2YINC

Structure of the complex between dock2 and rac1.
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
180
structure length
180
Chain Sequence
QGTMQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEDICATOR OF CYTOKINESIS PROTEIN 2
publication title Multiple Factors Confer Specific Cdc42 and Rac Protein Activation by Dedicator of Cytokinesis (Dock) Nucleotide Exchange Factors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 55
structure length 180
sequence length 180
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2yinC00
1YZKA 3L0OA 4OHWA 2XTMA 4A0RA 4EPVA 4LDJA 3SE0A 1G64A 2IYYA 2PEZA 3MFYA 3VKHA 1NMYA 5UKDA 3SHFA 421PA 1EFHA 1GITA 1GKYA 1SULA 1YR8A 2WWXA 1G5TA 4HDOB 4B44A 1F2UB 3T1OA 3QBVA 3X1XA 4A0FA 2IF2A 2JASA 4KLZA 1W2HA 1HTWA 3IHWA 1X3SA 2HJGA 2D7DA 4Q03A 4AKEA 3R9WA 1I4DD 1KMHA 4LYJA 4NP6A 3P4XA 4PC7A 2AK3A 2ORWA 4HB0A 3REGA 3W3ZB 2C77A 3THOA 2H16A 3C7KA 3NBZC 1NLYA 2P3SA 2CHQA 3GLIA 1AS2A 1UDXA 3AKEA 3CO5A 4NCJA 2ODEA 3RRNA 1XTIA 4H1UA 4DSNA 4IDPA 4NU0A 1MABB 4ZCMA 2YKGA 4RZUA 1P5ZB 5FBWB 3TR0A 1PVOA 1YRAA 3EC2A 1W0KA 4ACBA 3LW8A 1D6JA 1NVWQ 3B60A 5BN4A 1Z6TA 4TLDA 3V4FA 3OEHA 1SXJB 3VNUA 1XJ0A 4DDTA 3QF7A 1Z8FA 1ZU5A 1N6KA 3T5GA 3OF5A 3W6PA 1BIFA 3LLUA 3P20A 3I32A 4PQFA 5C4MA 1FMJA 2BEJA 4KI0A 4PFSA 3TH5A 3F3YA 1S9HA 2IYSA 2JJ2D 2B6HA 3LDAA 4DCVA 2X77A 5JRZA 1QG4A 2VP6A 5H68A 4BQSA 1N6IA 2Q21A 3JVVA 1HH4A 4WZBE 1G20E 5AWFC 5KPJA 3RYTC 2D74A 1GWNA 3WYGA 1CS4C 1E2GA 4AYXA 3QXCA 5HE9A 2ZRDA 3DEFA 5EXXA 2QG6A 3MCAA 5CITA 2ZSBA 2HEIA 5D3QA 2QORA 1N5LA 1CTQA 2A30A 1C4OA 1SXJE 2BVNA 1YZTA 2LCFA 1G8PA 2RKOA 2I3BA 2YJTD 3CUEF 3NH9A 4DB2A 4Q18A 5AUNB 2QSYA 3IILA 3EIEA 1OIXA 3I5YA 2J7KA 2ZR7A 4W5HA 2ZSEA 1ZYUA 2JLRA 4EQ6B 2PLRA 3DZDA 1II8B 4JZKA 1ZVQA 4JJZA 4W9MC 1HY3A 1LB1B 2CLDX 3OEED 3B6EA 3I5XA 2UZIR 1XEXB 4MRSA 3SU8A 3QXJA 1CRPA 4IOKA 2O8FA 5ELXA 2YC4C 4PHFA 1UEJA 1P75A 3A6PC 2D4HA 2QMEA 3MAAC 2BCGY 1XMJA 5BWMA 4Q02A 3CR7A 1R8SA 4A15A 2IL1A 1YKSA 2ZUBA 3WMEA 1GL7A 1SVOA 4KAXA 2F1RA 1JQJC 2ZYWX 5IT5A 1J90A 2ONJA 1ELOA 4V0NA 1W5SA 4X8HA 1J99A 5FOUA 5FOTA 4LBVA 5TXGA 3ZIAA 1VYVA 2QQ0A 5J5CA 2J0UA 1E0JA 3CZPA 1Q1EA 4FWIB 1LW7A 2XZLA 2FSFA 1E2KA 4Q47A 3NDBB 2GKSA 3GLGA 4MGYR 4TYPA 1OFHA 1ZJ6A 3A1UA 2HT6A 1F5NA 1E98A 2ZI6A 5HTKA 3TMKA 4ABYA 2JGNA 1VPLA 1LF5A 5CB8A 2ZM5A 4LJ8A 3PEUA 3GLHB 2F3RA 2ZUCA 2QRNA 4QNMA 1Z0IA 5F9HA 1XU4A 4BUJA 2ODBA 2OLKA 5SZIA 1OIVA 3EZ9A 3L8ZA 1XEWX 1E9SA 4E07A 1S0UA 1ETUA 5BN5A 4FMCB 4PZZA 2OBLA 4BLRA 1AKEA 5BW8A 2C04A 3C5HA 4MRNA 4F4IA 3EZ2A 5TV2A 3T34A 1TL7C 4C0LA 1IHUA 1FL9A 1L2TA 3PCRB 2YV5A 1KK3A 3M4YA 4M1TA 1DO2A 2BBSA 5HPYB 2GETA 4C7OB 2ZUDA 3LRPA 3GLFB 1KGDA 1XJCA 2OV2A 5EZ5A 4BWYA 4XTCS 3EC1A 4AIIA 2ZXUA 3G82C 3GLHE 4V03A 2CE2X 2C95A 1JR6A 1M34E 1TQ4A 2JDIA 3IKJA 4XJXA 4DBLC 2GF0A 2V1XA 1KK2A 4EDHA 3KQKA 1CJKC 2GJKA 4FD2A 2IHYA 1RRFA 3QKSA 4TSFA 3SC3A 4ZDJA 1CEEA 3DKPA 1T5IA 4LHVA 4DSOA 4DIEA 4C0BA 4A4DA 2DCUA 4MKGA 5FFMA 2NTYC 3TAUA 3KTAB 4NCIA 3GFOA 1RFLA 4B75A 4ZV4A 2IA5A 2WV9A 3THYA 4V0LA 4ZIRB 3GLFE 2QM7A 1E4YA 2OLJA 4LJ6A 4W7SA 1EWRA 1G7TA 3JZAA 4NCHA 5CJ2A 1BS1A 2PX0A 5DIFA 4CIDA 1X86B 3DOFA 4RSGA 2PH1A 1DTSA 2CNWA 5DISB 1OIWA 4HZIA 1YVDA 1NF3A 4DKXA 3BOSA 3CRQA 1CR2A 4DLXA 1L7VC 3O8CA 5AJWA 3AF2A 5CB6A 2O52A 4LX0A 4WXRA 2V4ZA 4QNRA 3GMTA 4LPSA 2ZRMA 1OPXA 1R4AA 4F4CA 1AQYA 5JHHB 1UAAA 5B2ZA 2WVJA 5G3YA 1EG7A 1W48A 4DUGD 4B3FX 3KJHA 3SJBA 2RGGA 4Q1AA 4AI6A 1R0YA 4HB3A 2F43B 3RC8A 3WY9A 2GXAA 4OQFA 5A0FA 4GI7A 2IYZA 1XF9A 1E2JA 3FGNA 1ZUIA 1E9FA 4Z8YA 1E2MA 1FUUA 1B23P 4PO9A 4D81A 4ZCLA 2K5UA 2RGXA 1W36C 4FN5A 3AVQA 2ZE5A 1AQUA 1XD2B 2VYFA 4Q9IA 4YLGA 1D8TA 3BGWA 1H65A 3MUFA 4C2TA 1KNQA 1Z0FA 3NBXX 4NONA 2YC2C 3B78A 3ZLJA 2GTPA 2W6JA 4M53A 1OFUX 2DFNA 4NMMA 2XTNA 3FTQA 3GJ0A 1UEIA 1WCV1 4HATA 2F1HA 1GDDA 2F3TA 4GDFA 3SHWA 4UNRA 2J3EA 2CXXA 1KIMA 1NBMD 1ZD8A 4AWXA 4JT4A 1NMZA 1E32A 2ZS9A 4PAMA 2OBMA 1TPZA 2GCOA 2XZPA 5GJVC 4BLQA 2BMDA 4GMDA 5P21A 5CIWA 2I4IA 2CK3A 3VR6A 2R65A 1MO3A 2VSOA 3IGFA 2VO1A 1YQTA 1VG9B 1HEIA 2REOA 4CVNA 5CK4A 4O2LA 4LJYA 3CF6R 4KYIB 3W34A 2RHDA 4Q7LA 2V6IA 4NKRA 4F38A 5AJYA 2YWFA 2G1KA 4ON9A 4WBSA 2WIAA 3EPHA 2EW1A 1XPUA 1CJMA 2ANCA 4RD2A 1XJQA 1OH5A 3QXSA 2IS4A 4C9BA 4ASUD 4CEHB 3DPUA 1RYFA 4RKEA 1ZINA 1J2JA 2LKDA 4HUTA 2OUKA 2OCYC 4NYJR 4PC2A 4E03A 5FR1A 1SXJC 2AD5A 3OE7D 4B3XA 3THXB 3UWOA 1G7SA 4DEXA 3LLMA 1BH2A 2IUSA 5F98A 3D6TB 2KSQA 4ZCIA 1N6LA 3A1SA 1NIPA 5HCIA 3A1WA 3E70C 4G5GA 1E3MA 3AVPA 1Z29A 2R8RA 4Q4JA 1Z3IX 4BEJA 2J0SA 1TX4B 3K0AA 1Q3HA 2JEOA 4JVLA 4TLAA 3QKTA 3RWMB 3QBTA 1YE8A 2X1VA 3AGQA 2JLQA 3LBIA 1F2TA 3KX2A 2ZRKA 2QAGA 4A8JB 4G5QA 4EUNA 1E2LA 1Q44A 4HDQB 3QSYA 4HI0E 3BJIC 1GKIA 4EAQA 2O8EA 2BM0A 5FI1B 1MR3F 3QENA 5KDOA 3QKUA 1OH8A 4L9SA 3QEJA 4RFSA 5HR5A 1GP2A 2OZEA 3D31A 1M7BA 2BKUA 4NYMR 4OHXA 1YZGA 4YMUA 3AF0A 4NH0A 1DE0A 5JCZA 4EJSA 3HYTA 3BORA 3FKQA 4ACAA 4P4UA 2HDNB 4OK6A 1OXXK 1U98A 2FJUA 2OILA 1W2GA 2AWNA 1CJTC 5J4LA 1X1SA 3B1XA 3HWSA 3P32A 2QSZA 5G3ZA 4MUBA 4Q01A 4TLCA 5BN3A 1PV4A 2R6GA 2JJ2A 3O47A 1YR7A 1QDEA 4NZYA 1VCIA 3GJ4A 2ZYTX 2ZROA 1K6MA 2FEMA 3LQQA 3KKOA 1VYTA 2IUTA 4EFMA 2GF9A 2HYIC 4LJ9A 1NJFA 4DSTA 2C5LA 5J4KA 2FZ4A 3NTUA 3W3AA 4LY6A 2EFHB 4PSVA 5DSZA 2O8DA 2WJHA 3IEUA 2FH5B 4LYAA 4QC2A 4FMCF 4KFUA 4I4LA 4DLYA 3GFTA 1E9RA 1M8PA 4Q4AB 3B85A 1U9IA 2HXYA 4LHYA 4QJ5A 4N3NA 1CR4A 4YMTA 1WRBA 5AUPB 5EP3A 1W1WA 2CVHA 3BH0A 2H17A 2IYQA 5KNDA 2V55B 5FOXA 3ZD6A 4ZO4A 3OEEA 3WMFA 4UJ3A 2ZRJA 1QHNA 4MDEA 2VSXA 1YR9A 1IBRA 2ZU0C 3A4LA 3Q72A 3DL0A 4HB2A 1VTKA 2Q9AA 4PXAA 4LBYA 3RS0A 2HXSA 5GADl 2XB4A 5DE3A 4JLOA 3TIFA 1OFTA 2DHRA 2VA8A 4OL0A 2GJ8A 2O5VA 1XXHB 3RC3A 1KNXA 1YU9A 1NL3A 5BYKA 3RLFA 2NQ2C 3BB3A 2BC9A 1ZM2A 2CMKA 2P67A 3SQWA 3KXIA 2BMJA 1CJVC 1N0UA 1DS6A 3BC1A 4WAUA 2PL3A 3VR5A 2ZSAA 5TY0A 2BKEA 5GVSA 1U0LA 3A4MA 4Q7MB 3HJNA 4TZ0A 1JPNA 1RC8A 5L3QA 3A1TA 3NVAA 1P4SA 4YC7A 3BFXA 3PITA 5JCPA 1E2EA 3F5FA 1US8B 4P4SB 1LVGA 2W2XA 1LFDB 1T3LA 5BQ5A 1IN8A 1Z2CA 3O8DA 4OQNA 1J8YF 1IAQA 4LOAA 4OKSA 1DAGA 3F8TA 5EUMA 3AM1A 1QF9A 4D25A 1KI2A 2YVUA 4IFBA 4BEBA 1B0UA 3CX8A 4P3YA 1EX6A 5FPKA 2XX3A 3OIYA 3BH7A 3THWB 1IM2A 4QKQA 1I4LD 4PZYA 1VCMA 1G5RA 4HAYA 4Q9HA 4CDGA 3U4QA 4M1WA 1V5WA 2IEZA 2WWIA 1TADA 2FX3A 4FINA 3VQTA 4C0HA 1G18A 3PUWA 4DLZA 3G0HA 4OJKA 2FDCA 3TGPA 1MRSA 2ZRHA 4KSBA 2IXEA 1KI6B 2CVFA 3KKMA 2NO6A 1W49A 4HLDA 2ZI3A 3QJYA 3N70A 3QVVA 5KO2A 2NO9A 3BXZA 3U7HB 2ERXA 4A9AA 3WBKA 2QPTA 1KDOA 2AD1A 4BZQA 4OJQA 4BZPA 4B48A 5L3VA 2GCPA 1IJEA 2BCJQ 3SS8A 2WOJA 2NOAA 4JLAA 1G8HA 5H70A 3EARA 2J1LA 3IHLA 1C9KA 3AVOA 2ZSFA 4U7DA 1A7JA 2KWIA 3AF4A 2A7QA 6Q21A 3CBQA 5HZKA 1KK1A 5FUYA 3CNOA 121PA 2QT1A 1F2UA 2WJJA 1RPZA 1HURA 4Q5IA 4X8MA 1GZSA 4B74A 1I2MA 3F0TA 3JZMA 2AK2A 1T0JB 4G01B 2WWYA 4L4UA 1E9CA 4QJ4A 1E1RD 3LWNA 1KI1A 1GM5A 1CKEA 5C2JB 1Q57A 1EFCA 1XX6A 3TBKA 4CW7A 3KFVA 2W2TA 3CM0A 3LNCA 1T91A 2JIZD 2G77B 4KFTA 3ZVMA 2FA9A 4XTRA 4B6FA 4H9GA 3U60B 1DPFA 2F7SA 4XWAA 4DB4A 4LPKA 3K70B 4WZAE 1MOZA 1PZNA 4KITB 1DAFA 4CEIB 2RHMA 4DUGA 1EK0A 1RZ3A 3N2EA 1DEKA 1MABA 4Q9LA 3BAFA 4B3CA 4IEEA 4URXR 1G41A 4KJZA 1MKYA 3QOFA 4D0NA 2ZYUX 4BRWA 1TF7A 1Q1QA 5KU1A 4TYWA 1E99A 4M22A 3WP0A 1Z0JA 5M04A 2WKQA 4TMZA 4KU4A 2PT5A 3SJCA 3PR1A 3TUJC 2EFCB 2VEDA 3CNNA 3VAAA 3HU3A 1ZBDA 2ASEA 2IXGA 3QXHA 2MSEB 4I1OA 1SHZA 4Q4HB 4R2IA 3BERA 2CCJA 2DPXA 2PX3A 2QP3A 4C30A 3TSOA 5FBLB 3KXLA 4LK2A 4PHGA 5H1YA 1SVSA 3RRYA 5KTYA 4Q9JA 1CRQA 2VHJA 4LCBA 5IF9A 2R2AA 4CGZA 3AP1A 5FI0B 3UMFA 2QENA 2ZJAA 3KXKA 2EYUA 2QEQA 4BZXA 2YINC 1TQDA 2KBFA 2FMXA 3CWZA 4DLUA 4Q9KA 4ZI2A 3C16C 2XB2A 2WHXA 2YNMA 2FGKA 2HCJB 1E1QD 3ONWA 5KYKA 1N3BA 5L3RA 5KHOC 1RW4A 3U61B 3KKNA 3T06B 5IDVA 4B2PA 3R9XA 4O0MA 1VKJA 4WA7A 3CX7A 1A2KC 1RRCA 4EQ6A 1QRAA 2ERYA 5DLQC 1IOZA 1S1MA 2PZGA 4ARZA 2J41A 4GFDA 5JS7A 4PTLA 2NZJA 5SZHB 3K1JA 1JR3E 1XEXA 2GEDA 3SDZA 4DZZA 5H8WA 3H2YA 3NHBA 4A8JC 4KXFB 3QNUA 4RD0A 1LS1A 4ZKDA 3KB2A 4CEJA 5FH9A 721PA 3KJEA 3HDTA 1GNRA 3BH6A 5HCNA 2W0MA 3RS7A 3RRMA 3QG5A 3VU9B 5JMTA 3Q8XB 3O8RA 3EPLA 4ASUA 1UPTA 2QN6A 2Q9CA 1R0XA 5D3MB 3HU2A 1XTQA 2FFBA 1KO5A 3GEEA 3K09C 1D9ZA 4DDUA 1T3HA 1ZUHA 3UATA 1N6PA 5G41A 3REFA 3T12A 1N2CE 4DEYA 1GSIA 1SHKA 3TK1A 1Z08A 3OE7A 2YOGA 4KBGA 2HYDA 4ESVA 5DYIA 3BRWD 4HAUA 3K0CC 1CULC 4QHTA 4DT1B 1XPRA 1KJWA 3FMPB 2ECKA 3M6AA 1ZW6A 2JLWA 3X1WA 4R98A 2KJQA 4PO1A 1OT3A 1BYUA 3AGPA 4JS0A 1WB9A 2RGEA 2VPPA 3QF4B 2OBNA 2Q6TA 2BMEA 5J40A 1RIFA 5AJVB 4MKFA 3KL4A 2UZ3A 3TAHA 3P26A 2IBMA 3R9IA 1X8LA 1E2PA 3SBDA 2RCNA 2FG5A 2PMDA 2ZAMA 1Q3TA 2KB0A 3QIAA 4QJ3A 8OHMA 1RE0A 1HT1E 2CL6X 3H4MA 1QVRA 3TW8B 2QRZA 3C8UA 5E3HA 3PUYA 1CR1A 3R7WB 4C0AC 2D2EA 1TUEA 4KVGA 3TR5A 4D4LA 3QKRA 1NG1A 3W6NA 1DELA 2H92A 3AKCA 3PIRA 4Q1DA 4C7OA 2BMFA 4HLUA 3SBEA 2O8BA 1ANKA 1AIPA 5JEEA 4GBMA 5EP4A 1P72A 1TUIA 2PJZA 2V8OA 3BWDD 3RNLA 4GRAA 2C2HA 3QXXA 3MWYW 4AYTA 4O3MA 5FL7D 2NO0A 2RGAA 4U5XA 4AURA 4M4SA 4W5JA 3AKYA 1DG3A 3PJRA 1N0VC 2AL7A 2GILA 1QG2A 2IS2A 3MMPA 3EXAA 4JYBA 3B2EA 2D7CA 3EWSA 3ASYA 3TVDA 3LBNA 1ZCAA 1P9WA 1YZUA 3DHWC 2WKPA 4URWR 3KTAA 5CM9C 4D4KA 4URVR 4XD7D 2ZJ2A 3NWJA 1OSNA 4DCSA 1QHGA 1QHHB 2ATXA 3GFPA 3AVUA 4B34A 1ZD1A 2RGDA 1XZQA 1X1RA 4QGAA 2C98A 1WF3A 4FW9A 4RD4A 3VFDA 2B8TA 821PA 3EW9A 3IBYA 1KTVA 2GXSA 4D6PA 1NNEA 3UXMA 1IJFA 1E69A 5JI2E 2GBLA 3K9LA 3KDSE 2CL7X 3ASZA 5FTNA 1P60A 1VCNA 1OW3B 2H57A 4L15A 3OIVA 4XSHA 5EXTA 3WMGA 5J4HA 1UFQA 3K9HA 4KFSA 1KI3A 3E5HA 4L8GA 4Q1FA 4B3DA 2WM9B 1N0WA 1YR6A 4IHQA 3U2QA 4RJLA 1G8GA 2GVZC 4M9XA 4PC3A 4BLPA 1AM4D 1IY2A 3LBHA 2DFKB 2ZS8A 4MRPA 2QP9X 1VIAA 621PA 4QBGB 3IO3A 3BK7A 4K46A 2G3YA 2QY9A 1Z28A 1G3RA 3AEZA 4KBFA 2JLSA 1ZC3A 1UKYA 4MYUA 4A92A 2OCAA 1CXZA 3FE2A 1KI7A 4KODA 5JSZB 1T4GA 2LWIA 3SN6A 3ZH9B 4PANA 2J87A 1KMHB 2XZOA 3VX4A 5DO9A 2IWHA 1JXOA 2BJWA 1NLZA 4LUCA 5SZKB 4C0SA 5J47A 2GXQA 3FDIA 3U7FB 4KFRA 4MRVA 2JATA 3W8RA 2AFIE 4B43A 2W58A 3KJGA 3B5JA 1UKEA 4L16A 3SZRA 2H1LA 3NDPA 1AKYA 3GCGA 5E7JA 1G21E 3CF0A 4MUAA 2ANBA 2DFTA 5J4VA 2OSBA 1FP6A 3AQ4A 2IT1A 4DLTA 4NYIQ 1GNQA 5FTKA 3VX3A 2WAXA 3ICQB 5DI9A 1JI0A 1W36D 4M1SA 2F55A 1G3QA 4K8OA 4NL4H 3X1DA 2RGNA 1KKLA 5DHFA 1P9NA 2ZIAA 4GZLA 4ZDKA 2FV8A 1P2TA 3LW7A 3IIJA 3O8BA 4F93B 2VL7A 1OJLA 2EFDB 2WTUA 3FHCB 1AZSC 2MMCA 3BE4A 3T1QA 1SVIA 3L0SA 1T6NA 2Z43A 2PZFA 3U7GA 1DVRA 3WXMA 2GAAA 1G17A 1NP6A 3GLIE 1EFRD 2C9CA 2G6BA 5L3SA 1DADA 4II7A 1OHHD 1SKYE 4LZZA 4PAOA 1JJVA 1RJ9B 2AKAB 3TLXA 3K70C 4Q1EA 3LY5A 1NVVQ 3TE6A 4CEHA 2BOVA 1ZM7A 2N46A 1DAIA 2NPIA 4JSYA 4R9UC 4F91B 2P65A 4J0QA 5HKKD 3CONA 4A6XA 3K9GA 4IRUB 2NGRA 4CYMA 3DKVA 3S1AB 4N0DA 4WIAA 2ZTSA 3AF3A 3C41J 2XOKD 3GJ7A 3FB4A 3T1VA 4TL9A 3U3RA 1G1MA 4G1UC 2QI9C 4IVPA 5AUQA 5KDLA 2L0XA 1Z0AA 2BBOA 1KO4A 2HV8A 3T5DA 2JJ8A 4ZDIA 1P2UA 1E1RA 2HF9A 3CF2A 4MITA 2DB3A 2GVDC 2J0QA 2OM2A 2O8FB 2O0HA 1NY6A 3M0EA 1MO6A 3RSLA 1SVWA 2JIZA 4PPGA 4XWKA 4M1YA 2R44A 1SXJD 2X2FA 4DJTA 1NN1A 2ZI5A 2YWEA 2J5XA 4LV5B 4AG5A 4B76A 2P2LA 2F1IA 4B3GA 1X8JA 2VP9A 4PX9A 1T3SA 3MJHA 4BLSA 4OBEA 1NMXA 4OK3A 4N1AA 1E94E 5CDFA 2MMGA 1G6OA 4LJ5A 3EZ7A 3B8HA 3AUYA 3SJAA 3WRXC 5DHAA 1TF2A 2QPOA 4XIGS 5GVRA 1TAGA 3LQRA 4MA4A 2G0NA 1U99A 1UBGA 2ZEJA 4B33A 2J0UB 2OT3B 5DH9A 3WNBA 2OCPA 4G0NA 1T8TA 4XVRA 3QI2A 4QBFA 1DO0A 3I1FA 5EQTA 4KYUA 1E2HA 4M9ZA 4MYHA 3PXGA 3CW2A 3U3MA 4JKIA 3FOZA 1D5CA 2Q3MA 3WHLA 4RCYA 2CJWB 1XD8A 1L8QA 2A3RA 4QHYA 4OQXA 3PEYA 1JAHA 2WMOB 2XAUA 3VMFA 2ONKA 4YDHB 4YDSA 1E2NA 2X2EA 2QNRA 1ZU4A 2VF8A 1E1QA 2EQBA 2E9SA 1A5TA 2PBRA 4Q4AA 1GL6A 2XTZA 1E79D 1GRQA 2FNAA 4B47A 3CRMA 4QOSA 3EPKA 3X2SA 4JJKA 1FTNA 3KKPA 4QG7A 3GLGE 3CIOA 3B7GA 1M1YE 3W5JA 4HLCA 3SNHA 3PUVA 1XRJA 2BDTA 2REBA 1E4VA 4XVQA 4TYQA 2IYWA 1ZNZA 1NJGA 3SQXA 1P2SA 5FTLA 1XEWY 2WWFA 1XMVA 5CIQA 2IW3A 3QKSB 2X19A 2ZAOA 4DXAA 5EE0A 5JI3E 4GZMA 4BGDA 3B1ZA 4HDCA 5G40A 3KQNA 2VP5A 4RVCA 4UNSA 3QPUA 1ZCBA 1Z83A 4QGFA 2SHKA 3AVXA 3RANA 2VHQA 2ZI7A 5IRCD 1Z5ZA 3THYB 3FVQA 2JLZA 4Q00A 1OKKD 2ZJ8A 1QVAA 3L2OB 1U81A 5EXSA 4JL6A 4NDZA 3PUXA 2F6RA 2DYKA 1KDRA 4EPXA 2QQEA 1S3SA 2QAJA 4G5SA 1GIAA 4F92B 2D62A 1U0JA 2H18A 3K0SA 2WSSD 1UF9A 5CM8B 3GEHA 2WPDD 1UKVY 4RKFA 2P6UA 4JYCA 4LGMA 3JVUA 1M6NA 3N5CA 1W0JD 3ZVNA 1A1VA 2XSZD 3MJRA 2ZJ5A 2J7PD 5C4GB 3C14C 3I73A 4B2LA 3MG9A 1XTJA 4JT2A 2BV3A 4Q7JB 4QXAA 3AVYA 5J4YA 2FPLA 1LNZA 4BFZA 3UPUA 4PSAA 1LF0A 2AXNA 1BMFD 3A4NA 2QPAA 1EX7A 2P6RA 4M8NE 4EPRA 3LXXA 2D06A 4CRWB 4BECA 4CF7A 1FPMA 2VRWA 4GMXA 4HUQA 3W9YA 3EX7C 1HV8A 4KSCA 2EYQA 1DAHA 5FOSA 3KQHA 3B1VA 2WJIA 4WW0A 1XMSA 2FPMA 3U5ZB 2AWOA 4A2QA 5FL7A 3RHFA 1BYIA 1DBSA 3NIBA 5KSYA 4EPWA 3OZXA 2OESA 3ZGXA 1II9A 1IN7A 1ZRHA 2R6DA 4TTQA 2JJ1D 3ZVRA 4OI4A 1GAJA 4B73A 4LBZA 2VHUA 5EE9A 2GCOB 4XD7A 2YHSA 2ZVQX 5FR2A 3UANA 2H8KA 5TVKA 4US2R 4TYYA 4TMWA 4OK5A 2LKCA 1E0SA 5KSOA 3EAQA 5JBQA 4DLRA 2GWHA 2GESA 3IQXA 2PLFA 2OFOA 3ZD7A 1YRBA 2JLVA 4IKEA 4HZUB 1ZIPA 4I1VA 3LX8A 2IWRA 1TU4A 2I1VB 5HE8A 2CL0X 4NCKA 1GNPA 2JLXA 4RZ3A 1RKBA 1S2MA 3RAPR 2V1UA 1G8FA 4JVSB 4CEIA 1XWIA 5EJEA 3Q9LA 3PUZA 3QPWA 3EA0A 5SZJA 1XCPA 4C0QC 3CNLA 1A2BA 3IIKA 4MYTA 1G3IA 2JLYA 3OESA 1M7GA 2F9MA 4GP6A 2HLDD 1UBEA 1KOFA 1JEDA 4CT4B 3RS3A 2PEYA 3NHAA 1R0ZA 2QMOA 4US0R 4OI2A 1FOEB 1Z6GA 2H5EA 2IF0A 4Q4HA 3FHTA 1H8HD 3TVTA 1G4UR 5BXQC 4Q7KA 2QAGB 2Z4SA 3BFVA 3DMNA 1VHTA 1SVMA 2JCSA 4P32A 4RZXA 2W2VA 4DLSA 1HQYE 3T1TA 4MKIA 2ZE7A 2O8EB 2FGJA 3UG6A 3NC0C 1SGWA 1X6VA 3MGCA 1KJZA 4DCNA 2W83A 5KOYA 1XDBA 2QE7D 2CLSA 2AX4A 3GD7A 1HT2E 1KI4A 1E9BA 3VR4A 2FEOA 3OFND 3TKLA 5C18A 3U3OA 2AHOA 1YZQA 3WBJA 2C03A 3LVQE 1AGPA 2AFHE 2XJ4A 4KV9A 2QBYA 4OHYA 4D4MA 4JVMA 3NBYC 4R2HA 1R5OA 2O8CA 1YJ5A 1TEVA 4Q21A 5JRJA 4H1VA 4FIDA 1OFIA 3L0IB 4DDWA 2BBTA 1TTTA 5LBIA 4DWJA 2J46A 1EFRA 1IXZA 4HLQB 2QM8A 1OHHA 4L5BA 2ZRPA 1IN5A 4MGIR 1QBKC 1F60A 1FX0B 2B92A 1MV5A 3K0EA 4DHEA 2O8DB 5D3MA 2ORIA 2V54A 4M21A 1AS0A 1D2EA 3UKDA 1FFHA 4JL8A 3AP3A 4IJMA 5HKKA 5E7MA 1NSFA 1KZ7B 3OIUA 3QQ5A 4B6EA 2NIPA 1E9DA 2XJ9A 1F3OA 4HAXA 3B9QA 2D2FA 4FCTA 2XOKA 1EWQA 521PA 2WICA 2WMNB 2EVWX 1KY3A 2GCNA 1WP9A 3IPYA 4DT1A 3I61A 1GOTA 3MRSA 1KDPA 4AKGA 1YZNA 2ZI4A 2QUZA 2R62A 3R20A 4FCWA 3TQCA 3KZ1E 3I4LA 3R8CA 2EFGA 2PCLA 4LYHA 1R6BX 2OEPA 2VP0A 3AB3A 2QA5A 3FMFA 4TL7A 4A0HA 4LI0A 4D4JA 4D26A 1G16A 3ND9A 2GJAA 4TQAA 1LTQA 5FOWA 3PFIA 2HUPA 1NRJB 1SXJA 5A4JA 5FPTA 5IK2D 1CU1A 1JBKA 1GUAA 4JIMA 4BFTA 2BEKA 4CZ2A 4AK9A 5B57C 1Y63A 3DM5A 4JLDA 1KMQA 1Q22A 4YXWD 4A2WA 5DN6D 4RCZA 1CBUA 5CYOA 1LV7A 3I92A 4G3XA 4M9QA 1PUJA 5KSZA 4NYIR 3PVSA 3BIFA 4E5UA 2R6CA 2XNDD 3B13B 3HYRA 3VKWA 2OAP1 3CZQA 1GKUB 3RVBA 3PENA 3VR1A 4GL2A 2WJYA 2QROA 1N5IA 3BFKA 1NVXQ 1U0HC 1PUIA 1OB5A 5FTMA 1R5NA 3AH8A 4IFEA 1GL9B 1NBMA 4MYCA 4OYHA 1UDWA 1G19A 2IYXA 3W8NA 2DR3A 4EPYA 2FF7A 3SYKA 3UIEA 2VP2A 4TMTA 1BO6A 3CWQA 1TQ2A 4URUR 2ORVA 4TZ6A 1Z6YA 2FSHA 1P2VA 1II8A 3W5IA 2NO1A 3LA6A 3P27A 4UJ5A 3CH4B 1NVVR 3G5UA 3RSOA 3RWOA 4KCGA 3VHLB 1NN0A 2E87A 2B8WA 1QHHA 3U44B 3MWLA 4LJAA 4EIWA 2CE7A 3V4RA 4BASA 1ZNYA 3LFUA 1E79A 4LWZA 4IDNA 3EIQA 3ZS8A 1P73A 3MSXA 4P0TA 4TMXA 3BBPA 4RD1A 1FZQA 3IQWA 4CT5A 2QU8A 2GXUA 1VHLA 4AYWA 3I8XA 3CB4A 1P7CA 1RRPA 4A2PA 1AJEA 2HJVA 1W4BA 4XH9B 1TMKA 1M7HA 4Z1MD 3I62A 1ZNWA 1NI3A 5E95A 5KSPA 1IXSB 3A8TA 1NSTA 2AN9A 3TJZA 4ESHA 3OHMA 1W46A 4TQ9A 2ZSDA 2XXAB 3FYHA 4KLNA 2BBWA 3X1ZA 1G291 1A4RA 2GZHA 1SKQA 1OB2A 1XZPA 3NG1A 1PLJA 3H84A 2HT1A 1QHYA 4OHVA 2G1JA 1HA3A 3EASA 1W7AA 1DAKA 1F48A 2ODWA 1OKKA 5JSZA 4AKHA 3GEIA 4FXPA 3GLHA 5ANRB 3PEVA 2QMUA 3LX5A 3NC1C 3ZYCA 1TNDA 4HB4A 3SEAA 2V7QD 4FI3C 3HR8A 3NEJA 4HAWA 5EP2A 1KSFX 3KUDA 3BB1A 4RD3A 2DWPA 2QP4A 2OE2A 2WSSA 2J0VA 5EUQB 3SOPA 1Z2AA 2WPDA 2O0JA 1E2DA 2QMHA 1JQLB 3NXSA 1E9AA 2D3WA 2ZJYA 4LHWA 1VG8A 1W0JA 1WDTA 1XNJA 2FOLA 5DYGA 2XSZA 1GTVA 2GAOA 1KY2A 1YHNA 2J7PA 4PR0A 3GLFA 5B64A 2MSDB 3IIMA 1XTKA 1ZC4A 3LXRA 4QM7A 5KPDA 5L8VA 3PQCA 3D7MA 2NG1A 4JBXA 3W90A 1XMIA 2I1QA 3EA5A 1II0A 3OAAD 4JKYA 5JECA 3L82B 3FMIA 4QM6A 5AUOB 4F7WA 5KNCA 3QVUA 1BMFA 1BOFA 2DBYA 4PQRA 2AXPA 3FFBA 1I2DA 4IW3B 4DCUA 2F9LA 1AGRA 2ZANA 3K0FB 1C1YA 3V00A 2ZRIA 2IYUA 1OYWA 4UNPA 2DWOA 4GP7A 1RJ9A 3KQUA 2FU5C 1DAEA 1PLKA 4TLBA 3WYAA 3TW4A 1GVNB 4PSKA 4ZIRA 2DY1A 1O87A 5AJZA 2V3CC 2DWQA 2ZYVX 1M2OB 4B35A 4M1KA 4TLEA 2C8VA 2Z6VA 4B2IA 1GILA 1JXMA 2JJ1A 5DI3B 2RMKA 1JNYA 1Z06A 1E6CA 4YONB 2WIBA 2P0EA 2ZU6A 4QBIA 5CJPA 2AKYA 4O25A 2A5FA 2E1RA 4IVRA 4IOJA 2WZQA 1S96A 4ARZB 2W6ID 2NZ8A 3UWKA 2G9NA 5JHGB 4K81B 2GZAA 1Z22A 3K70D 1S4QA 2RH5A 2OXCA 2QAGC 3C5CA 1T9HA 5K8IA 1AA9A 4FMDB 1Q0UA 2F43A 4CEJB 1P3JA 2FFHA 4GT1A 4O2RA 5FBVB 4FMBB 2KE5A 3IPXA 2VBCA 3NBFA 3Q5DA 4PC6A 1M74A 2ZPTX 2ZRNA 3C15C 1A82A 1VDZA 1S3GA 1IN4A 4C0KA 1NBME 4I81A 1VECA 1JEEA 3ZVLA 4EJSC 3E2IA 4OQLA 2QTFA 4US1R 2FFQA 1OH6A 2YOHA 3DM9B 1G6HA 2PT7A 1XP8A 3E1SA 3ADBA 4I1SA 3LVRE 1G9XA 1XD2A 2A78A 4UNNA 4X8LA 3NKVA 1U8AA 1N6OA 3BS4A 4PHTA 2OAQ1 3MD0A 1JR3D 3WP1B 2GK7A 4S35A 2FSGA 2V6JA 1QHXA 1R5BA 221PA 5FBRB 3ZDQA 3TSWA 2HLDA 2Q3FA 1KSGA 4V02A 4E22A 3I8SA 1GFIA 3GLIB 3K53A 1P6XA 4TQUS 4JLBA 3DOEA 1SKYB 4P31A 2VH5R 5KUTA 1H8HA 5JLJA 4R7ZA 4FWTA 4EFNA 5K8TA 3AVVA 3MLEA 2CJWA 1ZNXA 2EWWA 4XSGA 3K8YA 2IXFA 4WVFA 2VSFA 3J81k 5BYJA 3TSZA 3HP1A 2AR7A 1OYYA 4D82A 2QE7A 1I4TD 1X8KA 1COWD 3KKQA 1U9IC 2C9YA 4X8OA 1MRNA 4LYFA 5FL3A 5G53C 1D9XA 2ZRAA 3U6BA 3QKRB 3LO5A 1Z07A 1ZD9A 3BB4A 3OFNA 2GHIA 4JLNA 1K5DA 3H1TA 5FUWA 1KAGA 1N25A 2O8BB 2BHRA 2BIFA 4PQYA 2XNSA 5JZVA 3EIHA 1J70A 1LS6A 2A2ZA 3PEWA 3IO5A 1KK0A 4PAQA 2ZQ5A 5FBQB 3SR0A 2A9KA 1E0AA 2B7CA 1FNNA 3SFZA 4N0EA 4HEJA 3SJZA 1W4RA 1AZTA 4F4JA 2QGNA 1ZMXA 2FPKA 3AV0B 5EE1A 2NO7A 2P6NA 3LD9A 4Q1CA 5JFGA 3THXA 2Q0HA 3ZQJA 2ZR0A 4MKHA 1G4AE 2WWWA 3FMOB 2WOOA 4A6PA 2FN4A 5B58C 1Z0KA 2ZJBA 1MH1A 1CLUA 1ZM9A 5B30A 4TT3D 2IC5A 4YMSA 1XTRA 2V9PA 3T61A 1Z6XA 4BPBA 4KHZA 2WSMA 1ZAKA 5K8LA 5KDDA 2NMVA 1JALA 1L4UA 2CHGA 2VIIA 2ZRLA 5AJXA 5C46F 4UKDA 2ATVA 1CIPA 3Q3JB 4A8JA 5FPSA 3EPJA 3CPHA 3L0PA 3P1JA 2OCBA 4IOLA 4TN1A 4V0MA 5E7IA 3RABA 4LHXA 2Y8EA 1G7RA 1J8MF 4JVNA 4AG6A 4PPNA 1E0KA 1VIYA 1KZGB 2VLIA 4LJ4A 3LV8A 1OLOA 1AK2A 2XITA 3QG1A 3UG7A 1HQCA 5GJBA 1S1CA 2GRJA 1KAOA 2R6FA 4Q48A 3WNCA 2GEUA 2OO7A 3AVWA 3TNFA 4TYNA 1HYQA 3K09A 3B1YA 4NTZA 3BD9A 3RS5A 4QHSA 3U6KA 3CRW1 2W00A 2WWHA 1UBFA 1Q1BA 4AC9A 3FKSD 4JBYA 5F9FA 5E4FA 2FFAA 2ZJZA 4M2LA 4NE2A 5IK2A 1KO7A 3VNVA 1BKDR 4W5WA 4OI1A 2ZRCA 3K0CA 1ODFA 2B21A 2ZRFA 5FOVA 5DGXA 3RDPA 1P62B 3SYLA 4RY2A 4YXWA 1U2RA 5DN6A 2RAPA 1TF5A 3GLGB 1XCMA 3AVTA 2WJGA 4XOIA 1XEFA 2J9RA 5JEDA 1DOAA 1T0HB 4AY2A 1U8ZA 2ZITA 4PC1A 4P4TA 5CLQA 2XNDA 2WAYA 3UMSA 2A5DA 4I99A 5JWRA 3H0KA 2GNOA 4M9SA 2C96A 3PV0A 1OXUA 1D2MA 1QHSA 1FQJA 3UMRA 1NKSA 5JJIA 2QL6A 2DFLA 4Y0VA 3IEVA 4EKDA 1IN6A 1UBCA 3VR2A 3GJ6A 3FWYA 4GSYA 1Z47A 4Q4LA 5FPHA 5C1BA 2YYZA 2XGJA 1KKMA 2HF8A 1XTSA 2N1BA 3ZZTA 4BFXA 3VR3A 1NVUQ 2Z4RA 3VHXA 3GJ5A 1OXTA 2TMKA 3NH6A 3DVLA 4LBWA 3EWAA 1TEXA 2VHTA 2VTKA 3Q7PA 4G5RA 4Q19A 4JLVA 3CPJB 4ZPXA 5JJLA 2YWGA 3CKLA 2IYLD 4ITRC 3WNDA 4C0JA 3B82A 3VKGA 1N6RA 2ZRBA 1H8ED 2ZREA 2IEYA 1Q1ZA 1FW6A 3HR7A 1VCOA 4A1FA 2QGZA 1KO8A 3CPEA 1W4AA 2UVQA 5L3SB 1XXHA 2BWJA 4BFUA 4HZUA 3C4JA 5EP1A 3WYFA 4DC9A 1VG0B 1GRNA 1HUQA 3GJ8A 1W44A 4LC1A 3FHOA 4IEIA 3T35A 3TQFA 2JAQA 1JPJA 4Z1MA 5TMPA 4UXHA 1R7RA 4UQOA 5EE3A 4MGZR 4RD6A 2A5JA 4AKIA 2VHCA 3KJIA 2BM1A 2IX3A 2A5GA 1V43A 4I1UA 1ESMA 5K8UA 2YZ2A 4PPFA 4XVUA 2GEVA 4LC0A 4QL3A 2IUUA 3D3QA 3LAWA 4GOKA 4JMPA 4Q66C 3CR8A 4D0GA 4AD8A 1Q20A 3TUZC 4Q1BA 3QEOA 3GJ3A 4NHOA 1US8A 2PZEA 4P4SA 2EU8A 4OHZA 4XWOA 1GG2A 1FNMA 3B1WA 4QFMA 3S1AA 2WJVA 5LD2B 4C2UA 4YMVA 4MQBA 1ESNA 3K9NA 4A0GA 2KI5A 1KYIA 1PJRA 1VG1A 4FMDF 4GOJA 1RYHA 2A5YB 2V7QA 1W0KD 3EG5A 4ZDWA 4EPTA 5CLLA 3THWA 4LHZA 2JA1A 3OEHD 2NPFA 3UK6A 4DVGA 1RVDA 2IHBA 3B9PA 4IXMA 1EESA 2VP4A 1P9RA 3I3SR 4NCNA 5JWOA 2Z83A 1XPOA 3ZQ6A 3U3JA 4YQFA 1DG1G 4M1OA 3GJXC 1AS3A 1KI6A 1TQ6A 3IUYA 1Z63A 1VMAA 2QTVB 3ECCA 4TMVA 1ONBA 1CJUC 1KI8A 1EFUA 3QY0A 4LJ7A 4TWZA 3X1YA 4KO8A 4IOMA 4V0KA 2C9OA 3R8FA 4HYYA 1EGAA 4JLJA 2IYTA 1MO4A 3ZZ0A 2OFXA 3OAAA 2G88A 4JBWA 3ICEA 3Q85A 5JS8A 4LV6A 1G8YA 1N6NA 4V0ME 1XD9A 4JSTA 1NG9A 2GA8A 1W4CA 4PHHA 1NN3A 1ZM3A 3W6OA 4BLTA 2FE4A 1WBDA 2CCGA 2ZRGA 2G0TA 2ZS7A 2EFEB 3DZ8A 5CK5A 1G3MA 2ZETA 3ND8A 1UJ2A 2CCKA 1L4YA 2YWHA 1MO5A 2ZR9A 1FX0A 1IQPA 5TDHA 1KJYA 1Q12A 4LRWA 5F3WB 5CDFE 1SQ5A 2Z0MA 1K5GA 1W5TA 3V9PA 1CP2A 5EZ6B 1WA5A 4MDFA 4B71A 2Q9BA 4QGGA 4Y0AA 5FUXA 3QUSA 1SVKA 3OIWA 2WBLC 1W47A 1KO1A 1K8RA 1UADA 2QT0A 2Z5FA 2BJVA 1S8FA 4DSUA 3Q7QA 3Q5EA 2QTHA 1Z0DA 3IBGA 4RZ2A 2VF7A 3U3KA 4MH0R 4GNKA 4RFVA 2PMKA 2W6IA 3MWJA 1HE1C 1E2FA 4DCTA 4YMWA 1FP7A 4TTRA 4ZI3A 4D80A 2REXB 1T8UA 3A58B 1D2NA 1XBTA 1N5KA 3IDQA 4QGHA 1WMSA 5AK0A 4KVAA 3HPRA 1NY5A 1NN5A 2N42A 3U7EB 4TL8A 3ZIAD 4TMKA 3WRYC 1IY0A 3AF1A 3PG5A 2FSIA 1JAIA 2PCJA 4IVQA 2OXRA 4POAA 2R9VA 1CF4A 4PO8A 1WBBA 4Q4JB 4LV8B 3K0AB 3L8YA 2C78A 4R71A 3ZJYA 1DAMA 2CLCX 4HLUC 5FTJA 1F2TB 1NKTA 1QZXA 1WE2A 3A37A 1JR3A 1N6HA 5CYPA 4ERNA 2GJSA 4WXPA 1GRRA 4A36A 1G7CA 4EFLA 2IK8A 2IYRA 1KSHA 3T15A 3VTKA 4HAZA 5JWHA 4PZLA 3RRZA 4DRZA 4M0LA 4C3ZA 3TUIC 2PJRA 4JLKA 4RFSB 2IS6A 1P61B 4LSGA 2WKRA 3KQLA 1F6BA 4MRRA 1WXQA 4D2IA 1R10A 2O0KA 2ZVPX 4BLOA 5HZHA 1JECA 4EJSB 1XXHE 4GOXA 3M1IA 4FCVA 1XB2A 1ZIOA 1E96A 3GP8A 5LB2A 4JLMA 3CRRA 4BRUA 4UXIA 1UKZA 2GZDA 1COWA 2CHVA 3U44A 1G3UA 2JDID 3TRFA 2ZE6A 4IDHA 1FTSA 3CX6A 5A5GA 2FZLA 5EXPA 1PLLA 1R2QA 3AKDA 4DDVA 2OG2A 4TSFD 3WHKA 4BFWA 5TARA 4HUQB 4Z8XA 4TL6A 1OH7A 1J7KA 2GBLC 3SI7A 1OXSC 3VU9A 3ADCA 4UNQA 3ETLA 2B7BA 4V0OA 4JLPA 2RB4A 1UM8A 3AP2A 3N2IA 2XEXA 3HPQA 2GDJA 2GJ9A 3A36A 4HSEA 1NLFA 1SZPA 1ZM4A 3FPAA 2XXAA 2ZE8A 2CNWD 5TB5A 1R8QA 4NPHA 3P4YA 4C4PA 4IXNA 4DIDA 5DNYB 2J59A 4L9WA 3MWKA 1VYUA 1XCGB 2RGBA 4D0LB 4TT3A 2QZ4A 4BFVA 5KNBA 4ZKEA 3SFVA 5FPYA 4BFYA 3CRVA 3QF4A 3GPLA 1JB1A 2FWRA 1CR0A 1FUKA 4NYJQ 1G5PA 2H7VA 2Q3HA 4BE7B 1N5JA 2KBEA 4ILEA 4NBSA 3QE0A 5LB4A 1E2IA 1MT0A 4A82A 4S2EA 3SYNA 2ODNA 2YOFA 3A1VA 3HU1A 2F1JA 2P5TB 3KB1A 5GJCA 1WQ1R 2UKDA 5LDDC 1S9DA 2CBZA 1T5LA 2CDNA 1IY1A 1TU3A 2OHFA 4PPQA 4HAVA 4TTPA 3QPVA 5EE5B 1LY1A 5F2EA 4P33A 1E9EA 2ZJOA 3DMDA 3R7WA 3L43A 2CEAA 1OV4A 1EFTA 1OF1A 5AR1A 4URYR 3ADKA 1YZLA 2J45A 1IXRC 3DO6A 3NEYA 4IDQA 4URZR 2C99A 3EZ6A 4BFSA 3FKSA 2W0SA 1R0WA 2RGNC 2VQSA 3KUCA 1KHTA 5L3QB 1OXVA 2WWGA 4B3BA 2R6AA 2W6JD 4WOPA 2OFWA 4Z51A 4NYMQ 4Z54A 2JLUA 1Q21A 4DLWA 3ZS9A 4B32A 3CLVA 3LH5A 4GPTA 1NIJA 1Z6AA 3CH5A 4JL5A 1DARA 4G5OA 3K0FA 4M1MA 5GJWC 1RRGA 1U90A 1FMLA 3ADDA 1KDTA 2P5SA 5JJKA 2IS1A 1EXMA 4UXJA 2CK3D 1KI9A 1FQKA 3FFAA 3U4QB 4QRHA 1XFAA 4OQMA 1KSJA 4WZ6A 5LPNA 1ZP6A 1SVLA 1ZUNB 3KFXA 1HE8B 4E09A 1IONA 3RS4A 1AN0A 5DI3A 1E2QA 3ZZUA 3I72A 1O3YA 1Y3AA 2G83A 1JJ7A 1OE0A 4OI0A 3DDCA 1W36B 2GK6A 3D8BA 3H86A 1U94A 1U8YA 3GQBA 2ZI9A 2HCBA 5LD2C 4QBHA 2MSCB 1QHIA 2X8AA 4IDOA 4MGKR 3EZFA 4U00A 2QBYB 4DLVA 3AUXA 1H8EA 2RGCA 2IYVA 4U02A 5IHPA 2O8CB 5FUVA 3RS2A 2EWVA
chains in the Genus database with same CATH superfamily
4KQ2A 1I80A 1P3DA 4DEVA 4H08A 4OHWA 4EPVA 5ELLA 1UMCB 4XGIA 1I3OA 2KS6A 5ECDA 3DEJA 1EFHA 1GITA 2C7VA 1V7QA 1G5TA 1T2NA 4G5HA 1NVGA 3VPGA 1SCKA 2W37A 2WJWA 1Z8NA 2NAPA 3DLBA 3U3DA 5I48A 3RK0A 4JFRA 4D99A 4U2DA 5J2UB 3RK1A 3FSEA 4KLZA 3IT2A 1UXJA 3IHWA 2O23A 2ID9A 4WSOA 2D7DA 2HK6A 2ZBEA 4Q03A 4AKEA 3R9WA 1KMHA 2AT1A 4J07A 4RHTA 1HKHA 2KM1A 4Z9FA 5FP0A 4HB0A 4O4JF 4HNAB 3WLMA 5C7OO 2PKEA 1A2QA 3D6UA 1PZHA 1SC6A 2H16A 1QM5A 2G67A 3C7KA 3HA5A 3PC6A 4V0SA 3RE1A 2H1OA 3KD3A 1GZ6A 1CYEA 1ZO8A 1JFFB 3FCEA 1O89A 2Q8PA 1R4ZA 3FZNA 2CHQA 3QFCA 4C4OA 1PG0A 5HG0A 5HKBA 4RIEA 4LIPD 2AYYA 4DQVA 3H5WA 3URKA 1CFZA 1MT3A 2VTVA 3RRNA 1Z4IA 4HKTA 1DKUA 4DSNA 3EVBA 4NU0A 5FUQA 5DEOA 5FORA 2YKGA 4RLHA 1GTRA 2HREA 4YI3A 1OXKB 2GSWA 2K2QB 1Y7PA 3BXOA 1YRAA 3EC2A 5IN5A 2JAPA 1QQ6A 3B60A 4G4GA 1B00A 4LCJA 2HBZA 2JIPA 2RJ3A 3PSAA 4TLDA 5FNVB 3WK5A 2CHUA 1XJ0A 2YS7A 1RQPA 4CLRB 4DDTA 4IIEA 1Z8FA 3F98A 1N5MA 3OF5A 1JAYA 1JUDA 4KMRA 4WCFB 3N1UA 1HKUA 2GERA 3I32A 3ENNA 4RGYA 4U2BA 4B79A 4MUEA 1V7PC 2AX3A 2NZUG 1R9NA 2IXTA 1S9HA 3BHJA 2JCXA 4Y6SA 1UT8A 4DCVA 3HV2A 1JA0A 2X77A 1PEYA 3DMGA 3INGA 3H2BA 3RVOA 5H68A 1X8XA 1L4GA 1G20E 2B7LA 4ZCQA 4MTLA 1DIRA 3N75A 1K6XA 3AIMA 2HSDA 5F5LA 3QXCA 5JD5A 5HE9A 2AJDA 2PZJA 5LQKA 2OGTA 1TFRA 2ZRDA 4OVKA 3W3AD 3PD0A 1YI0A 2Q2WA 2H4ZA 4M9RA 2C9ZA 4GAEA 1ZMRA 4WNAB 1N5LA 2A9JA 4QJBA 4YCBA 2R00A 1P7YA 3L9XA 1C4OA 3S1AA 3SYMA 4EHLA 2RKOA 3MLAA 3CUEF 2RHOA 2WQ7A 3MCUA 1ODCA 1E92A 5M3BA 5AUNB 2QSYA 2XQFA 3OG9A 4DANA 2P2CA 4GVXA 5BQXA 2YWDA 3L7KA 1HLPA 3LUGA 5K6RA 3MBKA 4C1BA 1LEHA 3ZHXA 4X1IB 2XTAA 1ZVQA 4OATA 3GWGA 4BMXA 1HY3A 2W6NA 1KJQA 4W9MC 2Z1NA 4INAA 3JQFC 3SZOA 5A3JA 1LSUA 4DJAA 1AB5A 4F45A 4D41A 1YDWA 5DNWA 1CUGA 4WL0A 4D9IA 4QARA 4HNUA 4PHFA 4E94A 1N57A 1D04A 3MGBA 1NDQA 2ODTX 2FPGB 1PJ2A 4RTMA 1F17A 1ZD2P 3GEBA 3OE4A 1F12A 1I14A 4PHCA 1EM8A 5BWMA 2P68A 1R8SA 5KNBH 4A15A 1QKJA 3WGMA 4LXYA 5T4FA 3SQOA 4KQKA 3AR4A 5IJWA 5T5QA 9LDBA 2YS6A 4YP0A 4X24A 2EHJA 5LYJF 3I4CA 2ONJA 1PL6A 4JCCA 1O95C 4S1NA 1ELOA 4XGQA 5HZGA 2XKAA 1U8CB 4ND8A 3NIGB 1U1DA 4P5PA 5FOUA 3M3DA 2W7TA 1HF3A 3NRBA 3OZGA 4X7PA 3K73O 4MDYA 1M1NA 1R88A 3TM4A 3VKVA 5DGHA 3IMEA 1MH9A 4EMTA 2FSFA 1BWSA 2GBGA 5TSDA 2B8EA 1YXMA 4P5DA 3TOCA 2M32A 3MINB 3ESXA 1WUJS 4TYPA 1Z82A 1AU9A 2C2GA 2DY0A 3KSRA 3ZBQA 4MB6A 1F5NA 3GMSA 5AI6A 2YXPX 3TMKA 5H7XA 1SU4A 3IEPA 5JMWA 2ZM5A 2REQA 4LJ8A 3S55A 3GLHB 5L6LB 2P9QA 2ZUCA 3QHQA 2VYCA 3BJMA 1Y9JA 4V39A 5DNAA 2ZPUA 4NU5A 1V39A 4B6JA 4BUJA 3O73A 2WHQA 4X95A 1OIVA 3EZ9A 3L8ZA 1XEWX 5DZSA 1IHPA 2C83A 3NT5A 1QCDA 2VJOA 1DKLA 4FB4A 2FPWA 4UHCA 2OBLA 3P9NA 4BLRA 4EBBA 1VMEA 3KZKA 1E2UA 1NUQA 2CFRA 1HC7A 3P9QA 1HFEL 3BMNB 4RESA 5K3FB 4F4IA 3E4CA 2W48A 3T34A 2H2GA 2Z2YA 2CFCA 3PCRB 4OJYA 2YV5A 1JHRA 5EXEA 1TT5B 1KK3A 2PQ2A 4M1TA 3KO8A 2BBSA 4IX1A 1ORWA 2P69A 2ZUDA 4TTIA 2M1XA 1DXQA 4KWHA 1XJCA 5BSMA 3C3KA 4BWYA 4IH9A 2LNDA 3EC1A 4EI2A 2JIRA 3VU8A 3G82C 3IPAA 5DM2A 3SBOA 4F6CA 1O4VA 3AI3A 2C95A 4OHCA 5LP6B 1KS2A 1FRQA 2BFAA 2N9UA 2PX4A 4XJXA 2B1QA 1RABA 1RWXA 4RV5A 4V2UA 1V5GA 4ZRDA 5HBRA 5LZ8A 2JCGA 4MXDA 3F8WA 4PCUA 1QS0B 1QQAA 3SXJA 1SBZA 1XDDA 1L4KA 1CEEA 3DKPA 3FOFC 2Y99A 3W5CA 3ORSA 4ZRNA 4E12A 5KX5F 1WZ2A 4C0BA 4J1TC 4A4DA 1LWNA 4BV3A 2QUBA 1FSFA 4NCIA 4BU0A 1NASA 4DV3B 4A27A 4ZV4A 2IA5A 3EIUA 3P9SA 1H2EA 2EL9A 4ZVSA 3WK7A 4YAGA 4QVGA 4CL0A 4LJ6A 1SHTX 1EWRA 3UC9A 3G0GA 2YFYA 4NCHA 1UC5B 2R1VB 3ICVA 2WUVA 1OI2A 1RXCA 3E3OA 2PH1A 2CNWA 3AG6A 3NYRA 4ONEA 2I34A 3CURA 4RM2A 2YRFA 3IXQA 4B80A 4GEGA 4Y2XA 1D2GA 3AF2A 1GCAA 4B6QA 4Z4QA 3MXTA 5B3JA 2E89A 4WXRA 2V4ZA 3D8SA 3ZWBA 2ZRMA 4RVFA 4F4CA 4HH1A 3L93A 3EQ7A 2GYVA 2EKZA 2ISQA 3QBEA 1UAAA 3CINA 5G3YA 1W48A 4TKZA 4DUGD 3CZMA 3KL2A 4EENA 2RGGA 3IMKA 1V8FA 4Q1AA 1Y6FA 4AI6A 1HNNA 1Q17A 1OI7A 1PJTA 2EF0A 2JA2A 5GAJA 1UJ6A 5A0FA 2ZIUB 4R54A 3RIGA 1YE5A 4JEUA 1Q0QA 4JJEA 4LOJA 4JI6B 4J0KA 4P7KA 5DB4A 2AG8A 5JXHA 1F4PA 1E2JA 3AK4A 4N47A 1E9FA 1FUUA 4JU9A 4PO9A 3AR2A 4D3DA 5COAA 4D81A 5J2UF 3EIWA 4HDKB 1QIMA 3OIDA 4FN5A 3ZXXA 3AVQA 4I9HA 4HEHA 4IH1A 4X94A 1AQUA 3S5UA 1H9BA 3HHPA 1O6ZA 2VCHA 3MUFA 1Z0FA 3KWFA 3KLNA 3D1JA 4KTVE 3LX6A 3NBXX 1D6NA 1QVWA 3JATA 4NONA 5DGIA 3V7UA 3VVMA 6GPBA 2PT6A 1X80A 1BQ3A 2QLLA 3HWRA 4X1OA 1DMSA 5CT9A 1X94A 2AG6A 2DFNA 2BY4A 3EGWA 3KBBA 1VB5A 5KNCH 4NS1A 1NJ8A 1YDGA 4J0HA 4OQ4A 1WCV1 4HATA 3KBOA 1HG1A 1R0CA 2YNMD 1CPYA 2F62A 4FJ0A 1YVRA 3SHWA 1PYOA 3JSAA 4FWBA 3NFYA 4KIUA 1OWLA 2CXXA 1ISMA 4MQEB 2HCRA 5L4SA 3W5VA 3ZC3A 5B4VA 1IY8A 1X7XA 2YJ6A 4AWXA 1E32A 5GJVC 2OBMA 3OQIA 4X1YA 1GGNA 3JQBA 4GMDA 5P21A 1KFKB 4FVTA 1YBVA 1MO3A 3FSGD 4FQ5A 5FNVF 4X7RA 1A71A 1SBIA 2VSOA 4M38A 1PP4A 4B8YA 3WGNA 2Z6AA 3ZGOA 1KOJA 2QD2A 1HEIA 3INNA 2J9YB 3IC5A 2ZJ6A 2X9VA 1L6IA 1TJYA 4IIYA 5CK4A 3T3DA 3KALA 1ECCA 1T29A 2CVPA 4DARA 1KYWA 3R09A 4ZAZA 3W34A 2V6IA 2F59A 4NKRA 5AJYA 4YHHB 1JDTA 1CR6A 2G1KA 3QPAA 4NI5A 1O8CA 1BXRB 2EW1A 1XRNA 4MS4A 3FHLA 4RPGA 4PLCA 4ARVA 2RD2A 4TM7A 4CEHB 3DPUA 3NHPA 1G0NA 2XMZA 4M54A 3O2SB 4L50A 3OTHA 10MHA 1ZINA 5CLJA 1DAOA 4YUAA 1V7CA 1Y8QB 2LKDA 2Z5GA 3PFWO 3T5AA 2OCYC 3CUYA 3L0DA 4NYJR 2FP4A 1OLUA 4NENA 3UJAA 2JHGA 4OFWA 3W9BA 3BRQA 5FR1A 3PX3A 3ZCRA 4B3XA 4ABTA 1ZR2A 3H4VA 2MOKA 2HIHA 5J58A 3AFIA 3C5WP 4NMLA 1L8OA 2WB4A 4W8GA 5CJJA 3LLMA 1YIDA 5KYUB 4OHUA 2PS9A 5EG5A 2GLUA 3ZHZA 1QGOA 3HVJA 4LEIA 1O6FA 5HCIA 3A1WA 2GTHA 2HLPA 1UBHS 1OXBB 3PPXA 4MTCA 1KYVA 1Z3IX 2C5SA 3Q2KA 4HZGA 4LXQA 1Q3HA 2JEOA 4BEJA 2B83A 3QKTA 4EW3A 1GQRA 3WKBA 3QBTA 2JH8A 3D81A 3AGQA 1HMYA 5BNIA 2JLQA 3GXBA 4FHDA 4DIFA 5REQB 4LF5B 1SPBS 4ALNA 1IB0A 2B4AA 2E4UA 4MCJA 5K03A 2W2OA 4EUNA 4HDQB 2DWUA 3VZCA 2BGLA 3BJIC 1GKIA 4I1RA 5CFRA 5ITVA 2OWEA 4EAQA 3PDCA 3VOBA 4W5NA 1MXFA 4O29A 3QA9A 1LXCA 2VYND 1SMKA 3QKUA 4HN4B 4K1LA 3H6HA 5KDOA 4KXUA 3JR7A 3KC2A 4JI1B 3DA8A 6PFKA 2BKUA 4G5XA 4L5IA 5T6BA 2R7MA 1YZGA 5HX7A 2HWUA 2W2KA 5C8XA 3H7AA 1GZ5A 1Y3CE 1DE0A 1E6WA 2EDCA 3JWEA 4JBGA 5DWVA 5T8KA 4RK5A 3BORA 4EJSA 4NXNB 3F4BA 2HDNB 1XR3A 1BH6A 3EISA 4KN6A 1L5LA 1KC3A 2AWNA 1V4NA 1EK6A 3ROGA 4EL0A 2WG2A 4Y9TA 4DLBA 4LI3X 5AOBA 1SD5A 1X1SA 3DTTA 3P32A 3T3HA 4QU0A 5E9JA 3WL6A 1V1RB 2GD0A 5G3ZA 1GZDA 4ZALA 1C3VA 1KR2A 2P1RA 4Q01A 2WR8A 2R6GA 1I5RA 2C2WA 2VDQB 4FS8A 2AKEA 4J1NA 3A27A 2IEBA 2WHPB 2DFVA 3EXIA 2OHOA 3I6BA 4INPA 2WINI 4OGGA 3A3OA 1J97A 4MCIA 4MUXA 4DM4A 1EVKA 4MPTA 2C5GA 3KKOA 3ZE9A 4EA8A 1IHYA 4OB8A 1P1RA 1GDHA 4LS3A 3AG5A 3ETJA 1UCFA 1UK7A 4JASB 4RYDA 3DEYX 1K97A 1P8JA 2DFDA 2XYGA 1FX1A 5CURA 1Y1LA 1E18A 1YA4A 3IEUA 1QFXA 3OZAA 1DHRA 1Z4PX 1P4RA 3ER8A 4I4LA 4IUCS 2IOHA 1IAVA 2HJHA 2PY6A 3GFTA 3FMGA 4MWGA 3UJ7A 5F21A 2QRQA 2KYRA 1T1SA 1V25A 1W4ZA 4OKIA 3B85A 4R1PA 1U9IA 5C81A 2WIGA 3D7KA 4LHYA 4ZMSA 3FOWA 4EITA 1GGKA 4OXYA 2H48A 4YUZA 2GZRA 1DUIA 1WJGA 4NJOA 3MJ4A 3QWBA 2CLHB 1ID1A 4D7AA 1JDBC 3CH6A 3VH4A 4ZO4A 4BDSA 4RS4A 4IDDA 1R9GA 4MDEA 1XXLA 1ZL2A 4BJ5A 2VSXA 4BATA 2ZU0C 3TCKA 3DHNA 1RPJA 1WXEA 2OL4A 3ETCA 5LP6F 1AHNA 1K06A 2Q49A 4JB2A 4X90A 4A8HA 1C0KA 4PXAA 5ALSA 3DC7A 5K4AA 3RS0A 4LWOA 3GT0A 1LLUA 2FPXA 4K26A 3JARA 4JLOA 5TGDA 3TIFA 4D9EA 2OFPA 5JASA 2HSWA 5CDUA 3O5AA 1RLMA 2O5VA 1GQOA 3M6LA 1T35A 3HB0A 3O91A 5MF6A 1GFWA 2OK7A 1ODKA 3RLFA 5C32A 2F64A 4F46A 4RTOA 3BB3A 4H2DA 2BC9A 2Z1DA 3G1TA 4R1MA 5ES4B 4Q3BA 1SKAA 1FU4A 2H5LA 2VPXA 4GZ3A 4AJKA 3VUEA 2X9GA 1T8WA 3DYBA 3KXIA 3QUQA 3VR5A 1GPJA 3BC1A 1FP4A 2PL3A 3U7QA 4DZRA 2BFFA 1KY5A 2WFZA 4GC5A 1K5PA 3SIRA 1U0LA 4DNFA 1QB7A 3D0QA 3A4MA 1YQ9A 3UV6A 1BMQA 3HV0A 4Q7MB 3UJ6A 3I5MA 3PHHA 4G63A 3FPCA 3A1TA 2QUJA 4N5IX 4RA6B 1H2WA 2HFKA 1TZBA 1ZJZA 5HSGA 2Y1EA 2Z57A 3B70A 4JH0A 3PITA 3I9NA 4I5GA 3F5FA 1E1KA 5JCPA 1N34B 1L5NA 4QYMA 3WLOA 1TLTA 1CIJA 3R3ZA 1RI1A 1J2EA 3ZV7A 4CMGA 1J8YF 5C0OE 1TU0A 1ETHA 4KO1S 3KV1A 4KYTA 2WWRA 3QEMB 3ZY3A 3DBLA 4BN0A 2YVUA 3E58A 4O2BA 4C5AA 5K4GA 1L5HB 1TA4A 2WT9A 4DR2B 3PT5A 4G97A 1H6DA 4G5FA 4WLEA 1TVEA 2XX3A 3OIYA 5EUCA 3OZSA 5IFLA 3THWB 3GVPA 3HO1A 5IU6A 1C7EA 3WJAA 1C9MA 1A8QA 1GLVA 1NC3A 1VCMA 4FD3A 1NBAA 4BJ3A 3CXRA 2PUGA 5CFPA 5LZ4A 2B8JA 2FX3A 1WPGA 4C0HA 4FB5A 5KHAA 3G0HA 4MQFB 5ALTA 4BUCA 1C4WA 3DF7A 1MRSA 2F1KA 2A0FA 1MJFA 1IVSA 4UMVA 1Z4JA 4J2OA 1A5ZA 4HO1X 4FGUA 4GX0A 3TLJA 2NO6A 1XCLA 2GZ2A 4HLDA 2ZI3A 2CSXA 1QH9A 3QVVA 4OL9A 3FWHA 1ITZA 2BFBB 1T9AA 3BXZA 3AW9A 3DPSA 4GKVA 2I2DA 3TXYA 3Q3CA 5TQ0A 2AUTA 4EHFA 3U7HB 4BZQA 4OJQA 2Q2NA 2GCPA 3P71T 4HSGA 2PVPA 1Q7GA 5EVJA 2GT1A 4NFSA 3IHLA 4S24A 1N0IA 1P0FA 3EVZA 2KWIA 4G1MB 3UCXA 6Q21A 2JKZA 3MHTA 5HZKA 1C8KA 4FGJA 2C7RA 2WUDA 2A5LA 1RM0A 3UJDA 2XIQA 3LA8A 4WOCA 1F2UA 1OX6A 4DSZA 5A1TA 1DXYA 1HURA 4B74A 4R2WA 1I2MA 5IS2A 3JZMA 5ALQA 1POWA 4KXLA 1V16A 2AK2A 4G01B 3CIFA 2C2XA 1TAUA 3V6LA 1M2VB 5CEEA 1N7IA 2RFLA 1E1RD 3HNRA 1HX7A 3WGTA 3CF4A 3PKIA 2JPDA 2X0DA 3ZU3A 4XX0B 5AVQA 4HGYA 4CIWA 5IPFA 2R1TA 1EFCA 4UHDA 3KFVA 3OLQA 2W2TA 2ZDQA 5IP5A 5KS2A 2JIZD 3EVDA 2EL7A 4BRSA 4KFTA 3ZVMA 1T3TA 3Q3IA 2WC1A 1SUWA 1V8OA 2G06A 4MUKA 3D8NA 3OF2A 3KOYA 1LQ2A 2Z4TA 4G89A 1SVUA 1GPYA 2BCEA 3DVAB 4XWAA 5ELMA 3IH5A 3TTYA 2C7GA 4EHKA 4KITB 5CFZA 3IBFA 3IE1A 4XFJA 2BP7B 3N2EA 3KEFA 4K03A 4Q9LA 2WFLB 2JZOA 4RBNA 2EJBA 5B7PA 3RFVA 4URXR 1PL8A 2ZDHA 4KJZA 4B5KA 1I0IA 2OQVA 1RJEA 3GWZA 1TF7A 2NVOA 1D1QA 3NAMA 4M22A 4TN5A 2WKQA 1C1XB 4KU4A 4ZCPA 1REQB 3GUVA 5DWDA 4KN9S 4RIIA 4DPKA 5DM4A 3SJCA 2J3KA 4GI3A 1JSCA 2EFCB 2H9AA 3H2IA 2VEDA 3HFSA 3NCHA 5CDHA 4OFXA 3VAAA 4RTQA 1XF1A 3HU3A 2XUHA 1AKMA 3DYVA 1LJUA 2WIJA 2YVQA 2MSEB 1VZ2A 2PA3A 4MK4A 4EI8A 4Q4HB 4U8HA 3BERA 2CCJA 2PX3A 2QP3A 3ELUA 3E5RA 5BW4A 3KXLA 4PHGA 3JS5A 5A5DA 4Z0TA 5JADA 1FFSA 2X8JA 4CTNA 4Q9JA 5EWJA 4U7HA 1WU8A 1DP4A 2MIIA 4E33A 2YMQA 2QENA 4DA8A 4EHBA 2XDQB 7ADHA 2YINC 4MR8B 1TW2A 4Q9KA 4KQ1A 3P5BA 2XB2A 5ADWA 4K9SA 3FAKA 4AQYB 2A7XA 2WD8A 5KYKA 4XDZA 5L40A 1VRCA 5MFZA 1Q2UA 2OKGA 1CUCA 1I3KA 2WFMA 3T06B 3S1SA 5IDVA 3R9XA 2DKNA 4QTZA 3TOXA 4U2GA 4FFLA 4PFKA 4WA7A 5EZYA 1XRMA 3HCOA 1Y9DA 4WCDA 4EGQA 1A3CA 1WX1A 3ETHA 1L5GB 4PFQA 5JS7A 2OK8A 3WLLA 3K1JA 5F33A 4YJ3B 3CY6A 5AHOA 4A8JC 2Z2JA 3QNUA 1LS1A 2W2PA 3TLAA 4YB8A 3O3NB 3PFHA 5DBEX 4V2IA 1HMPA 2GJ4A 5C1OA 4H0CA 721PA 3SNKA 2BMWA 4CG0A 3BH6A 2JD0A 1YS9A 1EBUA 4JV5B 3MQ2A 5LYYA 4BJHB 3RWBA 4F2PA 1Y4UA 1JLLA 2WAAA 3UK0A 1XMPA 2MINB 4HRXA 4EZEA 5D3MB 1QH1A 1ZCZA 3DMPA 3HU2A 2FFBA 1KO5A 1TYAE 4N5NA 2PX6A 1PV1A 1MJ5A 1POXA 1ZVJA 2NYRA 2YXEA 1N6PA 2VT2A 1P7ZA 4JP2A 4PSCA 4KPFC 5G41A 1IZYA 1GSIA 3TK1A 5JAMA 2H29A 1VKZA 4KBGA 1Y0BA 5JO0A 4ESVA 1U2QA 3CMMA 1K9VF 2VF4X 4QHTA 4KV7A 4DT1B 2ZCVA 4NECA 2N0SA 2YMLA 4MOWA 2AJCA 4WZBB 4YP7A 2XUJA 3W8EA 1QYXA 1OT3A 3WXBA 4BIMA 5MN4A 3AGPA 4GUDA 4EUFA 1VB3A 3A6DA 3DE3X 3VR5H 3TXAA 4OP3A 3K6RA 5J40A 4LHSA 4NAVA 1ND5A 1VC2A 4ZO8A 1FYDA 2UZ3A 1X8LA 4KG7A 4YPVA 5LN1A 1O95D 2G1AA 2PMDA 2RCNA 1Q3TA 2G09A 2KB0A 3QXGA 4EY4A 2X2PA 4O4IA 1U0BB 1RE0A 3AB8A 1IL0A 1FLAA 2JFVA 3HVIA 3RV3A 4V1CB 3G9TA 5A9SB 1RD4A 2G4CA 5C51B 3WRYA 2XECA 1KDYA 2PV7A 3R7WB 3V6MA 2Q6KA 2XVAA 1SN7A 3TW0A 1BDIA 4C0AC 5ITWA 4KVGA 4C4XA 2WLSA 4X61A 2O7RA 4FR0A 3TIGA 2YFQA 5KTRA 2V0GA 3SLRA 1VCHA 2YHBA 3PNBA 2QM0A 4HLUA 4MVJD 2FZGA 2O8BA 5BT9A 2J9FA 3LDFA 1P72A 3HJFA 1QMGA 3BWDD 1TMGE 3AI7A 3VJRA 4KAJA 1AV6A 3NGLA 4IBOA 3MWYW 3T7JA 4AZ3B 4CM4B 1B26A 1UBNA 4TVSA 1GUDA 2OZVA 2RGAA 4U5XA 3PHIA 3AKYA 4DMUB 1Y89A 2WTMA 4R1UA 1N0VC 3C39A 2QX8A 1VE7A 2GILA 5A4IS 2FCRA 4KR3A 1QG2A 1ZWLA 1SU6A 3GVHA 3EXAA 4M87A 3EWSA 3ASYA 4RTLA 1YZUA 1ZCAA 3DHWC 3F3SA 2WKPA 2PLAA 3GX1A 5AW2A 2YDYA 4HVTA 2B9VA 3ZDXB 4CIXA 1PBTA 1AMOA 2B4KA 1NR5A 1ISSA 4JYAB 3TSAA 4WXHA 1ZD3A 1OZ0A 2PJUA 3GFPA 3V4VB 4OSOA 1MPTA 3CUTA 1ZD1A 1V3TA 3E1GA 3L6DA 4YASA 4B34A 1SCUB 4MV9A 2F2TA 2QDKA 1JIQA 4BO6A 2C98A 3AMVA 3MK31 2IH4A 4MVJF 1OA0A 3WFIA 4CKXA 1C0LA 4D6PA 3FTFA 1NNEA 1IJFA 1VIVA 4BQNA 1LKZA 1B74A 5JDCA 4LE1A 2I67A 1UKCA 2PUTA 4XSHA 1OAAA 3QX8A 3WMGA 2VK2A 4AY6A 2JARA 3K9HA 4OYLA 4ZVPA 4DR1B 4Q1FA 2VJCA 1N0WA 4W8HA 1J0AA 2GZSA 2OP1A 2ZSHA 1XQVA 3DOOA 1V71A 4H0NA 4LE2A 1IY2A 4REMA 4YAJA 1IZ0A 4MRPA 2QP9X 4P34A 3E9EA 5C8YB 4K46A 3BREA 4TUYA 2F8LA 3FLBA 1Z28A 2Z2XA 3QITA 2JIQA 5LBTA 3HMKA 4KJXA 3RNOA 4MYUA 3OQJA 3OU6A 2VUUA 4LYEA 1CXZA 3PGXA 2VFAA 3FE2A 3LQFA 1O1YA 3C87A 3SN6A 4UM9B 1AHPA 1A8SA 1V48A 2Y9MB 3QUTA 4PANA 2V7BA 3PQ2A 4EH1A 1KMHB 4MWZA 2VSQA 4L74A 3BIOA 2BJWA 2SKCA 5SZKB 4M46A 2HBRA 3FOCA 4QBTA 4IHKA 5IABA 1M8KA 4OMDA 4RORA 2JATA 1JFLA 1OBHA 2H1HA 4KIWA 3ZCPA 3U0VA 2PN1A 3LP8A 3W8RA 4C4YA 1RXSA 3DONA 3F71A 1CY7A 4L2IA 1C8VB 3NDPA 3R6WA 4MARA 1G21E 1GR1A 3MPUA 2OYRA 3D6NB 3C98A 2QQFA 4LE0A 2Q99A 3NGXA 4K9NA 5ICFA 1WULS 3ZTTA 5BV2P 3LGAA 4RTPA 5AO9A 1XI2A 1BXGA 1GNQA 2I6GA 2PH7A 4U7JA 5FTKA 1Z0ZA 3C0KA 3BXHA 3GNLA 3JPWA 4N01A 1F0NA 4YIKA 4ZU6X 3VR4D 4DMMA 1H1LA 2BFDA 4IIGA 1YIAA 2QSJA 2H2WA 2XCOA 4JP8A 4O2AB 3FDZB 4MVXA 3K5HA 1G3QA 4K8OA 4NL4H 4WKBA 4BFCA 5CB4A 2JJYA 5EJ5A 1RKXA 5DHFA 1DFIA 1Y33E 3CVJA 2JI9A 4B40A 2FV8A 3W8FA 3O8BA 4MR7A 4YUXA 2CYCA 2VL7A 3WWOA 1OJLA 2ZYHA 3RVLA 2QI9F 3M2PA 3K1AA 4UTNA 3FHCB 4YRQA 2DJIA 1NUSA 3P9ZA 4CU5A 3R5FA 1T6NA 1XZBA 2GTIA 2JFFA 2Z43A 1R9MA 3WXMA 4U9IS 1AQJA 3GLIE 1S8AA 3BTVA 5J1TB 1DRJA 5L3SA 1T34A 4EZIA 1DADA 2WV7A 4PAOA 4AZ0A 3HK2A 4IUYA 3K70C 5I7HA 1V9LA 1K89A 1H05A 1NVVQ 2D8AA 3EDMA 4HWTA 3Q0TA 1DKQA 5THKA 5DLYA 2NPIA 3BICA 2TMYA 3ESRA 1JEAA 4H4CA 1K0FA 4FCCA 1TDJA 2P4HX 3GR6A 4UBNA 3S1AB 5JVDA 5KWJA 1FIUA 3ERCA 1KYXA 2H8GA 3B6IA 1PDOA 3DGFC 3ZDCA 2XOKD 4TWIA 2W2QA 3N0XA 4DMHA 3I01A 1VXRA 3T3GA 3E05A 3LSYA 3TKYA 5LWQA 4IVPA 2HNBA 4RGQA 3PU6A 2L0XA 2UYOA 1GHTA 1MD9A 3EODA 4UFOA 3U1TA 4AS3A 4PNEA 5DPMA 3FLEA 4FYMA 2JJ8A 4QUDA 4TOIA 4ZDIA 1AHIA 3JYNA 2E0IA 5E0KB 2HF9A 2NXJA 3CVOA 2Q45A 1MTOA 1UAYA 3VZDA 4Q3AA 4M8IA 4YJ3F 2GVDC 3N0WA 3W5SA 2O0HA 2XCLA 3G85A 3MQFA 4P3OA 2JFZA 1G5QA 2MT9A 1M76A 3GDFA 1SVWA 3S2ZA 4Q9NA 2XCSB 1E0DA 1I7PA 4MV6A 4NK4A 3L0ZA 3C4QA 1EM8B 2VZ9A 2D3TA 4U9UA 4LV5B 3KYJB 1SIOA 1EJ2A 1D6SA 2F1IA 2GN9A 2AOUA 3HA7A 3CR3C 4OBEA 1NMXA 3BMOB 2H4HA 4N1AA 4LAFA 4WFJA 4DNQA 1H4SA 4H18A 3JSXA 4BNUA 4C3UA 3S81A 2CFIA 3HI6A 1K7CA 2AMYA 3SJAA 4ND8B 1X3LA 1GR0A 2QPOA 1M5UA 5DHAA 5GVRA 2IDZA 4FLFA 1S3FA 4PYOA 5K3SA 1KDZA 1RE1A 1B41A 1NQXA 4WK6A 1M1NB 5HF5A 1DI0A 5ALFA 4YRPA 4B33A 4BWVA 1WQ4A 2YJ4A 3ZW9A 2EP7A 1OH8A 2OT3B 1C7QA 3TEMA 1T8TA 1CUZA 2HCFA 4BNYA 3N8HA 2C4UA 1W93A 2Q2VA 4ND4A 3BSWA 4P84A 5AW4A 1PJCA 2CUNA 3I1FA 3B52X 3I1IA 4HS9A 1E2HA 4XYBA 3WTBA 3CW2A 1WAMA 4MUFA 4PEVA 4IQ4A 1ZJWA 4N9QA 3KVVA 1Z4QA 3E27A 4D6YA 1XD8A 4QHYA 3UICA 5CA0F 3COPA 1ZJ4A 4NSNA 3RKUA 2OXIA 5JYCA 3GZTB 5I5EA 2FDRA 3FOAA 2JVJA 5AHXA 4Y9DA 3QI7A 2PZMA 3PFGA 3I9FA 2QNRA 3GJTA 4NDNE 3V8QA 5JISA 5BOVA 3KEOA 3IQGX 1MRZA 2H1CA 3LCMA 1NBOA 3MNFA 4YRZA 4HAIA 5KYGA 1A5TA 1DBVO 3UYLA 1CZHA 1GL6A 1SH7A 2JHAA 3OE5A 3T94A 5CX1A 1ORDA 3VPCA 3CRMA 4QOSA 2CXUA 3LRXA 3MS7A 1FNSA 2EWMA 1UFVA 1ZMTA 3KKPA 4MI6A 3GLGE 5AQ1A 2XNCA 3CIOA 3P19A 1I5EA 4R84A 4GE3A 1D6MA 1DX4A 3I52A 3W5JA 2B0JA 1JHUA 4HLCA 3W06A 2XWBF 3HP4A 3PUVA 1XRJA 4U7PB 5IM5A 5BVGB 7MDHA 3ZLBA 1E4VA 1S5PA 3RAEC 1SCAA 4NLLA 3OU2A 4CLHA 2GPWA 2DHCA 1NJGA 3H42B 3K31A 2JIDA 5KYVA 3SCZA 2OAEA 3BEDA 3IAAA 2ATEA 4X41A 1D09A 2QUIA 4EX6A 5EIBC 4RMJA 3RU3A 5EMHA 1Y7LA 1RYDA 1Q7BA 4J8PA 2ZAOA 5BYBA 4DXAA 2GBPA 1KVTA 1D0IA 1E60A 3FX2A 4GZMA 3B1ZA 5SY4A 5JI3E 1DZ3A 2VP5A 3H75A 5ESDA 2BD0A 5BWOA 4MQUA 2W93A 5AYVA 3X2FA 4Q34A 3Q9UA 2FKAA 4KE8A 5E4YA 1WTCA 1G60A 2ZI7A 3GGGA 1I24A 1Z5ZA 3FVQA 2JLZA 4S04A 4Q00A 3MERA 4ROSA 1MUUA 2MHCA 2ZJ8A 5IJ9A 3Q2IA 3L2OB 1IOLA 1U81A 3HN7A 5H83A 5K3BA 1DC4A 3KG2A 4NDZA 2VDJA 2VPWA 4Y2PA 5EFZA 3BRWA 1R12A 1NPYA 1NYLA 4PLZA 4F1WA 3Q7SA 3UJBA 2QQEA 1O96B 3QY9A 4I1YA 5I9MA 1ZUWA 1AXEA 3UGTA 4ODIA 1KRHA 1PVVA 1X2BA 2ECPA 1U0JA 4M8SA 9ABPA 4EK9A 2PUCA 1UKVY 2O0MA 4M60A 4ND3A 5C3MA 3BSFA 3SG0A 4CT0A 2HQRA 4LGMA 1M6NA 4RH1A 2J9ZB 1W0JD 3LS2A 2C29D 3CLKA 3T1NA 3FGOA 5DLEA 4A7PA 3UKOA 4NZNA 1DFHA 1GLNA 2JH9A 1T25A 4KUGA 4QQFA 5JV5A 1XTJA 3S2IA 2BV3A 3AHEA 3MAGA 4K9QA 4V24A 4UCFA 5C8YF 1UJBA 1GN8A 3OPXA 3ZVKA 1LNZA 4BFZA 5I7VA 4C7JA 2VWGA 1VMDA 2ZKIA 3D7SA 5KNCD 1HETA 1LF0A 2V96A 3A4NA 4DM7A 1EX7A 1AQLA 2Q0SA 2GAJA 4EBFA 3A31A 1RLIA 3QUCA 3C6YA 2CVQA 2C8LA 4M37A 5CR9A 3VDXA 4WXYB 4QPCA 4AXBA 4NG5A 4MYRA 4BECA 3EX7C 5EYPA 5HXAA 2EYQA 4RZHA 3W2TA 3PI7A 4F4HA 3NHMA 3DUWA 1J39A 1X80B 2J6BA 2FPMA 3OA2A 4A2QA 1SEPA 5FL7A 1N9GB 5BV8A 1DBSA 5G0WA 1USWA 3OM8A 4FK8A 3STXA 4W5RA 4LKOA 2GRUA 3QE4A 4R81A 3GN2A 1R6DA 2FY8A 2K7ZA 2QJFA 3OFSA 5ICCA 3LT5A 1IN7A 1BVUA 1T3ZA 3ABQB 2OECA 2C5AA 2JJ1D 1YL7A 5DJ5A 1ZESA 4P98A 1UPFA 2NNWB 4GKBA 4LBZA 1EE9A 1F1BA 1I0LA 3OQIB 5EE9A 4WFIA 1XAHA 5EWLA 4XD7A 3ZYZA 2H1IA 3NFRA 4M0DA 2ZVQX 3ZX5A 3OQHA 5KVCA 4A2CA 1PS0A 3EDRA 5AQEA 4BNDA 2QX9A 3D6VA 4CMKA 3LXMA 1UIMA 4TMWA 4OK5A 3WQQA 2ZIVB 1B3BA 5KJ6A 2IXAA 5B7GA 2ZYSA 2GWHA 2GESA 4IGEA 1YTLA 5IYZA 1VPWA 1MOPA 2EG9A 1ZA1A 1MG0A 2G5CA 4ENSA 1I7QB 1BX1A 2BT4A 2VRCD 2Y76A 4IKEA 5E6SA 3W6ZA 4HZUB 2EKBA 4I1VA 3GJSA 1EWTA 4ZOLA 3PC2A 3WWDA 4D0RA 1BS9A 4S2UA 3KWJA 1RKBA 4RZ3A 4F6RA 5A6SB 1RWBA 1ZMBA 1FP2A 1G8FA 3ER6A 4CL2A 4CEIA 3FF1A 3QPWA 3EA0A 1SOUA 3I9V1 4UDNA 3CNLA 2FP4B 1OLUB 2BE9A 3FNIA 3JQGB 1SUSA 4R5MA 2R79A 3IIKA 4GUAA 4WMLA 4R8RA 2CMHA 4TQGA 5EVCA 2JLYA 3G8BA 2IH2A 1DJMA 1IK6A 1M7GA 4Z9YA 3T4EA 1Z4OA 1MB3A 4ALLA 1VKNA 3I23A 2AZTA 3FB1A 1JG6A 4Q3EA 1EFAA 1AKWA 3LF1A 1J0CA 2R60A 4X6UA 2AMFA 2FSSA 2IIBA 2FRXA 5E4TA 4GW3A 1FOEB 1Z6GA 1UMKA 2IF0A 3SLKA 3GP3A 1RLUA 3LYAA 4O4LA 3ZHQA 4L8FA 1FYEA 2Z4SA 5KWSA 3GBVA 4DG9A 1VHTA 2JCSA 5JPIA 4TWRA 4PPYA 1HQYE 1ONPA 2YJZA 4MKIA 5FLKA 4RY9A 4ISBA 3AO0B 3QIVA 4TV8B 3UG6A 2QLTA 3MB8A 4GOOD 4K6CA 1JKMA 2IUEA 3U16A 3ND6A 1QV7A 4QEZA 1UBRS 4N7RA 4P93A 1OX5A 2CLSA 2Q29A 1P7WA 4F3TA 1SUAA 5B1SA 5FNZA 1KI4A 1QR6A 1E9BA 4QOEA 1K63A 1KPHA 2B9EA 3FTCA 4UUAA 1M6VB 2BF4A 3VNRA 4DBVO 1NYRA 2Q1XA 3ELWA 1KZYC 3K0BA 3AJRA 3RUDA