2YIOA

Crystal structure of parasite sarcocystis muris microneme protein sml- 2 in complex with 1-thio-beta-d-galactose (spacegroup c2221)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
LDVSCFAHDKNIGSRTEQLSVVHVASAQDCMKECQALPTCSHFTYNKNSKKCHLKAGAPEFYTYTGDMTGPRSCEHNCSDACWMDGNNPLAVWDYSGQPPALCWAACMGTPGCDLYTFQGMTCKLYSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MICRONEME ANTIGEN L2
publication title Pan-Modular Structure of Microneme Protein Sml-2 from Parasite Sarcocystis Muris at 1.95 A Resolution and its Complex with 1-Thio-Beta-D-Galactose.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 34
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00024 PAN_1 PAN domain
A PF14295 PAN_4 PAN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.180 Alpha Beta 2-Layer Sandwich Defensin A-like Defensin A-like 2yioA02
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 2yioA01
5CT1A 3HN4A 1W81A 2K13X 2Y8RA 3HMRA 5CS9A 2Q8BA 4Z0EA 2YILA 3ZWZA 2J8JA 4Z0FA 3MKPA 2LL4M 2YIPA 2F83A 5CS3A 4A5TS 2HGFA 2QJ2A 2X2ZA 4R1AA 3SRJA 4R1CA 1GP9A 4UV6A 1GMOA 4Z09A 3ZLEA 5CT2A 2J8LA 2Z8WA 5CT3A 1NK1A 1W8KA 5CS1A 1YXEA 5CS5A 4R1BA 2LL3A 5CP9A 2YIOA 1BHTA 4APLA 5CSQA 4APMA 1Z40A 4IUAA 3HMSA 2Q8AA 5EODA 3SP8A 4R19A 2QJ4A 1I8NA 4UAOA 3SRIA 4DURA 1GMNA 2Z8VA 4Z0DA 5I25A 5COEA 3HMTA 5EOKA 1HKYA
chains in the Genus database with same CATH superfamily
2LJMA 1NGHA 2LY6A 2N2QA 2E2FA 2YEOA 5BPMA 3KOZA 1WWNA 5CT2A 3LDPA 5FPMA 2LKBA 4R1BA 1WMTA 1T7EA 3LDOA 3HMSA 1JXCA 2QWOA 1I2UA 5CS9A 2F83A 1NRAA 2KBJA 3ATVA 1BMRA 3E7RL 2ATBA 4H5TA 2Z8WA 2D56A 5CT3A 5CP9A 2GL1A 3LDNA 2QWQA 1AHOA 3HN4A 2QWPA 4Z0FA 3KP0A 4A5TS 3L56A 3QMLA 3IUCA 2J8LA 2KHOA 1N4NA 1PX9A 5EODA 3SRIA 5AQWA 5AQFA 5CT1A 2YC1C 1KV0A 1ATSA 1OMYA 1NPIA 1TI5A 1UGLA 4H5RA 3MKPA 1XRSB 1ZFUA 4HHFA 2B68A 2QJ2A 5FPDA 3SRJA 5F2RA 1SN4A 5CS5A 1BK8A 4KYPA 4YIVA 5EVZA 2ASCA 3SP8A 5AQMA 3D2EB 2Q8BA 1BUPA 1NGBA 1C56A 2LI7A 1QQMA 2V7ZA 1W8KA 1MYNA 1SNBA 2N2RA 1KAXA 1NGEA 1PE4A 5BN8A 3CQXA 3R2VA 4UAOA 3GDQA 2N66A 1S3XA 3L4IA 1NGIA 3D2FB 5AQTA 2JDQD 1L4VA 1T7BA 4HWIA 5F1XA 4YIZA 2E3GA 1GMOA 1C55A 5AQGA 5BPLA 3AY9A 1NGAA 3BK3C 3SF4D 2MN5A 1HX1A 1JZAA 4CQKA 1GMNA 1YUWA 3KOYA 1WT7A 3M3ZA 3D2FA 2A7TA 5CS3A 1LQIA 1P00A 2E3FA 1NH5A 2G2KA 1GP9A 3ZLEA 2QWNA 1ZYWA 1BRZA 2LL3A 5AQSA 1NGFA 5AQUA 1BCGA 3FE1A 5AQIA 1LQHA 5COEA 3LDQA 3QI7A 2E88A 1MR4A 2MBKA 2LT8A 3E7UX 5KK4A 2K35A 1VNBA 2LY5A 3ATUA 5AQPA 3KOWA 1FH3A 5BPNA 3KVGA 1YXEA 5CSQA 4Z0DA 4KBOA 5FPNA 3KHWA 1I6FA 3GL1A 2BUPA 3FZHA 2KJAA 4AEIA 1ZU3A 4R1CA 2KGQA 1B3CA 3A8YA 3KOXA 1ZYVA 1QQNA 1JZBA 4V1DC 4R19A 4DURA 5EY4A 5AQHA 1W81A 5BN9A 4UJ0A 1HJOA 2N69A 2MZ0A 1HPMA 1QQOA 2QXLA 4UV6A 5AQJA 1I2VA 2KBKA 3GKUA 1NK1A 4FSVA 4APMA 2QJ4A 4H5NA 1GPSA 4UAEF 1NGCA 4AB0A 1DJTA 1T0ZA 1K8BA 2KYQA 1BA1A 1ZVGA 1ATRA 1KAZA 1ICAA 5F0XA 2QWMA 3QFPA 2VY6A 4R1AA 3CW4A 3L6QA 1CHZA 5CS1A 3I33A 2YIOA 1ZVEA 2E0HA 5FPEA 3QFUA 2KL5A 2YBRC 5AQKA 1ZUTA 2Y8RA 2J8JA 2QWLA 2LL4M 5EXWA 4IO8A 2HGFA 1KAYA 2KPYA 3C7NA 1T7AA 1BHTA 4APLA 5AQOA 3KP1A 1HKYA 5AQNA 1SEGA 3HMRA 5CY0A 2X2ZA 2LJ7A 3JXUA 3FZKA 2Q8AA 1I8NA 1NGDA 1T1TA 2LR3A 2M8BB 1SN1A 5AR0A 2GMOA 2YIPA 2NY9X 1DKGD 5AQVA 3FZLA 2SN3A 2B3CA 1GPTA 2BRZA 1POIA 5AQLA 2LN8A 1JKZA 1VNAA 4HE7A 1AYJA 2Z8VA 1PTXA 5EOKA 1CN2A 2K13X 4Z0EA 3ZWZA 4UADE 1LQQA 1NE5A 4H5WA 1BA0A 3PSMA 4H5VA 5AQYA 2QW9A 3FZMA 4IUAA 1OZZA 1NRBA 1DQ7A 5I25A 3HMTA 4GNIA 1NGJA 4FL9A 5EX5A 5AQQA 3HSCA 2YILA 2KSKA 3FZFA 2E8AA 5AQRA 4UAFE 5AQZA 4Z09A 2QWRA 5AQXA 4AAZA 3KC6A 1B7DA 1NGGA 2NY8X 3C7NB 1Z40A 2I61A 3LDLA 2KBHA 3D2EA 1I6GA 1P0AA
chains in the Genus database with same CATH topology
3D2EB 5AQNA 2Q8BA 1NGHA 3HMRA 3GL1A 2BUPA 1BUPA 1NGBA 2E2FA 3FZHA 5BPMA 2X2ZA 4R1CA 1QQMA 5CT2A 3A8YA 3LDPA 5FPMA 2V7ZA 1W8KA 3JXUA 1QQNA 4R1BA 1KAXA 3LDOA 1NGEA 3FZKA 5BN8A 3HMSA 2Q8AA 4R19A 3CQXA 3R2VA 1I8NA 4UAOA 4DURA 3GDQA 1NGDA 2QWOA 5EY4A 1S3XA 5AQHA 3L4IA 5BN9A 1W81A 5CS9A 1NGIA 5AR0A 1HJOA 2GMOA 2YIPA 3D2FB 2F83A 5AQTA 1DKGD 2JDQD 3ATVA 5AQVA 4HWIA 5F1XA 3FZLA 1HPMA 4YIZA 1QQOA 2QXLA 1GMOA 4UV6A 5AQJA 5AQGA 5BPLA 4H5TA 2Z8WA 2D56A 5CT3A 3AY9A 1NK1A 1NGAA 1POIA 3BK3C 5AQLA 3SF4D 5CP9A 2LN8A 4FSVA 2MN5A 4APMA 1HX1A 2QJ4A 4H5NA 4UAEF 1GMNA 2Z8VA 3LDNA 1NGCA 5EOKA 2QWQA 1YUWA 1BA1A 1ATRA 2K13X 3HN4A 4Z0EA 1KAZA 3M3ZA 3ZWZA 2QWPA 3D2FA 4Z0FA 5F0XA 4UADE 5CS3A 2QWMA 4A5TS 3QFPA 2VY6A 3L56A 4R1AA 4H5WA 1GP9A 1BA0A 3CW4A 3QMLA 3ZLEA 3IUCA 4H5VA 3L6QA 2J8LA 5AQYA 2QWNA 2KHOA 2QW9A 5CS1A 3FZMA 3I33A 2LL3A 2YIOA 5AQSA 1NGFA 5AQUA 4IUAA 5EODA 5FPEA 3SRIA 3FE1A 3QFUA 5AQIA 2KL5A 5I25A 5COEA 5AQWA 3HMTA 4GNIA 5AQKA 5AQFA 3LDQA 1NGJA 3QI7A 4FL9A 5EX5A 5CT1A 5AQQA 2Y8RA 2E88A 1ATSA 3HSCA 2MBKA 2YILA 4H5RA 2J8JA 2QWLA 2LL4M 3MKPA 2K35A 3FZFA 2E8AA 5EXWA 4IO8A 2HGFA 2QJ2A 5AQRA 5FPDA 1KAYA 4UAFE 5AQZA 3SRJA 3ATUA 5AQPA 4Z09A 2QWRA 3C7NA 5AQXA 3KC6A 5BPNA 3KVGA 5F2RA 1NGGA 1YXEA 5CS5A 3C7NB 1BHTA 4APLA 4YIVA 5CSQA 5EVZA 1Z40A 3LDLA 3SP8A 5AQMA 5AQOA 3D2EA 4KBOA 5FPNA 4Z0DA 3KHWA 1HKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CT1 A;  3HN4 A;  1W81 A;  2K13 X;  2Y8R A;  3HMR A;  5CS9 A;  2Q8B A;  4Z0E A;  2YIL A;  3ZWZ A;  2J8J A;  4Z0F A;  3MKP A;  2LL4 M;  2YIP A;  2F83 A;  5CS3 A;  4A5T S;  2HGF A;  2QJ2 A;  2X2Z A;  4R1A A;  3SRJ A;  4R1C A;  1GP9 A;  4UV6 A;  1GMO A;  4Z09 A;  3ZLE A;  5CT2 A;  2J8L A;  2Z8W A;  5CT3 A;  1NK1 A;  1W8K A;  5CS1 A;  1YXE A;  5CS5 A;  4R1B A;  2LL3 A;  5CP9 A;  2YIO A;  1BHT A;  4APL A;  5CSQ A;  4APM A;  1Z40 A;  4IUA A;  3HMS A;  2Q8A A;  5EOD A;  3SP8 A;  4R19 A;  2QJ4 A;  1I8N A;  4UAO A;  3SRI A;  4DUR A;  1GMN A;  2Z8V A;  4Z0D A;  5I25 A;  5COE A;  3HMT A;  5EOK A;  1HKY A; 
#chains in the Genus database with same CATH topology
 2LJM A;  1NGH A;  2LY6 A;  2N2Q A;  2E2F A;  2YEO A;  5BPM A;  3KOZ A;  1WWN A;  5CT2 A;  3LDP A;  5FPM A;  2LKB A;  4R1B A;  1WMT A;  1T7E A;  3LDO A;  3HMS A;  1JXC A;  2QWO A;  1I2U A;  5CS9 A;  2F83 A;  1NRA A;  2KBJ A;  3ATV A;  1BMR A;  3E7R L;  2ATB A;  4H5T A;  2Z8W A;  2D56 A;  5CT3 A;  5CP9 A;  2GL1 A;  3LDN A;  2QWQ A;  1AHO A;  3HN4 A;  2QWP A;  4Z0F A;  3KP0 A;  4A5T S;  3L56 A;  3QML A;  3IUC A;  2J8L A;  2KHO A;  1N4N A;  1PX9 A;  5EOD A;  3SRI A;  5AQW A;  5AQF A;  5CT1 A;  2YC1 C;  1KV0 A;  1ATS A;  1OMY A;  1NPI A;  1TI5 A;  1UGL A;  4H5R A;  3MKP A;  1XRS B;  1ZFU A;  4HHF A;  2B68 A;  2QJ2 A;  5FPD A;  3SRJ A;  5F2R A;  1SN4 A;  5CS5 A;  1BK8 A;  4KYP A;  4YIV A;  5EVZ A;  2ASC A;  3SP8 A;  5AQM A;  3D2E B;  2Q8B A;  1BUP A;  1NGB A;  1C56 A;  2LI7 A;  1QQM A;  2V7Z A;  1W8K A;  1MYN A;  1SNB A;  2N2R A;  1KAX A;  1NGE A;  1PE4 A;  5BN8 A;  3CQX A;  3R2V A;  4UAO A;  3GDQ A;  2N66 A;  1S3X A;  3L4I A;  1NGI A;  3D2F B;  5AQT A;  2JDQ D;  1L4V A;  1T7B A;  4HWI A;  5F1X A;  4YIZ A;  2E3G A;  1GMO A;  1C55 A;  5AQG A;  5BPL A;  3AY9 A;  1NGA A;  3BK3 C;  3SF4 D;  2MN5 A;  1HX1 A;  1JZA A;  4CQK A;  1GMN A;  1YUW A;  3KOY A;  1WT7 A;  3M3Z A;  3D2F A;  2A7T A;  5CS3 A;  1LQI A;  1P00 A;  2E3F A;  1NH5 A;  2G2K A;  1GP9 A;  3ZLE A;  2QWN A;  1ZYW A;  1BRZ A;  2LL3 A;  5AQS A;  1NGF A;  5AQU A;  1BCG A;  3FE1 A;  5AQI A;  1LQH A;  5COE A;  3LDQ A;  3QI7 A;  2E88 A;  1MR4 A;  2MBK A;  2LT8 A;  3E7U X;  5KK4 A;  2K35 A;  1VNB A;  2LY5 A;  3ATU A;  5AQP A;  3KOW A;  1FH3 A;  5BPN A;  3KVG A;  1YXE A;  5CSQ A;  4Z0D A;  4KBO A;  5FPN A;  3KHW A;  1I6F A;  3GL1 A;  2BUP A;  3FZH A;  2KJA A;  4AEI A;  1ZU3 A;  4R1C A;  2KGQ A;  1B3C A;  3A8Y A;  3KOX A;  1ZYV A;  1QQN A;  1JZB A;  4V1D C;  4R19 A;  4DUR A;  5EY4 A;  5AQH A;  1W81 A;  5BN9 A;  4UJ0 A;  1HJO A;  2N69 A;  2MZ0 A;  1HPM A;  1QQO A;  2QXL A;  4UV6 A;  5AQJ A;  1I2V A;  2KBK A;  3GKU A;  1NK1 A;  4FSV A;  4APM A;  2QJ4 A;  4H5N A;  1GPS A;  4UAE F;  1NGC A;  4AB0 A;  1DJT A;  1T0Z A;  1K8B A;  2KYQ A;  1BA1 A;  1ZVG A;  1ATR A;  1KAZ A;  1ICA A;  5F0X A;  2QWM A;  3QFP A;  2VY6 A;  4R1A A;  3CW4 A;  3L6Q A;  1CHZ A;  5CS1 A;  3I33 A;  2YIO A;  1ZVE A;  2E0H A;  5FPE A;  3QFU A;  2KL5 A;  2YBR C;  5AQK A;  1ZUT A;  2Y8R A;  2J8J A;  2QWL A;  2LL4 M;  5EXW A;  4IO8 A;  2HGF A;  1KAY A;  2KPY A;  3C7N A;  1T7A A;  1BHT A;  4APL A;  5AQO A;  3KP1 A;  1HKY A;  5AQN A;  1SEG A;  3HMR A;  5CY0 A;  2X2Z A;  2LJ7 A;  3JXU A;  3FZK A;  2Q8A A;  1I8N A;  1NGD A;  1T1T A;  2LR3 A;  2M8B B;  1SN1 A;  5AR0 A;  2GMO A;  2YIP A;  2NY9 X;  1DKG D;  5AQV A;  3FZL A;  2SN3 A;  2B3C A;  1GPT A;  2BRZ A;  1POI A;  5AQL A;  2LN8 A;  1JKZ A;  1VNA A;  4HE7 A;  1AYJ A;  2Z8V A;  1PTX A;  5EOK A;  1CN2 A;  2K13 X;  4Z0E A;  3ZWZ A;  4UAD E;  1LQQ A;  1NE5 A;  4H5W A;  1BA0 A;  3PSM A;  4H5V A;  5AQY A;  2QW9 A;  3FZM A;  4IUA A;  1OZZ A;  1NRB A;  1DQ7 A;  5I25 A;  3HMT A;  4GNI A;  1NGJ A;  4FL9 A;  5EX5 A;  5AQQ A;  3HSC A;  2YIL A;  2KSK A;  3FZF A;  2E8A A;  5AQR A;  4UAF E;  5AQZ A;  4Z09 A;  2QWR A;  5AQX A;  4AAZ A;  3KC6 A;  1B7D A;  1NGG A;  2NY8 X;  3C7N B;  1Z40 A;  2I61 A;  3LDL A;  2KBH A;  3D2E A;  1I6G A;  1P0A A; 
#chains in the Genus database with same CATH homology
 3D2E B;  5AQN A;  2Q8B A;  1NGH A;  3HMR A;  3GL1 A;  2BUP A;  1BUP A;  1NGB A;  2E2F A;  3FZH A;  5BPM A;  2X2Z A;  4R1C A;  1QQM A;  5CT2 A;  3A8Y A;  3LDP A;  5FPM A;  2V7Z A;  1W8K A;  3JXU A;  1QQN A;  4R1B A;  1KAX A;  3LDO A;  1NGE A;  3FZK A;  5BN8 A;  3HMS A;  2Q8A A;  4R19 A;  3CQX A;  3R2V A;  1I8N A;  4UAO A;  4DUR A;  3GDQ A;  1NGD A;  2QWO A;  5EY4 A;  1S3X A;  5AQH A;  3L4I A;  5BN9 A;  1W81 A;  5CS9 A;  1NGI A;  5AR0 A;  1HJO A;  2GMO A;  2YIP A;  3D2F B;  2F83 A;  5AQT A;  1DKG D;  2JDQ D;  3ATV A;  5AQV A;  4HWI A;  5F1X A;  3FZL A;  1HPM A;  4YIZ A;  1QQO A;  2QXL A;  1GMO A;  4UV6 A;  5AQJ A;  5AQG A;  5BPL A;  4H5T A;  2Z8W A;  2D56 A;  5CT3 A;  3AY9 A;  1NK1 A;  1NGA A;  1POI A;  3BK3 C;  5AQL A;  3SF4 D;  5CP9 A;  2LN8 A;  4FSV A;  2MN5 A;  4APM A;  1HX1 A;  2QJ4 A;  4H5N A;  4UAE F;  1GMN A;  2Z8V A;  3LDN A;  1NGC A;  5EOK A;  2QWQ A;  1YUW A;  1BA1 A;  1ATR A;  2K13 X;  3HN4 A;  4Z0E A;  1KAZ A;  3M3Z A;  3ZWZ A;  2QWP A;  3D2F A;  4Z0F A;  5F0X A;  4UAD E;  5CS3 A;  2QWM A;  4A5T S;  3QFP A;  2VY6 A;  3L56 A;  4R1A A;  4H5W A;  1GP9 A;  1BA0 A;  3CW4 A;  3QML A;  3ZLE A;  3IUC A;  4H5V A;  3L6Q A;  2J8L A;  5AQY A;  2QWN A;  2KHO A;  2QW9 A;  5CS1 A;  3FZM A;  3I33 A;  2LL3 A;  2YIO A;  5AQS A;  1NGF A;  5AQU A;  4IUA A;  5EOD A;  5FPE A;  3SRI A;  3FE1 A;  3QFU A;  5AQI A;  2KL5 A;  5I25 A;  5COE A;  5AQW A;  3HMT A;  4GNI A;  5AQK A;  5AQF A;  3LDQ A;  1NGJ A;  3QI7 A;  4FL9 A;  5EX5 A;  5CT1 A;  5AQQ A;  2Y8R A;  2E88 A;  1ATS A;  3HSC A;  2MBK A;  2YIL A;  4H5R A;  2J8J A;  2QWL A;  2LL4 M;  3MKP A;  2K35 A;  3FZF A;  2E8A A;  5EXW A;  4IO8 A;  2HGF A;  2QJ2 A;  5AQR A;  5FPD A;  1KAY A;  4UAF E;  5AQZ A;  3SRJ A;  3ATU A;  5AQP A;  4Z09 A;  2QWR A;  3C7N A;  5AQX A;  3KC6 A;  5BPN A;  3KVG A;  5F2R A;  1NGG A;  1YXE A;  5CS5 A;  3C7N B;  1BHT A;  4APL A;  4YIV A;  5CSQ A;  5EVZ A;  1Z40 A;  3LDL A;  3SP8 A;  5AQM A;  5AQO A;  3D2E A;  4KBO A;  5FPN A;  4Z0D A;  3KHW A;  1HKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...