2YHCA

Structure of bamd from e. coli
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
223
structure length
209
Chain Sequence
PPNEIYATAQQKLQDGNWRQAITQLEALDNRYPFGPYSQQVQLDLIYAYYKNADLPLAQAAIDRFIRLNPTHPNIDYVMYMRGLTNMALDDDPQQARAAFSDFSKLVRGYPNSQYTTDATKRLVFLKDRLAKYEYSVAEYYTERGAWVAVVNRVEGMLRDYPDTQATRDALPLMENAYRQMQMNAQAEKVAKIIAANSSNTLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0169 LIPOPROTEIN YFIO
publication title Structural Basis of Outer Membrane Protein Biogenesis in Bacteria.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 83
structure length 209
sequence length 223
ec nomenclature
pdb deposition date 2011-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2yhcA00
4YVQC 2PL2A 3CKCA 2PQRA 3OXGA 5CCLA 4G1TA 2VSNA 4J0UA 4NQ0A 4GYYA 3Q4AB 4GYWA 4WNGA 4BT9A 4JL0A 1Y8MA 4GCNA 3O48A 2IF4A 5D0QD 4J8DA 1WM5A 3PDNA 4N5CA 4CDRA 3QWPA 3ULQA 2C2LA 4GZ6A 5FTPA 3VTXA 5JJTA 5LCWJ 4Y6CA 2JLBA 2FI7A 1KLXA 4KBQA 2LNIA 1HH8A 2V5FA 1HZ4A 4GPKA 4IN3B 2MHKA 3MV3B 5G05C 3R9AB 5FT9A 5FZQA 3ZN3A 3FWVA 3LKUA 3QDNA 2FBNA 4RG9A 1A17A 4CGWA 3GZ2A 3SF4A 3U3WA 3URZA 3OXFA 3RJVA 2UWJG 4KYOB 4XI0A 3S7JA 3S7FA 1HXIA 3SZ7A 4WNDA 3MEKA 5EKQD 1TJCA 3AS4A 4A1SA 3UPVA 1KT0A 4UQXA 4F3VA 3Q47B 4AIFA 2AVPA 2Y4TA 3QWWA 2KCVA 5ARGA 2NC9A 4YVOA 2L6JA 3CVNA 2QFCA 4Y6WA 4BTBA 2C0LA 2OOEA 1QQEA 4ME2A 4G24A 3S7DA 3S7BA 4GYOA 3KAEA 4N3BA 3MA5A 2VGYA 5HQ8A 3EDTB 4BT8A 3N71A 3HYMB 5BT1A 3U4TA 4HOTA 3GW4A 2YQ8A 1E96B 3ZGQA 4XIFA 3AS5A 3TG5A 4JHRA 4UI9K 3KD7A 5JJ6A 1ZU2A 3UQ3A 4RG6A 1IYGA 2I6HA 5HI7A 4WNEA 4GA2A 3ZFWA 2LSVA 2HR2A 3CEQA 4HORA 4GA1A 3LY7A 4NRHB 3CV0A 3ASDA 3Q5MA 1FCHA 2VGXB 4UI9J 2E2EA 5G05J 3K9IA 3CK8A 5G04C 5EX0A 4BTAA 3KS2A 4APOA 4WUYA 3MKRA 1ELRA 2UY1B 3RO2A 3ZPJA 2VYIA 3TG4A 5AYWD 4J8EA 3AS8A 5DIZA 3ZHEB 2VGXA 2WQHA 2HYZA 3CK9A 2BUGA 2ONDA 4U0ZA 4BWRA 2XCCA 2J9QA 4UQYA 3LPZA 4U0SA 3TAXA 3RKVA 2YHCA 2UY1A 3Q49B 4I9EA 3NF1A 3PE4A 4EQFA 1OUVA 3ZHEA 4AY5A 3ASHA 4W9RA 4CGVA 2FF4A 4LEUA 4O6FA 4I17A 2LSUA 3Q15A 1P5QA 1NA0A 3BEEA 3QKYA 4I2ZA 5A6CA 5DBKA 1ZBPA 2VQ2A 3CVLA 5FZSA 5FZRA 5KJMA 2DBAA 4HOUA 3GYZA 1NA3A 2KC7A 2FEZA 4GCOA 4HOQA 1IHGA 4G26A 4N2QA 4AM9A 3GZ1A 4G23A 2R5SA 1XNFA 5FJYA 4AY6A 3CVPA 2XEVA 2XGSA 4JA7A 4HOSA 3IEGA 5G04J 4XI9A 2C0MA 3UUXA 3ASGA 2P58C 3E4BA 4N39A 4N2SA 4WNFA 4JA9A 3RU0A 4U07A 1KT1A 5EX3A 5BNWA 5CHEE 3CKBA 2GW1A 3CVQA 5A7DB 2KATA 3QWVA 4H7XA 2HO1A 2XCBA 3MV2B 5C1DA 2PQNA 2IFUA 2Y4UA 3LY8A 3LYAA 3QOUA 3RIBA 2XGOA 4U0UA 1ELWA 3JYSA 2KCLA 5D0OD 2XPIA 2Q7FA 4U04A 5LCWC 2PZIA 4UI9C 4ABNA 5JJ7A 5M72A 5KJKA 3ESKA 5KJNA 2KCKA 4J8FA 3TGOA 4I9CA 1B89A 4H7YA 3LCAA 2FO7A 4B94A 4I2WA 4GZ3A 4G25A 2XGMA 5BW8C 4GA0A 1W3BA 3VTYA 3FFLA 4KXKB 3LY9A 5ARFA 2WPVA 5KJLA 1WAO1 1NZNA 1YA0A 3ASFA 3CK7A 3FP3A 4I1AA 3WXXA 4GZ5A 3PE3A 5CCMA 4N3CA 4UQZA 3RO3A 4G2VA 2VSYA 3OXLA 4N3AA 4YNDA 1QZ2A 1PC2A
chains in the Genus database with same CATH superfamily
3CKCA 3QJZA 3D9KA 2WXMA 5CCLA 1G3NB 3P1UA 2R03A 4XKBA 2WXNA 2ETCA 1Y6IA 4FC8A 4GYWA 3CHOA 4CZ2D 2AJAA 3OTNA 3O48A 4X8QA 1IQUA 2AXVA 4GPMA 4J8DA 4B0ZA 3U66A 3SFZA 3ESLA 2WXGA 2XEEA 3FTWA 4Y6CA 3D9MA 2Y1LE 4KBQA 3PEVB 3SI5A 2ETBA 1HH8A 3L54A 5EIDA 2NXPA 4GPKA 4B93B 1D8EA 1OWOA 4JZYA 2X3MA 4ANVA 4EBAG 3ZN3A 1KZOA 3PZ3A 4QFVA 3QDNA 4RG9A 1A17A 2Y3AA 2J4BA 2QYJA 3GZ2A 4C0EA 3U3WA 3URZA 3UT8A 3S7FA 1HXIA 4AEZC 3MEKA 3D9JA 1N9AA 4D10C 3D9NA 5AQAA 4A1SA 3UPVA 4F3VA 3C98A 4GTMA 4GAAA 2DZOA 4KMOA 4NACA 4K5CA 4F1PA 4YVOA 4ANWA 2E0IA 3CVNA 2QFCA 2KXPC 1FVHA 4EPZA 5AIJA 1EDUA 5HRYA 3ZKJA 4N3BA 2X6FA 5CRUA 3UTMA 3KEZA 1Z5SC 3HVEA 2WXRA 2ZISA 3PZDA 3W9FA 3SO8A 3N71A 3AG1E 3JXIA 4FULA 1TNOA 4FP7A 3FTSA 3PVLA 4DUIA 4I6GA 4L7TA 3TG5A 1AWCB 3FUNA 4UI9K 3UQ3A 4J7WA 4GA2A 2LSVA 3B7RL 4TUUA 3MKQA 4MRUA 3CEQA 4GA1A 3CVUA 3I4RB 4U8HA 4NRHB 5FQ7A 4UI9J 4L1BA 5E75A 3Q78A 2EIKE 4BTAA 3ZW3A 2IU1A 4PS3A 1UN8A 4LG6A 1O1TA 4AV7A 2OCCE 2ETAA 5AARA 2WXLA 4JEUA 5HS0A 3AS8A 4LRZA 3TWUA 3UM2A 2HM8A 3EHQA 2ONDA 4U0ZA 1N0RA 4UQYA 3FDHA 4IULA 4CT4A 2R2LA 4TRQA 1D9SA 3UIPC 1X5BA 2YHCA 4HRNA 2BKGA 2LXLA 1S63A 3ZEFA 3NF1A 3ZXPA 3EU5A 3ULYA 1A5EA 4CDNA 4BESA 5CEDB 4CGVA 4LNBA 4LEUA 1MX6A 4O6FA 1BI8B 5JHBA 2BF0X 3Q15A 3PRZA 1Z3YA 1P5QA 3DSTA 1NA0A 4A55A 3ZVVA 1UW4B 4A63B 1ZBPA 2GGFA 3SHFA 4HQDA 3ZXSA 1MX2A 3C3OA 1NA3A 3V2XA 2VTBB 4WAFA 4Q94A 4JD2G 4BFRA 4N2QA 3AU5A 2R5SA 4I1OB 3Q73A 2GRMA 2XEVA 1LD7A 3FUDA 4U95D 2XPZA 2H6GA 4HNAD 3NQPA 1OCZE 4JW1A 3Q9NC 4CCAA 4N39A 4HLEA 4N2SA 2VGEA 4WNFA 1NP7A 2YINA 5EX3A 3ZYLA 5BNWA 2L6BA 3JCKC 3PUKA 3NZUA 2ZGGA 1E8XA 3IXEA 5A7DB 3CHQA 4JEHA 5FQ6A 2WXQA 3B7SA 3MV2B 3SD5A 4BEPA 2IFUA 4CT0A 1OWLA 3LY8A 4B89A 3RIBA 2XGOA 3W9GA 1ELWA 3FULA 3JYSA 5H7PA 4U04A 2GRPB 4AVXA 4WWPA 4I9CA 1B89A 1H2UA 4Q96A 5BUZA 4H7YA 1V55E 4B94A 4BY6A 3JUEA 4G25A 2XGMA 2P9KG 5BW8C 4GA0A 2V4LA 4CRWA 3LY9A 5EYPF 1WAO1 1NZNA 3CK7A 3FP3A 1SQMA 4I1AA 3NOGD 4K5BA 4J8SA 3WXXA 4TUMA 4F6RD 4GZ5A 3I3NA 5T3RA 4DI4A 3PE3A 4N3CA 1OCCE 1IQRA 3TWQA 2OV8A 1OT8A 1QZ2A 3D9IA 3ML9A 4YVQC 1OWNA 2DYRE 2PQRA 4YDOA 4FADA 1TNYA 1YCSB 3DBSA 4G1TA 5LOZA 2VSNA 3UM3A 3FTUA 5ENQD 4WNGA 4BT9A 4DLOA 3ABKE 4GCNA 4E6HA 3HXCA 2PM7A 3G2SA 4ATZD 4GB9A 4JVSA 2IF4A 5D0QD 4DLQA 4N5CA 5CECB 4DX2A 4CDRA 3ULQA 2C2LA 1S0PA 3ENEA 4GZ6A 5CBNA 5EILA 3FU6A 2I1KA 3HIZA 4GTQA 3L22A 1UN9A 5ENRD 4IN3B 3UKUG 1O5MA 4NURA 2MHKA 4IRUA 5CMWA 3D9PA 1E8WA 4ILGA 3LKUA 3RRUA 1ZB1A 5KCMA 4UWLA 2FBNA 1IXVA 4I1MA 3SF4A 1N95A 3S7JA 4PS7A 4WNDA 2BEDA 2VSXE 3UINC 5AQ7A 4G11A 3AS4A 5KBAA 3FUFA 3Q47B 1HO8A 4GZDA 2AVPA 3L6AA 5AN8A 3QWWA 3V79K 2WXHA 2NYJA 4RSYA 1MX4A 4Y6WA 5FINA 3R9MA 4FHJA 3CGHA 4F53A 4DPRA 2H6IA 2HE0A 3L17A 5ENNA 3UT7A 4EZJA 3EDTB 5ANRA 3HYMB 3JXJA 5BT1A 1H6KA 4Z68A 3GW4A 1JCSA 4M7CA 4XX5A 4DRXE 3I5PA 3FUEA 3FTZA 2V8SE 3B7TA 2KBXA 1IYGA 5LP0A 5HI7A 4HFGA 2LAHA 5LX8A 1N54A 5JMND 3ZU7B 1MJ0A 2IONA 3FUKA 2HR2A 4HORA 4KZCA 1TN7A 4DJAA 2VSOE 4BSZB 1BPOA 4RLYA 4O1PA 3CV0A 3ASDA 3IV0A 3Q5MA 2VGXB 2E2EA 5G05J 4DX7D 3K9IA 3CK8A 1IHBA 3C5RA 1N11A 3KS2A 1BLXB 4LNUD 2V0PA 3X2QE 4N5QA 3MKRA 2WQ6A 2UY1B 1YMPA 3KSQA 3APDA 2XRYA 1FT1A 4R7LA 4TXRA 3NB2A 5E76A 3WG7E 1N0QA 2OVBA 4BWRA 5FQ8A 3LJNA 3Q7FA 3Q49B 3TJPA 2GROB 3APFA 4EQFA 1OUVA 3ZHEA 4AY5A 5BV0A 5A23A 4PUCA 1EPUA 4FJZA 4EBAA 3E32A 2QZAA 4YDEA 3ABME 3IHVA 5ENPD 2QY7A 3G2VA 2QC9A 4I2ZA 5A6CA 4MBGA 4M3OA 4JHKA 2AXZA 2VQ2A 5FZSA 1SW6A 2F0YA 2DBAA 4HOUA 3D9LA 3FU3A 3TXNA 1SA5A 2KC7A 4TXPA 1AP7A 4ACKA 4HOQA 5FQ4A 3G2TA 1DNPA 4G23A 1XNFA 5FJYA 1UJJA 4JHJA 4YDYA 1N4PA 3ONKA 1OY3D 4AJWA 4HOSA 3E33A 1N94A 1QYMA 1HG2A 5EDSA 2P58C 4GTPA 1TN8A 4XZ4A 4JA9A 3RU0A 2M63A 3ONLA 5CHEE 3PNTB 4U63A 3QWVA 3L08A 4H7XA 2HO1A 3F6QA 3DPDA 2PQNA 3HXFA 3LYAA 5G55A 1HFAA 3AU4A 3RRNB 3ZRHA 4HXIA 5M72A 4GTTA 3UT4A 3FU0A 2B6CA 1TN6A 3PREA 2WMNA 1K1BA 3FY4A 1U2VG 3AG4E 1U3CA 3AG3E 2FO7A 2MYOA 4I2WA 5AQ9A 5AJDA 3ULEG 3BQOA 2P9LG 3B95A 1W3BA 3FFLA 2R17C 5KJLA 1YA0A 2OEVA 5KNGA 1JWGA 3DSWA 3ASFA 4MKTA 2KZTA 3D3MA 4EECA 2XRZA 3HDXA 3AAAC 3FTVA 1OWPA 5CCMA 2I2OA 3EHNA 3SY2A 4RQIA 2X6KA 1INZA 1MHQA 3CLJA 2VSYA 2FO1E 4EHMA 4N3AA 4YNDA 1H6PA 1TR4A 2CG3A 1V54E 3L82A 3MGBA 5IY5E 4OVVA 1Z6TA 3TL5A 3OXGA 4BERA 5JA4D 3LJ3A 2CG2A 3Q4AB 2WXFA 3PZ1A 3OAWA 4JL0A 4AXHA 3EHRA 3BU8A 3CHRA 2XENA 4A1GA 5AQBA 3FH5A 3Q79A 3PDNA 3MJWA 3QWPA 3R7RA 3ABLE 2YNQA 4LUNU 1RZ4A 5D2MC 3ZUVB 4GU5A 5FTPA 1H2VC 2CFUA 5BXOA 4HVBA 3EIQC 2H6HA 3RK6A 2FI7A 2BTDA 1HZ4A 2J08A 2P9IG 2GRLA 3E30A 4GTOA 4HBDA 1NFIE 4IYPA 3CVXA 3MV3B 5G05C 5FZQA 5B1AE 3NZSA 3FWVA 1TNBA 3FU5A 3RRMB 1XGWA 3OXFA 3RJVA 4XI0A 3PNLB 4KVMA 4K03A 3UIOC 3T9KA 3ZNGA 3D9HA 5EKQD 1TJCA 1GW6A 3QAQA 2F37A 4AOFA 1ELKA 1KT0A 1BI7B 4UQXA 4EZLA 1JCRA 3EU9A 3HVEB 2ZXWE 2Y4TA 3SNXA 2NC9A 2V5QC 2L0TB 5BV1A 2CHWA 2F8YA 4BTBA 2C0LA 2OOEA 1QQEA 4ME2A 4G24A 3S7DA 1O1RA 3JUIA 4FLBA 2J49A 4FA6A 4KVOA 5HQ8A 3FH8A 2EILE 4BT8A 3QNKA 3UM1A 3U4TA 4HOTA 4WWOA 3MKQB 2IY0C 4J8YA 4GTRA 1E96B 1X81A 3ZGQA 4HRLA 1S70B 1HF8A 4PS8A 2CFZA 1LTXA 5HKPA 1H2TC 4ATGA 2R02A 4K0RA 1JUQA 4WNEA 2DYSE 2WMOA 3ZFWA 1DCEA 3FUIA 3HXEA 2LO6A 2ZIRA 3DSVA 4WWNA 1FPPA 1DVPA 2J09A 1IKND 5JHAA 2ILRA 4YDWA 2RFAA 1TJFA 2ZGDA 1E90A 4LSZE 3CSTA 2DVWA 3TWTA 4GMRA 3V31A 2DZNA 4C48B 2VJ8A 1ELRA 1H6OA 3P2BA 3ZPJA 1Q2ZA 3CVYA 2VYIA 5EN5D 5AYWD 3DXMG 1UOHA 5J08A 2HYZA 5FWQA 3EHMA 2XCCA 3LPZA 4U0SA 3T8KA 3CVWA 3LS8A 3PH0C 1JWFA 4JC8A 3TWSA 1OWMA 3IKOB 3ASOE 2NSZA 3UM0A 4W9RA 4TXQA 3SQVA 3CVVA 4U96D 2FF4A 2LUHA 2IOSA 3AG2E 4B8CB 3T5VA 4L23A 2L9BA 3TWWA 3ZYKA 2V4HC 5BXUA 4LERA 5CERB 3BEEA 2I9CA 1HG5A 3PUJA 5DBKA 2XEHA 2P9SG 5ENSD 5FZRA 5CBOA 4CDMA 3GYZA 4HS2A 3QB2A 3SFXA 4P29A 4GCOA 5AJLA 2X6IA 4AP2A 3TXMA 3PZ4A 3VLEA 2GRNB 2A5UA 2PNNA 4AY6A 1WY6A 3LDZA 4OVUA 3EIJA 2XGSA 4JA7A 5T4YA 5G04J 2C0MA 1QNFA 2GRQB 3V30A 4EZKA 4ILHB 3DRAA 3T8MA 1Z3XA 3ASGA 3QARA 2VTBA 3E4BA 2CHXA 3ZYQA 5C2YA 4GMLA 4GTSA 4U07A 3IHYA 5T8IA 1KT1A 4Q69A 2XZDG 1DC2A 2JEKA 2GW1A 3DEPA 4I6JA 4L2YA 4XE0A 2I1JA 2AWIA 3UMVA 4ZHBA 2XCBA 5C1DA 1N4RA 2Y4UA 3QOUA 4GTVA 4GMJA 5B3SE 3LVRE 3CR3A 3ZIMA 2IO2C 2PM6A 5D0OD 3ASNE 5D66A 5JJ7A 3DSXA 5KNHD 5KJKA 1L5JA 3ESKA 5KJNA 2IJGX 4J8FA 3TWXA 3LCAA 2MRIA 4DX1A 4GZ3A 5CMYA 1JCQA 2L0IA 4NIKA 3IBEA 3DSSA 1OXJA 1RW2A 4O60A 4KXKB 3VTYA 1MZCA 1HU3A 2WPVA 3DEOA 3BG0B 2JABA 1OCRE 4FHKA 2R05A 5AAOA 4L2LA 2XS1A 1K8KG 2J8SD 3V2OA 1EF1C 4KZ0A 4UQZA 5KWDA 2RKKA 3DXKG 1S64A 2EINE 3RO3A 4G2VA 5ENTD 2CHZA 3UKRG 3OXLA 1PC2A 1QBQA 2AXUA 4I43A 2PL2A 2RG8A 2P2CP 3SBTB 1PAQA 4BSXA 4J0UA 4NQ0A 3D9OA 3GZSA 3Q7AA 4GYYA 5EYLA 4PH4B 1Y8MA 3L9TA 2FULA 4DX5D 3HXBA 4B8AA 3CHPA 3Q9UC 2RFMA 1TYQG 3QK0A 4F7AA 1WM5A 3UX4A 3SGHA 2WXOA 4TV3A 1H0AA 4UWFA 3VTXA 5JJTA 3C3QA 5LCWJ 1JPLA 1OCOE 2P9UG 4C9BB 4JB8P 2JLBA 1KLXA 1E7VA 2LNIA 2V5FA 3NOCD 2Y0BG 2X6JA 4UWKA 3R9AB 5FT9A 1U3DA 2IOLA 3PZ2A 1H19A 2EIJE 1DCQA 3E37A 3FHEA 3VLDA 2LXMA 3CIAA 1BU9A 4CGWA 2WXIA 1MQSA 3CHMA 4JPSA 1SZAA 2UWJG 4KYOB 2XQ0A 3SZ7A 3ML8A 3HRAA 1VDYA 2GRRB 3RSEG 1BD8A 4OYSA 4BX8A 4AIFA 2LAIA 2OVFA 4K5AB 4ILIA 2KCVA 5ARGA 4C0MA 3NBNB 3T5XA 4FU3A 3BG1B 2EQXA 3J5QB 3UI2A 2L6JA 4XEIG 4ACLA 1N4QA 1O1SA 1YYHA 3KEAA 1LF8A 3S7BA 4GYOA 5J90A 1UJKA 4BX9A 3KAEA 3MA5A 2X38A 3O4ZA 4OAUC 2VGYA 3TWRA 2DWZA 4I6EA 2XHEA 4A3VA 3CQCB 2MOWA 2YQ8A 3LXUX 4JXTA 4MS6A 4XIFA 3AS5A 4MLPA 5G2NA 4U7EB 4JHRA 4V3IA 2WB2A 3DWLG 3QC1A 1HS6A 3DSUA 3KD7A 4G8LA 5JJ6A 1ZU2A 3MCXA 3MX3A 2B0OE 1UG3A 4RG6A 4U8YD 4DK5A 2I6HA 1SZ9A 4A3TA 5FIOA 3U9WA 4DI3A 2XS8A 3LY7A 3BUAA 1MYOA 3L16A 4HRMB 1FCHA 4ANXA 3CHSA 4RVBA 5G04C 5EX0A 3FUMA 3CSFA 4KT6B 1HE8A 4LCTA 4APOA 3HHMA 4WUYA 5ENOD 2WXKA 3EJNA 3RO2A 4GZCA 3I4GA 3FEXA 2P9PG 3FUJA 1TNZA 2J07A 4PDXA 3TG4A 3LEWA 4J8EA 2X6HA 3CQGB 5BPPA 5DIZA 3ZHEB 2VGXA 4BETA 2WQHA 3CK9A 2BUGA 3B13A 2Y69E 2J9QA 1K1AA 4UWGA 1N4SA 3TAXA 3RKVA 4G8KA 2UY1A 1HX8A 3UXGA 5EIBE 4I9EA 3MYVA 3PS6A 3FTXA 1SA4A 3PE4A 3G2WA 1N52A 2WXPA 3ASHA 4J6IA 4I17A 2LSUA 2XPYA 2P9NG 1TEZA 4XKCA 3JQ1A 4E85A 1E8YA 3VLFA 3QKYA 2DIWA 4ANUA 3TWVA 4ZFHA 5LFAA 2WM9A 1NI1A 4HLLA 3AJIA 2OEWA 3CVLA 3B7UX 3KSLA 5KJMA 3J5PA 3NAWA 4URKA 2FEZA 4F1SA 4CYMD 1D8DA 1WG0A 3DPYA 3R7QA 4HI9A 2KM4A 1IHGA 4G26A 4AM9A 2WXJA 2A5EA 3GZ1A 3CVPA 3FH7A 2BKKB 3SFYA 2IQCA 3IEGA 5AENA 1FT2A 4XI9A 2WQ7A 3UUXA 3S2AA 3HG0D 1KZPA 5B1BE 5ITZF 4FJYA 2EIME 3APCA 1K3ZD 2J4DA 3CKBA 3HXDA 1FVFA 3C3RA 2IO3C 3MZLB 3CVQA 4LNGA 2QYUA 2KATA 1LD8A 2ZU6B 1NL4A 4CEMA 4U0UA 4U8VD 4HI8A 3ISMC 1KPSB 2KCLA 3L13A 2XPIA 1SVXA 2Q7FA 5LCWC 3ZYMA 4DX6D 2PZIA 4UI9C 2XZTG 4ABNA 4L9PA 5CRVA 2IEJA 4QQIA 2R59A 2KZTB 2KCKA 3TGOA 2DCPA 3FUHA 1E7UA 2WVIA 4APFA 4O1OA 3U64A 3SBSA 3Q75A 3E34A 3RAUA 4UUCA 3PEUB 3LVQE 5ARFA 1TNUA 4UWHA 2RD0A 3EUVA 2F8XK 4HB5A 2H6FA 3B7BA 1WDYA 5CEAA 1EYHA 3G2UA 3FTYA 3JQ0A 5ANLA 2AW6A 2YHEA 4OAVB 1PY1A 2A4ZA 3C72A 3FEYA 1E8ZA 4FLHA
chains in the Genus database with same CATH topology
3MGBA 4I43A 4YVQC 4OVVA 1OWNA 2PL2A 2RG8A 3CKCA 1Z6TA 3SBTB 1PAQA 2PQRA 3QJZA 3OXGA 3TL5A 4BSXA 4FADA 3D9KA 2WXMA 3DBSA 4G1TA 5CCLA 5LOZA 2VSNA 4J0UA 3LJ3A 3P1UA 2CG2A 4NQ0A 4XKBA 3D9OA 3GZSA 3ML9A 2WXNA 4GYYA 3FTUA 3Q4AB 1Y6IA 4FC8A 4PH4B 2WXFA 3CHOA 4GYWA 4WNGA 4BT9A 4DLOA 3OAWA 4JL0A 1Y8MA 4GCNA 4E6HA 2PM7A 3G2SA 4AXHA 2FULA 3OTNA 3O48A 4GB9A 4JVSA 2IF4A 4B8AA 5D0QD 1IQUA 2AXVA 3CHRA 3CHPA 4A1GA 4DLQA 3FH5A 3QK0A 4F7AA 4J8DA 4B0ZA 1WM5A 3PDNA 4N5CA 3MJWA 3U66A 3SFZA 3UX4A 3ESLA 4CDRA 3QWPA 3R7RA 3ULQA 3SGHA 2C2LA 1S0PA 2YNQA 3ENEA 4GZ6A 2WXOA 4LUNU 4TV3A 1H0AA 3FU6A 2I1KA 4UWFA 4GU5A 5FTPA 3VTXA 1H2VC 2WXGA 5JJTA 2CFUA 5LCWJ 1JPLA 3HIZA 3FTWA 4Y6CA 4HVBA 3EIQC 4C9BB 3RK6A 2JLBA 2FI7A 3D9MA 1KLXA 4KBQA 3PEVB 1E7VA 2LNIA 3SI5A 3L22A 1HH8A 2BTDA 2V5FA 1UN9A 1HZ4A 2J08A 3L54A 2NXPA 4GPKA 2GRLA 4IN3B 1OWOA 2X6JA 4UWKA 4JZYA 4NURA 4IYPA 2X3MA 4ANVA 3CVXA 2MHKA 3MV3B 5G05C 4IRUA 3R9AB 5FT9A 5FZQA 1U3DA 2IOLA 1H19A 4EBAG 5CMWA 3ZN3A 3D9PA 3NZSA 1E8WA 3FWVA 3LKUA 4ILGA 3RRUA 3FU5A 4QFVA 3FHEA 3VLDA 5KCMA 4UWLA 3RRMB 3QDNA 2FBNA 1XGWA 3CIAA 4RG9A 4I1MA 1A17A 2Y3AA 2J4BA 4CGWA 2WXIA 1MQSA 3CHMA 3GZ2A 4JPSA 4C0EA 3SF4A 1SZAA 3U3WA 3URZA 3OXFA 3RJVA 2UWJG 4KYOB 4XI0A 3UT8A 3PNLB 3S7JA 3S7FA 1HXIA 4KVMA 4PS7A 2XQ0A 4WNDA 3SZ7A 4K03A 4AEZC 3MEKA 3ML8A 2VSXE 5EKQD 3D9JA 1TJCA 4D10C 1VDYA 1GW6A 4G11A 3D9NA 3AS4A 3QAQA 4A1SA 4OYSA 4AOFA 4BX8A 1ELKA 1KT0A 3FUFA 4UQXA 4EZLA 4F3VA 3UPVA 3C98A 3Q47B 4AIFA 2LAIA 1HO8A 2OVFA 3HVEB 4GZDA 2AVPA 2Y4TA 4GAAA 4KMOA 3SNXA 4ILIA 3L6AA 3QWWA 4NACA 2KCVA 5ARGA 4C0MA 2NC9A 4YVOA 3T5XA 2WXHA 4FU3A 3BG1B 2EQXA 4ANWA 2L0TB 4RSYA 5BV1A 2E0IA 2CHWA 2L6JA 3CVNA 2QFCA 4ACLA 1FVHA 4EPZA 4Y6WA 4BTBA 2C0LA 2OOEA 5AIJA 1QQEA 4ME2A 1EDUA 4G24A 3S7DA 3JUIA 4FHJA 3CGHA 1LF8A 4FLBA 3S7BA 4F53A 4GYOA 5J90A 1UJKA 4BX9A 3KAEA 4N3BA 2X6FA 3MA5A 2J49A 2X38A 4FA6A 3KEZA 3O4ZA 4DPRA 4KVOA 3HVEA 2WXRA 3L17A 2VGYA 5HQ8A 5ENNA 3UT7A 3PZDA 3FH8A 4EZJA 3EDTB 5ANRA 4BT8A 3N71A 3HYMB 3QNKA 4FULA 5BT1A 4FP7A 3U4TA 1H6KA 4WWOA 4HOTA 3MKQB 4I6EA 2XHEA 3FTSA 4A3VA 3PVLA 3GW4A 3CQCB 4I6GA 2MOWA 2YQ8A 1E96B 4L7TA 3LXUX 4JXTA 3ZGQA 4MS6A 4XIFA 3AS5A 3TG5A 1HF8A 4MLPA 4PS8A 5G2NA 4XX5A 4JHRA 4V3IA 2CFZA 2WB2A 3FUNA 3I5PA 3QC1A 4UI9K 3FUEA 1HS6A 1H2TC 3KD7A 4ATGA 5JJ6A 3FTZA 1ZU2A 3MCXA 3MX3A 2V8SE 3B7TA 4K0RA 3UQ3A 1UG3A 4RG6A 1IYGA 4DK5A 5LP0A 2I6HA 5HI7A 4HFGA 1JUQA 2LAHA 4WNEA 5LX8A 1N54A 1SZ9A 2WMOA 4GA2A 3ZFWA 2LSVA 3B7RL 4A3TA 3U9WA 3FUIA 4TUUA 3MKQA 4MRUA 2IONA 3FUKA 2LO6A 2HR2A 3CEQA 4DI3A 4WWNA 4HORA 4GA1A 3CVUA 1DVPA 3I4RB 3LY7A 4U8HA 4KZCA 3L16A 2J09A 4NRHB 4DJAA 2VSOE 1BPOA 5FQ7A 5JHAA 3CV0A 3ASDA 3IV0A 1FCHA 2VGXB 2ILRA 3Q5MA 4UI9J 2E2EA 5G05J 1TJFA 4L1BA 1E90A 3CHSA 3K9IA 4RVBA 3CK8A 5E75A 5G04C 4ANXA 5EX0A 3FUMA 3CSTA 4BTAA 3CSFA 4KT6B 3KS2A 3ZW3A 1HE8A 4LCTA 2IU1A 4APOA 4PS3A 1UN8A 3HHMA 4WUYA 2V0PA 2WXKA 3EJNA 2VJ8A 3MKRA 4AV7A 2WQ6A 1ELRA 3P2BA 2UY1B 3RO2A 3ZPJA 4GZCA 3CVYA 3I4GA 3APDA 2VYIA 2WXLA 3FEXA 4JEUA 2XRYA 3FUJA 3TG4A 2J07A 4PDXA 3LEWA 4R7LA 5AYWD 4J8EA 2X6HA 3CQGB 5BPPA 3AS8A 4LRZA 5DIZA 3ZHEB 2VGXA 5J08A 2WQHA 2HYZA 5FWQA 2HM8A 3EHMA 5E76A 3CK9A 2BUGA 2OVBA 2ONDA 4U0ZA 3B13A 4BWRA 5FQ8A 2XCCA 2J9QA 4UQYA 3FDHA 4IULA 3LPZA 4U0SA 4CT4A 4UWGA 3CVWA 4TRQA 3TAXA 3RKVA 3LS8A 1X5BA 2YHCA 3PH0C 2UY1A 3Q49B 1JWFA 1HX8A 4JC8A 4I9EA 3NF1A 3MYVA 3PS6A 3FTXA 3TJPA 3APFA 3ZEFA 3PE4A 4EQFA 1OWMA 1OUVA 3G2WA 3IKOB 3ZHEA 4CDNA 4AY5A 5BV0A 2NSZA 1N52A 2WXPA 3ASHA 4W9RA 4J6IA 4CGVA 5A23A 3CVVA 2FF4A 4PUCA 4LEUA 4O6FA 1EPUA 2IOSA 4B8CB 4FJZA 3T5VA 4EBAA 5JHBA 4I17A 2BF0X 4L23A 2LSUA 3Q15A 2L9BA 2XPYA 3PRZA 1TEZA 1Z3YA 4XKCA 3ZYKA 3JQ1A 3IHVA 4E85A 1P5QA 1NA0A 2QY7A 1E8YA 3G2VA 4A55A 3ZVVA 3VLFA 4LERA 3BEEA 3QKYA 2DIWA 2I9CA 4I2ZA 1HG5A 5A6CA 4ANUA 3PUJA 5DBKA 5LFAA 4M3OA 2WM9A 4JHKA 1UW4B 1ZBPA 2AXZA 2VQ2A 3CVLA 3B7UX 2GGFA 5FZSA 3SHFA 5FZRA 5KJMA 2DBAA 4HOUA 4CDMA 3GYZA 3D9LA 3FU3A 4HS2A 3ZXSA 3QB2A 1NA3A 3TXNA 4URKA 2KC7A 4P29A 2FEZA 4F1SA 2VTBB 4GCOA 4WAFA 3R7QA 4ACKA 4HOQA 5FQ4A 5AJLA 2KM4A 2X6IA 4Q94A 1IHGA 3G2TA 4G26A 3TXMA 4AP2A 4BFRA 3VLEA 4N2QA 1DNPA 3AU5A 4AM9A 2WXJA 2A5UA 3GZ1A 4G23A 2R5SA 4I1OB 1XNFA 5FJYA 1UJJA 4JHJA 2GRMA 4AY6A 3CVPA 3FH7A 3ONKA 1WY6A 2XEVA 3LDZA 4OVUA 4AJWA 2IQCA 3EIJA 2XGSA 3FUDA 4JA7A 4HOSA 3IEGA 5T4YA 5AENA 5G04J 4XI9A 2XPZA 2WQ7A 1HG2A 2C0MA 1QNFA 3UUXA 3NQPA 4EZKA 5EDSA 4ILHB 4JW1A 3T8MA 3S2AA 1Z3XA 3ASGA 3QARA 2VTBA 2P58C 3E4BA 4CCAA 2CHXA 4N39A 4HLEA 3ZYQA 4N2SA 4FJYA 4WNFA 4XZ4A 1NP7A 4JA9A 5C2YA 2YINA 4GMLA 3RU0A 4U07A 3IHYA 5T8IA 1KT1A 2M63A 5EX3A 3ONLA 3APCA 3ZYLA 4Q69A 5BNWA 5CHEE 3PNTB 2J4DA 3CKBA 1FVFA 3JCKC 3MZLB 3PUKA 2JEKA 3NZUA 2GW1A 3CVQA 1E8XA 5A7DB 4I6JA 4U63A 3CHQA 2KATA 3QWVA 4L2YA 3L08A 4JEHA 4XE0A 4H7XA 2I1JA 2HO1A 5FQ6A 2AWIA 3UMVA 2XCBA 2WXQA 3B7SA 3MV2B 3DPDA 2ZU6B 3SD5A 5C1DA 2PQNA 2IFUA 4CT0A 1OWLA 2Y4UA 3LY8A 3LYAA 4B89A 3QOUA 5G55A 2XGOA 4GMJA 3RIBA 1HFAA 4CEMA 3LVRE 4U0UA 1ELWA 3CR3A 3ZIMA 2PM6A 3FULA 3JYSA 2KCLA 3AU4A 3L13A 5D0OD 2XPIA 3RRNB 3ZRHA 2Q7FA 4U04A 5LCWC 4HXIA 3ZYMA 2PZIA 4UI9C 4ABNA 5JJ7A 5M72A 3UT4A 5KJKA 3FU0A 1L5JA 3ESKA 3PREA 2R59A 5KJNA 2WMNA 4AVXA 2KZTB 2IJGX 2KCKA 3FY4A 4J8FA 3TGOA 4WWPA 4I9CA 1B89A 1H2UA 4Q96A 2DCPA 5BUZA 4H7YA 1U3CA 3LCAA 2FO7A 2MRIA 3FUHA 4B94A 4BY6A 4I2WA 4GZ3A 5CMYA 5AJDA 1E7UA 2WVIA 4APFA 2L0IA 3IBEA 3U64A 3SBSA 4G25A 2XGMA 5BW8C 3PEUB 4GA0A 2V4LA 3LVQE 1W3BA 4KXKB 3FFLA 5ARFA 1HU3A 3LY9A 2WPVA 4UWHA 3VTYA 4CRWA 2R17C 2RD0A 3BG0B 5KJLA 1WAO1 1NZNA 1YA0A 1JWGA 3ASFA 3CK7A 4MKTA 3FP3A 2KZTA 1SQMA 4FHKA 3D3MA 4I1AA 4EECA 4L2LA 1EYHA 3G2UA 2XRZA 3HDXA 4J8SA 3FTYA 3JQ0A 5ANLA 3WXXA 2AW6A 3FTVA 4GZ5A 3I3NA 5T3RA 1EF1C 4DI4A 1OWPA 3PE3A 2YHEA 5CCMA 4KZ0A 4N3CA 1PY1A 4UQZA 2I2OA 3EHNA 2A4ZA 3FEYA 1IQRA 2X6KA 1INZA 3RO3A 1MHQA 4G2VA 3CLJA 2CHZA 2VSYA 3OXLA 4N3AA 4YNDA 2CG3A 2OV8A 1QZ2A 1E8ZA 4FLHA 3D9IA 1PC2A 2AXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YVQ C;  2PL2 A;  3CKC A;  2PQR A;  3OXG A;  5CCL A;  4G1T A;  2VSN A;  4J0U A;  4NQ0 A;  4GYY A;  3Q4A B;  4GYW A;  4WNG A;  4BT9 A;  4JL0 A;  1Y8M A;  4GCN A;  3O48 A;  2IF4 A;  5D0Q D;  4J8D A;  1WM5 A;  3PDN A;  4N5C A;  4CDR A;  3QWP A;  3ULQ A;  2C2L A;  4GZ6 A;  5FTP A;  3VTX A;  5JJT A;  5LCW J;  4Y6C A;  2JLB A;  2FI7 A;  1KLX A;  4KBQ A;  2LNI A;  1HH8 A;  2V5F A;  1HZ4 A;  4GPK A;  4IN3 B;  2MHK A;  3MV3 B;  5G05 C;  3R9A B;  5FT9 A;  5FZQ A;  3ZN3 A;  3FWV A;  3LKU A;  3QDN A;  2FBN A;  4RG9 A;  1A17 A;  4CGW A;  3GZ2 A;  3SF4 A;  3U3W A;  3URZ A;  3OXF A;  3RJV A;  2UWJ G;  4KYO B;  4XI0 A;  3S7J A;  3S7F A;  1HXI A;  3SZ7 A;  4WND A;  3MEK A;  5EKQ D;  1TJC A;  3AS4 A;  4A1S A;  3UPV A;  1KT0 A;  4UQX A;  4F3V A;  3Q47 B;  4AIF A;  2AVP A;  2Y4T A;  3QWW A;  2KCV A;  5ARG A;  2NC9 A;  4YVO A;  2L6J A;  3CVN A;  2QFC A;  4Y6W A;  4BTB A;  2C0L A;  2OOE A;  1QQE A;  4ME2 A;  4G24 A;  3S7D A;  3S7B A;  4GYO A;  3KAE A;  4N3B A;  3MA5 A;  2VGY A;  5HQ8 A;  3EDT B;  4BT8 A;  3N71 A;  3HYM B;  5BT1 A;  3U4T A;  4HOT A;  3GW4 A;  2YQ8 A;  1E96 B;  3ZGQ A;  4XIF A;  3AS5 A;  3TG5 A;  4JHR A;  4UI9 K;  3KD7 A;  5JJ6 A;  1ZU2 A;  3UQ3 A;  4RG6 A;  1IYG A;  2I6H A;  5HI7 A;  4WNE A;  4GA2 A;  3ZFW A;  2LSV A;  2HR2 A;  3CEQ A;  4HOR A;  4GA1 A;  3LY7 A;  4NRH B;  3CV0 A;  3ASD A;  3Q5M A;  1FCH A;  2VGX B;  4UI9 J;  2E2E A;  5G05 J;  3K9I A;  3CK8 A;  5G04 C;  5EX0 A;  4BTA A;  3KS2 A;  4APO A;  4WUY A;  3MKR A;  1ELR A;  2UY1 B;  3RO2 A;  3ZPJ A;  2VYI A;  3TG4 A;  5AYW D;  4J8E A;  3AS8 A;  5DIZ A;  3ZHE B;  2VGX A;  2WQH A;  2HYZ A;  3CK9 A;  2BUG A;  2OND A;  4U0Z A;  4BWR A;  2XCC A;  2J9Q A;  4UQY A;  3LPZ A;  4U0S A;  3TAX A;  3RKV A;  2YHC A;  2UY1 A;  3Q49 B;  4I9E A;  3NF1 A;  3PE4 A;  4EQF A;  1OUV A;  3ZHE A;  4AY5 A;  3ASH A;  4W9R A;  4CGV A;  2FF4 A;  4LEU A;  4O6F A;  4I17 A;  2LSU A;  3Q15 A;  1P5Q A;  1NA0 A;  3BEE A;  3QKY A;  4I2Z A;  5A6C A;  5DBK A;  1ZBP A;  2VQ2 A;  3CVL A;  5FZS A;  5FZR A;  5KJM A;  2DBA A;  4HOU A;  3GYZ A;  1NA3 A;  2KC7 A;  2FEZ A;  4GCO A;  4HOQ A;  1IHG A;  4G26 A;  4N2Q A;  4AM9 A;  3GZ1 A;  4G23 A;  2R5S A;  1XNF A;  5FJY A;  4AY6 A;  3CVP A;  2XEV A;  2XGS A;  4JA7 A;  4HOS A;  3IEG A;  5G04 J;  4XI9 A;  2C0M A;  3UUX A;  3ASG A;  2P58 C;  3E4B A;  4N39 A;  4N2S A;  4WNF A;  4JA9 A;  3RU0 A;  4U07 A;  1KT1 A;  5EX3 A;  5BNW A;  5CHE E;  3CKB A;  2GW1 A;  3CVQ A;  5A7D B;  2KAT A;  3QWV A;  4H7X A;  2HO1 A;  2XCB A;  3MV2 B;  5C1D A;  2PQN A;  2IFU A;  2Y4U A;  3LY8 A;  3LYA A;  3QOU A;  3RIB A;  2XGO A;  4U0U A;  1ELW A;  3JYS A;  2KCL A;  5D0O D;  2XPI A;  2Q7F A;  4U04 A;  5LCW C;  2PZI A;  4UI9 C;  4ABN A;  5JJ7 A;  5M72 A;  5KJK A;  3ESK A;  5KJN A;  2KCK A;  4J8F A;  3TGO A;  4I9C A;  1B89 A;  4H7Y A;  3LCA A;  2FO7 A;  4B94 A;  4I2W A;  4GZ3 A;  4G25 A;  2XGM A;  5BW8 C;  4GA0 A;  1W3B A;  3VTY A;  3FFL A;  4KXK B;  3LY9 A;  5ARF A;  2WPV A;  5KJL A;  1WAO 1;  1NZN A;  1YA0 A;  3ASF A;  3CK7 A;  3FP3 A;  4I1A A;  3WXX A;  4GZ5 A;  3PE3 A;  5CCM A;  4N3C A;  4UQZ A;  3RO3 A;  4G2V A;  2VSY A;  3OXL A;  4N3A A;  4YND A;  1QZ2 A;  1PC2 A; 
#chains in the Genus database with same CATH topology
 3CKC A;  3QJZ A;  3D9K A;  2WXM A;  5CCL A;  1G3N B;  3P1U A;  2R03 A;  4XKB A;  2WXN A;  2ETC A;  1Y6I A;  4FC8 A;  4GYW A;  3CHO A;  4CZ2 D;  2AJA A;  3OTN A;  3O48 A;  4X8Q A;  1IQU A;  2AXV A;  4GPM A;  4J8D A;  4B0Z A;  3U66 A;  3SFZ A;  3ESL A;  2WXG A;  2XEE A;  3FTW A;  4Y6C A;  3D9M A;  2Y1L E;  4KBQ A;  3PEV B;  3SI5 A;  2ETB A;  1HH8 A;  3L54 A;  5EID A;  2NXP A;  4GPK A;  4B93 B;  1D8E A;  1OWO A;  4JZY A;  2X3M A;  4ANV A;  4EBA G;  3ZN3 A;  1KZO A;  3PZ3 A;  4QFV A;  3QDN A;  4RG9 A;  1A17 A;  2Y3A A;  2J4B A;  2QYJ A;  3GZ2 A;  4C0E A;  3U3W A;  3URZ A;  3UT8 A;  3S7F A;  1HXI A;  4AEZ C;  3MEK A;  3D9J A;  1N9A A;  4D10 C;  3D9N A;  5AQA A;  4A1S A;  3UPV A;  4F3V A;  3C98 A;  4GTM A;  4GAA A;  2DZO A;  4KMO A;  4NAC A;  4K5C A;  4F1P A;  4YVO A;  4ANW A;  2E0I A;  3CVN A;  2QFC A;  2KXP C;  1FVH A;  4EPZ A;  5AIJ A;  1EDU A;  5HRY A;  3ZKJ A;  4N3B A;  2X6F A;  5CRU A;  3UTM A;  3KEZ A;  1Z5S C;  3HVE A;  2WXR A;  2ZIS A;  3PZD A;  3W9F A;  3SO8 A;  3N71 A;  3AG1 E;  3JXI A;  4FUL A;  1TNO A;  4FP7 A;  3FTS A;  3PVL A;  4DUI A;  4I6G A;  4L7T A;  3TG5 A;  1AWC B;  3FUN A;  4UI9 K;  3UQ3 A;  4J7W A;  4GA2 A;  2LSV A;  3B7R L;  4TUU A;  3MKQ A;  4MRU A;  3CEQ A;  4GA1 A;  3CVU A;  3I4R B;  4U8H A;  4NRH B;  5FQ7 A;  4UI9 J;  4L1B A;  5E75 A;  3Q78 A;  2EIK E;  4BTA A;  3ZW3 A;  2IU1 A;  4PS3 A;  1UN8 A;  4LG6 A;  1O1T A;  4AV7 A;  2OCC E;  2ETA A;  5AAR A;  2WXL A;  4JEU A;  5HS0 A;  3AS8 A;  4LRZ A;  3TWU A;  3UM2 A;  2HM8 A;  3EHQ A;  2OND A;  4U0Z A;  1N0R A;  4UQY A;  3FDH A;  4IUL A;  4CT4 A;  2R2L A;  4TRQ A;  1D9S A;  3UIP C;  1X5B A;  2YHC A;  4HRN A;  2BKG A;  2LXL A;  1S63 A;  3ZEF A;  3NF1 A;  3ZXP A;  3EU5 A;  3ULY A;  1A5E A;  4CDN A;  4BES A;  5CED B;  4CGV A;  4LNB A;  4LEU A;  1MX6 A;  4O6F A;  1BI8 B;  5JHB A;  2BF0 X;  3Q15 A;  3PRZ A;  1Z3Y A;  1P5Q A;  3DST A;  1NA0 A;  4A55 A;  3ZVV A;  1UW4 B;  4A63 B;  1ZBP A;  2GGF A;  3SHF A;  4HQD A;  3ZXS A;  1MX2 A;  3C3O A;  1NA3 A;  3V2X A;  2VTB B;  4WAF A;  4Q94 A;  4JD2 G;  4BFR A;  4N2Q A;  3AU5 A;  2R5S A;  4I1O B;  3Q73 A;  2GRM A;  2XEV A;  1LD7 A;  3FUD A;  4U95 D;  2XPZ A;  2H6G A;  4HNA D;  3NQP A;  1OCZ E;  4JW1 A;  3Q9N C;  4CCA A;  4N39 A;  4HLE A;  4N2S A;  2VGE A;  4WNF A;  1NP7 A;  2YIN A;  5EX3 A;  3ZYL A;  5BNW A;  2L6B A;  3JCK C;  3PUK A;  3NZU A;  2ZGG A;  1E8X A;  3IXE A;  5A7D B;  3CHQ A;  4JEH A;  5FQ6 A;  2WXQ A;  3B7S A;  3MV2 B;  3SD5 A;  4BEP A;  2IFU A;  4CT0 A;  1OWL A;  3LY8 A;  4B89 A;  3RIB A;  2XGO A;  3W9G A;  1ELW A;  3FUL A;  3JYS A;  5H7P A;  4U04 A;  2GRP B;  4AVX A;  4WWP A;  4I9C A;  1B89 A;  1H2U A;  4Q96 A;  5BUZ A;  4H7Y A;  1V55 E;  4B94 A;  4BY6 A;  3JUE A;  4G25 A;  2XGM A;  2P9K G;  5BW8 C;  4GA0 A;  2V4L A;  4CRW A;  3LY9 A;  5EYP F;  1WAO 1;  1NZN A;  3CK7 A;  3FP3 A;  1SQM A;  4I1A A;  3NOG D;  4K5B A;  4J8S A;  3WXX A;  4TUM A;  4F6R D;  4GZ5 A;  3I3N A;  5T3R A;  4DI4 A;  3PE3 A;  4N3C A;  1OCC E;  1IQR A;  3TWQ A;  2OV8 A;  1OT8 A;  1QZ2 A;  3D9I A;  3ML9 A;  4YVQ C;  1OWN A;  2DYR E;  2PQR A;  4YDO A;  4FAD A;  1TNY A;  1YCS B;  3DBS A;  4G1T A;  5LOZ A;  2VSN A;  3UM3 A;  3FTU A;  5ENQ D;  4WNG A;  4BT9 A;  4DLO A;  3ABK E;  4GCN A;  4E6H A;  3HXC A;  2PM7 A;  3G2S A;  4ATZ D;  4GB9 A;  4JVS A;  2IF4 A;  5D0Q D;  4DLQ A;  4N5C A;  5CEC B;  4DX2 A;  4CDR A;  3ULQ A;  2C2L A;  1S0P A;  3ENE A;  4GZ6 A;  5CBN A;  5EIL A;  3FU6 A;  2I1K A;  3HIZ A;  4GTQ A;  3L22 A;  1UN9 A;  5ENR D;  4IN3 B;  3UKU G;  1O5M A;  4NUR A;  2MHK A;  4IRU A;  5CMW A;  3D9P A;  1E8W A;  4ILG A;  3LKU A;  3RRU A;  1ZB1 A;  5KCM A;  4UWL A;  2FBN A;  1IXV A;  4I1M A;  3SF4 A;  1N95 A;  3S7J A;  4PS7 A;  4WND A;  2BED A;  2VSX E;  3UIN C;  5AQ7 A;  4G11 A;  3AS4 A;  5KBA A;  3FUF A;  3Q47 B;  1HO8 A;  4GZD A;  2AVP A;  3L6A A;  5AN8 A;  3QWW A;  3V79 K;  2WXH A;  2NYJ A;  4RSY A;  1MX4 A;  4Y6W A;  5FIN A;  3R9M A;  4FHJ A;  3CGH A;  4F53 A;  4DPR A;  2H6I A;  2HE0 A;  3L17 A;  5ENN A;  3UT7 A;  4EZJ A;  3EDT B;  5ANR A;  3HYM B;  3JXJ A;  5BT1 A;  1H6K A;  4Z68 A;  3GW4 A;  1JCS A;  4M7C A;  4XX5 A;  4DRX E;  3I5P A;  3FUE A;  3FTZ A;  2V8S E;  3B7T A;  2KBX A;  1IYG A;  5LP0 A;  5HI7 A;  4HFG A;  2LAH A;  5LX8 A;  1N54 A;  5JMN D;  3ZU7 B;  1MJ0 A;  2ION A;  3FUK A;  2HR2 A;  4HOR A;  4KZC A;  1TN7 A;  4DJA A;  2VSO E;  4BSZ B;  1BPO A;  4RLY A;  4O1P A;  3CV0 A;  3ASD A;  3IV0 A;  3Q5M A;  2VGX B;  2E2E A;  5G05 J;  4DX7 D;  3K9I A;  3CK8 A;  1IHB A;  3C5R A;  1N11 A;  3KS2 A;  1BLX B;  4LNU D;  2V0P A;  3X2Q E;  4N5Q A;  3MKR A;  2WQ6 A;  2UY1 B;  1YMP A;  3KSQ A;  3APD A;  2XRY A;  1FT1 A;  4R7L A;  4TXR A;  3NB2 A;  5E76 A;  3WG7 E;  1N0Q A;  2OVB A;  4BWR A;  5FQ8 A;  3LJN A;  3Q7F A;  3Q49 B;  3TJP A;  2GRO B;  3APF A;  4EQF A;  1OUV A;  3ZHE A;  4AY5 A;  5BV0 A;  5A23 A;  4PUC A;  1EPU A;  4FJZ A;  4EBA A;  3E32 A;  2QZA A;  4YDE A;  3ABM E;  3IHV A;  5ENP D;  2QY7 A;  3G2V A;  2QC9 A;  4I2Z A;  5A6C A;  4MBG A;  4M3O A;  4JHK A;  2AXZ A;  2VQ2 A;  5FZS A;  1SW6 A;  2F0Y A;  2DBA A;  4HOU A;  3D9L A;  3FU3 A;  3TXN A;  1SA5 A;  2KC7 A;  4TXP A;  1AP7 A;  4ACK A;  4HOQ A;  5FQ4 A;  3G2T A;  1DNP A;  4G23 A;  1XNF A;  5FJY A;  1UJJ A;  4JHJ A;  4YDY A;  1N4P A;  3ONK A;  1OY3 D;  4AJW A;  4HOS A;  3E33 A;  1N94 A;  1QYM A;  1HG2 A;  5EDS A;  2P58 C;  4GTP A;  1TN8 A;  4XZ4 A;  4JA9 A;  3RU0 A;  2M63 A;  3ONL A;  5CHE E;  3PNT B;  4U63 A;  3QWV A;  3L08 A;  4H7X A;  2HO1 A;  3F6Q A;  3DPD A;  2PQN A;  3HXF A;  3LYA A;  5G55 A;  1HFA A;  3AU4 A;  3RRN B;  3ZRH A;  4HXI A;  5M72 A;  4GTT A;  3UT4 A;  3FU0 A;  2B6C A;  1TN6 A;  3PRE A;  2WMN A;  1K1B A;  3FY4 A;  1U2V G;  3AG4 E;  1U3C A;  3AG3 E;  2FO7 A;  2MYO A;  4I2W A;  5AQ9 A;  5AJD A;  3ULE G;  3BQO A;  2P9L G;  3B95 A;  1W3B A;  3FFL A;  2R17 C;  5KJL A;  1YA0 A;  2OEV A;  5KNG A;  1JWG A;  3DSW A;  3ASF A;  4MKT A;  2KZT A;  3D3M A;  4EEC A;  2XRZ A;  3HDX A;  3AAA C;  3FTV A;  1OWP A;  5CCM A;  2I2O A;  3EHN A;  3SY2 A;  4RQI A;  2X6K A;  1INZ A;  1MHQ A;  3CLJ A;  2VSY A;  2FO1 E;  4EHM A;  4N3A A;  4YND A;  1H6P A;  1TR4 A;  2CG3 A;  1V54 E;  3L82 A;  3MGB A;  5IY5 E;  4OVV A;  1Z6T A;  3TL5 A;  3OXG A;  4BER A;  5JA4 D;  3LJ3 A;  2CG2 A;  3Q4A B;  2WXF A;  3PZ1 A;  3OAW A;  4JL0 A;  4AXH A;  3EHR A;  3BU8 A;  3CHR A;  2XEN A;  4A1G A;  5AQB A;  3FH5 A;  3Q79 A;  3PDN A;  3MJW A;  3QWP A;  3R7R A;  3ABL E;  2YNQ A;  4LUN U;  1RZ4 A;  5D2M C;  3ZUV B;  4GU5 A;  5FTP A;  1H2V C;  2CFU A;  5BXO A;  4HVB A;  3EIQ C;  2H6H A;  3RK6 A;  2FI7 A;  2BTD A;  1HZ4 A;  2J08 A;  2P9I G;  2GRL A;  3E30 A;  4GTO A;  4HBD A;  1NFI E;  4IYP A;  3CVX A;  3MV3 B;  5G05 C;  5FZQ A;  5B1A E;  3NZS A;  3FWV A;  1TNB A;  3FU5 A;  3RRM B;  1XGW A;  3OXF A;  3RJV A;  4XI0 A;  3PNL B;  4KVM A;  4K03 A;  3UIO C;  3T9K A;  3ZNG A;  3D9H A;  5EKQ D;  1TJC A;  1GW6 A;  3QAQ A;  2F37 A;  4AOF A;  1ELK A;  1KT0 A;  1BI7 B;  4UQX A;  4EZL A;  1JCR A;  3EU9 A;  3HVE B;  2ZXW E;  2Y4T A;  3SNX A;  2NC9 A;  2V5Q C;  2L0T B;  5BV1 A;  2CHW A;  2F8Y A;  4BTB A;  2C0L A;  2OOE A;  1QQE A;  4ME2 A;  4G24 A;  3S7D A;  1O1R A;  3JUI A;  4FLB A;  2J49 A;  4FA6 A;  4KVO A;  5HQ8 A;  3FH8 A;  2EIL E;  4BT8 A;  3QNK A;  3UM1 A;  3U4T A;  4HOT A;  4WWO A;  3MKQ B;  2IY0 C;  4J8Y A;  4GTR A;  1E96 B;  1X81 A;  3ZGQ A;  4HRL A;  1S70 B;  1HF8 A;  4PS8 A;  2CFZ A;  1LTX A;  5HKP A;  1H2T C;  4ATG A;  2R02 A;  4K0R A;  1JUQ A;  4WNE A;  2DYS E;  2WMO A;  3ZFW A;  1DCE A;  3FUI A;  3HXE A;  2LO6 A;  2ZIR A;  3DSV A;  4WWN A;  1FPP A;  1DVP A;  2J09 A;  1IKN D;  5JHA A;  2ILR A;  4YDW A;  2RFA A;  1TJF A;  2ZGD A;  1E90 A;  4LSZ E;  3CST A;  2DVW A;  3TWT A;  4GMR A;  3V31 A;  2DZN A;  4C48 B;  2VJ8 A;  1ELR A;  1H6O A;  3P2B A;  3ZPJ A;  1Q2Z A;  3CVY A;  2VYI A;  5EN5 D;  5AYW D;  3DXM G;  1UOH A;  5J08 A;  2HYZ A;  5FWQ A;  3EHM A;  2XCC A;  3LPZ A;  4U0S A;  3T8K A;  3CVW A;  3LS8 A;  3PH0 C;  1JWF A;  4JC8 A;  3TWS A;  1OWM A;  3IKO B;  3ASO E;  2NSZ A;  3UM0 A;  4W9R A;  4TXQ A;  3SQV A;  3CVV A;  4U96 D;  2FF4 A;  2LUH A;  2IOS A;  3AG2 E;  4B8C B;  3T5V A;  4L23 A;  2L9B A;  3TWW A;  3ZYK A;  2V4H C;  5BXU A;  4LER A;  5CER B;  3BEE A;  2I9C A;  1HG5 A;  3PUJ A;  5DBK A;  2XEH A;  2P9S G;  5ENS D;  5FZR A;  5CBO A;  4CDM A;  3GYZ A;  4HS2 A;  3QB2 A;  3SFX A;  4P29 A;  4GCO A;  5AJL A;  2X6I A;  4AP2 A;  3TXM A;  3PZ4 A;  3VLE A;  2GRN B;  2A5U A;  2PNN A;  4AY6 A;  1WY6 A;  3LDZ A;  4OVU A;  3EIJ A;  2XGS A;  4JA7 A;  5T4Y A;  5G04 J;  2C0M A;  1QNF A;  2GRQ B;  3V30 A;  4EZK A;  4ILH B;  3DRA A;  3T8M A;  1Z3X A;  3ASG A;  3QAR A;  2VTB A;  3E4B A;  2CHX A;  3ZYQ A;  5C2Y A;  4GML A;  4GTS A;  4U07 A;  3IHY A;  5T8I A;  1KT1 A;  4Q69 A;  2XZD G;  1DC2 A;  2JEK A;  2GW1 A;  3DEP A;  4I6J A;  4L2Y A;  4XE0 A;  2I1J A;  2AWI A;  3UMV A;  4ZHB A;  2XCB A;  5C1D A;  1N4R A;  2Y4U A;  3QOU A;  4GTV A;  4GMJ A;  5B3S E;  3LVR E;  3CR3 A;  3ZIM A;  2IO2 C;  2PM6 A;  5D0O D;  3ASN E;  5D66 A;  5JJ7 A;  3DSX A;  5KNH D;  5KJK A;  1L5J A;  3ESK A;  5KJN A;  2IJG X;  4J8F A;  3TWX A;  3LCA A;  2MRI A;  4DX1 A;  4GZ3 A;  5CMY A;  1JCQ A;  2L0I A;  4NIK A;  3IBE A;  3DSS A;  1OXJ A;  1RW2 A;  4O60 A;  4KXK B;  3VTY A;  1MZC A;  1HU3 A;  2WPV A;  3DEO A;  3BG0 B;  2JAB A;  1OCR E;  4FHK A;  2R05 A;  5AAO A;  4L2L A;  2XS1 A;  1K8K G;  2J8S D;  3V2O A;  1EF1 C;  4KZ0 A;  4UQZ A;  5KWD A;  2RKK A;  3DXK G;  1S64 A;  2EIN E;  3RO3 A;  4G2V A;  5ENT D;  2CHZ A;  3UKR G;  3OXL A;  1PC2 A;  1QBQ A;  2AXU A;  4I43 A;  2PL2 A;  2RG8 A;  2P2C P;  3SBT B;  1PAQ A;  4BSX A;  4J0U A;  4NQ0 A;  3D9O A;  3GZS A;  3Q7A A;  4GYY A;  5EYL A;  4PH4 B;  1Y8M A;  3L9T A;  2FUL A;  4DX5 D;  3HXB A;  4B8A A;  3CHP A;  3Q9U C;  2RFM A;  1TYQ G;  3QK0 A;  4F7A A;  1WM5 A;  3UX4 A;  3SGH A;  2WXO A;  4TV3 A;  1H0A A;  4UWF A;  3VTX A;  5JJT A;  3C3Q A;  5LCW J;  1JPL A;  1OCO E;  2P9U G;  4C9B B;  4JB8 P;  2JLB A;  1KLX A;  1E7V A;  2LNI A;  2V5F A;  3NOC D;  2Y0B G;  2X6J A;  4UWK A;  3R9A B;  5FT9 A;  1U3D A;  2IOL A;  3PZ2 A;  1H19 A;  2EIJ E;  1DCQ A;  3E37 A;  3FHE A;  3VLD A;  2LXM A;  3CIA A;  1BU9 A;  4CGW A;  2WXI A;  1MQS A;  3CHM A;  4JPS A;  1SZA A;  2UWJ G;  4KYO B;  2XQ0 A;  3SZ7 A;  3ML8 A;  3HRA A;  1VDY A;  2GRR B;  3RSE G;  1BD8 A;  4OYS A;  4BX8 A;  4AIF A;  2LAI A;  2OVF A;  4K5A B;  4ILI A;  2KCV A;  5ARG A;  4C0M A;  3NBN B;  3T5X A;  4FU3 A;  3BG1 B;  2EQX A;  3J5Q B;  3UI2 A;  2L6J A;  4XEI G;  4ACL A;  1N4Q A;  1O1S A;  1YYH A;  3KEA A;  1LF8 A;  3S7B A;  4GYO A;  5J90 A;  1UJK A;  4BX9 A;  3KAE A;  3MA5 A;  2X38 A;  3O4Z A;  4OAU C;  2VGY A;  3TWR A;  2DWZ A;  4I6E A;  2XHE A;  4A3V A;  3CQC B;  2MOW A;  2YQ8 A;  3LXU X;  4JXT A;  4MS6 A;  4XIF A;  3AS5 A;  4MLP A;  5G2N A;  4U7E B;  4JHR A;  4V3I A;  2WB2 A;  3DWL G;  3QC1 A;  1HS6 A;  3DSU A;  3KD7 A;  4G8L A;  5JJ6 A;  1ZU2 A;  3MCX A;  3MX3 A;  2B0O E;  1UG3 A;  4RG6 A;  4U8Y D;  4DK5 A;  2I6H A;  1SZ9 A;  4A3T A;  5FIO A;  3U9W A;  4DI3 A;  2XS8 A;  3LY7 A;  3BUA A;  1MYO A;  3L16 A;  4HRM B;  1FCH A;  4ANX A;  3CHS A;  4RVB A;  5G04 C;  5EX0 A;  3FUM A;  3CSF A;  4KT6 B;  1HE8 A;  4LCT A;  4APO A;  3HHM A;  4WUY A;  5ENO D;  2WXK A;  3EJN A;  3RO2 A;  4GZC A;  3I4G A;  3FEX A;  2P9P G;  3FUJ A;  1TNZ A;  2J07 A;  4PDX A;  3TG4 A;  3LEW A;  4J8E A;  2X6H A;  3CQG B;  5BPP A;  5DIZ A;  3ZHE B;  2VGX A;  4BET A;  2WQH A;  3CK9 A;  2BUG A;  3B13 A;  2Y69 E;  2J9Q A;  1K1A A;  4UWG A;  1N4S A;  3TAX A;  3RKV A;  4G8K A;  2UY1 A;  1HX8 A;  3UXG A;  5EIB E;  4I9E A;  3MYV A;  3PS6 A;  3FTX A;  1SA4 A;  3PE4 A;  3G2W A;  1N52 A;  2WXP A;  3ASH A;  4J6I A;  4I17 A;  2LSU A;  2XPY A;  2P9N G;  1TEZ A;  4XKC A;  3JQ1 A;  4E85 A;  1E8Y A;  3VLF A;  3QKY A;  2DIW A;  4ANU A;  3TWV A;  4ZFH A;  5LFA A;  2WM9 A;  1NI1 A;  4HLL A;  3AJI A;  2OEW A;  3CVL A;  3B7U X;  3KSL A;  5KJM A;  3J5P A;  3NAW A;  4URK A;  2FEZ A;  4F1S A;  4CYM D;  1D8D A;  1WG0 A;  3DPY A;  3R7Q A;  4HI9 A;  2KM4 A;  1IHG A;  4G26 A;  4AM9 A;  2WXJ A;  2A5E A;  3GZ1 A;  3CVP A;  3FH7 A;  2BKK B;  3SFY A;  2IQC A;  3IEG A;  5AEN A;  1FT2 A;  4XI9 A;  2WQ7 A;  3UUX A;  3S2A A;  3HG0 D;  1KZP A;  5B1B E;  5ITZ F;  4FJY A;  2EIM E;  3APC A;  1K3Z D;  2J4D A;  3CKB A;  3HXD A;  1FVF A;  3C3R A;  2IO3 C;  3MZL B;  3CVQ A;  4LNG A;  2QYU A;  2KAT A;  1LD8 A;  2ZU6 B;  1NL4 A;  4CEM A;  4U0U A;  4U8V D;  4HI8 A;  3ISM C;  1KPS B;  2KCL A;  3L13 A;  2XPI A;  1SVX A;  2Q7F A;  5LCW C;  3ZYM A;  4DX6 D;  2PZI A;  4UI9 C;  2XZT G;  4ABN A;  4L9P A;  5CRV A;  2IEJ A;  4QQI A;  2R59 A;  2KZT B;  2KCK A;  3TGO A;  2DCP A;  3FUH A;  1E7U A;  2WVI A;  4APF A;  4O1O A;  3U64 A;  3SBS A;  3Q75 A;  3E34 A;  3RAU A;  4UUC A;  3PEU B;  3LVQ E;  5ARF A;  1TNU A;  4UWH A;  2RD0 A;  3EUV A;  2F8X K;  4HB5 A;  2H6F A;  3B7B A;  1WDY A;  5CEA A;  1EYH A;  3G2U A;  3FTY A;  3JQ0 A;  5ANL A;  2AW6 A;  2YHE A;  4OAV B;  1PY1 A;  2A4Z A;  3C72 A;  3FEY A;  1E8Z A;  4FLH A; 
#chains in the Genus database with same CATH homology
 3MGB A;  4I43 A;  4YVQ C;  4OVV A;  1OWN A;  2PL2 A;  2RG8 A;  3CKC A;  1Z6T A;  3SBT B;  1PAQ A;  2PQR A;  3QJZ A;  3OXG A;  3TL5 A;  4BSX A;  4FAD A;  3D9K A;  2WXM A;  3DBS A;  4G1T A;  5CCL A;  5LOZ A;  2VSN A;  4J0U A;  3LJ3 A;  3P1U A;  2CG2 A;  4NQ0 A;  4XKB A;  3D9O A;  3GZS A;  3ML9 A;  2WXN A;  4GYY A;  3FTU A;  3Q4A B;  1Y6I A;  4FC8 A;  4PH4 B;  2WXF A;  3CHO A;  4GYW A;  4WNG A;  4BT9 A;  4DLO A;  3OAW A;  4JL0 A;  1Y8M A;  4GCN A;  4E6H A;  2PM7 A;  3G2S A;  4AXH A;  2FUL A;  3OTN A;  3O48 A;  4GB9 A;  4JVS A;  2IF4 A;  4B8A A;  5D0Q D;  1IQU A;  2AXV A;  3CHR A;  3CHP A;  4A1G A;  4DLQ A;  3FH5 A;  3QK0 A;  4F7A A;  4J8D A;  4B0Z A;  1WM5 A;  3PDN A;  4N5C A;  3MJW A;  3U66 A;  3SFZ A;  3UX4 A;  3ESL A;  4CDR A;  3QWP A;  3R7R A;  3ULQ A;  3SGH A;  2C2L A;  1S0P A;  2YNQ A;  3ENE A;  4GZ6 A;  2WXO A;  4LUN U;  4TV3 A;  1H0A A;  3FU6 A;  2I1K A;  4UWF A;  4GU5 A;  5FTP A;  3VTX A;  1H2V C;  2WXG A;  5JJT A;  2CFU A;  5LCW J;  1JPL A;  3HIZ A;  3FTW A;  4Y6C A;  4HVB A;  3EIQ C;  4C9B B;  3RK6 A;  2JLB A;  2FI7 A;  3D9M A;  1KLX A;  4KBQ A;  3PEV B;  1E7V A;  2LNI A;  3SI5 A;  3L22 A;  1HH8 A;  2BTD A;  2V5F A;  1UN9 A;  1HZ4 A;  2J08 A;  3L54 A;  2NXP A;  4GPK A;  2GRL A;  4IN3 B;  1OWO A;  2X6J A;  4UWK A;  4JZY A;  4NUR A;  4IYP A;  2X3M A;  4ANV A;  3CVX A;  2MHK A;  3MV3 B;  5G05 C;  4IRU A;  3R9A B;  5FT9 A;  5FZQ A;  1U3D A;  2IOL A;  1H19 A;  4EBA G;  5CMW A;  3ZN3 A;  3D9P A;  3NZS A;  1E8W A;  3FWV A;  3LKU A;  4ILG A;  3RRU A;  3FU5 A;  4QFV A;  3FHE A;  3VLD A;  5KCM A;  4UWL A;  3RRM B;  3QDN A;  2FBN A;  1XGW A;  3CIA A;  4RG9 A;  4I1M A;  1A17 A;  2Y3A A;  2J4B A;  4CGW A;  2WXI A;  1MQS A;  3CHM A;  3GZ2 A;  4JPS A;  4C0E A;  3SF4 A;  1SZA A;  3U3W A;  3URZ A;  3OXF A;  3RJV A;  2UWJ G;  4KYO B;  4XI0 A;  3UT8 A;  3PNL B;  3S7J A;  3S7F A;  1HXI A;  4KVM A;  4PS7 A;  2XQ0 A;  4WND A;  3SZ7 A;  4K03 A;  4AEZ C;  3MEK A;  3ML8 A;  2VSX E;  5EKQ D;  3D9J A;  1TJC A;  4D10 C;  1VDY A;  1GW6 A;  4G11 A;  3D9N A;  3AS4 A;  3QAQ A;  4A1S A;  4OYS A;  4AOF A;  4BX8 A;  1ELK A;  1KT0 A;  3FUF A;  4UQX A;  4EZL A;  4F3V A;  3UPV A;  3C98 A;  3Q47 B;  4AIF A;  2LAI A;  1HO8 A;  2OVF A;  3HVE B;  4GZD A;  2AVP A;  2Y4T A;  4GAA A;  4KMO A;  3SNX A;  4ILI A;  3L6A A;  3QWW A;  4NAC A;  2KCV A;  5ARG A;  4C0M A;  2NC9 A;  4YVO A;  3T5X A;  2WXH A;  4FU3 A;  3BG1 B;  2EQX A;  4ANW A;  2L0T B;  4RSY A;  5BV1 A;  2E0I A;  2CHW A;  2L6J A;  3CVN A;  2QFC A;  4ACL A;  1FVH A;  4EPZ A;  4Y6W A;  4BTB A;  2C0L A;  2OOE A;  5AIJ A;  1QQE A;  4ME2 A;  1EDU A;  4G24 A;  3S7D A;  3JUI A;  4FHJ A;  3CGH A;  1LF8 A;  4FLB A;  3S7B A;  4F53 A;  4GYO A;  5J90 A;  1UJK A;  4BX9 A;  3KAE A;  4N3B A;  2X6F A;  3MA5 A;  2J49 A;  2X38 A;  4FA6 A;  3KEZ A;  3O4Z A;  4DPR A;  4KVO A;  3HVE A;  2WXR A;  3L17 A;  2VGY A;  5HQ8 A;  5ENN A;  3UT7 A;  3PZD A;  3FH8 A;  4EZJ A;  3EDT B;  5ANR A;  4BT8 A;  3N71 A;  3HYM B;  3QNK A;  4FUL A;  5BT1 A;  4FP7 A;  3U4T A;  1H6K A;  4WWO A;  4HOT A;  3MKQ B;  4I6E A;  2XHE A;  3FTS A;  4A3V A;  3PVL A;  3GW4 A;  3CQC B;  4I6G A;  2MOW A;  2YQ8 A;  1E96 B;  4L7T A;  3LXU X;  4JXT A;  3ZGQ A;  4MS6 A;  4XIF A;  3AS5 A;  3TG5 A;  1HF8 A;  4MLP A;  4PS8 A;  5G2N A;  4XX5 A;  4JHR A;  4V3I A;  2CFZ A;  2WB2 A;  3FUN A;  3I5P A;  3QC1 A;  4UI9 K;  3FUE A;  1HS6 A;  1H2T C;  3KD7 A;  4ATG A;  5JJ6 A;  3FTZ A;  1ZU2 A;  3MCX A;  3MX3 A;  2V8S E;  3B7T A;  4K0R A;  3UQ3 A;  1UG3 A;  4RG6 A;  1IYG A;  4DK5 A;  5LP0 A;  2I6H A;  5HI7 A;  4HFG A;  1JUQ A;  2LAH A;  4WNE A;  5LX8 A;  1N54 A;  1SZ9 A;  2WMO A;  4GA2 A;  3ZFW A;  2LSV A;  3B7R L;  4A3T A;  3U9W A;  3FUI A;  4TUU A;  3MKQ A;  4MRU A;  2ION A;  3FUK A;  2LO6 A;  2HR2 A;  3CEQ A;  4DI3 A;  4WWN A;  4HOR A;  4GA1 A;  3CVU A;  1DVP A;  3I4R B;  3LY7 A;  4U8H A;  4KZC A;  3L16 A;  2J09 A;  4NRH B;  4DJA A;  2VSO E;  1BPO A;  5FQ7 A;  5JHA A;  3CV0 A;  3ASD A;  3IV0 A;  1FCH A;  2VGX B;  2ILR A;  3Q5M A;  4UI9 J;  2E2E A;  5G05 J;  1TJF A;  4L1B A;  1E90 A;  3CHS A;  3K9I A;  4RVB A;  3CK8 A;  5E75 A;  5G04 C;  4ANX A;  5EX0 A;  3FUM A;  3CST A;  4BTA A;  3CSF A;  4KT6 B;  3KS2 A;  3ZW3 A;  1HE8 A;  4LCT A;  2IU1 A;  4APO A;  4PS3 A;  1UN8 A;  3HHM A;  4WUY A;  2V0P A;  2WXK A;  3EJN A;  2VJ8 A;  3MKR A;  4AV7 A;  2WQ6 A;  1ELR A;  3P2B A;  2UY1 B;  3RO2 A;  3ZPJ A;  4GZC A;  3CVY A;  3I4G A;  3APD A;  2VYI A;  2WXL A;  3FEX A;  4JEU A;  2XRY A;  3FUJ A;  3TG4 A;  2J07 A;  4PDX A;  3LEW A;  4R7L A;  5AYW D;  4J8E A;  2X6H A;  3CQG B;  5BPP A;  3AS8 A;  4LRZ A;  5DIZ A;  3ZHE B;  2VGX A;  5J08 A;  2WQH A;  2HYZ A;  5FWQ A;  2HM8 A;  3EHM A;  5E76 A;  3CK9 A;  2BUG A;  2OVB A;  2OND A;  4U0Z A;  3B13 A;  4BWR A;  5FQ8 A;  2XCC A;  2J9Q A;  4UQY A;  3FDH A;  4IUL A;  3LPZ A;  4U0S A;  4CT4 A;  4UWG A;  3CVW A;  4TRQ A;  3TAX A;  3RKV A;  3LS8 A;  1X5B A;  2YHC A;  3PH0 C;  2UY1 A;  3Q49 B;  1JWF A;  1HX8 A;  4JC8 A;  4I9E A;  3NF1 A;  3MYV A;  3PS6 A;  3FTX A;  3TJP A;  3APF A;  3ZEF A;  3PE4 A;  4EQF A;  1OWM A;  1OUV A;  3G2W A;  3IKO B;  3ZHE A;  4CDN A;  4AY5 A;  5BV0 A;  2NSZ A;  1N52 A;  2WXP A;  3ASH A;  4W9R A;  4J6I A;  4CGV A;  5A23 A;  3CVV A;  2FF4 A;  4PUC A;  4LEU A;  4O6F A;  1EPU A;  2IOS A;  4B8C B;  4FJZ A;  3T5V A;  4EBA A;  5JHB A;  4I17 A;  2BF0 X;  4L23 A;  2LSU A;  3Q15 A;  2L9B A;  2XPY A;  3PRZ A;  1TEZ A;  1Z3Y A;  4XKC A;  3ZYK A;  3JQ1 A;  3IHV A;  4E85 A;  1P5Q A;  1NA0 A;  2QY7 A;  1E8Y A;  3G2V A;  4A55 A;  3ZVV A;  3VLF A;  4LER A;  3BEE A;  3QKY A;  2DIW A;  2I9C A;  4I2Z A;  1HG5 A;  5A6C A;  4ANU A;  3PUJ A;  5DBK A;  5LFA A;  4M3O A;  2WM9 A;  4JHK A;  1UW4 B;  1ZBP A;  2AXZ A;  2VQ2 A;  3CVL A;  3B7U X;  2GGF A;  5FZS A;  3SHF A;  5FZR A;  5KJM A;  2DBA A;  4HOU A;  4CDM A;  3GYZ A;  3D9L A;  3FU3 A;  4HS2 A;  3ZXS A;  3QB2 A;  1NA3 A;  3TXN A;  4URK A;  2KC7 A;  4P29 A;  2FEZ A;  4F1S A;  2VTB B;  4GCO A;  4WAF A;  3R7Q A;  4ACK A;  4HOQ A;  5FQ4 A;  5AJL A;  2KM4 A;  2X6I A;  4Q94 A;  1IHG A;  3G2T A;  4G26 A;  3TXM A;  4AP2 A;  4BFR A;  3VLE A;  4N2Q A;  1DNP A;  3AU5 A;  4AM9 A;  2WXJ A;  2A5U A;  3GZ1 A;  4G23 A;  2R5S A;  4I1O B;  1XNF A;  5FJY A;  1UJJ A;  4JHJ A;  2GRM A;  4AY6 A;  3CVP A;  3FH7 A;  3ONK A;  1WY6 A;  2XEV A;  3LDZ A;  4OVU A;  4AJW A;  2IQC A;  3EIJ A;  2XGS A;  3FUD A;  4JA7 A;  4HOS A;  3IEG A;  5T4Y A;  5AEN A;  5G04 J;  4XI9 A;  2XPZ A;  2WQ7 A;  1HG2 A;  2C0M A;  1QNF A;  3UUX A;  3NQP A;  4EZK A;  5EDS A;  4ILH B;  4JW1 A;  3T8M A;  3S2A A;  1Z3X A;  3ASG A;  3QAR A;  2VTB A;  2P58 C;  3E4B A;  4CCA A;  2CHX A;  4N39 A;  4HLE A;  3ZYQ A;  4N2S A;  4FJY A;  4WNF A;  4XZ4 A;  1NP7 A;  4JA9 A;  5C2Y A;  2YIN A;  4GML A;  3RU0 A;  4U07 A;  3IHY A;  5T8I A;  1KT1 A;  2M63 A;  5EX3 A;  3ONL A;  3APC A;  3ZYL A;  4Q69 A;  5BNW A;  5CHE E;  3PNT B;  2J4D A;  3CKB A;  1FVF A;  3JCK C;  3MZL B;  3PUK A;  2JEK A;  3NZU A;  2GW1 A;  3CVQ A;  1E8X A;  5A7D B;  4I6J A;  4U63 A;  3CHQ A;  2KAT A;  3QWV A;  4L2Y A;  3L08 A;  4JEH A;  4XE0 A;  4H7X A;  2I1J A;  2HO1 A;  5FQ6 A;  2AWI A;  3UMV A;  2XCB A;  2WXQ A;  3B7S A;  3MV2 B;  3DPD A;  2ZU6 B;  3SD5 A;  5C1D A;  2PQN A;  2IFU A;  4CT0 A;  1OWL A;  2Y4U A;  3LY8 A;  3LYA A;  4B89 A;  3QOU A;  5G55 A;  2XGO A;  4GMJ A;  3RIB A;  1HFA A;  4CEM A;  3LVR E;  4U0U A;  1ELW A;  3CR3 A;  3ZIM A;  2PM6 A;  3FUL A;  3JYS A;  2KCL A;  3AU4 A;  3L13 A;  5D0O D;  2XPI A;  3RRN B;  3ZRH A;  2Q7F A;  4U04 A;  5LCW C;  4HXI A;  3ZYM A;  2PZI A;  4UI9 C;  4ABN A;  5JJ7 A;  5M72 A;  3UT4 A;  5KJK A;  3FU0 A;  1L5J A;  3ESK A;  3PRE A;  2R59 A;  5KJN A;  2WMN A;  4AVX A;  2KZT B;  2IJG X;  2KCK A;  3FY4 A;  4J8F A;  3TGO A;  4WWP A;  4I9C A;  1B89 A;  1H2U A;  4Q96 A;  2DCP A;  5BUZ A;  4H7Y A;  1U3C A;  3LCA A;  2FO7 A;  2MRI A;  3FUH A;  4B94 A;  4BY6 A;  4I2W A;  4GZ3 A;  5CMY A;  5AJD A;  1E7U A;  2WVI A;  4APF A;  2L0I A;  3IBE A;  3U64 A;  3SBS A;  4G25 A;  2XGM A;  5BW8 C;  3PEU B;  4GA0 A;  2V4L A;  3LVQ E;  1W3B A;  4KXK B;  3FFL A;  5ARF A;  1HU3 A;  3LY9 A;  2WPV A;  4UWH A;  3VTY A;  4CRW A;  2R17 C;  2RD0 A;  3BG0 B;  5KJL A;  1WAO 1;  1NZN A;  1YA0 A;  1JWG A;  3ASF A;  3CK7 A;  4MKT A;  3FP3 A;  2KZT A;  1SQM A;  4FHK A;  3D3M A;  4I1A A;  4EEC A;  4L2L A;  1EYH A;  3G2U A;  2XRZ A;  3HDX A;  4J8S A;  3FTY A;  3JQ0 A;  5ANL A;  3WXX A;  2AW6 A;  3FTV A;  4GZ5 A;  3I3N A;  5T3R A;  1EF1 C;  4DI4 A;  1OWP A;  3PE3 A;  2YHE A;  5CCM A;  4KZ0 A;  4N3C A;  1PY1 A;  4UQZ A;  2I2O A;  3EHN A;  2A4Z A;  3FEY A;  1IQR A;  2X6K A;  1INZ A;  3RO3 A;  1MHQ A;  4G2V A;  3CLJ A;  2CHZ A;  2VSY A;  3OXL A;  4N3A A;  4YND A;  2CG3 A;  2OV8 A;  1QZ2 A;  1E8Z A;  4FLH A;  3D9I A;  1PC2 A;  2AXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...