;  4TV3 A;  3KSL A;  4XIF A;  1DC2 A;  4GCO A;  4F3V A;  2WXG A;  3TWQ A;  1MX4 A;  2L0T B;  2YHC A;  3S7B A;  5EIB E;  2QYJ A;  3PZ3 A;  5A6C A;  4UQY A;  4TUU A;  3LS8 A;  3B7R L;  2UY1 B;  3TWT A;  1LF8 A;  4JW1 A;  3I3N A;  2EIM E;  4N39 A;  2H6G A;  2FI7 A;  1NL4 A;  3D9L A;  1N52 A;  4J0U A;  2WXQ A;  4GTO A;  5EKQ D;  4LER A;  3CHP A;  1PC2 A;  1JWF A;  2X6H A;  2WXR A;  4N3A A;  3D9I A;  4HQD A;  4WNE A;  4K5C A;  3CHS A;  2YHE A;  4YDY A;  2L9B A;  1BU9 A;  2AXZ A;  3D9K A;  1HX8 A;  4LRZ A;  3PZD A;  4HFG A;  4U63 A;  3AAA C;  4LNG A;  2NSZ A;  4JHK A;  5ENQ D;  3QWW A;  1A5E A;  3IEG A;  2DZN A;  3AG2 E;  3PE4 A;  3TG4 A;  2LSU A;  4LG6 A;  4HVB A;  4HRN A;  5JJ6 A;  3BEE A;  2DWZ A;  3AJI A;  3DPD A;  4PDX A;  4GMR A;  2WB2 A;  2IO3 C;  3FEY A;  4JA7 A;  4CDM A;  4B0Z A;  4A3V A;  3ASD A;  3MKQ A;  3LY9 A;  1INZ A;  2KZT A;  3Q7F A;  5FQ4 A;  1W3B A;  3B7B A;  4C48 B;  4RG9 A;  2MOW A;  4WND A;  4YDW A;  4I1A A;  3CEQ A;  3Q75 A;  4IYP A;  5LP0 A;  4I1O B;  2JAB A;  2B0O E;  5JHB A;  2JEK A;  5HS0 A;  2E0I A;  5HRY A;  2LXM A;  3FUM A;  4HB5 A;  2AVP A;  3UTM A;  3PEU B;  1FVF A;  1ZU2 A;  2NXP A;  1QZ2 A;  3GZS A;  3ZYK A;  4BX9 A;  2J4D A;  2ETA A;  3HDX A;  3NZU A;  4DJA A;  3FTU A;  3Q47 B;  3MGB A;  2AXV A;  3MA5 A;  4PS3 A;  5EX0 A;  3CR3 A;  1N0R A;  1UN8 A;  5T8I A;  2WXN A;  2CHX A;  4J7W A;  3T5V A;  2WQ7 A;  4FHK A;  3IKO B;  1EF1 C;  1BD8 A;  1U3D A;  3DXK G;  3CHM A;  3I5P A;  4E6H A;  2I6H A;  5LFA A;  1S63 A;  3G2W A;  3ZUV B;  4H7X A;  3L82 A;  3ISM C;  3MEK A;  4HOR A;  3FUF A;  4C9B B;  2KAT A;  4J6I A;  5LCW J;  2P9K G;  2J08 A;  2IU1 A;  3KS2 A;  4FUL A;  3ZKJ A;  2XGS A;  4DPR A;  2GRQ B;  1N9A A;  3HIZ A;  1KZP A;  3OTN A;  4MS6 A;  4EBA G;  1S0P A;  5G2N A;  5AYW D;  4L7T A;  2CHW A;  2I2O A;  3CHR A;  3OXG A;  3ONK A;  3LVQ E;  3ULY A;  4GTM A;  3V31 A;  5ARF A;  4F1S A;  2DVW A;  4ANV A;  4HOS A;  2IOL A;  4GU5 A;  3L6A A;  1Q2Z A;  3TWV A;  1JCQ A;  3U9W A;  3P1U A;  1BPO A;  2ION A;  4EEC A;  3UIN C;  3HHM A;  2QFC A;  1OT8 A;  5AAO A;  1SA4 A;  4JHR A;  3PZ2 A;  4I9E A;  1UG3 A;  2RD0 A;  4IRU A;  4F1P A;  3FTZ A;  2EIN E;  3EUV A;  4ATG A;  3ABL E;  4JZY A;  3ULE G;  4AY6 A;  4BTA A;  2XCC A;  5B1A E;  3UIP C;  1OWP A;  3KD7 A;  3UM1 A;  4O60 A;  5HI7 A;  3AU5 A;  1OCR E;  3X2Q E;  1V54 E;  2XEN A;  3SBS A;  3KSQ A;  3SD5 A;  2WQH A;  1FT1 A;  2B6C A;  3SNX A;  4AXH A;  2GRL A;  2P2C P;  5FIO A;  3OAW A;  1XGW A;  3ZGQ A;  5E75 A;  3UM3 A;  2VGE A;  4JA9 A;  4N2S A;  5BXU A;  1MQS A;  3D3M A;  4CT0 A;  3V2O A;  4ABN A;  3FEX A;  4AM9 A;  3QKY A;  4YDE A;  3BG0 B;  1Y6I A;  1HS6 A;  3Q7A A;  1DCE A;  3TGO A;  3FTY A;  4I2Z A;  4O1P A;  1KLX A;  1OCZ E;  3G2V A;  1IHB A;  3BU8 A;  4ME2 A;  3UT4 A;  3R9M A;  4EPZ A;  2L6B A;  5A7D B;  3EDT B;  3SF4 A;  3HVE B;  4N5Q A;  4L2Y A;  2L0I A;  3W9F A;  3KAE A;  2C2L A;  2EQX A;  2RFM A;  4AOF A;  3T5X A;  3E4B A;  3Q5M A;  2PL2 A;  4DX7 D;  2NYJ A;  2P9I G;  4CYM D;  1ELK A;  4A1S A;  3KEZ A;  3CQC B;  2IJG X;  4J8D A;  4ATZ D;  4MBG A;  1TR4 A;  4FU3 A;  4ILH B;  2WXM A;  3SFX A;  3C98 A;  3IBE A;  3FU0 A;  3V30 A;  3FP3 A;  2IOS A;  3EIJ A;  3TXM A;  3ZYM A;  4UWG A;  4DI3 A;  2PNN A;  1TNB A;  1K8K G;  2QC9 A;  4G8K A;  2KXP C;  4XI0 A;  3DXM G;  4GTR A;  3NQP A;  1NA3 A;  3RJV A;  2ETC A;  4BES A;  3SO8 A;  4NAC A;  2R2L A;  4EBA A;  1X5B A;  5BV1 A;  3ASG A;  4B94 A;  5AQB A;  4K03 A;  2XS8 A;  1N4S A;  3LY7 A;  3TWU A;  3UUX A;  4BER A;  4KYO B;  5DIZ A;  2L6J A;  1OWL A;  3NAW A;  2J07 A;  3Q9U C;  2WQ6 A;  4W9R A;  3MKQ B;  2OEW A;  1E8X A;  1TN8 A;  2IQC A; 
#chains in the Genus database with same CATH homology
 1N52 A;  4ILG A;  2YQ8 A;  2HM8 A;  1ELR A;  4J0U A;  2VGX A;  5ARG A;  2WXQ A;  4I6J A;  4NRH B;  3QNK A;  4I9C A;  3LY8 A;  2I9C A;  3CVQ A;  3AU4 A;  2LO6 A;  4LER A;  5EKQ D;  3VLE A;  4H7Y A;  3CHP A;  2PQR A;  1PC2 A;  4GZ5 A;  4AEZ C;  1IYG A;  1OWN A;  1JWF A;  2X6H A;  2WXR A;  2NC9 A;  3FY4 A;  4N3A A;  3D9I A;  4NUR A;  3UT7 A;  3FU3 A;  4B89 A;  1E7U A;  4WNE A;  4AJW A;  2VGY A;  4HOQ A;  3ZN3 A;  3CHS A;  4G11 A;  3VLF A;  2YHE A;  2OVB A;  1H2T C;  5M72 A;  4WWO A;  2XEV A;  3CKC A;  2P58 C;  4A3T A;  5KJN A;  2V0P A;  3R9A B;  4E85 A;  4RSY A;  2L9B A;  4FJY A;  2ILR A;  2AXZ A;  2DBA A;  3PRE A;  3RRU A;  3D9K A;  3MCX A;  1HX8 A;  1Z3Y A;  3QAR A;  2J09 A;  4WWP A;  4LRZ A;  3PZD A;  5FQ8 A;  4HFG A;  4U63 A;  1HG2 A;  3S7F A;  2AW6 A;  3G2S A;  5JJ7 A;  3PVL A;  2NSZ A;  2IFU A;  4AVX A;  4JHK A;  3D9P A;  3QWW A;  3IEG A;  1Y8M A;  3PE4 A;  4N3C A;  3TG4 A;  4N2Q A;  5A23 A;  4ANU A;  2LSU A;  1NA0 A;  2XPY A;  3D9O A;  5HQ8 A;  5AJD A;  3APD A;  3FUD A;  4XKC A;  3RU0 A;  1Z3X A;  2KCV A;  2OVF A;  4G2V A;  4I2W A;  4UI9 C;  1JPL A;  3QWV A;  3UT8 A;  3B7T A;  4HVB A;  4GZC A;  5JJ6 A;  3BEE A;  4UQZ A;  4D10 C;  1UJK A;  3DPD A;  4PDX A;  3JUI A;  3ZHE B;  4KVM A;  4GB9 A;  2UY1 A;  3CHO A;  1ZBP A;  2WB2 A;  2VSX E;  3FEY A;  3CK9 A;  4LEU A;  4JA7 A;  4CDM A;  3MX3 A;  3MJW A;  4A1G A;  3PRZ A;  3CSF A;  1N54 A;  2GGF A;  4UWL A;  4B0Z A;  2X6I A;  2A4Z A;  3D9M A;  3FUE A;  3ASD A;  3UX4 A;  4A3V A;  4GMJ A;  2AXU A;  3TG5 A;  2R59 A;  3FTX A;  4KBQ A;  3JQ0 A;  3MKQ A;  5D0O D;  2OV8 A;  1WY6 A;  1KT0 A;  3LY9 A;  1INZ A;  3RKV A;  2KZT A;  4GYY A;  3ML8 A;  3URZ A;  3I4G A;  2MHK A;  3AS5 A;  1H2V C;  1W3B A;  3LXU X;  5FQ4 A;  5FZQ A;  2M63 A;  1HO8 A;  2ZU6 B;  2XCB A;  4FP7 A;  5LCW C;  1Z6T A;  4RG9 A;  2MOW A;  4WND A;  1TEZ A;  4G1T A;  5CCL A;  1FVH A;  4I1A A;  4WUY A;  3CEQ A;  4IYP A;  5LP0 A;  4I1O B;  3G2T A;  4EZJ A;  3LEW A;  4DK5 A;  3U4T A;  5KCM A;  1ELW A;  3ESL A;  3CK7 A;  4GYO A;  2CHZ A;  5JHB A;  2JEK A;  3L08 A;  4PUC A;  1HF8 A;  5J90 A;  3B13 A;  3PUJ A;  1H6K A;  4GYW A;  2E0I A;  4JVS A;  4CGV A;  3QC1 A;  3FUM A;  3FH8 A;  5FJY A;  3QJZ A;  2AVP A;  3HVE A;  3U66 A;  3UPV A;  2VSN A;  3JCK C;  4BT8 A;  1QQE A;  3O4Z A;  3RO3 A;  3IHY A;  3CVV A;  3LKU A;  3CVL A;  3PEU B;  1PY1 A;  3N71 A;  2WMN A;  1FVF A;  3L54 A;  1ZU2 A;  4CDR A;  2NXP A;  4XKB A;  1UN9 A;  4ACK A;  1E96 B;  4R7L A;  3JQ1 A;  1QZ2 A;  3GZS A;  3ZYK A;  3FU6 A;  4BX9 A;  1H2U A;  4CCA A;  4KZC A;  2J4D A;  4CDN A;  3HDX A;  4JEH A;  3NZU A;  5FWQ A;  4AV7 A;  4FLH A;  4DJA A;  2VYI A;  4G25 A;  4XZ4 A;  1EYH A;  2XGM A;  1VDY A;  2PM7 A;  3ZHE A;  1E90 A;  3FTU A;  2A5U A;  3R7R A;  1PAQ A;  1E8Y A;  3Q47 B;  3UQ3 A;  3MGB A;  3MZL B;  4BY6 A;  2AXV A;  2IF4 A;  3MA5 A;  4PS3 A;  3CIA A;  2UWJ G;  3EHM A;  3CR3 A;  3JYS A;  5EX0 A;  2X38 A;  1UN8 A;  4UI9 J;  3SBT B;  5T8I A;  1IHG A;  2GRM A;  3CHQ A;  3QK0 A;  2WXN A;  2CHX A;  3T5V A;  4JEU A;  3PE3 A;  3RK6 A;  2WQ7 A;  3ZRH A;  5KJL A;  2I1J A;  4FHK A;  3VTY A;  1HH8 A;  2BTD A;  3IKO B;  4FJZ A;  1H19 A;  1EF1 C;  4WWN A;  4BSX A;  4GZ3 A;  1U3D A;  5FTP A;  3U3W A;  3CV0 A;  3CHM A;  3FH5 A;  4Q94 A;  4TRQ A;  5DBK A;  5G05 J;  4EZL A;  1EPU A;  3GZ1 A;  3I5P A;  2FUL A;  2Y4T A;  4E6H A;  2I6H A;  5LFA A;  2WXP A;  3G2W A;  5G55 A;  4EZK A;  4AIF A;  5LOZ A;  4BX8 A;  4N5C A;  3Q15 A;  2OOE A;  4H7X A;  2I1K A;  1IQR A;  2CFZ A;  4BT9 A;  4FAD A;  2MRI A;  3MEK A;  4HOR A;  3FUF A;  2R5S A;  1P5Q A;  5LX8 A;  4C9B B;  4U0U A;  2KAT A;  3EJN A;  4J6I A;  4M3O A;  4RG6 A;  4I6E A;  5LCW J;  2J08 A;  2IU1 A;  3KS2 A;  3CVX A;  2JLB A;  3FUI A;  3FTV A;  4FUL A;  4BFR A;  2VTB B;  3ESK A;  4FLB A;  5JHA A;  4DPR A;  2XGS A;  3NZS A;  3GW4 A;  2HR2 A;  3QB2 A;  2QY7 A;  3B7U X;  4KXK B;  4HOU A;  3T8M A;  3U64 A;  3FTW A;  2FBN A;  3HIZ A;  4WNF A;  3OTN A;  4MS6 A;  3SI5 A;  4EBA G;  4U0S A;  2PQN A;  4CGW A;  3MKR A;  1S0P A;  3TAX A;  3CVU A;  3CK8 A;  5G2N A;  5AYW D;  1UW4 B;  3ZFW A;  4L7T A;  1EDU A;  2CHW A;  3ASF A;  2I2O A;  3FFL A;  3CHR A;  3OXG A;  4LCT A;  5CMW A;  2J4B A;  4ILI A;  3FHE A;  4GA0 A;  4DLO A;  2LAH A;  3ONK A;  3LVQ E;  5G05 C;  4C0M A;  5C2Y A;  3CKB A;  1JWG A;  4WNG A;  1XNF A;  4RVB A;  2PZI A;  2WM9 A;  4Q69 A;  5ARF A;  4F1S A;  3APC A;  4KT6 B;  4XI9 A;  4ANV A;  1E8W A;  4HOS A;  3G2U A;  4JPS A;  3AS8 A;  2IOL A;  2XPI A;  4GU5 A;  5AIJ A;  1KT1 A;  1TJC A;  3L6A A;  4K0R A;  5C1D A;  3CQG B;  4YVQ C;  2WMO A;  1E8Z A;  4B8A A;  3IV0 A;  1TJF A;  2FO7 A;  2HO1 A;  3ZPJ A;  2VQ2 A;  4JC8 A;  3U9W A;  5BPP A;  3P1U A;  3FUK A;  1BPO A;  3SHF A;  2ION A;  3UMV A;  4EEC A;  5JJT A;  3LVR E;  1B89 A;  1HE8 A;  5CHE E;  4P29 A;  3HHM A;  4OVU A;  3APF A;  3QDN A;  2QFC A;  3FH7 A;  2VJ8 A;  4BWR A;  2V4L A;  3WXX A;  1YA0 A;  4JHR A;  4I9E A;  1UG3 A;  3CST A;  3S7J A;  3FUH A;  2RD0 A;  4HLE A;  4FC8 A;  4IRU A;  3SZ7 A;  3LCA A;  4ANX A;  3CVN A;  4APF A;  3FTZ A;  4PS8 A;  3FTS A;  2X3M A;  3FDH A;  4LUN U;  2FF4 A;  4XE0 A;  4GML A;  4ATG A;  4G26 A;  2R17 C;  4JZY A;  5FZS A;  2KCK A;  3L22 A;  4Q96 A;  4IN3 B;  4AY6 A;  4BTA A;  2XCC A;  4CRW A;  2XRY A;  3PUK A;  4CEM A;  2VTB A;  2WPV A;  1OWP A;  3KD7 A;  3MV3 B;  3D9J A;  3MV2 B;  4QFV A;  3O48 A;  5HI7 A;  3AU5 A;  3VTX A;  1DVP A;  3LPZ A;  4WAF A;  1QNF A;  1NP7 A;  2CFU A;  3SBS A;  3EIQ C;  3L17 A;  2WXH A;  3SD5 A;  4PH4 B;  5D0Q D;  2WQH A;  5FQ7 A;  3IHV A;  3TJP A;  4Y6W A;  3SNX A;  5T4Y A;  4AXH A;  5EDS A;  2GRL A;  2WXK A;  2XGO A;  4I43 A;  4JXT A;  3ZYL A;  4CT4 A;  3ZVV A;  1HU3 A;  1IQU A;  3OAW A;  5ENN A;  1U3C A;  3TL5 A;  1OWO A;  1XGW A;  5FZR A;  4AP2 A;  3ZGQ A;  3ZW3 A;  5E75 A;  2WXL A;  3S2A A;  4UI9 K;  5CCM A;  4U07 A;  2Q7F A;  3HYM B;  3RO2 A;  4JA9 A;  2WXJ A;  2HYZ A;  3ZYQ A;  4G24 A;  4N2S A;  5G04 C;  3FUN A;  4EQF A;  3CVW A;  1MQS A;  3D3M A;  5CMY A;  3ULQ A;  4ABN A;  4CT0 A;  2KZT B;  3FEX A;  4KVO A;  4AM9 A;  3QKY A;  4FHJ A;  4UWK A;  3BG0 B;  4U04 A;  3K9I A;  2X6J A;  1Y6I A;  5ANL A;  4AY5 A;  2KM4 A;  4KZ0 A;  1DNP A;  1HS6 A;  4MLP A;  2KCL A;  3L16 A;  3ONL A;  1OUV A;  3TGO A;  3BG1 B;  4U0Z A;  3RRM B;  3FTY A;  4GA1 A;  4GPK A;  4I2Z A;  1JUQ A;  1KLX A;  3CVY A;  2CG2 A;  3G2V A;  4HXI A;  4JHJ A;  4F7A A;  4ME2 A;  3Q4A B;  3FUL A;  4U8H A;  2VSY A;  3UT4 A;  4ANW A;  4EPZ A;  3OXL A;  5A7D B;  2DCP A;  4GCN A;  2FEZ A;  3VLD A;  2WVI A;  1H0A A;  3EDT B;  3I4R B;  5AJL A;  3SF4 A;  1OWM A;  5AEN A;  4N3B A;  3HVE B;  4L2Y A;  1SZA A;  2L0I A;  2VSO E;  3FU5 A;  4YVO A;  3OXF A;  2WXF A;  1HFA A;  2C2L A;  3KAE A;  2XRZ A;  2EQX A;  2C0M A;  4MKT A;  3ZEF A;  1HZ4 A;  4AOF A;  3T5X A;  3E4B A;  1A17 A;  3NF1 A;  2PL2 A;  3Q5M A;  1HXI A;  4DLQ A;  2YIN A;  1NZN A;  2E2E A;  4OYS A;  3AS4 A;  4I17 A;  2LAI A;  4FA6 A;  2V8S E;  4I1M A;  4J8E A;  4DI4 A;  1HG5 A;  1ELK A;  2OND A;  2XHE A;  3PH0 C;  4J8F A;  4A1S A;  2Y3A A;  3MYV A;  1UJJ A;  3KEZ A;  3CQC B;  2IJG X;  2RG8 A;  4J8D A;  2V5F A;  5KJK A;  4FU3 A;  2XPZ A;  4ILH B;  3PDN A;  4PS7 A;  2CG3 A;  1MHQ A;  3EHN A;  5T3R A;  3GYZ A;  2VGX B;  2WXM A;  5E76 A;  4L2L A;  3C98 A;  3QOU A;  3IBE A;  3FU0 A;  1E7V A;  5FQ6 A;  3ZIM A;  1L5J A;  4KMO A;  3FP3 A;  2LNI A;  2PM6 A;  4UQX A;  4ACL A;  4BTB A;  1FCH A;  2IOS A;  2X6F A;  3EIJ A;  2XQ0 A;  3B7S A;  5FT9 A;  5BW8 C;  3S7D A;  3PEV B;  3TXM A;  2J9Q A;  3ZYM A;  2YNQ A;  2BUG A;  2WXO A;  3PNL B;  4G23 A;  3DBS A;  2J49 A;  4UWG A;  3QWP A;  3CVP A;  4UWH A;  4DI3 A;  4A55 A;  3P2B A;  3ASH A;  2AWI A;  4C0E A;  3SFZ A;  4B8C B;  3LYA A;  3ENE A;  3LDZ A;  2KC7 A;  3L13 A;  4XI0 A;  3ZXS A;  4URK A;  2WXI A;  1WAO 1;  3FWV A;  1SZ9 A;  4GZD A;  3NQP A;  5ANR A;  4L1B A;  4F53 A;  4NQ0 A;  2BF0 X;  1NA3 A;  1GW6 A;  3RJV A;  2LSV A;  5G04 J;  4JL0 A;  3RIB A;  2GW1 A;  5BUZ A;  3D9N A;  3PS6 A;  4TV3 A;  3LJ3 A;  3GZ2 A;  4GAA A;  2Y4U A;  4UWF A;  4XIF A;  4Y6C A;  4MRU A;  4GZ6 A;  4OVV A;  3R7Q A;  4GCO A;  4F3V A;  4V3I A;  2WXG A;  5BV0 A;  4NAC A;  5EX3 A;  4EBA A;  4HOT A;  3Q49 B;  1X5B A;  5BV1 A;  3ASG A;  2L0T B;  2YHC A;  3S7B A;  4IUL A;  5KJM A;  3PNT B;  4B94 A;  4K03 A;  5BNW A;  4APO A;  3LY7 A;  5A6C A;  4UQY A;  3UUX A;  4L23 A;  2DIW A;  4KYO B;  4TUU A;  5DIZ A;  2L6J A;  3LS8 A;  3B7R L;  1OWL A;  4GA2 A;  2UY1 B;  3FUJ A;  5BT1 A;  3TXN A;  3ML9 A;  4HS2 A;  2C0L A;  1LF8 A;  3SGH A;  4I6G A;  4JW1 A;  2J07 A;  3I3N A;  4O6F A;  3CLJ A;  3RRN B;  3CGH A;  4YND A;  2X6K A;  1WM5 A;  1SQM A;  3QAQ A;  4N39 A;  4W9R A;  3MKQ B;  4XX5 A;  5J08 A;  2WQ6 A;  1E8X A;  4J8S A;  2IQC A;  2FI7 A;  3D9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...