2YINC

Structure of the complex between dock2 and rac1.
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
180
structure length
180
Chain Sequence
b'QGTMQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEDICATOR OF CYTOKINESIS PROTEIN 2
molecule tags Apoptosis
source organism Homo sapiens
publication title Multiple Factors Confer Specific Cdc42 and Rac Protein Activation by Dedicator of Cytokinesis (Dock) Nucleotide Exchange Factors.
pubmed doi rcsb
total genus 55
structure length 180
sequence length 180
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2yinC00
4A0HA 3JVUA 1OYYA 3T12A 2WMOB 1Z0IA 4PSVA 2DY1A 4JL6A 1X8LA 4IOJA 3VU9A 3IEVA 5FBWB 1P73A 4BFZA 2Q3FA 2WMNB 2YWHA 3ZZ0A 3GJ8A 4V0MA 5CLLA 2DFTA 1EGAA 2EU8A 4RD4A 4CEHA 1G20E 2PZEA 5EXPA 3K0AB 3JVVA 4RD2A 3EPKA 2KBEA 2C98A 4URZR 1FQKA 1F2UB 2FGJA 1IOZA 3DO6A 2OUKA 1UKVY 2QEQA 3QJYA 5JJIA 1T8TA 2OBLA 5FOTA 2IYRA 3VNUA 4QHSA 2BBWA 4B6EA 5F98A 4FW9A 1E9SA 1VKJA 2GZHA 2WOJA 4CW7A 2PJRA 1QHYA 1GKYA 3CH5A 4BFYA 3GLIB 1W5TA 4XSGA 4M1WA 2N42A 5KSZA 3RRZA 4JLNA 2WHXA 3KUDA 3T5GA 2CJWA 1E2JA 3I73A 2VRWA 3FHOA 4PPGA 4WBSA 2IWRA 5A5GA 3ASYA 2YOGA 4FMBB 5BYJA 4OK5A 4DC9A 1N3BA 1M7GA 1YRAA 2X19A 3BH0A 3CR7A 3I62A 3AP3A 1FL9A 2ZSEA 2DWOA 1G18A 4RZXA 3CLVA 2F6RA 5IDVA 4AIIA 4EQ6A 4RCZA 5AJZA 3A4NA 5FPHA 1R8QA 3G5UA 3I32A 3QNUA 4C0KA 3U61B 3IDQA 4LJ7A 2QUZA 4BFSA 1PUIA 1W4BA 4WZ6A 2RGAA 1Z2AA 2XB2A 5M04A 1XTIA 4CEIB 5JJKA 4AURA 1QG2A 3NBZC 4AD8A 4Z51A 1UAAA 4KSCA 5CYOA 1DARA 1E4YA 4BLOA 3SNHA 1KK1A 1TX4B 1XEWX 2ZTSA 1P72A 4TSFD 3I8XA 4TQ9A 1Q1BA 2CCJA 2KI5A 1XJ0A 4P4SB 2EFHB 1MR3F 5FL7A 4CEJA 1AIPA 1X86B 1XP8A 3I4LA 2FSHA 2QM8A 4MGYR 2CL0X 3ZGXA 3QF4A 3B1WA 1EFHA 1U8YA 4KYIB 2CL7X 2VBCA 4EDHA 2R6DA 4RFVA 3KQKA 4B3CA 1NVVQ 1O3YA 3CF6R 2ERXA 4A0RA 3T35A 3KZ1E 5FUVA 4TL7A 4RKEA 4OK6A 1F2TB 3DZ8A 5E7IA 3I5YA 3TK1A 3QBTA 3CX6A 1GIAA 1KO4A 1UADA 1P62B 1Q1EA 4TL9A 3P4XA 2HXYA 1NVWQ 4P33A 4YXWD 5GADl 2JA1A 2ZRDA 4JT4A 3MWJA 1TF7A 1VIYA 1MKYA 5EJEA 1N6PA 4ZDIA 1SULA 3UMSA 3DHWC 3KX2A 4BUJA 4E07A 4EAQA 5JRJA 2TMKA 4NCNA 5KPJA 1YKSA 2AN9A 1YZKA 3X2SA 3Q85A 4LHZA 4EPWA 4KSBA 1IXRC 4EPRA 1LF0A 4WZAE 4D82A 1F60A 3UXMA 1XCGB 4LC1A 4AI6A 3WYGA 4PSAA 1M74A 2A5YB 5G3YA 2E9SA 4YONB 1CJVC 3OAAA 1FUKA 4JSTA 3I1FA 4XVUA 4D25A 1NMYA 1FMJA 4LOAA 5L3SB 3F3YA 1XXHB 4PO9A 1FTNA 4JSYA 4HB4A 1TAGA 2XXAA 1RPZA 1ZD8A 3N5CA 4ZCMA 2DWPA 1NN0A 1Q20A 5TDHA 2QGNA 1ZBDA 2YWEA 4JBXA 1FOEB 521PA 3UANA 4KLZA 1AQYA 3QXCA 3QKRB 3L43A 5FUYA 3WMFA 3W34A 3OIYA 1QG4A 1DPFA 3SJZA 5J4KA 2ZJYA 1KI6A 1QVRA 2ZJZA 4C3ZA 2QT0A 2C78A 3HPRA 3TMKA 4LYHA 1AK2A 3H4MA 3MCAA 3ASZA 4C9BA 2IHBA 5L8VA 2FPKA 2IUSA 1G3MA 4EQ6B 5SZJA 2DCUA 4PC1A 5EZ6B 3R20A 1TL7C 5G41A 1G6OA 2V7QA 1KY2A 3A1WA 3LBNA 5KHOC 3ICEA 4AKEA 3AVXA 1N25A 3T61A 4B75A 2J5XA 3LX5A 3SJCA 1GAJA 2VP4A 4BRUA 5C1BA 2CHVA 2FF7A 1Z29A 1FP7A 4IOKA 4QOSA 3LDAA 1S96A 3AM1A 3H0KA 1F5NA 1YHNA 3DKPA 3KUCA 2ZS8A 4LX0A 4LHYA 2C77A 2RGCA 2J0SA 1UKYA 1DAGA 4M9XA 4JBYA 2FFAA 3MWLA 4B71A 2HLDA 2GCNA 4FMDF 4BRWA 3RWOA 1CS4C 2WSMA 3SI7A 3IBYA 3CRRA 4DLSA 3GLFE 1SKYB 3H2YA 1S0UA 1IJEA 3MD0A 3EIEA 2JJ1D 4F93B 1SGWA 1P60A 4QGGA 5F9FA 4FI3C 2ZYVX 3FTQA 2HLDD 2QTHA 1G291 1EFCA 1KO8A 1FX0B 4K46A 2V4ZA 1W0JA 2C95A 1E2GA 3U7FB 2YHSA 1RFLA 1E2HA 3TUJC 2ONJA 1Q57A 1KY3A 1E2QA 3ZVLA 4HUTA 1OH5A 2F1IA 1HURA 1RRGA 1EX6A 1YZLA 1R0ZA 4XVRA 4EJSA 1KGDA 4CIDA 3QKSA 2F55A 3M6AA 4KAXA 3TVDA 2IYTA 2PCJA 5HKKA 1HT1E 2ZETA 3NG1A 1GP2A 2IA5A 2CHGA 1H8HD 2ZROA 3OEED 2JLWA 2RH5A 1Q1ZA 4C0HA 1HUQA 2QY9A 3IPYA 3BAFA 3U2QA 1A2BA 2B21A 4B35A 2PBRA 2IS2A 1TMKA 2GCPA 1MOZA 3IPXA 3LLUA 1AS2A 3NEYA 3GPLA 1W7AA 2AHOA 2X8AA 3CF0A 3IQXA 5LDDC 4ACAA 3H84A 2BEJA 1OXTA 1UDXA 2CCKA 3EC2A 3OAAD 4MUBA 4D81A 3PEVA 2CLCX 3QSYA 4A0GA 4DIEA 5F9HA 4KHZA 3GLHB 1KI9A 1ZUIA 721PA 4KBFA 3A36A 1DG3A 3U5ZB 2A3RA 3GJ5A 4FCWA 2CNWA 2HCJB 1HQYE 2IS1A 1HTWA 4URUR 5DSZA 1TF5A 5FUXA 2JIZA 3CPJB 1RYFA 1TTTA 5KPDA 1GM5A 3MAAC 1L2TA 4A4DA 1II9A 2YNMA 2F9LA 1KDPA 2XZPA 4H1VA 1ZCAA 3OIVA 2ZS9A 2J0QA 5UKDA 1JPJA 2CEAA 1OB2A 2D2EA 3OE7D 2N1BA 1GDDA 1CLUA 2NIPA 3K0CA 5EP2A 4US1R 4PPFA 1W4RA 2JLVA 3U6BA 2NPIA 4NDZA 1UDWA 1Q21A 3VMFA 4B2IA 1ZINA 2F1JA 3GLGA 4QGFA 1E32A 2ZRHA 2PZFA 3QVUA 3K0SA 1XMJA 2VHQA 1P9RA 5GVSA 2PT5A 2QTFA 2BCJQ 4G1UC 4L5BA 4V0KA 1AM4D 2G77B 5KSYA 4TZ0A 1G8PA 3ZZTA 1NIPA 4OI0A 1Z22A 4GT1A 4Q7LA 4IOMA 2IWHA 3A58B 3CWZA 1JI0A 2RMKA 5HCIA 5TMPA 1TQ6A 3RNLA 1U9IC 4ACBA 3S1AB 2J59A 5FOWA 2CE7A 3KJIA 4NKRA 2WKPA 3DM5A 5TY0A 4B34A 3L0PA 3KJHA 1QBKC 4MRVA 1CR1A 3CM0A 2C03A 3M0EA 1J8YF 1FNMA 4IJMA 3HR8A 3K9GA 2LKCA 2XGJA 4F7WA 1AQUA 2ZE5A 2BMDA 2ZIAA 4U02A 2PT7A 4QBHA 4TYPA 2ZYTX 3K9HA 2QPAA 2BVNA 4JKIA 1NN5A 4PZZA 5FFMA 1G3IA 2CBZA 1AZTA 4Q1DA 2GK6A 2G88A 2FH5B 5B58C 4JJKA 4LJ4A 1CXZA 1UKEA 2YYZA 5IRCD 2ZS7A 1ZCBA 5EE0A 1UBEA 3RVBA 2RHDA 2PJZA 1ZNWA 3RS0A 1D5CA 1AKEA 2OXRA 1XTQA 1G7TA 5EE1A 4XWOA 4LSGA 1CIPA 2BIFA 2ZPTX 1VCMA 4M1SA 3W3ZB 3P1JA 2ZVQX 3AKCA 4BFXA 1TF2A 2A5GA 2BEKA 3D6TB 1S1CA 2F1HA 4P4TA 3NH6A 4GFDA 1WB9A 2OFOA 5IHPA 5LD2B 4RJLA 3U4QA 2RGGA 4QHTA 1VCIA 2XNDA 1H8HA 1R0XA 1TQDA 1S9DA 3OEEA 3CNLA 4FD2A 4QNRA 4QXAA 621PA 4B3FX 2VHTA 2Z4RA 4DKXA 1DO2A 2OAP1 3KJGA 2WWHA 3RHFA 4BASA 2OLJA 1I4TD 1G7SA 1FNNA 2L0XA 4RY2A 5P21A 5L3VA 1C1YA 1I2DA 1YVDA 3AGPA 4LC0A 3CPHA 2RHMA 3W3AA 1WF3A 2ZRNA 2R6FA 2FGKA 5EE9A 4EFLA 1VYTA 1W44A 5FBLB 1Z47A 4F4IA 3VNVA 5EP3A 1JR3D 3W9YA 2RB4A 2NG1A 2IHYA 2QG6A 2ZR0A 5BN5A 3TW8B 3CONA 2B7CA 3QG5A 1PV4A 3CIOA 1XMIA 1BYUA 1IHUA 1ZNXA 2BCGY 3BC1A 3C5HA 2Q3MA 4Q18A 2BDTA 5JBQA 4RKFA 2IYSA 3FHCB 3R9IA 1JR3A 1ZM9A 2BHRA 1KMHA 5CM8B 1T0HB 5H1YA 1YZNA 2WWFA 4KITB 3C16C 3WMGA 4URVR 3V9PA 3CO5A 2OFWA 2QRZA 3CZQA 2QNRA 2BV3A 3A4MA 3AKEA 3NWJA 1SXJB 4OBEA 3TUZC 5FL3A 2AX4A 2EFEB 3KL4A 3EPJA 3FWYA 2XAUA 3SS8A 5AJVB 1WE2A 4Z1MD 3IIJA 4WOPA 3CF2A 1IN4A 2LWIA 2OCAA 3QF7A 2GJ8A 3BWDD 2V1UA 1PLKA 5AK0A 3AF3A 1N5IA 4QGAA 5J4LA 4HYYA 3TSWA 3EWSA 2J87A 2XX3A 4V0LA 3ZDQA 3M1IA 2FNAA 4I1SA 5FTJA 4DLYA 4ZIRB 1KZ7B 3QG1A 1II8A 1OFTA 4OHVA 3TRFA 1WBDA 4GI7A 1WA5A 2O8DB 4I81A 4BQSA 4D4MA 4OI2A 3PXGA 2J45A 2EFDB 2J7PD 5KTYA 2O0KA 2WICA 1XB2A 3W90A 1FQJA 4DEXA 1Z0JA 2A5JA 1WDTA 5KSOA 2OO7A 2W2VA 1KO1A 1MH1A 2BMJA 3GJ3A 4FMCB 2IT1A 5GJWC 4TMZA 3CUEF 1JNYA 1GITA 1BH2A 3BB3A 4CEJB 1MABA 4ESHA 4IDQA 3AVOA 1N6HA 2EYUA 5L3SA 4TLEA 3LY5A 4L16A 1E2FA 2WAYA 2W6JA 4A1FA 1OFIA 5DI9A 2DFNA 4O3MA 3WP0A 3EZFA 3TR0A 1YZQA 2G3YA 4LK2A 1SVMA 3QPVA 3IO5A 1Q12A 3EZ2A 2AFHE 4Q21A 4FWIB 3QXSA 2J46A 4MQBA 3BRWD 3ZD7A 1P9WA 2G0TA 2IUUA 2HF8A 2PLFA 2C9CA 4HLDA 5FBQB 1XFAA 2FEMA 4XH9B 2MMGA 3F0TA 2WAXA 2AD5A 2ZRLA 3IO3A 1NNEA 4GZLA 3VTKA 1GRNA 3U4QB 1EFRD 3H86A 4PC7A 3TW4A 3WRYC 3MFYA 3K70B 1KI7A 2V7QD 3RS4A 3LQRA 1DVRA 4PQRA 4EIWA 2GXAA 4ZCIA 4OQMA 1TQ2A 4RSGA 1Z6AA 1XEFA 2OSBA 1HH4A 2ONKA 3G82C 4KVAA 5HZHA 3BERA 2WPDD 2ZYUX 4F38A 1PJRA 1D2NA 1E1RA 2PL3A 1MABB 2FSIA 4NYIR 4KXFB 3SBEA 2XTMA 2GK7A 4A0FA 2FPLA 1JQLB 1GWNA 2CVFA 1Z2CA 1KK2A 1DAFA 2X77A 4MYCA 4DXAA 2SHKA 1G8GA 3LX8A 1QRAA 1BS1A 1E99A 3B8HA 1CJUC 1ZW6A 5GVRA 4DLXA 1J90A 4LHXA 2J9RA 2QGZA 4JT2A 2Q3HA 3RS2A 2JJ1A 1D2EA 2QN6A 4TL8A 3GLHE 1N0WA 1YU9A 2HEIA 4G5OA 1DTSA 1QHSA 3FKSD 3HJNA 2JJ2D 5EP4A 4JKYA 3SU8A 2XXAB 4ZKEA 1OIVA 2ZJAA 4W5HA 2JLUA 1R2QA 2VP2A 2VQSA 3GD7A 4JZKA 3VQTA 5H70A 4NH0A 5JHGB 4QBFA 1G7CA 4ZDKA 5J4VA 1NG9A 1N6LA 3IGFA 3W6PA 1MO3A 3ND9A 2D2FA 3I3SR 1P2SA 2QQEA 2YWGA 4MKFA 1YJ5A 3W6NA 5HR5A 4GL2A 4NYJQ 4HLUA 3Q9LA 1Y63A 4ZDJA 3BFKA 2PLRA 1OH7A 2ZR7A 1NF3A 3EX7C 3U7GA 4MH0R 4V0NA 1VCOA 1CRQA 1II8B 1UFQA 2WVJA 1XXHA 3TBKA 1NSFA 2NO1A 4UNPA 3W5IA 4IRUB 3IILA 1E2KA 5KDDA 1FUUA 2CK3A 4M0LA 1N6OA 1U0LA 4KBGA 3D7MA 1W1WA 3CRQA 4LCBA 1BMFA 1M7HA 4WZBE 5FBVB 2R62A 4LV6A 3OEHA 6Q21A 3SFZA 2CL6X 2ZRPA 3I92A 1NP6A 1G19A 3EAQA 3SC3A 3K0EA 3EA0A 5D3MB 5GJVC 2IW3A 4ZKDA 5CK4A 5AJXA 1E1QD 4M4SA 1AN0A 3VAAA 4PPNA 1W36B 5FOUA 1BMFD 1LVGA 4P3YA 4RZUA 3NC0C 2D06A 1W2GA 3AKYA 2DR3A 4GPTA 5E3HA 3FPAA 4DUGA 4BFUA 1G17A 1SXJE 3LBIA 4LHWA 2IF2A 3UKDA 1NJFA 2GTPA 1GKIA 1E96A 3RS5A 4LHVA 5AWFC 1U8AA 3MWYW 2OCBA 2ZSBA 1F6BA 2CXXA 4NBSA 3FHTA 3LV8A 5F2EA 2IYWA 1M8PA 2A78A 4X8HA 3WNDA 3U3KA 1SXJD 4RFSB 4YMWA 2FA9A 4GZMA 1VYUA 4PXAA 3C41J 4IFBA 3X1ZA 1N0UA 4B47A 4DIDA 3QUSA 1LW7A 2VO1A 4AG5A 2FOLA 2H7VA 4BEJA 1GFIA 4UNNA 4ABYA 3WY9A 3TKLA 3THXA 3Q5EA 2OEPA 4L4UA 2IX3A 1OLOA 4IXMA 1ZIOA 2IL1A 3LQQA 4H9GA 1RYHA 1OJLA 3EASA 4DLRA 5HPYB 1WBBA 1J7KA 5AUOB 2XOKD 1DAEA 4UQOA 4B76A 2VP5A 3WHKA 2IYQA 1OE0A 2ZQ5A 4GDFA 2ASEA 4FMCF 4D0GA 2HJVA 2WZQA 4Q4JB 3BH7A 2O8EB 1QHGA 2DBYA 2VP9A 1GRRA 4WVFA 1OXSC 3WYFA 1N2CE 4MKIA 1N5LA 4ZIRA 3AF1A 4BZXA 4DLUA 4G5RA 2VSXA 2HV8A 3QPUA 4R2IA 3U7HB 2W6ID 3QXXA 2BM0A 1Z28A 4EJSB 4RD6A 4EKDA 5DN6A 1G3UA 421PA 4A15A 5DE3A 4BLRA 1IAQA 5L3QA 4X8MA 2ZE8A 2XSZD 3PIRA 3GEHA 3MWKA 5CDFE 3ZIAA 4F4JA 3PJRA 1NBMA 2B8WA 2BJWA 4PZYA 5DYIA 4IVQA 2JLXA 1Q3HA 1E2NA 2CDNA 4YLGA 3DM9B 2OFXA 3NIBA 5CJPA 4UXJA 5HE9A 4OI1A 2J7PA 4DDTA 3W6OA 5K8IA 3NDPA 5IK2A 3QEJA 4Z8YA 2R9VA 4Q5IA 1YQTA 2C99A 3AUXA 4UJ3A 4NCKA 2QQ0A 3T5DA 2IS6A 2JLYA 1NKTA 3RS3A 3I5XA 1E9EA 1J70A 1ZP6A 2UKDA 1E2DA 2NTYC 1KSJA 4RCYA 1HA3A 1S1MA 4PC3A 4TYNA 4QC2A 2O8BA 3SR0A 1CBUA 2WWXA 4MUAA 1VIAA 5C4GB 1M2OB 5KNCA 1DO0A 4MGIR 1GRQA 2F7SA 4DCUA 4V0ME 4M22A 2VLIA 4FIDA 4L9WA 4TLAA 1UJ2A 2IC5A 4OJKA 1D8TA 1ZM4A 4YC7A 2YINC 2ODNA 1QHHA 2X2EA 3R7WB 3BB1A 2ORWA 2IYZA 3U44B 4Q9KA 2YC2C 4IW3B 3T34A 3PFIA 2W0MA 3U3RA 4POAA 4JVLA 4Q9JA 1F48A 4GNKA 5SZHB 3GJ6A 5JEDA 1RC8A 3QENA 1XD8A 4Q02A 3TAHA 4BLQA 1NL3A 3B82A 2Y8EA 4RD0A 3G0HA 3O8RA 3P26A 4I1UA 4JIMA 1T5IA 4XTRA 5HZKA 1RRCA 4Q48A 2UZ3A 3VKGA 3EIQA 3QKSB 2UZIR 4MRSA 2G1JA 3E2IA 4KFRA 1W5SA 2ZAOA 5LBIA 3BGWA 4MGZR 2A7QA 3FOZA 2VIIA 4Q19A 1C4OA 1Z8FA 2QTVB 5EE3A 4JL5A 2HJGA 2FFBA 3AVQA 2H8KA 2ZANA 3WHLA 4B32A 1W48A 2CNWD 2YVUA 5EUMA 1ANKA 4AYWA 2ZI6A 3NEJA 2REXB 4Q4HA 4KJZA 2QE7D 1U99A 2GZAA 3PENA 1I2MA 2JIZD 1S8FA 1ZJ6A 4OHYA 1L8QA 3FMPB 4UNRA 1KI8A 4IKEA 1TU3A 2XZLA 1QF9A 1M34E 1NY5A 2AR7A 1EFUA 4PX9A 4ASUD 3W5JA 4E09A 4C7OA 5BXQC 3RDPA 3EPLA 3VKHA 4Q4LA 1CR0A 3GEIA 2MSDB 5EXXA 2JLSA 1RZ3A 2E87A 4EPVA 1A1VA 1R4AA 5JCPA 3E5HA 2HYIC 4JMPA 2JJ2A 3ZH9B 3K0AA 1G64A 1QHXA 1DE0A 4BLSA 4ZI2A 1UPTA 4TYQA 3KKMA 5E7JA 2D7DA 4TYWA 3CWQA 4CT5A 3UMFA 5E4FA 1Q44A 4HDCA 1RRFA 4C0LA 1FZQA 3CRW1 4M1TA 5JEEA 1RKBA 4LZZA 5SZIA 4JL8A 1UF9A 1E3MA 4D2IA 2IXGA 3F8TA 3QKTA 4MKGA 5CIWA 1W49A 1XTSA 2W00A 1UBCA 1AZSC 3PQCA 2IYVA 2OE2A 3AUYA 1H8EA 1GUAA 1BYIA 1YR8A 4LRWA 3ECCA 1W0KA 2OXCA 5DN6D 3REFA 3CH4B 2ODWA 3RS7A 4QJ5A 3U3OA 4BZPA 4OHZA 1L7VC 3KFVA 2JDIA 2W83A 1E9CA 2RAPA 4PZLA 1LFDB 2GNOA 4YMUA 3ICQB 4LUCA 4LV8B 3QEOA 4HAUA 1H8ED 4MRPA 4NZYA 4W5WA 5CM9C 5C4MA 1NLYA 3AF4A 1ESMA 4Y0VA 1E9FA 1JJ7A 3B5JA 3SYKA 4ARZA 4TWZA 3L0SA 3WBJA 1KYIA 1KI2A 2P6NA 3VR3A 3KJEA 3CW2A 1Q0UA 2Q21A 2GWHA 3A4LA 3JZMA 3N70A 4D6PA 4UKDA 5CITA 3ZS9A 1R10A 4M53A 1N6NA 4G0NA 1SKQA 3TQCA 1A2KC 3UWOA 2EW1A 2OCYC 4DUGD 5AJWA 2FEOA 3B9QA 4B33A 1S2MA 3TSOA 4JLMA 1UEJA 4HZIA 2FFQA 2I4IA 3FKQA 3PUYA 1OHHA 3ADCA 4U5XA 3JZAA 3LXXA 1K5DA 2W0SA 3ZVNA 5JECA 2WOOA 2QZ4A 1YZUA 2GEUA 4NCHA 2AL7A 5FTLA 5G40A 3THWA 1XTRA 4LBZA 4GP6A 4EPYA 1ZRHA 2WKQA 2V6IA 1NMXA 3AF2A 3HU1A 2AXNA 3VHLB 1G4AE 3PEUA 3RRMA 1G5TA 2BJVA 1XF9A 3AH8A 1TUIA 5HE8A 4A9AA 1NG1A 2EFGA 4JLBA 4Q9HA 3OE7A 2KWIA 3N2IA 1IN8A 2BWJA 1GL6A 3GFTA 1E2LA 3RAPR 1FFHA 4PSKA 1CKEA 2MSCB 4N0DA 2ANBA 2PX3A 3V00A 1Q22A 1U94A 3U7EB 2W2XA 4BFVA 2WWGA 1PZNA 4L15A 2ZM5A 2GVZC 5KNBA 3BD9A 2GILA 1XD9A 2QE7A 3TR5A 1IQPA 2FSGA 5K8UA 1U0JA 4DLVA 4KV9A 3EW9A 3B60A 4C2UA 4V03A 1X6VA 2BKEA 1R5BA 3DOEA 4Z8XA 1JBKA 2J7KA 1M7BA 1XPUA 4FWTA 3PEYA 1ZC3A 4ASUA 5LPNA 1TNDA 1AGPA 1UBFA 1P6XA 1HV8A 3Q7QA 1DAHA 2VEDA 2RKOA 4P32A 1U2RA 2ZVPX 3QVVA 2QAGA 2LKDA 3LVRE 4GOKA 4Z1MA 2WKRA 2WWYA 3FMFA 4DB4A 5H8WA 4B6FA 3AVVA 5CB6A 3SYLA 4IOLA 3M4YA 4MA4A 5SZKB 4UNQA 1X8JA 3AVUA 5JSZB 4PHGA 2OLKA 1Z6XA 5CK5A 1G4UR 5C18A 1KK0A 3EIHA 1RJ9A 1JQJC 3O47A 4HATA 3P27A 1NN3A 4XWAA 1GKUB 3DDCA 3TIFA 5IK2D 2C9OA 4C7OB 3IEUA 3Q5DA 2YOHA 1D2MA 1KI1A 4CZ2A 1P2TA 2ZRFA 3GCGA 1TEVA 2B6HA 2GEDA 5EE5B 2Q9CA 3QE0A 4C0SA 3QKRA 4QJ4A 1ZM2A 4OKSA 1LV7A 3OIWA 1VG1A 1U81A 3R9XA 1JR6A 5HTKA 3ZQ6A 1EK0A 3NTUA 4V0OA 2ZE6A 4JYBA 3B78A 2OV2A 3EZ6A 5B2ZA 5GJBA 2C2HA 3CZPA 2IF0A 1E2EA 3BJIC 4LBYA 5JHHB 3P32A 3DKVA 4MGKR 2JASA 3LWNA 3SZRA 3ZVRA 3LXRA 2GF0A 2IYYA 2QL6A 3GFPA 1X1SA 1ELOA 3BORA 3ETLA 4PAMA 3I72A 3QXJA 4DHEA 4JBWA 4WIAA 1J8MF 2WV9A 2ZJ8A 1YR6A 3CBQA 4C2TA 1W4AA 1Z3IX 5FUWA 3LO5A 1U0HC 1F2UA 1XCPA 4IDHA 1F3OA 2A9KA 2JCSA 4B43A 5JFGA 1VHLA 2EFCB 2QROA 2GJAA 4Q03A 1NLFA 4PC2A 4WA7A 1XEWY 1US8B 2OBNA 2Q9BA 4RVCA 3GJ7A 4TMTA 4Y0AA 3A37A 1OHHD 4DBLC 1L4UA 5BWMA 2ZU0C 4K81B 5KU1A 4NPHA 2QP9X 4A82A 5BN3A 4Q1CA 1QDEA 4DLTA 4IDPA 3HU2A 3K09A 4U7DA 1XPOA 1XWIA 4JLVA 4H1UA 4HDQB 2FN4A 2R6CA 4NCIA 4LJAA 4M21A 1GL9B 1BOFA 1E4VA 3PG5A 1N6IA 3OESA 1M6NA 3DEFA 4TLDA 2WBLC 1CU1A 4QG7A 1NN1A 1YR9A 1MO5A 2Z83A 3MRSA 3TNFA 4A6PA 3T15A 1E0JA 3A1UA 3AP1A 4LJ5A 4Q47A 3HU3A 1PLJA 4DEYA 4EFNA 4QFMA 1N0VC 2NO0A 3CB4A 2PZGA 2VP6A 2REOA 3KB2A 3R8CA 1NVXQ 3Q3JB 3C7KA 3ZIAD 1OW3B 3FMIA 5KDOA 2NZJA 5A4JA 2XITA 4PHHA 1IY2A 1G5RA 1T5LA 1SHZA 2VTKA 4N1AA 4ZPXA 4M9QA 1NLZA 4RZ2A 2FDCA 1COWA 2NO6A 2NGRA 1L4YA 2ZRGA 1G8HA 5EXTA 2ZJ2A 2QAGB 3CX8A 5KO2A 3KQNA 4HLUC 3FFBA 1FPMA 2RGNA 1LS6A 3SDZA 3NBFA 3A6PC 3VR2A 5HKKD 3UIEA 1E0SA 3B1XA 3NHAA 4LI0A 2RGDA 5KOYA 5ANRB 1OIXA 2VHUA 3DMDA 2WIBA 3FFAA 4URWR 4ARZB 2P2LA 5CB8A 1CJTC 3GP8A 1KJWA 1KO7A 4DJTA 2FV8A 2GJ9A 2QP4A 1P9NA 1JPNA 2F43A 3KTAA 3MSXA 5DHFA 1KDOA 2W6JD 1Z63A 4QJ3A 3BOSA 3A1TA 3GMTA 5CLQA 1EX7A 5FOXA 1FW6A 3WP1B 1NMZA 1OPXA 2QI9C 4Q4AA 1T3SA 4BECA 4GSYA 5G3ZA 4Q66C 4F4CA 3KDSE 3RRNA 4US2R 2KSQA 2XJ4A 1JJVA 1EWRA 1Z0FA 4O25A 4TMWA 5FTKA 1M1YE 4WXPA 2VHJA 3SBDA 2ZI7A 2ZI9A 2ZITA 4AKGA 4JJZA 3C14C 1VTKA 4G5SA 4EJSC 4JLPA 1T3LA 3O8DA 4FMDB 5FTNA 3BXZA 5TB5A 3RYTC 2CJWB 3MLEA 5J47A 2IEZA 2AK2A 1DOAA 3TGPA 3GLGE 2P65A 1R7RA 2OBMA 4HLCA 2R2AA 1GOTA 2ZRKA 1OT3A 1UEIA 2JGNA 4M8NE 4S2EA 3K70C 1OKKD 5FTMA 4Q1FA 1CJMA 4HSEA 1BO6A 3IKJA 3QY0A 4PQFA 1ZAKA 2AKYA 2V55B 1OXVA 1KI6B 2FZLA 3AVPA 1E79A 2QU8A 3OFND 4TSFA 2AXPA 3GJXC 3HYTA 2AK3A 1Z5ZA 3OZXA 2BBSA 5CDFA 3UK6A 4BFTA 3R7WA 3W8NA 3AKDA 5B57C 3PUZA 4HUQB 1XD2B 4BZQA 4A36A 3Q8XB 3UPUA 2G83A 3PVSA 1OB5A 1KSHA 2B92A 3E70C 3ONWA 3V4RA 5GJCA 1SQ5A 4N0EA 3KXKA 2O8CA 4JLKA 1KTVA 1QHHB 3C8UA 1X1RA 5DGXA 5FR2A 3FKSA 1XTJA 3K0FA 4M9SA 4TT3A 3AP2A 2CE2X 3THYA 3FYHA 5JSZA 1NI3A 2JAQA 4QNMA 3K70D 3UATA 3CRMA 4P4UA 4CDGA 1KOFA 2QSZA 3LW8A 2H57A 2DPXA 2EYQA 2FZ4A 4ZV4A 3SYNA 2OCPA 2UVQA 2ZJ5A 2B8TA 4HAXA 2W2TA 2ZI5A 4XSHA 2Z0MA 3BK7A 4LGMA 1AA9A 1LB1B 4Q4HB 2C04A 2C8VA 4RD3A 5L3RA 4NMMA 4DSUA 3SQWA 3ZQJA 2XSZA 4TLCA 1NVVR 5B30A 4HB3A 4TMVA 1Q1QA 2GJKA 3VKWA 2FMXA 2XZOA 1GILA 4Q7MB 4PQYA 4B3DA 4E03A 3SHFA 1RIFA 2F1RA 4LJYA 2A30A 3LBHA 3ZZUA 4LJ8A 1AS0A 2GDJA 4Q1AA 4OL0A 3OEHD 1G5PA 4UNSA 5BQ5A 4Q1BA 2GA8A 3PCRB 1V43A 1GTVA 4HLQB 4AWXA 3V4FA 1G21E 5FI0B 4C30A 2IEYA 3VHXA 1DS6A 4PANA 5IT5A 4QBGB 3TAUA 1DELA 2X1VA 1NSTA 1XEXA 3K1JA 1UKZA 1IONA 4DSTA 5DH9A 3UWKA 1G16A 3HPQA 2F43B 2Q9AA 2ZREA 3K8YA 4JLAA 1CULC 3P4YA 1GZSA 1QHIA 1DEKA 2C96A 4A8JB 4E22A 2QBYA 2QAGC 3ZLJA 1S4QA 1Z6GA 3K0FB 5TARA 2NO9A 1UM8A 2O0JA 5DYGA 5LB2A 1HE1C 3A1SA 1KMHB 1IM2A 4XOIA 2GEVA 1E69A 1HYQA 4BFWA 3AV0B 1O87A 4HZUB 1US8A 1YE8A 4P31A 1PLLA 1P7CA 2H16A 4W7SA 3S1AA 3RSLA 5J4YA 1LF5A 2PMDA 1YRBA 2OILA 1XBTA 1XU4A 2RCNA 3C5CA 2A5DA 2AWOA 3QXHA 1E1RD 3LVQE 5EUQB 2JLZA 4XIGS 4R9UC 1KKLA 5KUTA 2CVHA 3SFVA 3ZYCA 3B6EA 4AC9A 3PEWA 1ZM3A 1XNJA 4RFSA 1W46A 1HEIA 4HAYA 4DZZA 2QMEA 2P67A 2ECKA 4B73A 2XNSA 1AKYA 2ZUCA 5FOSA 4Z54A 4LY6A 1NVUQ 1JXOA 5FH9A 3DPUA 1W36D 1SHKA 4LYAA 2QA5A 1AGRA 1GNQA 3UG6A 2FU5C 1A82A 5JLJA 2P5SA 1XEXB 3LA6A 1Z0KA 2KB0A 1E6CA 2MSEB 1NKSA 3B2EA 2QPOA 3LRPA 4AK9A 1S3GA 2E1RA 2DHRA 2G0NA 3KFXA 4GRAA 3X1YA 3VR6A 1JB1A 3KKPA 1WMSA 5H68A 5KSPA 2ATVA 1RW4A 4A8JA 2FWRA 1B23P 1U90A 1G1MA 2VSFA 2EVWX 2QBYB 2QM7A 4Q7KA 3AGQA 4K8OA 1RVDA 3CX7A 1YZGA 1ZU4A 1XMSA 3Q72A 2QT1A 4B74A 3THYB 2V6JA 2FPMA 2BMFA 3REGA 1PUJA 2GAOA 1JXMA 1NBMD 2VH5R 1YR7A 2GHIA 1IBRA 4KFUA 3C15C 1KSFX 1V5WA 2D7CA 3BH6A 3ZJYA 3SN6A 4DWJA 1H65A 2PEZA 3HR7A 3IQWA 3RANA 2ERYA 3KTAB 3R9WA 3EXAA 5FPTA 4XD7A 2CK3D 1DADA 1FX0A 1E94E 2ZSAA 1AS3A 2ZAMA 4Q4AB 1KO5A 2BM1A 2I3BA 4WAUA 3HP1A 1Z6TA 2NZ8A 2VPPA 4QRHA 1SVIA 4I4LA 3AEZA 4IFEA 2OG2A 5G53C 1R8SA 3NVAA 2V54A 3VX4A 1II0A 2DWQA 2J41A 4YMTA 4YMSA 1Z07A 2HDNB 1A4RA 3NH9A 4L8GA 4ZO4A 1Z0DA 3LAWA 2GZDA 3IIMA 2A5FA 3SE0A 4BPBA 2LCFA 3AVWA 2QAJA 4W9MC 2OESA 3B1ZA 1W47A 1KJYA 1OXXK 3FE2A 3H1TA 4TQAA 5KNDA 3EWAA 1T8UA 5FPKA 5J40A 4MYUA 3EZ9A 2V1XA 2JATA 4C4PA 2DFLA 5TXGA 4A8JC 3L0OA 2YJTD 3TSZA 1P2VA 1SKYE 1NRJB 4PHTA 2QPTA 3MMPA 1QHNA 1SVWA 1K8RA 2O8BB 4KO8A 2ZE7A 1U9IA 4OHWA 4E5UA 1PVOA 5HCNA 2G6BA 2WJIA 3TLXA 4NP6A 2R6AA 4DT1B 1MO6A 1QVAA 2GCOB 4PR0A 2H18A 2GJSA 2NO7A 3TVTA 3VFDA 1XMVA 4DCVA 4G5GA 1OIWA 5AUNB 3ADKA 1MRNA 2IYXA 4NTZA 1DG1G 3WXMA 1E9RA 2FX3A 3DL0A 3LLMA 1SZPA 3GLFA 4FCTA 3WBKA 1N5JA 4B44A 3CNNA 1G8YA 2GAAA 1VG0B 3KQHA 4M2LA 5JI3E 4US0R 1IXSB 1R5NA 4IHQA 1ZU5A 5A0FA 4X8OA 4URXR 3OF5A 4GOJA 3LNCA 1K5GA 2O8DA 3NKVA 2KE5A 3PR1A 2FSFA 4Q01A 3SOPA 2H1LA 3P20A 3SJAA 1ETUA 4EPTA 1Y3AA 5L3QB 2R8RA 2OAQ1 2ZRJA 2VSOA 1T4GA 4C0JA 3EC1A 4Q7JB 4Q00A 2ZUBA 2O8FB 1I4LD 4GMDA 4D4JA 2WWIA 4YXWA 2W6IA 4YMVA 3OIUA 1GSIA 1EXMA 3KKQA 4PHFA 1XPRA 1ZIPA 2BC9A 3QPWA 4TYYA 3ZVMA 1J99A 2H92A 1IY1A 2K5UA 1XCMA 3L82B 4AYTA 2QENA 4Q9IA 1E98A 4B2PA 1KHTA 5D3MA 1XRJA 4MDFA 2AWNA 2VYFA 3FVQA 4QHYA 4C0QC 4EUNA 3NDBB 1MRSA 2GBLA 5FBRB 4PC6A 2J0UA 3BB4A 1EWQA 4BEBA 1W0KD 3KXIA 2XJ9A 1OSNA 5DISB 4A92A 1NY6A 5JS8A 4QBIA 1BKDR 4IEEA 2D3WA 1KAOA 2GBLC 4NYMQ 3QOFA 4S35A 2ZEJA 4JVMA 4A6XA 1SVOA 2ZU6A 4P0TA 2NMVA 5DHAA 4UXHA 3EPHA 4OQLA 3K9LA 3BIFA 2QMHA 4R2HA 3D8BA 3N2EA 4G01B 4KLNA 2P6RA 4MYHA 1E9DA 1E9AA 1XDBA 4TLBA 4RZ3A 4YDSA 5JS7A 2YOFA 2YWFA 3F5FA 4NE2A 4OK3A 2QSYA 4UXIA 5BN4A 2W58A 3QF4B 1KMQA 2Q6TA 1U98A 4W5JA 1RJ9B 1VYVA 2F3RA 1WQ1R 3A1VA 4BWYA 2P5TB 1X8KA 3LH5A 2ZI4A 1WRBA 5AUPB 4IVPA 3EG5A 2H17A 4BLPA 3Q7PA 3VX3A 2AKAB 1R6BX 2YV5A 4TMXA 2A2ZA 3KB1A 3WNCA 4LJ6A 1LS1A 4X8LA 2FJUA 3CR8A 4ZDWA 4DCSA 3U6KA 4ZCLA 1W4CA 2QORA 2BOVA 2WM9B 1T0JB 2P0EA 4HAWA 2XOKA 2F3TA 1SVLA 4HUQA 2WTUA 1Z6YA 3GFOA 2WIAA 1GG2A 1SVKA 3B1YA 3FMOB 3VR1A 3SJBA 1G9XA 1G7RA 3RLFA 4CRWB 3GLIA 1JALA 2XB4A 1JEDA 1ZVQA 2Z5FA 5CJ2A 1EFTA 3PUVA 2I1QA 1X3SA 3MUFA 5J5CA 2ZSFA 1IJFA 5D3QA 2Q0HA 5CYPA 3BS4A 3KXLA 4AYXA 1D9XA 3THWB 4LBWA 4D0NA 2P3SA 4AG6A 4O2RA 3U60B 2V3CC 2ZRCA 3UMRA 2XTNA 2ZRIA 2JLRA 3SQXA 1N5KA 5E7MA 1KKMA 1MO4A 1T9HA 2PEYA 5AJYA 4NHOA 4KU4A 5DI3B 3CKLA 3R8FA 1S3SA 3D3QA 4B2LA 4CF7A 1G3RA 3K53A 1CR4A 2AD1A 4DT1A 3NBYC 1DBSA 2Z4SA 5JJLA 1NJGA 2EQBA 3HDTA 3NC1C 1E2IA 4GP7A 2XTZA 5JWHA 1JAHA 1R0WA 1VMAA 2IS4A 3DMNA 3CRVA 1BIFA 4DDVA 1CTQA 1HQCA 3B9PA 1CJKC 3DOFA 4ILEA 3QKUA 4D0LB 1OV4A 2GVDC 4OI4A 1ZUHA 4NL4H 2GXSA 4GBMA 5DIFA 5BW8A 1TQ4A 2WWWA 4MRRA 1DAMA 4M1MA 4AKIA 1ZD9A 4U00A 4WW0A 3QI2A 4KI0A 3AVYA 1E0KA 1KSGA 4OHXA 4RD1A 5ELXA 2NQ2C 2FG5A 4DB2A 2R65A 1S9HA 2O52A 3MJRA 2HCBA 3KKNA 3MJHA 4LPSA 1OXUA 1XD2A 2WJJA 1VG9B 1UBGA 1XZPA 1Z83A 3IBGA 4NYJR 1WXQA 4P4SA 1LY1A 1G41A 3MG9A 4LBVA 3THOA 2XNDD 1ZM7A 2ZYWX 3IUYA 1ONBA 4I1VA 3ND8A 1GNPA 1CEEA 4CT4B 4FXPA 3K09C 5FPSA 4BLTA 5JCZA 1KI3A 4CVNA 2WJYA 4DVGA 1DAKA 1CRPA 1DAIA 3DZDA 3KQLA 4YDHB 2O0HA 3RABA 2N46A 2DB3A 2O8EA 2VL7A 2ODEA 1TPZA 1F2TA 1I4DD 5EZ5A 1Z06A 2X2FA 3FB4A 4QM7A 2YKGA 3GJ0A 3PUWA 4KODA 4DSOA 1Z08A 4OJQA 5JWOA 1B0UA 1ZUNB 2YZ2A 2ZRBA 2ZSDA 3ADBA 4QL3A 2PX0A 4Q4JA 3TQFA 4M1OA 5TV2A 1HE8B 3DVLA 3LW7A 3C4JA 3NBXX 4UJ5A 1IXZA 4QKQA 2JEOA 4KYUA 1Z0AA 4DRZA 5C46F 1OH8A 2ZXUA 1T91A 4PAOA 2RGXA 5FPYA 4CEIA 1VPLA 4ERNA 2AFIE 3IIKA 4LYFA 1KK3A 4I1OA 3BBPA 3T06B 1ZD1A 1ZNZA 3AF0A 1KAGA 2VP0A 2NPFA 2D4HA 1ZC4A 2ZRAA 4DLWA 4L9SA 1ZYUA 3KQUA 1G6HA 821PA 1XJCA 4IXNA 4O0MA 1HY3A 2J0VA 4MKHA 4R71A 1E2PA 4Q9LA 2GXQA 2KJQA 4KFTA 2YC4C 4OQNA 3GLIE 3TJZA 1JAIA 2ZI3A 2P6UA 4IDNA 2BKUA 4HB0A 3U3JA 3X1XA 1D6JA 4PO8A 2FE4A 4HEJA 3T1VA 4NONA 4PPQA 4IEIA 2XEXA 3BFVA 1VECA 4B3XA 1A5TA 5DI3A 2B7BA 4V02A 5JZVA 2J0UB 3I8SA 5DO9A 2BBOA 4TT3D 1COWD 4CYMA 2HF9A 5AR1A 3WMEA 1ZMXA 4D80A 2WSSA 3GLHA 1ESNA 2G9NA 1XZQA 2OHFA 5BYKA 2HYDA 3PITA 2JDID 3OHMA 2QMUA 4DLZA 2CMKA 2QP3A 5K8TA 4JVSB 1TU4A 3LFUA 2WJGA 2Z43A 4LYJA 4IVRA 2BBTA 3IHWA 3GEEA 2EWWA 5LB4A 1XX6A 4FINA 4DSNA 3AB3A 5LD2C 2ZUDA 4WXRA 1QZXA 1CP2A 3ZD6A 2WSSD 2QMOA 1C9KA 4Q1EA 2QRNA 4F92B 2OZEA 4CGZA 1FTSA 1SVSA 1OFUX 1VCNA 4A2QA 2VHCA 4A2WA 4PO1A 1U8ZA 1R5OA 5FOVA 1CR2A 1VDZA 2C9YA 2DYKA 1KIMA 4FCVA 4HZUA 4XJXA 1E1QA 1AJEA 2ORVA 2IBMA 1OYWA 2HUPA 2ZJOA 3B7GA 4AY2A 4B48A 5CIQA 2REBA 3RSOA 5FI1B 4TTRA 2V9PA 2VF8A 2O5VA 1LNZA 4TTQA 2GKSA 4PAQA 5C2JB 1K6MA 2FFHA 4XWKA 4JLJA 4BE7B 3B13B 3B1VA 4M1YA 3WYAA 2WPDA 3KKOA 1KNXA 1OFHA 4HAVA 3U44A 3RC3A 1N6RA 5KDLA 3B85A 1A7JA 1SXJA 4HB2A 4C0BA 1WCV1 4MRNA 4TMKA 5DNYB 3A8TA 1D9ZA 4NCJA 4KCGA 3RWMB 3FGNA 1NIJA 1MT0A 4DCTA 3T1QA 4G5QA 4ON9A 4MITA 3BE4A 1SXJC 2V8OA 5FL7D 4LJ9A 1OF1A 3VU9B 3WRXC 5F3WB 2ATXA 1ODFA 2VA8A 1RRPA 4LPKA 4PTLA 5B64A 4BGDA 4TZ6A 4YQFA 5EP1A 4HI0E 4J0QA 4CEHB 1E79D 3OFNA 3O8CA 1IN7A 2EWVA 2IXFA 1FMLA 3AVTA 3PV0A 2JJ8A 2R44A 3T1TA 1G8FA 1E0AA 3BFXA 4C0AC 3W8RA 4D26A 3THXB 4HDOB 4LV5B 2PMKA 3CNOA 4F91B 3J81k 4B3GA 1MV5A 121PA 4M1KA 3L8YA 1W2HA 3VR5A 2IXEA 1XXHE 1ZNYA 2R6GA 1EG7A 4MYTA 1FP6A 1HT2E 2J3EA 3L2OB 2D62A 4ZI3A 5FR1A 2D74A 4D4LA 3X1DA 2PCLA 1E2MA 1J2JA 1JEEA 2PH1A 3QQ5A 2IUTA 2IYLD 1Q3TA 1EESA 4GOXA 1P2UA 4IDOA 2VF7A 4OYHA 5JI2E 2ANCA 2GCOA 5DLQC 1P3JA 3X1WA 4II7A 221PA 4XVQA 2CLDX 2KBFA 4JVNA 4OQFA 1LTQA 1GNRA 3TUIC 3WNBA 1KDTA 4KVGA 3IHLA 4O2LA 5EXSA 4FN5A 2OM2A 3K9NA 2ZRMA 2Z6VA 2ZR9A 4N3NA 3GLGB 2ZJBA 2BMEA 1W0JD 2HT1A 1IN5A 3UG7A 4ESVA 2F9MA 1TEXA 2O8CB 4EFMA 1NBME 3ADDA 1R0YA 1P5ZB 1G3QA 3U3MA 3ZS8A 4TQUS 2GXUA 5IF9A 2WJHA 4JYCA 3TH5A 2HXSA 1IN6A 1T6NA 3QIAA 4JLOA 2GESA 2RGEA 3SHWA 5K8LA 1WP9A 1T3HA 4XD7D 4A2PA 1W36C 1KZGB 5EQTA 1KJZA 4JLDA 4D4KA 5JRZA 1P4SA 3EARA 5KYKA 5TVKA 1EFRA 2RGNC 2GF9A 2CCGA 1JR3E 3RC8A 2IK8A 3AQ4A 1N6KA 3E1SA 2OT3B 3O8BA 3EA5A 4DDUA 2ORIA 4NYIQ 5AUQA 3D31A 1VHTA 3LD9A 4R98A 2G1KA 4NU0A 2O8FA 1KNQA 3GLFB 1VG8A 4AKHA 1YZTA 2JLQA 4DDWA 2NOAA 1CF4A 1XTKA 2CHQA 2MMCA 3GJ4A 3EZ7A 5JWRA 3K0CC 8OHMA 3CPEA 1TUEA 4I99A 4LDJA 4TL6A 3NHBA 4QM6A 4EPXA 4MDEA 1JECA 1OKKA 2ODBA 5E95A 3TE6A 2C5LA 1XJQA 4GMXA 2CLSA 4TN1A 1KI4A 3HYRA 1IY0A 2IYUA 3QBVA 5JMTA 3FDIA 3PUXA 1OH6A 3GQBA 3SEAA 3I61A 1GVNB 3NXSA 4HAZA 4R7ZA 3T1OA 1P61B 1RE0A 2HT6A 2RGBA 3L8ZA 2GETA 3HWSA 2J1LA 4NYMR 4G3XA 3RRYA 3VR4A 4B3BA 1TADA 4DCNA 1KDRA 3L0IB 2H5EA 4JS0A 3MGCA 2I1VB 1GL7A 4QGHA 2GRJA 4PFSA 4TTPA 2WJVA 4KFSA 4URYR 4XTCS 4OQXA 1P75A 4M9ZA 4LWZA 1E9BA 5J4HA 2DFKB 4ITRC
chains in the Genus database with same CATH superfamily
4LQ4A 4RQTA 4XGNA 1DDGA 5EL0A 2FMKA 5FB3A 3WS7A 4B80A 2OTCA 3PCXA 2Z6QA 3MF4A 4LISA 1C7FA 3FD8A 2DT5A 1D6NA 2Z58A 4PSVA 2GERA 4PFKA 1X13A 4IGAA 3OZAA 3Q2KA 2DHDA 3C3WA 4FDVA 1QG6A 4WNIA 2O2XA 3FJ1A 5FBWB 2PE5A 3IEVA 2A6PA 4FFMA 1NW3A 3HQ4O 3A9CA 4OQPA 1FUEA 3LPLA 2EU8A 4RD4A 2WAMA 1D0IA 1VGQA 3B7PA 2PZEA 1S2IA 5JARA 3CKMA 4RD2A 3LYHA 4YMLA 5KX5B 1PIWA 3OIGA 2QM0A 1WOYA 2IZ1A 2ZIZA 2HRZA 2NXJA 1AO0A 4J3JA 1QH0A 3DO6A 2PUDA 3UW3A 1UKCA 2BI8A 1JEYA 4QFCA 3DV9A 4BB9A 1W85A 2BBWA 3T6KA 4FW9A 3L77A 2I8LA 2QN2A 2WOJA 4MDHA 4CMJA 4CW7A 2PJRA 3IMCA 2FMIA 1YASA 1L5HA 1W5TA 5C52B 3ICCA 3NETA 3OP1A 4HXGA 3FAZA 1TO2E 1O4VA 4M1WA 4I08A 2CMHA 5DTRA 5BURA 1L7NA 1X7ZB 1P5RA 3G2NA 1H6DA 1JZQA 3HZHA 3I73A 4L6CA 5A5FA 4X97A 2IWRA 3HBAA 2W8BA 5I51A 4WOCA 3V1TC 2KS6A 2YOGA 3MMNA 4JVOA 5BYJA 4OK5A 5L7TA 3T38A 2NU8A 1N3BA 3G2IA 1YRAA 4OY3A 2FSPA 2X19A 1AKWA 4DC9A 4J0DA 3UJBA 2FN3A 4MVJI 3RB8A 3I62A 3U4AA 1M5TA 4BLVA 1FL9A 5BV1A 4EQ6A 1NSYA 3I9FA 1N9KA 4RCZA 1OY1A 1R9MA 4MP3A 1U3GA 1R8QA 1T4MA 3M83A 2JFZA 3G5UA 4GR5A 5FA8A 5JV5A 3EISA 1DQZA 2NO5A 3IDQA 5ALRA 4R5HA 5CFPA 4KVFA 5HRUA 2RGAA 1A95A 3FRJA 4OBWA 3WHPA 5LOVA 1QU2A 4MV7A 2LIVA 3KHKA 1JE0A 4AURA 3NBZC 2FMHA 3O38A 5HUJA 1THGA 1FVXA 5CYOA 4JQSA 2CXQA 1DARA 1E4YA 4BLOA 3ZCQA 2A8YA 4XFJA 3SNHA 1KK1A 4OB6A 2Q1XA 3TLAA 3L7DA 3OT1A 1LLCA 4FW8A 3TZEA 3VO2A 3QY9A 2EXXA 2DQYA 2EOAA 3KQQA 1T9GR 1DBRA 4OOEA 4CEJA 2XVYA 3KZCA 3MS4A 4I7EA 2Q49A 3EXEB 3M6UA 3KEQA 2G71A 1J0EA 2QM8A 2I5PO 3GDOA 2CXPA 1W5FA 5ALOA 2XUJA 3STYA 5JQWA 3B52X 5IBRA 3JARA 1U8YA 5AKZA 4JJ4A 2CL7X 3ZGXA 4DC1A 2R6DA 5EJ5A 2QR3A 1Z6ZA 1WHTB 2E49A 5IPFA 3I2GA 3DHVA 4QASA 4QREA 1VKHA 1C2TA 6ABPA 3N3BC 4NBVA 5DRTA 3T35A 1DC3A 1T8RA 1JSXA 3OLVA 3UICA 2V7XA 2X1HA 1DC4A 4RKEA 2R8XA 2X42A 3N0WA 4BQFA 4C7BA 1YFZA 3WWPA 3RADC 3BCSA 4N12A 3EYAA 4IH4A 3TK1A 3CX6A 1GIAA 4XAQA 1W52X 2XE6A 5JQGA 3MOGA 1Y4AE 1XNRB 1KYQA 2H8GA 5FUMA 1CJSA 1OI3A 1CEQA 3KC2A 1T34A 1Y7LA 1C4WA 2X13A 1NVWQ 1F2DA 4FYMA 4YXWD 5LP1A 2EDAA 5LOVB 4TTAA 1B6SA 4HYEA 4YPVA 4QT4A 2PH3A 5EHZA 1ZGGA 5KQSA 2CWWA 5F12A 1JJFA 3CH6A 4YP0A 2IHKA 1MKYA 3BIXA 1N6PA 3ZOZA 3UMSA 5EJ6A 2TMKA 2Z2XA 4GD3Q 2OK8A 1YKSA 1R12A 4OREX 4WNYA 4KXNA 4Z7OB 3Q85A 5FRDA 1KE1A 1DJLA 1ZEMA 2V5VA 4K2AA 5G0WA 4EPRA 4JB0A 2CF5A 5HNKA 4LC1A 4DG5A 4X1IB 3WYGA 3E3OA 3ZE7A 4AI6A 3ZDZB 4QX6A 4BMVA 2E9SA 4L4YA 3I1FA 5AOBA 4XVUA 1YS9A 4ZHSA 5CLHA 4LOAA 4KPUB 5CA1F 1XXHB 1TQHA 1FTNA 3C0KA 2HIAA 3KFLA 4XJVA 3S55A 5K0EA 3MJDA 2I7TA 2OCLA 4JSYA 4CXMA 2XUKA 1XAJA 1ZD8A 2B78A 3S2GA 5AW5A 5FI3A 4JP2A 4R68A 1J0BA 1DT5A 1JDJA 4HX5A 1FOEB 1ZIYA 2BR5A 1ZW1A 3J80A 1AQYA 1GEGA 3BGVA 3AHDA 1QIJA 3OI7A 4XA8A 5FUYA 3C3JA 3RRBA 1QO7A 1F4PA 5JUWA 3OC6A 1WF6A 5K0GA 1H22A 4RF5A 2ILTA 3PWKA 1QVRA 3X43A 3LCRA 2QT0A 5CD1A 3HB9A 4HTAA 4W8OA 3TMKA 4R8KA 2PR2A 3TNDA 2D1FA 4G07A 2GN6A 4ZD6A 4RZIA 4I14A 4MJ7A 1G3MA 4OFZA 5CB4B 3ELBA 4AQYB 1G8MA 1GD1O 4OUKX 3JQ7A 4C5AA 4EECA 3LBNA 1PR3A 3TZQA 5KHOC 4N7BA 2XYHA 4HVTA 1DJMA 2QRQA 4XIJA 4AKEA 4Q4CA 1N25A 4FN4A 4INOA 4D9MA 2KYRA 4G4GA 5HS6A 3SJCA 2J6CA 3QVTA 3TTSA 2DPYA 3KS9A 1P17A 4CMEA 4LYDA 4D57A 2VP4A 4N7RA 4RK5A 4K6OA 2CHVA 3CLTD 3S7ZA 3V3KA 1Z29A 2HIMA 3QH4A 1G20B 1RQNA 3BSFA 2VBFA 3TX2A 4QOSA 3ITDA 1JYFA 3DJFA 1F5NA 1Y89A 3BIOA 2C77A 1D2HA 3FRHA 4H2DA 1ODKA 1UKYA 2JFBA 3AEQB 3OCYA 4Z7QB 3R7NA 1Q1NA 3DONA 3P45A 4M9XA 1VJCA 1AK9A 2FFAA 3OPMA 3UJ7A 2PKQO 4EW2A 5ALMA 3IQIX 2QIOA 3UK2A 4DLBA 5IJ0A 1WULS 3DULA 4XI9A 2PNJA 5FJJA 1ZJ5A 3VUFA 3SMVA 4EJMA 2HNAA 4P3XA 2PLAA 1XLTC 4L74A 1SKYB 1I3NA 3H2YA 4EY4A 1IJEA 1M6HA 3MD0A 4AP5A 3K9FC 1HFJA 4A0QA 4HPWA 1IN1A 4QSMA 3U1BA 1Q5PA 3O2NA 1GTRA 3H1PA 1P60A 1XKXA 5F9FA 2I2XB 4FI3C 2IEAA 2QTHA 4I9GA 1G291 1EFCA 2HZBA 2UUAB 1SPBS 5J5AA 4HL6A 3ILSA 1E2GA 1U2ZA 3DPSA 3OVMA 4FBLA 1QYDA 2YHSA 4NJOA 4OG2A 4REMA 3WICA 3UJNA 3DT6A 5DWQA 4DQDA 5T7BA 3G5AA 2QM3A 1Q57A 2PKRA 3BJEA 5IAGA 1KFBB 3K5PA 3NM6B 1OH5A 4UAVA 3WLLA 1HURA 3M6XA 2HNKA 1TT5B 5ALUA 3ROKA 5D85A 2F55A 4QEZA 1CY6A 1JHZA 2G7ZA 3KJXA 4UUAA 3CVVA 5PNTA 4C0XA 4C5BA 1F4LA 3WR5A 1JIIA 3N7TA 2HWWA 3REQB 1ULTA 2RH5A 4R31A 4UBMA 4M6WA 2HWYA 1IU9A 2Y1GA 5EUBA 2IYOA 3LXMA 2C82A 5JW6A 1P1JA 4FK8A 1IUPA 4KXQA 3FOEC 1R0CA 1PZHA 1B6GA 4PPYA 1TUBB 3N7UA 2BTOA 3NEYA 1IPFA 3KSZO 1VHJA 5KVSA 2VHVA 2AHOA 5K8JB 4YP6A 2GX6A 3CF0A 3MB8A 5LDDC 3IHTA 3TX6A 1FFCA 1OXTA 3EC2A 4GWLA 2E3JA 4D81A 4PG6A 5BV8A 4NV3A 3PEVA 2IEGA 1KBOA 4A0GA 3W2IA 3C24A 3MJCA 5KMGA 4O2AF 3KVOA 721PA 2VEOA 4WV3A 1NDHA 5IAEA 1OBCA 3HB7A 2YFKA 4LXTA 5FHRA 3ICOA 3PDJA 1JAYA 2OZPA 1IBLB 3DZFA 3QYFA 2FEKA 4URUR 1TF5A 1CUDA 4R3WA 3KV1A 4W8HA 4BP1A 5MF6A 1RYFA 7MDHA 1GM5A 2C7BA 3EZGA 1FLNA 2F48A 2QTWB 1AGYA 1RR6A 3MWEA 1II9A 4M1EA 5AOCA 1SQGA 3IIIA 2AUMA 1KDPA 2F9LA 3HFJA 4PZPA 4R7TA 2I6FA 4S0XA 5IDYA 2O7VA 2J0QA 3PXXA 3J7TA 3VNRA 1JPJA 2D2EA 3NTLA 1CLUA 3K0CA 1PVVA 1W4RA 3VMFA 5C8XA 6PFKA 3KXDA 5JADA 4B2IA 1ZINA 2ZFUA 4F7DA 1SXGA 1OTHA 2ZRHA 3K8QA 2PZFA 2BJHA 1NQTA 1XMJA 3IOYA 4QUHA 3RQSA 1CW2B 1PL7A 3JATA 3VZCA 2QTFA 3TSYA 2HCRA 2CNLA 1MT3A 4G1UC 3R76A 5KSYA 4OH7A 1G8PA 3ZZTA 2O7RA 4MROA 5F78A 4OI0A 3PGJA 1TZMA 4LF9B 2IWHA 2ZULA 3MILA 3CWZA 1QMGA 1BDJA 2BONA 2RMKA 2LDBA 2QQFA 5TMPA 2YIMA 4FYIA 3TJMA 1L1QA 2C4HA 2NVOA 1TZ2A 1ISMA 1YZFA 4NE9A 1VFNA 4V3CA 2WNSA 3KJIA 2FJPA 2HF7A 3HNOA 2FDRA 2HH9A 1OAAA 4Y98A 2G5GX 1EK6A 2H08A 1ULAA 3EVEA 3ANLA 2CFRA 1XRMA 3CM0A 1FP4A 2C03A 1J8YF 3L8DA 4IJMA 5D84A 5HBGA 4F8EA 2ZE5A 2BMDA 2ZIAA 1ZHFA 2GK3A 3H2SA 5E9QA 1OYOA 2DUJA 1O95D 2I22A 4BO9A 4KYVA 3KZNA 2RJNA 4UQPA 1NURA 3BE5A 4EI7A 4LW8A 2HLNA 4UTZA 5BSUA 3BMQA 3W5BA 2GK6A 3ER6A 4Y9UA 4IILA 3R7DA 4EG7A 3WAJA 4XWYA 5B58C 2J5KA 4LJ4A 1JEQB 1I14A 5JSQA 1PD1A 1R64A 2JRCA 2FCAA 2ZS7A 3Q4GA 5JDCC 1F1BA 1EXNA 5EE0A 4DMUB 1C9MA 4K9RA 5KZMB 2G1PA 4KQIA 3EJWA 2OXRA 4YP7A 1R8YA 1XTQA 4BNMA 2C8JA 2XNCA 4KOAA 3ZY5A 1VMIA 3FETA 2YWJA 2DG2A 3W3ZB 3AKCA 1TF2A 1BS9A 1EK1A 3D6TB 9LDTA 1L7OA 3NH6A 2R4TA 3N6VA 1WB9A 1CK4A 2OFOA 4HBZA 4PZEA 4CCWA 1EZ1A 3NCHA 3EXIA 1OA1A 3OEEA 1R0XA 4JWKA 1CNFA 1P1CA 2V5UA 4R4JA 5EIHA 3Q3HA 1YRQA 3ZHBA 4IRMA 1N8SA 3RE1A 2VHTA 3G0CA 4DKXA 3DMFA 2JA2A 5AOVA 1Y6FA 3SC4A 4XGRA 2OBYA 4UM9D 1AH2A 4PCAA 3TMAA 1IHOA 4C2AA 1CUYA 3B3AA 5P21A 5CB4A 1GGKA 1I2DA 1VCHA 1X0XA 2C5HA 3AGPA 3HDJA 3JAWB 5K3SA 3IODA 4IH1A 4C0WA 1WF3A 1U7DA 2M1ZA 1EQUA 2R6FA 4YRGA 5KNLA 5FBLB 1W44A 4MP6A 1T1GA 2R66A 5EP3A 4DN6A 1HDOA 2QTGA 4Q39A 2C94A 2RBGA 5DX1A 2ZR0A 1HWYA 5BN5A 3NW9A 4KQEA 5K99A 3PA6A 4BVHA 4PNHA 2B7CA 3RG8A 3MCUA 3QG5A 1PV4A 3CIOA 1BYUA 3BC1A 5D1HA 2YV2A 2R00C 4RVGA 5JBQA 3VO1A 1PSWA 4BLUA 3RNOA 2R6JA 1U3TA 3DQQA 3EPRA 4XKJA 2I1LA 2I65A 2DEUA 3ONVA 2C57A 1WXHA 2WWFA 4Q9AA 4C06A 3WMGA 2C00A 4EELA 3C8ZA 4EHJA 1LKZA 2OFWA 2QDKA 1YOVA 2QRZA 5KYVA 1Q19A 2QNRA 5A4DA 2BV3A 2RAVA 2YV4A 2GI4A 3AKEA 3NWJA 1OAKA 4ID9A 4N6GA 4RY9A 4TSRA 5C1DA 3TUZC 2AX4A 2F8SA 3DMPA 4PYIA 3LX4A 3PPVA 2XAUA 3SS8A 1Y6JA 1EFVB 2SNIE 2PYZA 5AJVB 1WLYA 5G4LA 4AMUA 4JDPA 3IIJA 1PGQA 3S2ZA 4BBZA 1G5IA 1V25A 1IWOA 1WCXA 2QX4A 3BWDD 3ORRA 5B4VA 4WINA 5JFOA 1L8LA 5AK0A 2A1UA 4B8WA 3I42A 3M6WA 3DAOA 4NJEB 1ACMA 4P53A 3WOVA 4D6XA 5J4LA 3EWSA 1QPGA 3ZDQA 1A5AB 5HQJA 4ZIRB 4OXRA 3WFJA 5JCOA 1KZ7B 2WWTA 3EGWA 4OHBA 5EQDA 1J6UA 1VKRA 1Z4NA 3D81A 4IDAA 5BNZA 1RMQA 1WA5A 4I81A 1PL8A 3H75A 5DXAA 4B4OA 3ZPXA 2Z2KA 1YMQA 1XQ1A 3EZNA 1EDBA 3QFCA 2J7PD 3PXGA 5ERGB 1C81A 1XB2A 2BH9A 4UTPA 5I9NA 5G0TA 3W1WA 1Z0JA 2AFIB 4DG9A 5C5EA 1BC5A 1U7OA 3WLAA 3HJHA 4FBMA 3S1SA 2XCSB 2W2VA 3GJ3A 2BMJA 2I0FA 3IUBA 4S1OA 4FMCB 2PGXA 3D02A 3KJNA 4M6WB 4FHZA 4MJ3A 5KTTA 1R74A 2PD6A 1J42A 1U9ZA 2XLBA 4OEHA 1PT6A 1JLLA 3K1AA 1RABA 2O59A 1YOVB 3T4PA 1E1LA 2AA3A 4KPYA 3GRVA 1E1NA 1M3SA 1IC6A 1TFRA 3HZRA 4L16A 2PGAA 2JH8A 3A0RB 4DV2B 2I4OA 1OFIA 4Z2AA 1DDOA 3FR7A 2XE4A 3WP0A 1TC2A 4R9SA 4PW0A 3KBOA 2VT3A 3G7NA 1JPUA 3HO8A 3U3DA 3QPVA 4C04A 3FTEA 2ZBEA 1HRDA 3UJ9A 3CXRA 1EXVA 3QHQA 1WVGA 1GAEO 3EDMA 3EMBA 3K4PA 4P58A 4QPJC 2ON6A 3TL6A 1P9WA 1YRWA 2G0TA 3H87A 3K1YA 3KDAA 2HF8A 2J48A 1NUHA 3B6IA 5BR7A 2FEMA 1DJOA 1ZOOA 2QJFA 5KVCA 3F0TA 4C6HA 2PH7A 4EG1A 2L19A 4BVEA 1DFIA 1YIOA 2AD5A 2WFZA 2ZRLA 1KPIA 2MYPA 3IAHA 3H3XA 1UDCA 2J9FA 4Z4HA 1EFRD 3H86A 4PC7A 4ECAA 3RJMA 4K9NA 1KI7A 2V7QD 3RS4A 1E6KA 4MI9A 2J85A 2WWRA 4GR4A 5TS3A 3BMOB 4ZCIA 2I2CA 4OQMA 1OQAA 2UU9B 1Z6AA 1R6UA 4BP3A 3B3GA 1HH4A 2QT9A 2HK8A 4FX5A 1JMKC 5EJGA 4F3RA 1L7PA 1B73A 2G17A 3BIJA 1MAVA 4CBVA 3L4KA 3BERA 2WPDD 4F38A 1ESZA 2EW2A 5GWXA 1PJRA 4R8LA 4QFBA 1PI3A 2YW2A 3QUAA 5B7PA 2J6BA 2J9YB 2GK7A 1U4SA 1XP5A 3GFFA 3R3HA 1GWNA 1SOMA 3PFHA 2Q3DA 1G21B 4AJHA 3UUGA 5K0CA 4AS1A 2QZ9A 4MWBA 3S0JA 1A72A 1NF2A 5CB4F 3DGFC 1W9HA 2PS3A 2X77A 3UK1A 4DXAA 4P1ZA 3BSSA 3LX8A 1QRAA 3R9KA 2Y1CA 3EGDB 3SNKA 3UTDA 3ZHVA 4NDAA 3ZHRA 2UZ4A 3B8HA 1Q50A 1ZW6A 1H1LA 5IU6A 2NTEA 2DT8A 2P4SA 4H59A 1PSDA 5JZSA 3OQPA 2VQFB 2HCFA 1HLGA 1UMBB 2E6UX 1SD1A 3JSAA 4OFXA 4Q93A 4ZEWA 3HABA 1Z25A 4TL8A 5FV4A 3GLHE 5H16A 5HJEA 3KR9A 1WPRA 2JD1A 2RGYA 3O1IC 2XNHA 2JJ2D 2P9TA 3EEIA 4K6FA 3V6LA 4BKUA 2XXAB 4DKJA 4JD5A 2OV3A 3E2MA 3VR4D 1Q95A 2VP2A 3BRCA 4LDZA 5EPEA 1ZI6A 3AUSA 3GD7A 5CXQA 3NAQA 2RH8A 3EBLA 2KLHA 5IMSA 2I2WA 3FSEA 5TS2A 4KRFA 4LX8A 5J4VA 1AF4A 2WT4A 3S81A 4QGBA 3EY4A 1NI4B 4K9QA 3X3HA 3W6PA 1MO3A 6REQA 2QQEA 3JQEA 1TYZA 4IWXA 3VPAA 4GL2A 2OCKA 4IO1A 4GVPA 2X3YA 1FA9A 4LF7B 1ZVVA 1VRVA 3EX7C 2D54A 4RK0A 3QNMA 1VCOA 2WVJA 1II8B 1H2EA 1XXHA 1UMDA 3GJZA 3GRPA 1VHDA 2Z9CA 5AK6A 1FYXA 4MVWA 4QPZA 5KAMA 2NO1A 3KKZA 4UNPA 3R3SA 4YRJA 3L93A 5JY1A 3TFOA 4M0LA 1RYYA 3GGDA 3OC0A 4KBGA 4PRLA 5A3VA 2JEYA 3GFBA 4PLWA 1M7HA 3T5MA 1JHOA 2G8LA 2R62A 4LV6A 3ZHOA 2CL6X 1R3DA 3DDZX 3N05A 1NP6A 1T6BY 2O57A 1G19A 3IXMA 4LZPA 3U4DA 3K0EA 4X61A 4EUSA 2QL9A 4BX3A 1OYVA 4DV7B 2YV1A 4A8HA 2P8SA 3DWGA 2D1YA 4KZKA 2C97A 3AFOA 3AR8A 4ISCA 1UAYA 5IVIA 1XA0A 2I7VA 3S2FA 2YWBA 3BJMA 4HQNA 4PPNA 1W36B 5FOUA 2CUKA 5E6RB 4DQVA 3NC0C 3PQ4A 2IHNA 2V0NA 2WC1A 4GPTA 4BN5A 3U7HB 3FPAA 1F3LA 4L02A 3VR0A 3A7DA 5IANA 1MHPA 1VP9A 3W1EA 3PDCA 1MIOB 4ZRMA 5JYCA 5LXTA 9MHTA 4I4TB 3RS5A 2E2WA 5EIWA 1CQIB 1KIFA 3ACDA 4LHVA 3ZZNA 2HM7A 3A1DA 2ZSBA 1F6BA 4XFKA 4WXHA 2PWPA 1LK5A 3LV8A 2WFAA 4NWIA 1M8PA 3L8CA 1QHEA 2WU3A 4RDIA 2JKVA 5AM5A 4OSPA 4MS1A 1GNTA 3ZUGA 4TKZA 1SCQA 4RFSB 4R05A 2FA9A 4RF4A 3S2EA 2Q6KA 4GZMA 1VYUA 4HQLA 3C41J 4FJ2A 4IFBA 4NF2A 5LP6C 2EL7A 2G36A 3ZV4A 4B47A 5M34A 3S99A 5HFAA 1T26A 5C8VA 1GFIA 2ZPAA 1E3WA 5KNBH 2B82A 3TKLA 5J2UF 2OEPA 1UBSB 4B45A 4D7AA 2IX3A 5DHUA 4UMFA 3P2JA 1QR6A 1UJ5A 1OJLA 4NPAA 3EB9A 4B40A 5AUOB 3IAXA 1QQ7A 3HC7A 1SCAA 1TQ8A 2VP5A 1JF8A 3H8JA 4UQOA 4B76A 3I34X 3RFXA 2ZQ5A 1DBWA 2ASEA 3W9SA 2WZQA 1RWNA 4UHEA 2LCQA 4CM9A 3PI7A 1Y7PA 2FX2A 3MK31 4IXTA 4LMBA 2VP9A 4F1WA 3G2PA 4MPPA 4WVFA 4X85A 1U9JA 3U3XA 5HUHA 2W48A 4ME6A 3MD9A 3SQDA 1N5LA 4ZT5A 1TYDE 4ZIRA 5B53A 4E3WA 4OX9Y 1EEHA 1CQIA 3ZTWA 1P1FA 1UPXA 2PXAA 4GSLA 1P1KA 4PU0A 4MV6A 4RPCA 5T41A 1QIDA 3QXXA 4RAOA 1P81A 2J07A 4WCFB 1TT5A 2B7LA 3OKAA 3PYXA 4X1KA 3GDGA 1NT2A 2FP4B 2YWRA 4BCBA 3QTBA 4OB7A 3KSMA 1WKBA 5DN6A 1G3UA 4BKMA 4CUJA 4A15A 2L18A 4EW3A 3CNBA 5L3QA 1APBA 4X8MA 1RWPA 4QXOA 3KYJB 1LQ2A 4ZYXA 3INNA 1E89A 3PJRA 2B8WA 2YJ3A 4WKNA 3RVOA 3FSJX 3LHKA 3MA0A 2WM2A 3P2YA 4UCXA 5CAEA 3E7XA 3OZRA 5C5IA 4Z53A 1KPGA 4FYPA 2J7PA 2VWHA 3W6OA 5H4GA 3DOJA 3QEKA 3QEJA 4PAWA 4Z8YA 1UXKA 3QUBA 4NCKA 2R97A 2VUIB 1O9GA 2IS6A 4ND3A 3WGVA 1NKTA 3AESB 3T9BA 2ECPA 1TJ4A 2CHUA 2IPOA 2RB5A 1MEOA 2UKDA 2AN4A 4OHRA 5BW4A 2Q99A 3AYXB 5CX1A 1HA3A 1S1MA 1IHPA 2WWXA 4XLLA 4GHWA 4NBKA 1RHMA 4EL5A 1FXSA 4JEIA 3KOYA 4DCUA 5IASA 3P0JA 3D3WA 3T5PA 1E5XA 2AZDA 3VVLA 4M22A 3A14A 2VDPB 3DMGA 1PR4A 1XV5A 2IC5A 2SCUA 4QRDA 1D8TA 3LFTA 4YC7A 5KTPA 2ODNA 3R7WB 3N28A 5FQNA 4GLFA 5GGYA 3U44B 1GU7A 3FPLA 4O5AA 2QVCA 4WJKB 1CE8B 3MINB 2GCEA 2Q2VA 1BQ4A 3PFIA 1Z6QA 4TPKA 5ELLA 4W5TA 4Q9JA 1ZA1A 3B2QA 2H48A 2YXPX 4GNKA 3I5AA 3EQZA 3UMVA 3QENA 1XD8A 4Q02A 2PMEA 2J33A 3L8MA 1GLNA 1LQTA 4BLQA 2QYOA 1NL3A 2BE9A 2Y8EA 1INLA 4RD0A 3AB7A 1M0TA 4IDDA 5EJ2A 3FPCA 3SJ7A 2REQA 4DRYA 3PI6A 1ORDA 1KOJA 3HJRA 4ZAVA 5KTMA 3LK6A 4Q48A 1OWNA 3DW1X 4IG9A 3VKGA 3N2ZB 4PSUA 3FRIA 4EYQA 3GAMA 1KAHA 1ZXBA 2G1JA 3RIGA 3GARA 1A8PA 3IP3A 4WASA 3BGWA 1PW5A 4ROSA 1VJGA 4Q19A 2V6BA 1C4OA 1GTJ1 4EB3A 5KQLA 2QTVB 4DUZB 1B7GO 2WHQA 1B2RA 4N5IX 1W48A 2CNWD 1YC5A 4LYYA 4K7JA 1H1LB 5AM2A 1V1MA 4AYWA 4ENWA 3TTXA 3CNHA 4Q4HA 1P91A 2INGX 1QPBA 2QE7D 3LBAA 4F3TA 2AFHB 1S8FA 3DLIA 3E8XA 1ZJ6A 4NCBA 1L5KA 4OPMA 1ONNA 4FD3A 1TU3A 2X41A 1Q7BA 3QOYA 3ROXA 4H35A 1K5HA 3EOBI 3MM4A 3EQ7A 4I9HA 2HDOA 1FP4B 4I8IA 2AR7A 1G42A 4PX9A 4ASUD 4CDNA 2HK6A 1K6JA 2COEA 4EOGA 3UH1A 3GJSA 4JA2A 3OM9A 3EPLA 4DCJA 1CR0A 1FLDA 1N92A 2MSDB 3SC2A 2AN1A 3PGXA 3QTLA 2OHJA 2E87A 5JRDS 5BPFA 1R4AA 5CH5A 2AOTA 3GVXA 4JNCA 2JJ2A 4K5QA 3V2HA 1VOTA 4ZI2A 3WSVA 4EGSA 5GM2A 1UPTA 1T2VA 4TYQA 3FWZA 3WL6A 3UMFA 5E4FA 3HYSA 1C4KA 3CTPA 3LX6A 3WLEA 1RRFA 4Y1RA 1Z8HA 3CRW1 5SICE 1FNDA 4RMNA 4DRXB 1NVAA 3W9BA 4XB1A 4GQIA 1RKBA 5KC8A 2JGIA 1E3MA 3IT0A 3NO4A 2VUUA 1YZ3A 4FQ7A 4OATA 5HDBB 4J1NA 3WGUA 4XVHA 3RWBA 4BX9A 4NQRA 1GUAA 2OO5C 2YBEA 3BWYA 5TIIA 4LRWA 1RLMA 4MO9A 2C4VA 1NJ2A 3CH4B 3HR4A 2AOUA 3U3OA 4OHZA 2P27A 1ZRSA 1KPHA 4YV0A 1L7VC 3O4FA 2Q1TA 2W83A 3MS7A 5E1OA 5JMWA 1E9CA 4CUKA 2GNOA 1ZOLA 2DETA 1C3XA 4M60A 2VPXA 3F9RA 3KLOA 4GX0A 4GYWA 1STOA 4LV8B 4DMLA 4HAUA 3I6MA 3M33A 4OHPA 3BULA 2AZTA 1C1XA 3EQ9A 4W5WA 2WD7B 5L7WA 4HSGA 3PZRA 5A3JA 2PD3A 3O2SB 1ESMA 3B5JA 5LXTF 2R85A 1C8KA 5JPDA 3AERB 2FHSA 2HMTA 5DP1A 4ARZA 2LIPA 1MIOA 4ESOA 2D6FA 2AOTB 1DBPA 1ZVMA 2QMYA 1KI2A 1B3BA 3CQ9A 4JYMA 1DI0A 3CW2A 5BSHA 2Q21A 2GWHA 1QC5A 2Q4OA 2ISSD 3N70A 4WHMA 4K86A 4BJ5A 4IR7A 9LDBA 1FDOA 1WV1A 3L4BC 2P7HA 3NT5A 4Q3EA 1N6NA 3UWOA 4R01A 2O9JA 1AQ6A 2EW1A 2VJKA 5HIIA 1MDBA 2FEOA 1JU9A 4MJLA 2QN1A 4HC4A 3TSOA 2Z56A 4FFDA 1Y9ZA 2FFQA 1IAVA 1N5OX 2I4IA 2ODTX 3LDGA 3G1TA 3LLVA 1GZ6A 1Y8CA 1D6SA 3BBLA 2LUOA 4AMGA 2GEUA 3GH3A 4URHA 1ZMRA 4G5XA 3P52A 1M2NA 3HJUA 4NCHA 4C7MA 4EO4A 1F1JA 1T43A 2FKAA 2QX7A 4CCYA 1T8PA 5CNJA 1C0LA 4ITUA 3U7IA 4ENPA 3KZMA 3EAGA 2PQ2A 2R5WA 2WKQA 1RADA 2V6IA 3A7EA 2C2WA 1EGVB 1THTA 3BMCA 3NP9A 4KAJA 2AXNA 3V3TA 3VHLB 3S70A 4C4OA 1A88A 3PEUA 2G72A 1LLFA 2LTAA 1XF9A 2FVXA 4ENSA 5B1EA 2IRWA 1NG1A 1SZJG 2PGOA 4X0EA 2WIKA 2WT8A 4GI1A 4UVEA 4EYGA 2PWYA 4RSRA 4IIUA 1RQLA 5ALWA 2PX3A 4HD8A 1E6UA 1U94A 2GEKA 3HLYA 3RGGA 4TV9A 2WWGA 3LCUA 3JX9A 3LGSA 5EWJA 2NTNA 5A05A 4RPIA 3TR5A 1IQPA 1QCZA 2AHRA 2ZZKA 1MZPA 1G1AA 2XCOA 4EABA 1U0JA 4PE5B 3V1NA 3Q2IA 3RQIA 4JI1B 1QH8A 3JWJA 5JZ9A 5KQPA 1QGUB 1R5BA 4FS3A 4FNGA 1JBKA 4Z8XA 4CIAA 4LMRA 2LR0A 3Q12A 1Y0BA 3ESXA 1USUA 2RGUA 4HTFB 3PEYA 1TNDA 3O75A 3OUUA 3STHA 4C4SA 5LMZA 1HV8A 1QXSA 1NOIA 2I6SA 2QLMA 1J8VA 4KIFA 2FLWA 2VEDA 2RKOA 3NWEA 1G2QA 1U2RA 1T4CB 2QB5A 1U0TA 3O2QB 4J4BA 4TV8A 3LVRE 1R50A 1VBFA 3TBFA 4RA9A 1JGTA 5K45A 4OJTA 1O6FA 5CB6A 4ID3A 1P0FA 5GAJA 1X8JA 5CXXA 2JCGA 4CNQA 1WXWA 3IJEB 2O6LA 3O5AA 4FZVA 1KK0A 2J08A 4TKVA 1FNSA 3MT8A 4CKEA 1EK5A 5HJ7A 4J7CA 2VJLA 4ESEA 1GKUB 1QBGA 4Q3LA 2O0LA 4C7OB 3Q5DA 3T3GA 4UZEA 5CXUA 1UPUA 1KI1A 1QRSA 4CZ2A 1E1KA 1P2TA 2ZRFA 3WGYA 3LA8A 3ZUPA 3G2KA 2GEDA 1X1AA 1BZYA 5EWJB 5IYZF 2JFFA 5IZCC 2ATEA 3G9ZA 4OKSA 1VMDA 4KWTA 1X70A 4AN4A 4EO9A 2PFGA 2V9ZA 3R9XA 5G02A 1VJ0A 1MC1A 1QM5A 1JR6A 3ZQ6A 1EK0A 3G9UA 1X2EA 2C7PA 4V0OA 3HJCA 3HXPA 4JYBA 1CT9A 5DCYA 3EZ6A 4RBNA 1LWNA 1SBQA 3SZUA 2C54A 3CZPA 3VPGA 2X6RA 2IF0A 3BJIC 1USKA 1Y3IA 1ECGA 3P32A 1X8XA 3DKVA 5JHHB 3OZFA 4U6SA 1I1OA 1T3TA 3LXRA 2IYYA 2QL6A 1MXHA 2XMSA 3BORA 3FBTA 2X2OA 3I72A 1PX2A 3QXJA 5NLLA 1VPDA 2BRUA 4WIAA 2WV9A 4DY6A 4UU8A 2FSSA 2QTVA 4KVZA 5AXAA 3A6ZA 1Z3IX 5FUWA 4JROA 4YVFA 1C0KA 3LO5A 1C0EA 2JVKA 1EBFA 3B53X 1XCPA 3QYJA 1CEXA 4BN4A 1SA0A 2ZZMA 2IH5A 3IUMA 4DA7A 4I6EA 2ZYSA 1VHLA 3BHNA 4FEYA 4RXMA 4CUZA 2DR2A 4F4DA 1HX7A 3ZWVA 1N1MA 3HA2A 1QS0A 2GWRA 2AFHA 3H8VA 1NLFA 1YAHA 3I23A 2P9HA 5ADUS 1MB0A 4WA7A 4YQZA 1US8B 1PD0A 2V58A 3GJ7A 3AK4A 5ITZB 5FWAA 1OHHD 1ZHOA 2ODPA 3L01A 1XCOA 3RIMA 3NX4A 4ZVPA 5BN3A 3SVTA 2QAIA 4BO2A 4RVNA 5F1OA 1QDEA 4IDPA 3HU2A 5TQ0A 1JW9B 2JGFA 1QB7A 1UPBA 5LYJA 2CDRA 2FRXA 2PRSA 3OOEA 2EKDA 1R1DA 2PS0A 3F4LA 1L5GB 2DM6A 3ZDXB 4M21A 3ROFA 3KJZA 4X91A 1BOFA 3PG5A 3BXHA 5CVUA 2P68A 2A9VA 2JIPA 4FOPA 1CU1A 2QUBA 3KOOA 1V11B 3T15A 3S27A 1E0JA 1XZJA 1XQ6A 3LU1A 3QVSA 4HZGA 1CHDA 3LFHA 3D8SA 3HU3A 2H9IA 1ESDA 7AT1A 3HB4X 1IZ7A 3ZIAD 3KB2A 1F0KA 3JZDA 4J90A 3U62A 3SJUA 4JI4B 1T36B 2KM1A 5E1DA 2RDMA 4M99A 3EY9A 3G49A 4PHHA 4AKSA 1IY2A 1G5RA 2IODA 4D9HA 5AKGA 2X0DA 5FWYA 1SHZA 4MNTA 5EXEA 3SSOA 2NYVA 4RPKA 3QMMA 2Z8ZA 2FXIA 5DNVA 5KTNA 3OU6A 1JFTA 3OT5A 4OXKA 1ENOA 4RZ2A 1PS8A 4H7IA 5BUZA 1A8HA 1COWA 4B6PA 1W29A 2ZB2A 3IURA 5ICMA 3PXEA 3GN1A 4GRIA 3F7NA 5FWXA 1SIBE 3V8PA 2NO4A 4MCHA 2CYBA 3E0QA 3FCUB 5I5GA 3CX8A 3KQNA 1RYMA 1FPMA 1VLJA 2RGNA 3NBFA 3DE4X 4UCQA 5HKKD 2C61A 4MKRA 5E6RA 5HJ5A 1E0SA 2B8JA 3D7SA 3NHAA 4QYSA 4LI0A 2Q3CA 2RGDA 3FOAA 1WHTA 4IQ8A 4PBTA 4LGYA 2FSVC 2J3KA 2BYTA 2VHUA 4JKOA 4KQXA 5DMXA 1EI9A 2DUWA 5J2TF 3ZCRA 4ARZB 1V96A 1DT3A 2B1GA 3JALA 3MVEA 1JLRA 2EFJA 1P9NA 3J81A 3CLHA 1GSHA 1JPNA 4P08A 2R8BA 2F43A 1Z63A 1XVLA 2VKQA 4L8FA 1MENA 3ZU4A 1W6RA 2BELA 2Q62A 3IT3A 1CUUA 1PFQA 1P9OA 4U9UA 5D6NA 3UFXA 1HL3A 5FOXA 4DMCA 4EYEA 3PEFA 4F45A 1T9ZA 1FW6A 5ETJA 4E2ZA 1U04A 4WNAA 5T4EA 4NNPA 3SMQA 4Q66C 1OTXA 1O1YA 3QVGA 4FOLA 3RRNA 2KSQA 1TECE 4I46A 4K3VA 1EWRA 2J30A 4TMWA 3OFKA 1XRLA 5FTKA 5C34B 1XA4A 4WXPA 3UAYA 1IZ9A 4MCIA 1ZD3A 3Q3EA 4FFRA 4JJEA 1PFVA 3KYBA 3EXG1 4YMGA 5K20A 5KWJA 1HK7A 3FPKA 1VFPA 3O8DA 4JLPA 3KOXA 4REOA 5FTNA 2CVPA 3TPFA 3MLEA 3TGPA 1DOAA 2ZATA 3BWBA 2BR4A 4H15A 4KQ1A 3H3FA 1RI5A 5KS2A 2ACWA 3NV7A 1EFAA 2R2AA 1GOTA 1XU9A 1OT3A 1UFKA 3EULA 1Y80A 4WSOA 3K6KA 2C3YA 1E3IA 3D6MA 4Z3KA 2VJNA 2AE2A 4Q1FA 2YJ5A 1BO6A 3O3NB