2YIOA

Crystal structure of parasite sarcocystis muris microneme protein sml- 2 in complex with 1-thio-beta-d-galactose (spacegroup c2221)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
b'LDVSCFAHDKNIGSRTEQLSVVHVASAQDCMKECQALPTCSHFTYNKNSKKCHLKAGAPEFYTYTGDMTGPRSCEHNCSDACWMDGNNPLAVWDYSGQPPALCWAACMGTPGCDLYTFQGMTCKLYSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MICRONEME ANTIGEN L2
publication title Pan-Modular Structure of Microneme Protein Sml-2 from Parasite Sarcocystis Muris at 1.95 A Resolution and its Complex with 1-Thio-Beta-D-Galactose.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 34
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00024 PAN_1 PAN domain
A PF14295 PAN_4 PAN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.180 Alpha Beta 2-Layer Sandwich Defensin A-like Defensin A-like 2yioA02
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 2yioA01
5CT1A 2Z8VA 2Q8BA 3HMTA 4A5TS 4Z0DA 1GP9A 2Z8WA 4R19A 3ZLEA 5I25A 1BHTA 5CS1A 4APLA 2YILA 3SP8A 4DURA 5EOKA 4APMA 4Z0FA 2LL3A 2QJ2A 2YIPA 5COEA 4Z09A 3SRIA 3HN4A 2X2ZA 4IUAA 2Q8AA 4UV6A 5CSQA 2F83A 1YXEA 3ZWZA 1GMNA 2K13X 2J8LA 2Y8RA 1W8KA 5CT2A 2YIOA 2LL4M 5CS3A 1GMOA 3MKPA 3HMRA 1W81A 1NK1A 2J8JA 5EODA 2HGFA 4R1AA 5CP9A 5CT3A 3SRJA 1Z40A 2QJ4A 4UAOA 4R1BA 4R1CA 1HKYA 4Z0EA 1I8NA 5CS5A 3HMSA 5CS9A
chains in the Genus database with same CATH superfamily
3HMTA 2QWMA 4R19A 1BHTA 5CS1A 5AR0A 3D2FA 2LL3A 1LQHA 1GPTA 3KOYA 4H5NA 1KV0A 4IO8A 5CS3A 2N69A 5AQGA 1NGIA 1T7BA 4UAFE 2KYQA 3FZMA 4FSVA 2E2FA 1NGCA 1NRAA 2Z8VA 3C7NA 2B3CA 3D2EB 3R2VA 5F2RA 1ATRA 3LDQA 2Y8RA 1W8KA 1OMYA 1BK8A 3CQXA 5CP9A 1OZZA 4R1BA 5FPNA 1ZYWA 1VNBA 3I33A 4H5RA 3ZLEA 1LQIA 4UJ0A 1BMRA 4Z09A 1MR4A 1POIA 3L4IA 1YXEA 4UADE 5CY0A 3IUCA 2E0HA 2QWNA 1HPMA 1I6FA 2E3FA 1KAZA 2MBKA 2LKBA 1QQNA 2E3GA 2N2QA 2K13X 4V1DC 3SF4D 5CT3A 1Z40A 4R1CA 2QWRA 1I2VA 2YBRC 1QQOA 2LI7A 3A8YA 3ATUA 1UGLA 4APLA 5AQOA 3SRIA 3FZKA 5FPMA 1T7EA 2V7ZA 2BUPA 5AQHA 2ATBA 1BA1A 1I8NA 1DJTA 3HMSA 3GDQA 1SN4A 4HHFA 1P00A 1SNBA 2QJ2A 1BUPA 5BN9A 5CSQA 1I6GA 3ZWZA 1BRZA 3QMLA 3E7UX 3PSMA 5EODA 5AQTA 1T1TA 1NGJA 2QWLA 1NH5A 1NGEA 1NGHA 5AQWA 1W81A 1PTXA 5EVZA 1NK1A 1VNAA 2N2RA 2G2KA 5AQJA 3KC6A 4CQKA 1ZVEA 2E8AA 1WMTA 3FE1A 5AQPA 2MZ0A 5EX5A 3HN4A 3KP0A 3KOZA 2F83A 2I61A 5AQIA 1JZAA 2J8LA 5KK4A 3JXUA 2KL5A 2J8JA 1KAXA 1WT7A 5CS5A 1B3CA 4Z0DA 2Z8WA 2KBKA 1NE5A 3AY9A 1ZYVA 2YILA 4YIZA 2QWQA 1KAYA 2ASCA 3KOXA 3L56A 2YEOA 1ICAA 1NPIA 5BPNA 1JZBA 3D2FB 3KVGA 4AEIA 4R1AA 4HWIA 5AQMA 3D2EA 1ATSA 3LDPA 4H5WA 5CS9A 2K35A 3KHWA 2QWPA 2LN8A 5EOKA 2GL1A 2BRZA 5EXWA 3GKUA 2KGQA 4AB0A 3C7NB 2KPYA 2KSKA 2D56A 1AHOA 1DKGD 2N66A 1GPSA 1BA0A 2QXLA 3MKPA 4HE7A 1CHZA 3L6QA 5BN8A 3KP1A 4FL9A 1L4VA 5AQYA 1K8BA 4UAEF 2LT8A 3FZFA 5F1XA 3HSCA 3SP8A 1WWNA 1NGFA 2YIPA 1NGBA 4GNIA 4UV6A 1PX9A 5AQFA 1QQMA 2LL4M 2LY5A 3GL1A 1ZUTA 1NGAA 3E7RL 1NRBA 1I2UA 1TI5A 1GMNA 4AAZA 5CT2A 4H5TA 5BPMA 1NGDA 3LDNA 5AQKA 2M8BB 3QFPA 2LY6A 2LJMA 5AQSA 5CT1A 1T0ZA 3LDLA 1S3XA 2MN5A 3QFUA 1JXCA 2X2ZA 2NY9X 4KYPA 2YIOA 1GMOA 2LR3A 5AQLA 3FZHA 3KOWA 5AQRA 3SRJA 5F0XA 4Z0EA 2NY8X 2GMOA 1BCGA 1SN1A 2YC1C 1GP9A 2B68A 5EY4A 1AYJA 4DURA 4Z0FA 5FPDA 5COEA 2SN3A 4YIVA 4IUAA 3LDOA 1B7DA 1YUWA 2E88A 3BK3C 2JDQD 3ATVA 2HGFA 1PE4A 3M3ZA 1N4NA 5AQQA 2KHOA 1LQQA 2Q8BA 1T7AA 4H5VA 5I25A 1SEGA 5FPEA 1HX1A 2LJ7A 4KBOA 1ZVGA 1FH3A 3HMRA 1XRSB 2KBHA 5AQNA 1DQ7A 4UAOA 2QWOA 5AQUA 3FZLA 5AQZA 1NGGA 4A5TS 3CW4A 2VY6A 5AQVA 5AQXA 2A7TA 4APMA 1HJOA 1ZFUA 2KBJA 2Q8AA 3QI7A 1C55A 1C56A 1ZU3A 5BPLA 2QW9A 2KJAA 1P0AA 1JKZA 2QJ4A 1HKYA 1MYNA 1CN2A
chains in the Genus database with same CATH topology
3A8YA 5CT1A 3HMTA 3ATUA 2QWMA 2Z8WA 4Z0DA 3LDLA 4R19A 3AY9A 1BHTA 5CS1A 4APLA 2YILA 4YIZA 5AQOA 2QWQA 3D2FA 1KAYA 5AR0A 2LL3A 1S3XA 2MN5A 3QFUA 3SRIA 3L56A 3FZKA 5FPMA 2X2ZA 4H5NA 2V7ZA 4IO8A 5BPNA 3D2FB 2YIOA 3KVGA 5CS3A 2BUPA 1GMOA 5AQGA 1NGIA 5AQLA 5AQHA 4UAFE 3FZHA 3FZMA 5AQRA 4R1AA 4FSVA 4HWIA 5F0XA 3SRJA 2E2FA 5AQMA 1BA1A 4Z0EA 3D2EA 1I8NA 3HMSA 3GDQA 1ATSA 3LDPA 4H5WA 1NGCA 2GMOA 5CS9A 2Z8VA 2K35A 3KHWA 1GP9A 2QWPA 3C7NA 5EY4A 2LN8A 4DURA 3D2EB 5EOKA 5EXWA 4Z0FA 2QJ2A 1BUPA 5FPDA 3R2VA 5COEA 5F2RA 4YIVA 4IUAA 3C7NB 3LDOA 1ATRA 2D56A 5BN9A 5CSQA 3ZWZA 1DKGD 3LDQA 1BA0A 2Y8RA 1W8KA 2QXLA 3QMLA 3MKPA 1YUWA 2E88A 3BK3C 2JDQD 5EODA 3L6QA 3ATVA 3CQXA 5AQTA 5BN8A 2HGFA 5CP9A 4FL9A 4R1BA 5FPNA 3M3ZA 5AQYA 5AQQA 3I33A 2KHOA 1NGJA 4H5RA 2QWLA 2Q8BA 4UAEF 4H5VA 3ZLEA 5I25A 3FZFA 5F1XA 5FPEA 3HSCA 1HX1A 3SP8A 4KBOA 1NGEA 1NGFA 2YIPA 1NGBA 4Z09A 1NGHA 1POIA 3L4IA 4GNIA 4UV6A 5AQWA 1YXEA 5AQFA 1QQMA 2LL4M 3HMRA 4UADE 1W81A 5EVZA 1NK1A 3GL1A 5AQNA 3IUCA 4UAOA 2QWOA 5AQUA 5AQJA 3FZLA 5AQZA 1NGAA 1NGGA 2QWNA 1HPMA 3KC6A 4A5TS 3CW4A 1KAZA 2VY6A 5AQVA 2MBKA 2E8AA 1QQNA 3FE1A 5AQPA 5AQXA 4APMA 1HJOA 5EX5A 3HN4A 2Q8AA 3QI7A 2F83A 5AQIA 1GMNA 2K13X 5BPLA 2J8LA 5CT2A 3JXUA 4H5TA 2KL5A 2QW9A 3SF4D 2J8JA 1KAXA 5BPMA 1NGDA 3LDNA 5AQKA 5CT3A 1Z40A 2QJ4A 1HKYA 4R1CA 2QWRA 3QFPA 1QQOA 5CS5A 5AQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CT1 A;  2Z8V A;  2Q8B A;  3HMT A;  4A5T S;  4Z0D A;  1GP9 A;  2Z8W A;  4R19 A;  3ZLE A;  5I25 A;  1BHT A;  5CS1 A;  4APL A;  2YIL A;  3SP8 A;  4DUR A;  5EOK A;  4APM A;  4Z0F A;  2LL3 A;  2QJ2 A;  2YIP A;  5COE A;  4Z09 A;  3SRI A;  3HN4 A;  2X2Z A;  4IUA A;  2Q8A A;  4UV6 A;  5CSQ A;  2F83 A;  1YXE A;  3ZWZ A;  1GMN A;  2K13 X;  2J8L A;  2Y8R A;  1W8K A;  5CT2 A;  2YIO A;  2LL4 M;  5CS3 A;  1GMO A;  3MKP A;  3HMR A;  1W81 A;  1NK1 A;  2J8J A;  5EOD A;  2HGF A;  4R1A A;  5CP9 A;  5CT3 A;  3SRJ A;  1Z40 A;  2QJ4 A;  4UAO A;  4R1B A;  4R1C A;  1HKY A;  4Z0E A;  1I8N A;  5CS5 A;  3HMS A;  5CS9 A; 
#chains in the Genus database with same CATH topology
 3HMT A;  2QWM A;  4R19 A;  1BHT A;  5CS1 A;  5AR0 A;  3D2F A;  2LL3 A;  1LQH A;  1GPT A;  3KOY A;  4H5N A;  1KV0 A;  4IO8 A;  5CS3 A;  2N69 A;  5AQG A;  1NGI A;  1T7B A;  4UAF E;  2KYQ A;  3FZM A;  4FSV A;  2E2F A;  1NGC A;  1NRA A;  2Z8V A;  3C7N A;  2B3C A;  3D2E B;  3R2V A;  5F2R A;  1ATR A;  3LDQ A;  2Y8R A;  1W8K A;  1OMY A;  1BK8 A;  3CQX A;  5CP9 A;  1OZZ A;  4R1B A;  5FPN A;  1ZYW A;  1VNB A;  3I33 A;  4H5R A;  3ZLE A;  1LQI A;  4UJ0 A;  1BMR A;  4Z09 A;  1MR4 A;  1POI A;  3L4I A;  1YXE A;  4UAD E;  5CY0 A;  3IUC A;  2E0H A;  2QWN A;  1HPM A;  1I6F A;  2E3F A;  1KAZ A;  2MBK A;  2LKB A;  1QQN A;  2E3G A;  2N2Q A;  2K13 X;  4V1D C;  3SF4 D;  5CT3 A;  1Z40 A;  4R1C A;  2QWR A;  1I2V A;  2YBR C;  1QQO A;  2LI7 A;  3A8Y A;  3ATU A;  1UGL A;  4APL A;  5AQO A;  3SRI A;  3FZK A;  5FPM A;  1T7E A;  2V7Z A;  2BUP A;  5AQH A;  2ATB A;  1BA1 A;  1I8N A;  1DJT A;  3HMS A;  3GDQ A;  1SN4 A;  4HHF A;  1P00 A;  1SNB A;  2QJ2 A;  1BUP A;  5BN9 A;  5CSQ A;  1I6G A;  3ZWZ A;  1BRZ A;  3QML A;  3E7U X;  3PSM A;  5EOD A;  5AQT A;  1T1T A;  1NGJ A;  2QWL A;  1NH5 A;  1NGE A;  1NGH A;  5AQW A;  1W81 A;  1PTX A;  5EVZ A;  1NK1 A;  1VNA A;  2N2R A;  2G2K A;  5AQJ A;  3KC6 A;  4CQK A;  1ZVE A;  2E8A A;  1WMT A;  3FE1 A;  5AQP A;  2MZ0 A;  5EX5 A;  3HN4 A;  3KP0 A;  3KOZ A;  2F83 A;  2I61 A;  5AQI A;  1JZA A;  2J8L A;  5KK4 A;  3JXU A;  2KL5 A;  2J8J A;  1KAX A;  1WT7 A;  5CS5 A;  1B3C A;  4Z0D A;  2Z8W A;  2KBK A;  1NE5 A;  3AY9 A;  1ZYV A;  2YIL A;  4YIZ A;  2QWQ A;  1KAY A;  2ASC A;  3KOX A;  3L56 A;  2YEO A;  1ICA A;  1NPI A;  5BPN A;  1JZB A;  3D2F B;  3KVG A;  4AEI A;  4R1A A;  4HWI A;  5AQM A;  3D2E A;  1ATS A;  3LDP A;  4H5W A;  5CS9 A;  2K35 A;  3KHW A;  2QWP A;  2LN8 A;  5EOK A;  2GL1 A;  2BRZ A;  5EXW A;  3GKU A;  2KGQ A;  4AB0 A;  3C7N B;  2KPY A;  2KSK A;  2D56 A;  1AHO A;  1DKG D;  2N66 A;  1GPS A;  1BA0 A;  2QXL A;  3MKP A;  4HE7 A;  1CHZ A;  3L6Q A;  5BN8 A;  3KP1 A;  4FL9 A;  1L4V A;  5AQY A;  1K8B A;  4UAE F;  2LT8 A;  3FZF A;  5F1X A;  3HSC A;  3SP8 A;  1WWN A;  1NGF A;  2YIP A;  1NGB A;  4GNI A;  4UV6 A;  1PX9 A;  5AQF A;  1QQM A;  2LL4 M;  2LY5 A;  3GL1 A;  1ZUT A;  1NGA A;  3E7R L;  1NRB A;  1I2U A;  1TI5 A;  1GMN A;  4AAZ A;  5CT2 A;  4H5T A;  5BPM A;  1NGD A;  3LDN A;  5AQK A;  2M8B B;  3QFP A;  2LY6 A;  2LJM A;  5AQS A;  5CT1 A;  1T0Z A;  3LDL A;  1S3X A;  2MN5 A;  3QFU A;  1JXC A;  2X2Z A;  2NY9 X;  4KYP A;  2YIO A;  1GMO A;  2LR3 A;  5AQL A;  3FZH A;  3KOW A;  5AQR A;  3SRJ A;  5F0X A;  4Z0E A;  2NY8 X;  2GMO A;  1BCG A;  1SN1 A;  2YC1 C;  1GP9 A;  2B68 A;  5EY4 A;  1AYJ A;  4DUR A;  4Z0F A;  5FPD A;  5COE A;  2SN3 A;  4YIV A;  4IUA A;  3LDO A;  1B7D A;  1YUW A;  2E88 A;  3BK3 C;  2JDQ D;  3ATV A;  2HGF A;  1PE4 A;  3M3Z A;  1N4N A;  5AQQ A;  2KHO A;  1LQQ A;  2Q8B A;  1T7A A;  4H5V A;  5I25 A;  1SEG A;  5FPE A;  1HX1 A;  2LJ7 A;  4KBO A;  1ZVG A;  1FH3 A;  3HMR A;  1XRS B;  2KBH A;  5AQN A;  1DQ7 A;  4UAO A;  2QWO A;  5AQU A;  3FZL A;  5AQZ A;  1NGG A;  4A5T S;  3CW4 A;  2VY6 A;  5AQV A;  5AQX A;  2A7T A;  4APM A;  1HJO A;  1ZFU A;  2KBJ A;  2Q8A A;  3QI7 A;  1C55 A;  1C56 A;  1ZU3 A;  5BPL A;  2QW9 A;  2KJA A;  1P0A A;  1JKZ A;  2QJ4 A;  1HKY A;  1MYN A;  1CN2 A; 
#chains in the Genus database with same CATH homology
 3A8Y A;  5CT1 A;  3HMT A;  3ATU A;  2QWM A;  2Z8W A;  4Z0D A;  3LDL A;  4R19 A;  3AY9 A;  1BHT A;  5CS1 A;  4APL A;  2YIL A;  4YIZ A;  5AQO A;  2QWQ A;  3D2F A;  1KAY A;  5AR0 A;  2LL3 A;  1S3X A;  2MN5 A;  3QFU A;  3SRI A;  3L56 A;  3FZK A;  5FPM A;  2X2Z A;  4H5N A;  2V7Z A;  4IO8 A;  5BPN A;  3D2F B;  2YIO A;  3KVG A;  5CS3 A;  2BUP A;  1GMO A;  5AQG A;  1NGI A;  5AQL A;  5AQH A;  4UAF E;  3FZH A;  3FZM A;  5AQR A;  4R1A A;  4FSV A;  4HWI A;  5F0X A;  3SRJ A;  2E2F A;  5AQM A;  1BA1 A;  4Z0E A;  3D2E A;  1I8N A;  3HMS A;  3GDQ A;  1ATS A;  3LDP A;  4H5W A;  1NGC A;  2GMO A;  5CS9 A;  2Z8V A;  2K35 A;  3KHW A;  1GP9 A;  2QWP A;  3C7N A;  5EY4 A;  2LN8 A;  4DUR A;  3D2E B;  5EOK A;  5EXW A;  4Z0F A;  2QJ2 A;  1BUP A;  5FPD A;  3R2V A;  5COE A;  5F2R A;  4YIV A;  4IUA A;  3C7N B;  3LDO A;  1ATR A;  2D56 A;  5BN9 A;  5CSQ A;  3ZWZ A;  1DKG D;  3LDQ A;  1BA0 A;  2Y8R A;  1W8K A;  2QXL A;  3QML A;  3MKP A;  1YUW A;  2E88 A;  3BK3 C;  2JDQ D;  5EOD A;  3L6Q A;  3ATV A;  3CQX A;  5AQT A;  5BN8 A;  2HGF A;  5CP9 A;  4FL9 A;  4R1B A;  5FPN A;  3M3Z A;  5AQY A;  5AQQ A;  3I33 A;  2KHO A;  1NGJ A;  4H5R A;  2QWL A;  2Q8B A;  4UAE F;  4H5V A;  3ZLE A;  5I25 A;  3FZF A;  5F1X A;  5FPE A;  3HSC A;  1HX1 A;  3SP8 A;  4KBO A;  1NGE A;  1NGF A;  2YIP A;  1NGB A;  4Z09 A;  1NGH A;  1POI A;  3L4I A;  4GNI A;  4UV6 A;  5AQW A;  1YXE A;  5AQF A;  1QQM A;  2LL4 M;  3HMR A;  4UAD E;  1W81 A;  5EVZ A;  1NK1 A;  3GL1 A;  5AQN A;  3IUC A;  4UAO A;  2QWO A;  5AQU A;  5AQJ A;  3FZL A;  5AQZ A;  1NGA A;  1NGG A;  2QWN A;  1HPM A;  3KC6 A;  4A5T S;  3CW4 A;  1KAZ A;  2VY6 A;  5AQV A;  2MBK A;  2E8A A;  1QQN A;  3FE1 A;  5AQP A;  5AQX A;  4APM A;  1HJO A;  5EX5 A;  3HN4 A;  2Q8A A;  3QI7 A;  2F83 A;  5AQI A;  1GMN A;  2K13 X;  5BPL A;  2J8L A;  5CT2 A;  3JXU A;  4H5T A;  2KL5 A;  2QW9 A;  3SF4 D;  2J8J A;  1KAX A;  5BPM A;  1NGD A;  3LDN A;  5AQK A;  5CT3 A;  1Z40 A;  2QJ4 A;  1HKY A;  4R1C A;  2QWR A;  3QFP A;  1QQO A;  5CS5 A;  5AQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...