2YJ3A

Conformational changes in the catalytic domain of the cpx-atpase copb- b upon nucleotide binding
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
249
structure length
236
Chain Sequence
b'LSLYEKMLHKGMIIKNSNVYEKIKEIDTIIFEKTGTLTYGTPIVTQFIGDSLSLAYAASVEALSSHPIAKAIVKYAKEQGVKILEVKDFKEISGIGVRGKISDKIIEVKKNDIAVYINGEPIASFNISDVPRPNLKDYLEKLKNLKIIILSGDKEDKVKELSKELNIQEYYSNLSPEDKVRIIEKLKQNGNKVLMIGDGVNDAAALALADVSVAMGNVADIILVSNDIGTLLGLIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COPPER-TRANSPORTING ATPASE
publication title Conformational Changes in the Catalytic Domain of the Cpx-ATPase Copb-B Upon Nucleotide Binding
rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 66
structure length 236
sequence length 249
ec nomenclature ec 3.6.1.36: Transferred entry: 7.2.2.19.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2yj3A01
3.40.1110.10 Alpha Beta 3-Layer(aba) Sandwich Calcium-transporting ATPase, cytoplasmic domain N Calcium-transporting ATPase, cytoplasmic domain N 2yj3A02
1JUDA 5AVSA 1T5TA 3KOOA 4GIBA 4UW9A 3ZU6A 1VFPA 5AVUA 2DQSA 3UMGA 4QQFA 4DWOA 5AVXA 5ALSA 1RMQA 2ZBEA 2OBBA 3ZI4A 3D6JA 2YJ5A 4JB3A 3ZVLA 2RBKA 2ZBFA 2I7DA 4XQ0A 1U2TA 5AKXA 4YCNA 2I34A 3IJ5A 3BA6A 4Y2UA 3NUQA 5IS2A 3OCUA 4C4SA 4HYTA 1RPZA 5ALDA 1EK2A 5ALIA 3WGVA 3NANA 3U26A 1Z4JA 4FE3A 5AW3A 5T41A 5ALLA 4L6CA 4NWIA 3A3YA 3WK5A 5A3QA 5AKGA 5AW9A 2GHQA 2R8XA 4UASA 1N8NA 5AI5A 2G1AA 3UMBA 4MWOA 3BWVA 2W11A 4HGQA 1RQNA 3WK9A 1ZD4A 3N8GA 1MH9A 2GHTA 4XPZA 4DW8A 3ET4A 3I28A 5FP0A 2MSNA 4BKMA 4CF5A 1Z4PX 3ZVMA 2O9JA 1Q3IA 3F9RA 5AIAA 1QH9A 4BX2A 4EX7A 4KYTA 2OA0A 3E8MA 2WF8A 3U13A 5AW0A 3UMCA 2YN4A 3A1DA 2A00A 1YDFA 3E84A 3WGUA 3QU5A 3IB6A 1QYIA 2YMLA 3OTQA 3QGMA 2P9JA 2P27A 5ALFA 3FGOA 5AK6A 4EX6A 4I9GA 2I33A 3I1YA 2B82A 5ALXA 5AIBA 5AVZA 5AVVA 4XE5A 3DNPA 2HEGA 3WKBA 4UMVA 2YMPA 3WKAA 1EK1A 1U7PA 1SU4A 5AM5A 2B30A 3WKEA 4BBJA 2PQ0A 2HI0A 4HGPA 5AI0A 5ALWA 2RB5A 4KN8A 2JAWA 2P69A 3PDWA 3L5KA 2BDUA 2NO5A 2NO4A 3WK8A 1K1EA 4UMEA 3MN1A 2IOHA 4C4TA 3OCVA 5A3RA 5ALQA 1MO7A 4YIHA 1XP5A 2C8LA 3KZXA 3L8FA 1N9KA 2FEAA 3QNMA 2WHEA 2JARA 3CZ4A 4UMDA 5ALYA 5ALRA 4AS2A 4Y2SA 3NRJA 2KMXA 1NNLA 1RRCA 3WK6A 5AHXA 4BX0A 2ZG6A 2HF7A 3L1VA 3U7GA 4PNHA 2B1RA 3QU9A 5ALVA 4KX3A 3OPXA 1AQ6A 4ZEXA 1X42A 4ZEVA 4J03A 4UAUA 1U2SA 2GO7A 3DV9A 3ET5A 3U19A 2WFAA 3N07A 5AW7A 4J2TA 3SMVA 3QX7A 1RLMA 3A1EA 2Q5EA 4Y2PA 5AI6A 1MO8A 2R8YA 4RESA 3E58A 2YMQA 2YMMA 3CNHA 5AM1A 1ZS9A 4Y2VA 1J8DA 5AM0A 5AK5A 2AGVA 3ESRA 2G07A 1NF2A 4E88A 2RARA 1YJ5A 2QLTA 3SLRA 3IRUA 2AMYA 4YCMA 5ALEA 2RAVA 2ZBGA 3SD7A 5AVYA 2GMWA 1RMYA 4UARA 4IFTA 4CF3A 4F71A 1ZRNA 1L7NA 4NV0A 1L8LA 3QU7A 5AK3A 1RLOA 1T9ZA 3U7EB 2C8KA 2G0AA 4GXTA 3AR7A 1SWVA 1RMTA 5ALNA 3U7HB 4NAVA 4EEKA 3FZQA 1XPJA 1SVJA 2JAUA 4NFLA 3NAMA 1Z4QA 4BNDA 2YBDA 2IA5A 1WPGA 3A1CA 3K1ZA 4UATA 4CNQA 2HSZA 2QYHA 4UMFA 1Z4OA 3ESQA 3UM9A 4AS3A 1Y8AA 1TJ3A 3SF0A 3MC1A 1TJ5A 3QUQA 5AVWA 2YY6A 1Z4IA 4H1WA 5AVQA 2PR7A 2YFYA 3QUCA 2WF5A 2FUCA 2YJ4A 2G06A 4BEWA 2FPUA 3ZW7A 3E81A 2X4DA 2HOQA 3L0BA 4Y2JA 3NASA 3U7FB 3QUTA 1CQZA 4EELA 3ZX5A 4UAVA 1ZD5A 2WF6A 4YH1A 3L0CA 1QQ7A 2HHLA 3W5AA 3AR9A 2I54A 1RKQA 4KNWA 5ALUA 4CF4A 1L7MA 1ZD2P 1RQLA 1WR8A 1QQ6A 5AVTA 1FEZA 3QU2A 5E0OA 2ZBDA 4YIKA 3B8EA 1L7OA 1XVIA 2AUTA 3ONNA 4RETA 5ALJA 3I76A 2NYVA 2FPWA 3L8HA 1T5SA 1WZCA 2HCFA 4YGYA 4OD0A 3M9LA 3GWIA 4I9FA 2G08A 4DCCA 1IWOA 3ZUPA 3AR3A 3PCTA 2G80A 5AICA 3TLMA 4AP9A 4OCZA 4QJBA 1RKUA 4C4RA 2HDOA 1ZOLA 3KD3A 1Z5UA 5AKZA 5AW5A 3L0YA 3PGLA 4Y2YA 1NRWA 4UM7A 4UU0A 1YV9A 1Z4MA 3MPOA 5ALGA 1YS9A 3L8GA 3RF6A 3OCZA 1O03A 2AH5A 2OM6A 2B0CA 2C88A 5AVRA 5AW6A 2ZOSA 5AKIA 1ZJJA 3N5KA 5ALHA 4Y2TA 2FDRA 3W5CA 3L8EA 3ZTYA 4L6AA 4YCLA 2I6XA 5ALOA 3QU4A 4Y2RA 2B8JA 2W4MA 1CR6A 2IOFK 3M1YA 2B1QA 3HYCA 3DDHA 3QYPA 3QXGA 3DAOA 2FI1A 3AR5A 4Y2XA 1WVIA 5AI9A 1Z5GA 2GFHA 3MMZA 4XOUA 4DFDA 5ALTA 4ZEWA 3W5DA 3KC2A 5AKJA 4HAIA 4HGRA 5IT4A 2ARFA 2O2XA 2D2VA 4HGNA 2A29A 1F5SA 1KYTA 2CFTA 3R4CA 2IYEA 3R09A 1U02A 2VKQA 2Q4TA 3KDPA 2BY4A 4Y2QA 3FPSA 4FYPA 4FFDA 1QQ5A 1YNSA 3W5BA 2KMVA 5AM3A 3B9RA 5JJBA 4UU1A 2HF2A 3R9KA 3S6JA 2FPSA 5AW4A 5AW2A 5ALPA 1TA0A 5ALMA 4BEVA 4B6JA 1U7QA 3AR2A 3FM9A 3PGVA 2PKEA 2ODAA 2CFSA 2YJ6A 3RFUA 4F72A 2EAUA 5AKKA 1TJ4A 4EZEA 2BDEA 1SWWA 3QLEA 3AR4A 1PW5A 2FPXA 3SHQA 2IOFA 4NABA 2R8ZA 1VJRA 1L6RA 4OHFA 5AM2A 2R8EA 1RC8A 2EATA 3L1UA 4KX5A 5AKEA 1RKVA 3I6BA 3L7YA 1ZRMA 4L57A 3ZWKA 3VAYA 3WKCA 2C4NA 5AW1A 1LVHA 1Q92A 1Q91A 3N1UA 4Y3UA 2W43A 2CFRA 4G9BA 2G09A 4MUMA 4BYGA 5AI8A 3EF1A 1J97A 3OCXA 3NALA 5AW8A 1Z4KA 2FPRA 1Z4NA 4HGOA 2CN1A 3GYGA 3NIWA 2YJ3A 5AKLA 1RLTA 2FUEA 3J7TA 2OYCA 1VJ5A 2WF7A 5AESA 3ED5A 3QUBA 5A3SA 1L8OA 4BNDB 1ZD3A 3FVVA 2Q4RA 3OCWA 5AK4A 1LTQA 4EENA 4G63A 3WK4A 1S8OA 2HO4A 3ZTWA 1YMQA 3HLTA 2MU1A 2WF9A 1U7OA 4JDPA 3SKXA 2ZXEA 2EARA 5ALZA 1TE2A 3N28A 4IG4A 2JAOA 3P96A 1Z88A 3EWIA 3AR8A 5IT0A 1L7PA 3OCYA 4O8CA 3ZVNA 5AM4A 4KNVA 5AKHA 2C9MA 1RDFA 3EPRA 5AKYA 4CE6A 4BX3A 2P11A 3EF0A 5AI4A 5ALKA 1Z4LA 2WM8A 3FPBA 4OFZA 3WK7A 1S2OA 3ZX4A 3SKYA 2B8EA 2JGAA 2HX1A 3B9BA 4UM5A 3WKDA 1O08A 3ZWDA 3KBBA 3AR6A 2I55A
chains in the Genus database with same CATH superfamily
1ENPA 5BQFA 3G2JA 1M8KA 4KDFA 4OHWA 3VDRA 1URPA 1N5IA 3DMNA 3NWPA 4AMVA 2Z1NA 3LQQA 2PYZA 3A9WA 3WLMA 3J7AC 2HSDA 2O3QA 2Y1CA 1EXWA 4OXQA 1MP0A 2FZVA 2V6BA 3NBUA 4HDQB 2PEZA 3SX2A 5JRZA 4QFCA 5AD1A 1U2TA 2XJ4A 1HQYE 1ZCFA 3KZ1E 4WXEA 2QRZA 1UFQA 4X00A 5JCOA 5CLJA 4IHQA 5A6VA 2R2AA 3TOXA 5H4GA 2RH4A 3RREA 4MV7A 4XB6B 4PTLA 2WBLC 1VLHA 1Y3DE 4OQPA 5KAMA 1II8B 3I9LA 1C0KA 2PSDA 3KYJB 3F9IA 2BSQA 1Z4JA 3ANSA 2ZKIA 4HVCA 1YI8A 1EVEA 4WZ6A 2FW7A 2CSXA 4A8JA 2WFLA 4NCNA 2WZDA 4ZYVA 1YVDA 1VP3A 1L6IA 3BD8A 2VRNA 3QFHA 4L07A 3WK5A 4CV3A 1P4GA 3IC5A 4GYWA 3IP1A 4L9RA 4U5QA 3EVTA 4FHCA 4C08A 4UASA 4EVRA 1NXXA 3DWFA 1F2DA 1GIAA 4DR1B 8LDHA 3IP9A 4LXUA 4MWOA 1XD2B 1NJGA 3A3NA 3PA8A 1GPJA 1IB0A 1JG6A 2IYVA 2RH8A 3BFVA 2O0HA 2MHCA 3KVRA 1R0BA 3EGXB 3TZQA 4DZRA 3VNVA 1M1XB 3QLUC 4FFBB 4IOMA 3T3EA 1ZVMA 3I0NA 3TLEA 2HLHA 5CEJA 1YBVA 2C7BA 4PYNA 5DCUA 3HVUA 3JQBC 1WQ1R 1E59A 1CK4A 1Y8QA 3LC0A 4G1VA 4NONA 3NPMA 4O2RA 3WIUA 4DW8A 2VP6A 4G0WA 1NFFA 1C4XA 4RFVA 4W5OA 4MIEA 4MW5A 1H6AA 1FDIA 5EE9A 1F06A 3AM3A 1DBVO 3LW7A 1OIVA 3SSNA 1RHJA 2QBYB 1QH9A 3CRMA 3ODPA 4DIUA 1GU7A 4IJUA 1QH8B 2P9HA 2Z56A 1H22A 1QVVA 4MPTA 4OLHA 4YFYA 2JEOA 2I4TA 3I9FA 4D4LA 5CB4B 1SOUA 1Z22A 3HKCB 2XNJA 2JB9A 4X3PA 3HXKA 1UBFA 3UXYA 1R37A 3FKQA 1SZJG 1ZMBA 1J56A 1HFJA 2C54A 3AT1A 3IHTA 5DBEX 4EHIA 1FFWA 1V5EA 3HY6A 1EJ6A 5SY6A 1WHTA 4H15A 1BX0A 2W6JA 5FBKA 3ROGA 3GB9A 5C31A 2PTGA 2Y0BA 3P0FA 3OTQA 4WECA 3O3MB 4BN4A 2ZR7A 4EPRA 5IN4A 1ABBA 2OCXA 1ZGHA 2HQBA 3O47A 4BL5A 1LS1A 3DMRA 4E14A 2XMDA 2I33A 2WVAA 2IZZA 3ASZA 3HJUA 3P52A 5COAA 2XYVA 5BSRA 1J21A 4DOMA 1H8EA 3DM9B 1JN0A 1KO1A 4BTEA 1OXKB 1T5DX 1QK3A 1VCNA 1WV0A 3PA6A 3QRWA 4JASB 4W7SA 3W2TA 4CG1A 4AM8A 4W7HA 4PGMA 2IHUA 2AXPA 2PWZA 2QTGA 4BB6A 3PSHA 2DBYA 3FFTA 4NU6A 3BULA 4W5QA 3WKEA 4FBLA 1ZC3A 4M6WB 1KKLA 3I9JA 5JFOA 2VF5X 3O8QB 4BAZA 2VP2A 4KN8A 1UM9B 4D74A 3PDWA 4CV0A 5ICEA 4NCAA 2F8SA 3OJWA 4IHJF 4RNCA 4ZQEA 1DWQA 3PEUA 4C03A 3AFMA 2IU0A 1PFYA 1SK8A 4B6EA 2WFMA 3AHHA 4DARA 1ZCZA 4Q3KA 2V98A 3GZTB 4RCZA 3QVGB 3SEQA 1DDOA 2G9ZA 3MN1A 3PPVA 2HZBA 4FC6A 4IMRA 4LSZA 4MDHA 3BTUA 4AMUA 4C4TA 3OCVA 3OQIA 1VPDA 4MULA 2NSYA 4F5ZA 5H16A 1KP9A 5C1IA 1J0AA 3ENWA 2AZDA 3BXXA 3GRZA 2HJWA 2VZEA 4R69A 5CT5A 1X1SA 5BW8A 3ROQA 2VUSA 1ADBA 3A1VA 4TL8A 4Q3AA 1O3YA 1P60A 3I0MA 4V3BA 3S2IA 3PEWA 1TTQB 2O7SA 3PC8C 3JARA 4G23A 3GT0A 3QJ5A 1TF2A 1EA7A 2I67A 4NCJA 1KI9A 4LK3A 1QHHB 4M0UA 3GJSA 5A06A 4NE9A 1ZNQO 5KWVA 1B8OA 3EZ7A 4WCFA 3V4OA 2O23A 4TMXA 2CLLB 2VTBB 1EIZA 2H1CA 3CSDA 3SGLA 4AF6A 3CRZA 3X2SA 5BPHA 4CKCB 5JANA 4BQSA 1M9NA 3ADPA 1X9IA 4HB0A 4I55B 5AXBA 1Z5OA 3JQAB 2ONJA 1ANKA 5IAAA 1CEEA 3ZY4A 1A1VA 4MSUA 3D5TA 3ME5A 4B3XA 3GLFB 4C3ZA 1NRIA 2CYBA 3EGCA 4HZIA 4EG8A 4M7OA 2P2ZA 4IGEA 5TS3A 1X8XA 4L08A 3RTEA 5EEHA 4FEAA 5C37A 1QR2A 3O3CA 1OGIA 1SQSA 4HGYA 4P32A 4BQEA 1GVHA 3NRBA 1F60A 1YQXA 3DZBA 3FDFA 4E31A 2WAMA 4D3DA 2E89A 1EDZA 2JHGA 2NO0A 5DM1A 2PN1A 3BL8A 3JATB 3STUA 5DV9A 1UOOA 1YA4A 3D3JA 2XRYA 2OD9A 3H6KA 3D6NB 3D64A 1CJSA 1LDMA 4YT5A 5HBRA 1II9A 5DM0A 1AKVA 4MLPA 1L0BA 2Q3CA 1LS6A 3TQSA 2PFGA 4B33A 1CE8B 5KOJB 1QP8A 5E6UA 2QTVA 4JUIA 1O8CA 3B7PA 5FL7A 3TM5A 4G1CA 2GSWA 2Y1LA 4ESHA 2VUTA 3KQVA 3KQQA 4FYJA 3SYRA 3ZY2A 3MWJA 3RIYA 2ZBGA 5DN6A 5KQGA 3O2NA 4BO0A 4Y18A 3BDVA 1QGUB 4MVJG 4I14A 1HLDA 3VR5H 2JDIA 1PO7A 4NV0A 4BUZA 4OUKX 2R65A 4UQPA 4GOLD 4ZALA 5I4BA 4BPBA 1W73A 2NZVG 2QJRA 4NNJA 4WBXC 5TQ0B 4XEUA 3VH4A 3I01A 1YR7A 3AXTA 2DCUA 1D9XA 3P94A 3WLRA 2FUNB 2DZDA 1O5OA 1CY1A 4UUOA 1ISIA 1Q50A 4H3KB 2QVGA 3ZV7A 5KNDD 2G76A 5IJZA 1EFPB 1R9GA 2AI3A 4RV5A 3O8NA 3RS3A 2QRUA 4IJMA 2FK7A 1XPJA 1PL6A 1Z06A 4D0RA 3ZH9B 2WV9A 2ZSIA 2OQ2A 1MB3A 3WLQA 4Y7CA 1DQSA 1ZIPA 1AO0A 1BMFA 4J0EA 3GF4A 2BVNA 3ILHA 2IYAA 4MR8B 1XVVA 4FFPA 3BS4A 4IILA 4PQYA 5JVDB 1UIRA 2GN2A 4F3CA 1NYRA 5IMSA 5DTMA 3O83A 3UAZA 1M0WA 4C0SA 4C6HA 2QG9A 5AVWA 1HKUA 3ZHCA 4TXHA 4TLMB 4C05A 4WOJA 1C9DB 3LHSA 3PFGA 1B1CA 1ZM3A 1CDDA 3U62A 2H0AA 2ZWVA 3IAS6 1T1EA 4BKPA 3AUYA 4OB6A 4OU5A 1W88A 2BMJA 4MHSA 1K8RA 2VHVA 3D6AA 2AFRA 3GZNB 1NVBA 1UFOA 4DSNA 4KFRA 3UWMA 4C6TA 3U44B 2PNJA 4JLDA 5F9HA 3GXOA 3ZX5A 1Y1QA 2VDWA 4IMJB 3HXTA 4FB4A 4TYYA 2JH8A 2ZVPX 4DJAA 2WF6A 5CIWA 4M8SA 3FYCA 2EG5A 2HHLA 3E7FA 3PGJA 3BKWA 3D0RA 3NWJA 3HGMA 2I54A 4CM7A 1MG0A 5CPBA 3WQHA 3RSHA 3IPRA 4RVGA 4CG3A 2O2JA 4WZBE 3SE7A 2WM2A 1G8JA 4DNOA 2PV0A 2YHIB 4HQLA 3WGQA 1Z62A 5CVTA 1PJSA 5BR7A 2ILVA 1KMCA 2A1IA 4MGKR 3CB2A 4LBZA 5FAXA 3L02A 5BYKA 1TTHA 5BSFA 2IUUA 4IR7A 1ZUNA 1FLAA 2CK3D 2GS9A 2VBGA 2KJQA 1GPWB 5DZSA 3NHFA 3GJ3A 4K9MA 3JPYA 4B7CA 3H9CA 3RG2A 2NQTA 5EQJB 3CUTA 4BCBA 3TLYA 1KFKB 3BBPA 2W2LD 3BIJA 4H4EA 2OBMA 4YC7A 4C9BA 2K5UA 2VT2A 3PP8A 4DSZA 3LHKA 5KJCA 2FP4B 3NTVA 3PE4A 5HF8A 4ER0A 2TYSB 3IODA 1E7SA 2LKCA 3D8RA 3W77A 4RD4A 4CM4A 2Q8PA 2IKSA 3E9CA 3JCZA 4IKOA 4Q9NA 4YAFA 4C6RA 4P0QB 1Q3KA 1BVYF 1Z0IA 2V59A 4QXQA 3RRJA 3KEMA 3LZDA 1GAEO 2JFZA 2HUNA 3WWPA 3IT0A 4AP9A 3W5CA 4L4ZA 1F8UA 2V74B 5BOSB 5JYDA 3RC1A 3DBOB 3WNDA 3L6DA 3KJZA 4OX9B 4BWFB 3HDHA 4F1JA 1NVVR 1AQNA 4MUKA 2DFLA 3MM4A 4OFBA 2WJYA 1NRWA 3G2OA 2PLFA 3ZCUA 4GS5A 1DAHA 3QKRA 1N3BA 3O91A 4QC2A 4RMHA 3VTZA 4DCNA 2GEBA 1K27A 4TLCA 2ZRDA 3P2YA 3K09C 2VHZA 4YECA 4NPCA 4LOIA 4PZYA 4Q4HB 5DX0A 4DG9A 3ZWVA 4DWJA 3QA9A 5J2UF 3RU7A 3AUXA 4CMIB 3WAGA 3I5XA 1I2AA 3O31A 2ORVA 3ERCA 3IVGA 1YR6A 3ZNNA 1Q1NA 1QHEA 3TTUA 2GRUA 2ANBA 2RB4A 5IDVA 1OXTA 2FEOA 1A4RA 1PQUA 4V2IA 1NY5A 1QF6A 4L6AA 2O8NA 2C5BA 2QROA 3EBLA 4J6EA 4MZDA 3D3NA 5FBQB 5IEBA 5CEFA 2HT1A 4B82A 1JAXA 1JPNA 2FFAA 1ZVJA 2FN4A 2QRLA 4CNBA 5BVGB 5JZSA 1GPAA 3DMDA 1FDUA 1KR2A 3OESA 1XDWA 4MQ5A 2OV6A 4ZOAA 4TMFA 3P2MA 3DKRA 1ZXXA 4LPKA 4P3NA 2H2WA 5DGHA 5T64A 2MCFA 2ZYSA 3RWMB 3ZXIA 1QP7A 4R41A 3EXG1 3SX0A 2BR3A 4EEXA 4AMGA 3K7EA 3G1UA 1GUDA 1PTJA 1UPFA 4TS4A 4MIOA 2NWQA 4EG3A 3ZV3A 1C30A 2HUPA 4HWTA 4UEJA 1BO6A 2EF1A 4GR4A 1PHRA 3V8BA 1CQJA 1CUJA 3P45A 2EWWA 5AOVA 1IXSB 1XYVA 2VIIA 2X0FA 3FPJA 1YWGO 2PD4A 4HPWA 4MYRA 2K2QB 4ITRC 2C5HA 1YJXA 2FFBA 1G2QA 3AETB 3ZDEA 3A37A 3I6QA 4CDGA 1BGXT 3D8SA 3HDVA 2CVQA 1Y9EA 3ROPA 3TRKA 3LOQA 2X6QA 4LF4B 1ISJA 3NIDB 5C53B 1LBHA 2ZUUA 3BD9A 1JQDA 1W0KA 2D3WA 1YC2A 1N25A 5IX8A 3D8HA 1KEUA 1J2UA 5AM3A 4A6PA 2HH9A 2AJTA 2BTOA 4PY2A 4YUXA 3CO5A 1L5GB 5KOHA 5EUCA 5D3MA 4U7WA 3CB4A 1T24A 3D4NA 3NGXA 4IDGA 3Q0EA 1WZEA 3I1IA 1QE3A 3HBJA 3BDIA 1TIKA 3LPMA 4D9BA 4KN5A 2ZB8A 1YZ3A 4HDRA 2H92A 1E58A 1PFQA 1CUBA 3TSOA 1WCYA 1UODA 4QGAA 5T4EA 3T5CA 1BCRA 1T4CB 2I4LA 1Q1EA 1XMXA 1EM8A 4GKBA 4WDQA 2FPXA 5EZQA 2WUWE 1U2GC 3DO5A 1O97D 4QFMA 3T38A 4UOZA 4MCAA 1NQXA 2XUHA 2PKCA 3O2SB 1HZZA 2ZSUA 3I61A 4X7RA 1GQFA 4UKDA 1NQTA 1SG0A 1LVHA 1Q92A 3GH3A 3QOWA 1JEQB 4IGKA 4NU0A 4FDTA 2V58A 5GV7A 3VHLB 3JQDA 5DASA 5TF4A 3CR8A 1S7CA 3GVHA 4LWPA 1BA3A 2C7GA 5HIKA 4DBZA 1VPTA 1NI4A 1TVMA 3G2PA 1WKBA 4JC0A 1C7FA 4NYMR 5BSEA 3SIWA 1B0PA 3GGGA 3NALA 2QTCA 3GL9A 5GONF 1CDZA 1RJ9B 1TT7A 2IEAA 4M1TA 3WL3A 4GPAA 1DPGA 4JBLA 1B73A 5C1DA 2YINC 1RAAA 3H2JA 2GPSA 1FRVA 4XM0A 5JQGA 5CA0B 2I6TA 2VAMA 3STVA 3KSBC 4M1YA 1WUYA 2EKLA 3NHZA 4BGVA 1CUFA 3KHTA 3VISA 5DHQA 1EXMA 3D81A 3OIFA 4PYQA 2QTHA 4ESVA 1P1KA 1N6OA 1HURA 3GWGA 3I09A 4ZXPA 2OXIA 3ZQJA 4GGPA 2P5UA 4K0RA 4KWHA 4O4HA 4BNKA 4UE6A 2FDXA 1GTMA 5TRTA 1ZM7A 4G63A 1F8GA 3H2HA 3IFSA 1E3DA 3WYDA 5HQ3B 3C6YA 1GQRA 1N57A 5I7RA 2VHUA 1V96A 4ENWA 3S7TA 1BW9A 4G0PA 3R2JA 5CVEA 2ESRA 2PHZA 5E1MA 3K20A 1GKLA 4N4AA 1XAIA 1YVEI 2Q07A 2VA8A 1GCAA 3HV2A 2QW0X 3IUEA 4I46A 5M34A 2IYYA 2OORA 3BH6A 4CFSA 5KNLA 3EHDA 5F76A 4YJ3B 4Z53A 1XR3A 1Z47A 2HBRA 4HAWA 5FQOA 1XZQA 2RK4A 3ELDA 1XPUA 4O1HA 2R00C 1T8SA 2ZJ6A 1I2ZA 3GT7A 2G7MC 3HJCA 3DE7X 4PLPA 3QENA 3PF8A 3LLUA 3KTFA 2G4VA 4QPDA 4AIRA 5IBCA 2ISCA 4ND4A 3CRVA 4OFZA 4K26A 4Z8XA 1IH8A 3WXMA 2A0UA 2NUTB 2DHEA 3DT8A 3NIFB 3AEQA 4IX1A 4TXNA 1NXSA 1D2GA 1PIWA 3ROTA 4AURA 3Q3IA 1P18A 4UM5A 1C1DA 1AZSC 4W7IA 1MB0A 3QOYA 4EKIA 2P67A 3FHOA 4L8FA 2VXCA 2ODPA 4A0QA 8ATCA 4O1IA 5HG0A 1GRRA 3OE5A 3LT2A 3QELA 4ZRDA 4AY5A 1AGXA 2QMUA 5JNSA 3FWYA 2YRXA 4XCVA 2VPXA 1RM3A 4I1RA 4MV1A 1GN8A 1RMQA 2FNAA 4P4LA 3DYVA 1VJTA 3G8BA 1I3KA 3MBIA 4HATA 4YA6A 4XQ0A 1SCDA 5AKXA 4CKYA 2OUIA 4D56A 4JI7B 1C50A 2I62A 4UHBA 3I12A 2SKCA 4OBXA 4KWEA 3T9AA 1I10A 1X1EA 3F2VA 2YQZA 1P3DA 3OY2A 3TQRA 1SUIA 1ZMOA 2KWIA 2Z08A 1I6LA 3B48A 3CG4A 1GGHA 2NTJA 4MCJA 5TR9A 2W2KB 3EGOA 4GM0A 4YP0A 3WLOA 3ZBQA 1H2ZA 4FGKA 1FTWA 1RQ7A 1RWMA 2NTNA 3RYFA 1QSGA 4RPJA 3W2GA 2XZLA 1GSOA 2AX4A 4CCSA 4JSRA 4M49A 5HILA 4D3YA 1IOZA 2P0YA 1B2RA 3EIFA 3MYYA 2XB4A 3CLRD 4E5KA 2QTLA 3BFXA 1KPHA 1E1YA 3H65A 3NFRA 3MNFA 3NOXA 3NYRA 4FEYA 4JFRA 3O7WA 4TRJA 3HR4A 3WJ1A 1QG2A 3DQQA 4EPTA 5B55A 3IMGA 4XVQA 3BFJA 1YTLA 2P3LA 5E95A 3ICPA 4CG2A 1UMBA 4PU0A 1EWVA 4U1RA 4F4CA 3UMBA 1A8QA 1W36B 3NHPA 3PZRA 4CW7A 1HE4A 1SXQA 2BFBA 3ZS8A 4KL8S 2FMIA 1UEJA 4MV3A 3P9IA 4KMRA 1T4DA 4IWNA 2BW0A 4P38A 3CX4A 4IJQA 5G0UA 2Q41A 3TD6A 4MW7A 3WK9A 2PZBA 1QCCA 3EZFA 1HNWB 3U39A 1GZ5A 2XUGA 4CHGA 3ET4A 5FP0A 5J2TA 2EFHB 3EVDA 3W79A 3LSTA 4BLOA 4DLLA 2X5KO 2UZAA 2O9JA 3R6DA 3A9TA 4B87A 5BR8B 2B4YA 4ASUA 5JIBA 4BX2A 1U28C 1F48A 1U7ZA 3CURA 3LF1A 4TV9F 3DE5X 2AHOA 1WY7A 2H1VA 1OZ0A 3UKDA 3VMFA 4F2PA 6REQB 4HDKB 4MW2A 1PDVA 3PX3A 3U13A 4MWTA 3TW6A 1DAOA 3B1KA 3UMJA 3FTEA 1J1UA 2AMFA 2R11A 1L1EA 2FU5C 1ABEA 1M2GA 3IB6A 4FT2A 1FNBA 1B26A 4JQYA 1QYIA 1Y9ZA 4O3MA 2GA9A 4XIYA 3G49A 5TPZA 1GM5A 2XDQA 4ZCQA 3HJTA 2INGX 4E11A 1S3IA 4RE5A 5JZBA 4BN5A 4BHTA 1NG9A 1IBLB 2X0KA 3RSCA 1FS4A 2BLLA 2ZJ5A 3TAHA 5IABA 3IXQA 3WDKA 2LP4Y 1OBVA 2RI6A 3IDZA 3H5WA 3Q3HA 4FOPA 4M4SA 4WZZA 3R8XA 4EDHA 1J39A 2FUG1 1NU8A 3HDTA 3JR7A 3RWBA 3ZE8A 3LK6A 3BJIC 3LX5A 3H4TA 2E7ZA 4TRMA 4DWWA 1YAHA 1POXA 2MR6A 5TMEA 4N5MA 2CNKA 1B23P 1FYXA 5HOQA 4RD3A 3DZ8A 4MRRA 4OQEA 4EHHA 1T0IA 2XADA 3T99A 2QUIA 3EUAA 4K8RB 2C3OA 3Q12A 4R16A 3K5IA 5CNKA 3ASUA 3BBLA 4EGQA 3FKSD 4OREX 1DJQA 2NPFA 2BDUA 1QANA 1TL7C 2L82A 3C7CB 5FEMA 2RH9B 5DHAA 4EFDA 3VJLA 1GG5A 1RC0A 1Z6PA 3EZGA 5C8DA 1HEUA 3ZXUB 1SUFA 4HAXA 1UPUA 5AVOA 1Z8DA 5A3RA 3F7TA 4S35A 1H9CA 2C8VA 2LE0A 3TW8B 4LOJA 2QUBA 2V7GA 2OCAA 4MQLA 3SDBA 3N2KA 3VZRA 4U2DA 2WHEA 3KYCB 1KE2A 2COKA 2EQBA 3HBNA 3FWNA 4I50A 3PCRB 5HR5A 2O1XA 1WL8A 3FFBA 5D1NA 1VBFA 1R6TA 3I92A 2VJKA 5LD2B 2EBFX 5JVDF 4NBTA 5GPBA 4O4JF 1J1IA 1WS6A 2FOIA 4XYBA 1EWRA 1FP6A 3G9UA 5IRCD 2DUUA 4CMGA 3EBPA 5EXDA 1TC2A 2KW5A 1TMKA 2QUHA 4GP9A 4KU4A 4YB8A 4WQMA 2VHJA 4QFBA 1NF3A 5B7NA 2ECOA 1BG6A 1MJHA 1R64A 1SCBA 2PS1A 4B0OA 1CZNA 3DQZA 2VP4A 1Y37A 1Z3IX 3E9EA 5JYCA 4P0TA 1XLWA 4ZEXA 4EB6B 4ZEVA 1O0BA 4BMXA 2ZUEA 3I62A 3OG9A 2FSPA 4MINA 3GMIA 1OW3B 1ZONA 4PG7A 2A2ZA 3LDUA 2R8OA 1N9GB 2QN9A 3F4LA 4MP6A 1E3JA 1NBMA 3C3BA 3QIVA 4W63A 3COPA 4XGNA 3X43A 3DO8A 5IJ0A 3WISA 5L4SA 3AUUA 4YEDA 4JJZA 5EP1A 3SZOA 3A8TA 1XTQA 1ZZGA 4I1SA 4IV0A 3D6UA 3HJGA 3PUJA 1F4PA 4URWR 5CVUA 3DW3X 5DEIA 3CR3C 4NJMA 3W8EA 4ZI2A 5JDIC 1N7HA 2GXAA 5LQSA 4RJLA 2NPOA 2CC2A 2I22A 2Q3DA 2JLUA 2DKNA 2D59A 2GPYA 3BRWD 3VSAA 3X1XA 1X8JA 4TLLB 3O4HA 3WWCA 2OHOA 2CDNA 1HNXB 2QRKA 4Q66C 2Z6AA 1Z6QA 3UFXB 1MXHA 2VXOA 3UQZA 3WMWA 2QVLA 3THWA 1Z2CA 2ZR9A 1RYNA 3OX3A 1T3HA 1TYEB 1XD9A 2RAVA 3QUAA 2CLEB 4J4HA 4O2BA 1U4SA 4Q5IA 1H69A 5D5HA 3QF4A 1QO0A 4FZ3A 4RZ3A 1QE0A 1V6AA 3G68A 3CPHA 4FU0A 3K5PA 1VYHA 3OTHA 4RM2A 1RLOA 2V03A 3IV7A 2TSYB 4TX1A 3WYFA 4GLJA 3AR7A 1ZSVA 1N36B 4QOJA 5BSHA 1QIEA 4HD8A 5T8KA 2IYNA 4MGIR 3LT1A 4BQOA 4XARA 5I7UA 3N2NA 4YAUA 1U0RA 4RHTA 1JRLA 3OM8A 3QFSA 3GLIA 4MUBA 3AB7A 3BORA 2F8TA 1N0IA 1WNTA 3KJNA 1SXJE 3VC1A 4AJEA 2BJWA 3VQTA 2BKLA 2DP4E 4JS0A 1CVRA 4KAFA 1AGRA 2FXIA 4XVRA 1M75A 2AEFA 2J87A 4ISBA 3THOA 4J90A 1VIVA 5JR3A 2JI9A 4IW3B 3R4VA 4RTKA 4DV6B 4M1MA 2DPLA 5D6OA 2WHPA 3L9WA 1KNXA 5FI0B 4EHBA 4NJEB 3C3EA 2YY6A 3A6FA 3DOUA 2G36A 1WDWB 2I6GA 4L0MA 4Q47A 2WT9A 2YFHA 4DNFA 3OLQA 4RZUA 3HTXA 2NXEA 2KQUA 3IMCA 3H9UA 2XOKD 1ZGBA 4A8JB 3DJFA 4HWRA 3E81A 2MSDB 3T6KA 4C0BA 1SHLA 4V2UA 4OXXA 4X1YA 1A95A 2AI2A 3NO4A 4MWBA 4LSGA 4O08A 5LKRA 2I9KA 1KEVA 1T8TA 4Z0HO 3IKVA 1GUFA 4LBVA 3GFVA 5HOEA 4D81A 1HMPA 3ZBPA 4Q1FA 4QQRA 1O5IA 5CXUA 2Y93A 1PRYA 4ZT6A 3BXOA 4I1VA 1GZ4A 4NK4A 3HCRA 5IW8A 5KB3A 1W4ZA 3P0RA 2HGZA 2HM7A 3DAYA 1ZN8A 3DG9A 4WZBA 4KQXA 4HWPA 4JNCA 4CR7A 4MR9B 3WWEA 4NL4H 2HU5A 3REQA 1D2CA 1GL3A 1ACMA 2C7RA 2CVHA 1E79D 3B6JA 5JAPA 1TVKA 2ZIVB 4ICIA 1NM5C 2HZ7A 5EIHA 3FXAA 3GOQA 4CWAA 3I76A 4B2LA 5FLEX 3I58A 3MOGA 1YBMA 3ND9A 1D6MA 3HB1A 3GLHE 3LUCA 4DDTA 5CFRA 1X14A 2FOLA 4P86A 1GTRA 3M9LA 4M37A 2JASA 5CT8A 4KQ9A 4S04A 1J9GA 3OUUA 3CA8A 1KEEA 5CX4A 1KRXA 2CLIB 3ZUPA 3ZPXA 1KGDA 1LI7A 1Y6FA 4PYJA 4K2HA 5DMXA 1PZEA 2ETVA 3AEUB 2PMBA 1DZ3A 4PFJA 1JVSA 2BEKA 3D7KA 1F2VA 4Y1FA 1ZH2A 5HJEA 1FVFA 1WHTB 3H1FA 1O87A 1XD8A 1R5NA 3PFWO 4G37A 3TPZA 1JI3A 4CKEA 4DA6A 4EF4A 4N48A 2X2EA 2NXWA 4YXFA 3DXZA 1K9VF 3KD3A 4LXTA 5SZIA 2BAGA 3FZNA 3GDHA 3GVPA 1V39A 1RBQA 1X7YB 3LXXA 3PNYA 4BP8A 2ZSFA 5JHGB 5LLTA 2J6IA 2OCIA 2J1LA 4IFBA 5L3QB 1JR6A 4P80A 2CJPA 5C46F 3GT3A 3ZU4A 1WBJB 3HB5X 3VI3B 2XOXA 2JFOA 3FDJA 3G6WA 3PYLA 1DINA 2VTKA 1AKTA 2QE7A 4OQMA 5DNWA 5HF9A 5KSPA 4CM6A 5A9SB 1L4NA 2HCTA 1TQHA 3HVKA 1Q74A 4W5HA 1OREA 4JA0A 4YWHA 1JKIA 4P3KA 1T3ZA 5AKIA 3ZNPA 1BMDA 1H6DA 5LM3A 1DRWA 3G8YA 1N77A 4W9RA 3OZWA 2PX5A 1KVTA 2V7WA 2YS6A 4KDCA 2NUBA 3KAPA 3O84A 4YYZA 1NATA 4CQNA 5CA0F 4HNSA 4K9OA 4QM7A 5M5BA 3K2BA 2LGJA 2MINA 5BORA 2PVSA 1CUCA 2FETA 2GO1A 3DAOA 5TQVA 2M6LA 1DAIA 3T61A 4K5QA 3CVVA 2WJWA 1MQAA 3CZPA 4DWVA 2QN1A 3G17A 5AI9A 4YUVA 4AVYA 3LCMA 4B73A 1QP4A 1Q2UA 3GOHA 2OXTA 3JARB 4RD1A 2YUIA 1XQVA 1E2HA 1YHNA 4L4UA 5D87A 5ALTA 5JJLA 5DLEA 4INAA 4WCFB 1DXYA 1VGRA 4Y8VA 3X1DA 1DEOA 4QNRA 1Y3IA 2VYFA 4HTFA 5B12A 5FI3A 4LX8A 3I72A 4LIPD 4XLTA 1Q0SA 1MW9X 4L5YA 4LY9A 1IZ8A 1V16B 4M83A 3ADDA 3SICE 1M3SA 2PRJA 4H4CA 2P6OA 3QV2A 4UHHA 3NTQA 4DG5A 1AO3A 1U5BA 2AKYA 3DQPA 2OD2A 3KLPX 4ZT4A 4ARSA 5AOBA 4J3JA 2OCLA 1WU7A 3EG5A 2BF4A 1RM0A 2AZTA 3LVQE 3MB8A 2DEUA 1FSZA 2SCUA 4NATA 4CQMD 1YAJA 1YS7A 2BHTA 1I30A 1NVMB 1PX0A 2BHLA 1KJZA 3KXIA 3FM9A 1ICIA 4HH0A 4H6XA 1NN5A 3ZWMA 2SHKA 3CKYA 3SJCA 3V2HA 4IV5A 1JPUA 1YRWA 2QQ5A 4INPA 1NJ8A 2QYTA 5TPWA 2C2XA 3AHJA 2EBWA 2CHVA 4UNPA 3C24A 3NDJA 1L6RA 1UDRA 3PICA 2J3JA 1SKUA 5E6UB 4KITB 3L1UA 2B7BA 1LW6E 1RKVA 3JQFC 2PL5A 4TROA 1QFJA 2I8CA 3EA0A 1Q57A 1EZ1A 2VFAA 5ECGC 5L40A 2ZI3A 1E2UA 3V8EA 4E6PA 3R5XA 1HG1A 3QI7A 1OI3A 3PEVA 3QK7A 4K6OA 3TSZA 5TX7A 1ODLA 3B3FA 2GKOA 2GHIA 3GI1A 3UH1A 3WGLA 3WWZA 3A1SA 4AG5A 4ER3A 3PC3A 1JHXA 2PGAA 3OCXA 1M6EX 3B9PA 4J1QA 1L7RA 2XGSA 4ARVA 3IEMA 4UOEA 3CSUA 1X1CA 3OE7D 2VF4X 2A86A 4FJ0A 1Z3CA 4MI3A 3K0EA 5TMPA 3AKDA 1Y0BA 1Q0RA 2QYSA 3UK7A 4JI8B 1Z07A 4M9XA 2QZ4A 1PTKA 1Z2AA 1TCCA 1CEYA 1AN0A 2X8JA 3KWLA 3DZFA 4WXRA 2GVZC 4B8ZA 2JLYA 3OIVA 3V00A 3AXSA 3KCNA 3N2YA 1OFUX 3MLBA 4PHFA 2GN6A 3C87A 3HB0A 2PM8A 1GVNB 1YQWA 2V96A 4JFAA 4X44A 3W1EA 4FILA 1D8AA 2HMUA 1WKVA 4ZAYA 4QECA 5TB5A 1O5TA 2GETA 4DTIA 1A9RA 1M66A 1GLVA 5B1EA 1I3LA 2H9AA 2JGJA 5DI9A 1OH8A 2DKOA 3KO8A 3E2PA 3C8MA 3P26A 3IILA 3A7EA 2ODTX 2CKMA 4TSFA 3SNHA 1PJ8A 1W48A 2RAUA 5EKUA 1GT91 1W88B 3HBMA 3OQNA 2FX2A 3E5HA 1WXFA 1TCAA 4C6TB 4QUEA 5LOVB 3K15A 5LLDA 2VDWB 3BXZA 4U9UA 5HM8A 4EK9A 5B58T 4P3XA 5EFOA 2JIZA 1UAYA 5DIZA 1P73A 3Q0TA 3WWDA 4JENA 5JADA 1M2FA 4MKHA 3YASA 2GB4A 4F46A 3CZ5A 2BGUA 1AA9A 3SF8B 2FW8A 3EGEA 1UOEA 1ISSA 3H83A 3PLRA 5I51A 5ITSA 1OH5A 1BYIA 1FZQA 1ZGZA 2ODNA 1E1RA 2F3TA 2GDJA 2HA2A 3BD6A 3HACA 2XX3A 5A4FS 1NQAO 4JYZA 1QV6A 3SJZA 1E6EA 4ZQHA 3SFTA 4B3MB 1O08A 9GPBA 2FLWA 1AG9A 1OYOA 3UHOA 4AQ7A 3KSDO 4GAEA 4YV0A 1Q0HA 4BLPA 5ESXA 821PA 4UW9A 5DWQA 4HCJA 2P6RA 3F3KA 3K0FA 3LLVA 3VX3A 5IYZA 4HV4A 1XKLA 1X92A 1D2MA 2A8YA 2G72A 1KVSA 1XELA 4QQFA 1KP2A 2JNWA 2C2HA 4B81A 1YE3A 5AVXA 3A6JA 3C4JA 5EIAA 4F11A 4RTRA 1PJ4A 2RBKA 1ZYUA 1LEHA 5KVAA 2ENUA 1QRDA 1N4DA 2VDRB 3M6WA 3IVCA 3WFZA 5JAMA 1R88A 3WMRA 2QP4A 3HN7A 1WKCA 3JD4A 3PEEA 3OEHD 3U49A 3GLGE 1IZ0A 3CNOA 1LBIA 2H4FA 4U7FA 3FGZA 1ADFA 1XTPA 4FE3A 4OFWA 3G0OA 2DLDA 1UC8A 1ZOPA 2CL5A 1N5KA 3U17A 5ADUS 5AQ1A 1BE8A 1PR6A 1SD5A 2JJ8A 3ESYA 3PNVA 1OKKD 5A03A 1IJFA 3GDOA 2QUKA 3SYNA 1OWNA 2L19A 3AL0C 1KDVA 2UYYA 3RFVA 3QKRB 5TXGA 1V43A 2QTZA 4OGWA 1DRJA 2AN9A 2FN7A 2X5OA 1IY0A 3KQTA 3JQRA 3VTAA 1MW8X 5JOQA 3LQFA 1W2GA 2BZSA 2E82A 3DFFA 5A05A 3PNSA 1EAYA 4OB8A 4BAGA 3GJRA 2WHXA 3GBPA 3HG7A 2HJVA 4ROSA 2QLJA 1JEAA 4YMGA 3ZJTA 2R97A 4QXMA 1NX9A 2GAJA 1QIGA 1N0WA 3CIOA 4B44A 3C3DA 2G40A 2GX6A 3B1FA 4R9SA 5G1NA 4BNVA 1K66A 4XPZA 1EVLA 1G18A 1JVBA 1YJAA 4G24A 2QRJA 2FOXA 3DBVO 3KQWA 1BJTA 1FNSA 1T43A 1T4GA 3KOWA 421PA 4EVSA 1DAFA 4CDRA 5JE8A 5ELXA 1IUKA 4I36A 3PENA 2H1HA 4EECA 4DR4B 2YJNA 1EWKA 4NOLA 4KYTA 1IOLA 5DM2A 4GP6A 1CR1A 1HWYA 2HIGA 3UB2A 4F4HA 5DE3A 1YRBA 2BM0A 3QPAA 4E5NA 4DRZA 2RFLA 2FMKA 3CPJB 5TMDA 4Q9DA 1NSFA 1CQJB 1T2FA 2PBFA 5BV1A 1FDVA 5HZGA 4QX6A 2R1TA 1VKZA 1T29A 2B0JA 1JTVA 3QU5A 2HCRA 2BL4A 3EVEA 3TRJA 2D8MA 1GUAA 2I65A 1EFCA 1XZLA 2E49A 1HF3A 2FQYA 2R6AA 2YNMA 3U1VA 2O19A 1A5TA 4B80A 2M1XA 2VJBA 4RJKA 5TC4A 5KYGA 3H1PA 1IVNA 2ZAGA 4L6IA 1E2LA 2DHRA 2NM0A 2R6JA 2ZVQX 3KQPA 5A6SA 3HU5A 3K30A 3NEJA 3H5LA 4LRSB 5FRDA 3S2UA 5K8LA 5LR6A 1G3RA 1OZFA 4DN6A 2QL6A 3FNHA 5J5VA 1QIHA 1M2VA 1LWOA 2FR0A 2PZAA 4ZYTA 1FSSA 4ZYWA 3VAZA 2B9EA 3RM3A 2DXIA 1A2OA 5AM5A 2B30A 2CL7X 3F46A 1WTAA 1JQEA 2C9BA 6YASA 4S0XA 4TXMA 4TRRA 4WPGA 1NP3A 1ZK3A 1RE0A 2GPBA 4R0VA 2JCBA 5KC8A 1I01A 3D2CA 4G5FA 1YUMA 3LS2A 2O8CA 2V0NA 1YZYA 1NXTA 1J24A 5A5FA 3EAQA 3O1JC 3RVBA 1EJ2A 2R85A 1OSNA 3LAWA 3LVFO 1LPBB 2C7VA 3C39A 4J2OA 4M1SA 4ESOA 5KTYA 2NO5A 1H6BA 3M6FA 3O2JA 4DKJA 5FA6A 3WSTA 4F3RA 6ADHA 4Y7DA 4EAAA 2C31A 1KQOA 1LPMA 3BFKA 3GNTA 4IDCA 5IG2A 5K0FA 1AXGA 4OH1A 3L7AA 1LX6A 4RHYA 1B0UA 2ASEA 2YY7A 4HKTA 3AGPA 2FK8A 4QPCA 4CKBA 1QG0A 1NI4B 1I4WA 1N9KA 4P6VF 1YKFA 4L72A 1SCAA 2FVYA 3D3EA 4NEGA 5KQRA 4EFKA 5ECYA 1KQGA 2PBLA 2P5TB 1NI3A 1XGKA 3CJRA 4E7OA 2IDJA 3AI2A 4ZHQB 1O8BA 4L4RA 3MS2A 1PL0A 3DEHA 3H2KA 1N6PA 4I3HA 4ZOLF 3R75A 5LMCA 2VRBA 2NU7A 4RW0A 2KMLA 3ONEA 3WBJA 1KSHA 2X9VA 4XZ3A 4C89A 3RTCA 1Y89A 4YMUA 1R6AA 3A32A 2NTYC 1BU5A 1JR4A 2AF4C 2QG6A 3TD9A 4DCJA 1ULHA 3FPKA 4ZZ2A 3ICEA 1JXMA 4O4HB 2HLDD 4XGIA 2AJ8A 4IDEA 1Z39A 5BYJA 4PX3A 4Q7LA 1Z6TA 2WK1A 1Z0UA 2OZKA 4R7GA 2APJA 4F9GA 4JVMA 1XZEA 1NZJA 3GFSA 4H1TA 1BW9B 4ENUA 2D00A 1XEWX 3EQZA 5JDCA 1FYVA 4UBJA 4JHXA 1D2RA 3C3PA 3OM9A 1H2YA 5DX1A 1I6KA 2NUPB 4OHVA 1F6BA 1BROA 1OWOA 2FZ5A 3KUKA 2AD1A 4N40A 2L18A 4G25A 4QAQA 1GKUB 1QTQA 2F3UA 3IRUA 5E38A 4HDMA 1ZNYA 3GDFA 2XKJE 4XASA 1UJ5A 1ZM4A 3MTDA 1PFGA 4XQ9A 2BOVA 2A1UA 4M0CA 3THSA 4KPGA 3VR6A 1XRQA 4XWWA 2VJYA 3AEQB 4BNHA 2BE7A 2REOA 4GOJA 4DLTA 2V4ZA 4FWTA 5CR9A 4OLAA 1UXJA 2WJPA 5HCUA 1KAQA 2JFPA 3NORA 3QBTA 4GBMA 2IXGA 3M2PA 2DLCX 2ZIWB 1X2BA 2H7CA 1Q0ZA 3AB3A 4O4IA 4WXMA 4RTOA 4FEEA 4HYEA 1QV7A 3QELB 4P4SA 1U2ZA 1PUJA 4DV7B 2C9OA 2YJGA 2QGNA 3CEHA 2WR8A 3L8ZA 4FXPA 4AKTA 2Q4EA 1VSQA 2Q6VA 2PUVA 1L4EA 2FPIA 4RH0A 2GCGA 2Q28A 4TM8A 3TINA 4MR7A 1AQIA 3H1TA 4DIKA 2ZT6A 4US2R 4OBEA 3VBCA 2WU4A 4EYKA 2ZIUB 4B2PA 1KOLA 4C07A 1A7KA 3RQSA 3VPDA 1JMYA 1W59A 5GY7A 5I5GA 4OXYA 1O6CA 2R6R1 4BY9E 5DYGA 4I5EA 5D3QA 4TWIA 1KMIY 2O0LA 2Q2VA 1THZA 3LF2A 5BO5A 1GDTA 4QRHA 4ZDWA 1U8CB 4OHZA 3PYXA 4CDMA 4BEWA 1U3GA 3A4MA 4RELA 4UULA 4ERXA 3QSYA 4JBWA 2FPUA 5BSMA 3H2SA 4RA6B 5CIQA 1M0EA 1G7CA 5JY1A 1T26A 5AJTA 4OJYA 4QYIA 2H85A 2XBLA 1W87A 3OT1B 1PFKA 2ECQA 1FMJA 1H5UA 1CQZA 2FN8A 2WMYA 2IU6A 3AL2A 3EDMA 4UAVA 3T1HB 1Y80A 2K87A 3JQ8B 4YDQA 1UMBB 1V8BA 2NT3A 1EXVA 2Z57A 2A78A 2Y68A 2Y66A 3Q3VA 3HFRA 4A26A 5LUAA 3BH0A 2BFBB 4P7KA 2EFJA 1DADA 1FOEB 3BG5A 4TKVB 3VOTA 2D13A 2WQ6A 3ZQ4A 3KNZA 1KI8A 2REQA 4NKRA 1DX4A 1YL7A 4P4UA 4QEKA 4LJ7A 4R9UC 4BNTA 1Q95A 2ZJOA 3E7PA 3UJCA 1IB6A 2IOQA 1ZN7A 3DLTA 5ICCA 2WLTA 3RD5A 2ZBDA 2OYRA 3OVMA 4UPVA 5J2TB 4GX2A 3S3TA 2JGMA 3KZNA 4I4IA 1P5ZB 4KUEA 3DBIA 1ORDA 3R0ZA 2OPHA 4AJNA 3IE2A 4UDOA 2QB5A 3EHEA 5A4MS 5TGDA 1XZHA 1E2PA 5JD6A 1DTWA 4K3UA 3MWKA 4CI0B 1IPHA 2O8DA 1XIVA 3DL4A 3FNQA 1RLIA 3QKTA 3CF6R 5BW4A 5DNYB 1IJEA 5BWMA 1XJCA 2VYNA 2QN7A 1WXGA 5JECA 4QXAA 1YZKA 2O50A 1R8JA 1KH1A 2XDQB 3PFKA 3EIWA 4EABA 3L6RA 2HRBA 4X92A 2CFOA 4BZQA 4F92B 2A5LA 3K70C 1GFIA 3LXMA 4ZI3A 1TK2A 2O3RA 2YVQA 1LI4A 3KPWA 1PR3A 4GEKA 2ZJ4A 4MP8A 4QPNA 4KOEC 4UU0A 1YV9A 3ZG6A 4EG1A 5KQPA 2DR3A 1PD0A 3LX6A 2ZJZA 4JLPA 1YS9A 4M1ZA 3DEIA 2ZAMA 4PFQA 1XUOA 5A71A 2ZI9A 5TQJA 4ADSG 4WZAA 1Y8RB 4ZEMA 1WV1A 3TN7A 3GEEA 1F2TA 1N7JA 1BMQA 1X7XA 4QULA 2W8BA 1PDOA 4R0NA 3BPSA 4WW0A 3TCXB 2H7YA 2X9QA 1T4BA 4MV5A 2QT0A 3EJ6A 4LZJA 3W06A 4XJTA 3KUUA 3E4CA 2O1EA 3KAKA 1I4OA 1X94A 4KYIB 4DLSA 1NUUA 1TJNA 3S2SA 3KKNA 5FUBA 2H63A 3LIIA 5FPSA 1PBNA 2OGZA 4JJ4A 3MB5A 1H23A 2W4MA 2IOFK 3DWGA 4ZV4A 4YDRA 4HXEB 2HJGA 4M9SA 1DV1A 1SXJD 2V7EA 1D4AA 1UIMA 2GXSA 2IP4A 2W6OA 3OI7A 1P9NA 4RSGA 1K4YA 1THTA 1UWVA 3N2KB 5HK8A 3B3QA 4I50B 5LZ4A 3RS7A 1VMIA 3WR5A 4AICA 4B7UA 4PPQA 4W9NA 4GOND 3CLUD 4ENVA 1NY6A 5I4CA 3AUKA 3ZU3A 1IHDA 3ZHSA 1RRVA 5CDTA 1Q1GA 3IAUA 5LQDA 3HRHA 4JI3B 2YZKA 1Z0ZA 1ZC4A 2QMEA 4O4LB 4XLZA 1CJUC 2OCPA 1GPKA 2JVJA 3JQ9A 4HGRA 3D7LA 2O2XA 5I7AA 1JLSA 1U98A 1JIUA 1R0XA 2X77A 3P4XA 3VR4H 3NBQA 4KXXA 2A29A 5B1DA 1HMYA 3GFTA 2R0QC 1U02A 1Y48E 3QFFA 4DREA 4CR8A 2MYTA 3HYRA 5F7JA 1FJXA 2QTTA 3IP3A 4R54A 1S2MA 3Q8LA 2NXNA 5LOVF 4K03A 2NZ2A 4G5HA 4N01A 3TIVA 1VCOA 1WIWA 4EJMA 3G85A 3N7UA 2JI4A 5IJ0B 1NR5A 3OEEA 4HAZA 4RK6A 4MDEA 3B60A 4E46A 1KZ4A 1CJMA 3OJCA 4YCBA 2V7XA 1FU4A 2EWMA 1FFBA 1XCPA 1EFRA 4NJMB 3DONA 4I99A 2VT7A 4BVLA 1VQ1A 1WXEA 2W9XA 3E9QA 2CXRA 3H9EO 4GC5A 3ZH2A 2I2XB 4XD7D 3UOGA 4NESA 3RROA 4X62B 3IX7A 1DWPA 4XAQA 1P0CA 1GPDG 5GJWC 2E21A 3JW8A 3G0IA 1VJRA 1RQPA 1A9XA 2EKZA 3DEJA 4V24A 3BXEA 2O1WA 3ZWKA 4NV3A 2BSAA 1CHNA 1EMDA 3BXGA 3THWB 3C3AA 1UT8A 2QS9A 4RZIA 1JFFB 1I4TD 3CPSA 2AOWA 4MQMA 1FW6A 3QF4B 1QAMA 5IKXA 5L7TA 1JWAB 3MXOA 1V3UA 2CBXA 1LSJA 2E87A 2VN8A 3GUZA 4EW2A 5BYAA 1JLLA 2IUFA 2XB6A 1EJBA 3C16C 4X8MA 1AZTA 2CXHA 2W37A 3DTVD 2HTFA 4BNZA 1WF6A 1GNSA 2CZQA 2NACA 3ND7A 4MQUA 1OBHA 1SQ0A 2OCYC 1OAOA 1XAHA 3KTDA 6ABPA 1T2VA 4A7PA 2AB0A 1IN5A 3AHGA 3Q10A 4EGCB 4RTQA 3GLIB 1NFRA 1SVNA 1U80A 4UM9D 1UC5B 2I80A 1U1FA 1CRQA 1N7GA 3OZGA 3PIRA 3HJFA 3T0IA 1RKXA 1VJ5A 1WABA 2IPOA 4L0DA 3L92A 4QFDA 6CHYA 2I03A 2FJ0A 2UAGA 2VJCA 5A9RA 1QTNA 2QPOA 4B40A 4H35A 3FSRA 4WKCA 4KTTE 1DPFA 3I2HA 3OOHA 4FINA 3RW9A 2YXPX 4FGUA 3EDOA 1CQPA 3FPEA 2WHPB 2AG0A 4HOYA 1YR8A 2AC7A 2ZE7A 1OLSA 1NAIA 4Z4IA 4D45A 5ERGB 3BC1A 2RHTA 1CRWG 2ISQA 3ZE0B 4GWGA 3TPFA 4PYRA 2XZOA 1GRNA 1KDOA 1G5IA 4LJ8A 3RAEC 3ZUGA 5JATA 3RJ9A 4Q7QA 4GI2A 5BNFA 1V26A 3B1YA 1FX1A 1RJEA 2QT1A 2VSFA 3OCYA 4K9NA 5CT4A 5KYWB 2ZXUA 3OP1A 1EUDA 4X1YB 3SQDA 1I14A 4MYSA 4ZQGA 4BZZA 5EMLA 4GX5A 2J3IA 4YUZA 1E2GA 2Q8NA 3CNLA 2F1RA 4HSGA 1W0JA 4M54A 1T2AA 3O8CA 3L4EA 2OCKA 1WXWA 3T7TA 4BX3A 2QW1A 2WWHA 3KBOA 4LHSA 3L93A 3DMFA 3TSCA 4YMTA 4RF5A 5JAZA 3KUXA 3EF0A 1ONOA 5KX5B 1YZLA 1KU6A 1PWXA 2L2QA 2OHJA 4YRRA 4ITVA 5G0SA 2EW2A 3PFHA 1PSDA 1G5PA 1Q22A 3G88A 3HEBA 4HL6A 4Q6WA 1PVVA 1UT5A 4U3JB 2RHHA 1WEHA 3L01A 2A5JA 3SQLA 2DRIA 1Z2EA 2Q45A 3REQB 2H52A 2ZR8A 2UUBB 1UK7A 4FWBA 4ND8A 2Q62A 3QPBA 4AJPA 3KRTA 3C8UA 2Q1TA 2WSMA 3GGSA 1OZHA 1ZL0A 3K1AA 4KRYA 1P62B 1M1NA 1DC6A 4B32A 1T5TA 3NC0C 1KF0A 1JB1A 1QQAA 1KSFX 1SEVA 2ZIGA 4UXHA 3KPJA 3OZSA 3JD1A 2P2LA 1SKYE 1XVTA 2JAXA 3GFBA 3D31A 4CN8A 4PHTA 4C5BA 1B93A 2IV2X 1N6HA 3D8UA 1Z6XA 2XNHA 1KEEB 4JB3A 3DBRB 3RQIA 4KFCA 3OAAA 1Y7TA 3EEFA 2H59A 1JZQA 3TLKA 2IS4A 1SG9A 3W6NA 3BA6A 5C1OA 3B2EA 3TE7A 2QY9A 4JJ7A 3NKVA 3CIFA 4LX0A 1K08A 4CKEB 2RGCA 1DBIA 3LYAA 4A91A 4KQCA 1CRZA 2REBA 1WP4A 2OV8A 3N2GA 4PM4A 3U3DA 4OAPA 1PT6A 2G5TA 2YV2A 1GUYA 1HE3A 1ZD8A 2P9FA 3KIPA 5GOTA 1GEGA 1CEXA 1CNMA 4D80A 2BFWA 3KOXA 2WYUA 1GUBA 1CXZA 1U1EA 1JHVA 5EKSA 3B13B 3OO0A 5AKGA 3WDLA 5KNCD 1KJQA 4CR6A 2KB0A 1NU6A 1Z0KA 5LP6C 4RYDA 4ZDKA 3KVNA 3MT7A 3EG9A 3GUYA 4N6OA 4FNAA 2D2FA 3FRJA 1S3FA 3Q11A 4OM7A 2Q3EA 1SBNE 1AQUA 2F1IA 3ZZUA 1JDTA 5ESRA 5CCBA 2W11A 1ID1A 1AE1A 3FTPA 1IFXA 4N54A 4F4IA 2Y1OA 1NDHA 1D03A 1BU8A 3K4PA 3EXAA 3SBOA 4FCCA 4ZHQF 4CRWB 2XXBA 5TARA 3SJBA 8OHMA 2F1OA 4ZT2A 4DJ5X 4EO9A 2V7QD 4TV8A 2XRMA 3A9RA 3E1GA 5A1TA 1VLZA 5I7SA 3Q3GE 4R4JA 1YULA 1I7SB 2HWXA 3IR5A 1MX3A 2FWJA 2MINB 1RBYA 2B1IA 4GOMD 4WESA 5HKKD 3CWQA 1W93A 4BNXA 5LN1A 2CV0A 3QOXA 2Y1DA 4NNPA 4WINA 5AIAA 4QUJA 4MVXA 5ENZA 2WHYA 3OZRA 4BLVA 4DLPA 1ODIA 1RWQA 2OA0A 1NBAA 7MDHA 4LFBB 1E1NA 4MKXA 2J5QA 3PKIA 1BHJA 4KXUA 1QU3A 1L1QA 2B7CA 2AFIE 2OAGA 3E9MA 1C3XA 1C7ZA 4KMSA 4MQFA 2GESA 2VWGA 3SOZA 1JFLA 1F14A 1K0FA 3HL4A 3N70A 4UUBA 4HTFB 1ETUA 2PJRA 2FTKE 2R86A 4X71A 4TUYB 1RHRA 1WHSB 3T35A 4QT4A 2BMVA 1U5BB 2VYVD 3OQ6A 3JWPA 4DLWA 4KDRA 1H4QA 2R6DA 2P9ZA 1FFGA 4JP2A 3GMDA 1JSLA 1TM3E 2YBEA 2FX5A 4FMBB 5EYPB 3IQFA 5JXIA 1E1LA 1DCMA 1Y81A 2HEGA 3EZ2A 4UMVA 1G6HA 4MYUA 1FX0B 4ZI7F 1U2DA 1U2PA 4P4TA 4LECA 2QTRA 3BTSA 3A14A 4L8WB 2QVBA 2ABWA 4LRWA 1XWWA 3GRYA 4DRYA 5HKBA 4FR0A 4D8TA 1L5QA 3X1JA 4B8YA 5BR1A 1Q0PA 3L5KA 3D2AA 1I3OA 2QRHA 4G3XA 2QAJA 4H7PA 4LYGA 5TPWB 5JALA 1L4KA 2X6TA 4UHCA 5CTAA 1OYWA 2O57A 5D00A 3UMVA 2ZSHA 1AT1A 1EUZA 1XMJA 4GPIB 4IRMA 1PZXA 1UBNA 1Z17A 2PZ8A 1YJBA 4MKFA 4RCYA 4MITA 5M3BA 1UJ4A 3UVEA 3VOBA 1G2IA 4OXRA 5JUWA 1DC4A 1B8UA 2FCAA 2AJCA 5AOAA 4FSDA 1PK9A 3MFYA 3EZLA 1USGA 2FEAA 2G9NA 3KB2A 3WMGA 4N0MA 3V4PB 1FA9A 2O3UA 5IM4F 4PN3A 1C1YA 3V55A 1EP9A 2C5AA 5A9TA 4EUHA 4F3TA 1LBSA 4NY1A 1BDIA 4LJ9A 1UR5A 4BMZA 1OOEA 2VXYA 2G5CA 2GYUA 2IYPA 4EPXA 2VH1A 3AV0B 1NL3A 2A7XA 3E4DA 4JJIA 2JFBA 1VCIA 1QOPB 2B1RA 2X8JB 4ZKEA 3KK0A 3WICA 4GICA 4ZVUA 2Q6KA 3BIFA 3ZJUA 1JQAA 2O6HA 5EJ2A 1ZIXA 4EMSA 4RZHA 5CDSA 3MWLA 1X42A 1VHTA 4G1BA 5JROA 1NUTA 3DZDA 4EYOA 2BI8A 1W1WA 2IJGX 1HFKA 2QTMA 3H5AA 4QO8A 4MI9A 4BMVA 1BD4A 4LRQA 4QDUA 1L1FA 4BWVA 5C8XA 1EVJA 1CS0A 2IXDA 2HRCA 4G4IA 4H27A 2NV2B 2EVWX 3AYXB 3TKLA 3ZDZB 4BFVA 4HYQA 5L3SB 1VG9B 1SIBE 5I9NA 3IGFA 5KDLA 1PYDA 2YMQA 4OY3A 2RHCA 1E2FA 1QO9A 3PWTA 1CEQA 4FYMA 5TJHA 4P81A 3GFGA 1BS9A 5EERA 4ZA2A 4E1AA 2AN4A 3BRQA 1T9AA 1GQOA 2HCBA 2OGWA 3L79A 4MVJA 1KA9H 2NIPA 3MIIA 4ZN6A 1BOFA 1JDBC 3CBGA 2F1KA 3M4XA 4KH0A 1VOTA 1ZJYA 4X6YA 621PA 1G21E 2DPXA 3RPEA 1X1DA 2M6RA 3QQ5A 4G4SP 3WFIA 3G2HA 3IE0A 3WO1A 4EFNA 1C3EA 4F5DA 5THXA 5AYVA 2GM4A 3WGOA 3CF0A 4C0LA 4D4MA 2ZJ7A 5SZHB 2B92A 3U7EB 3PXXA 3K0AA 5DK4A 2HPHA 3NEYA 2RHJA 3QVJA 5WRFA 4NZZA 2VQFB 4F97A 3VC7A 2OFPA 3ZE7A 5BWCA 4DE5A 1FYWA 4ZODA 1UJ6A 3IAS1 4RJJA 4WX2B 5SYMA 4LFCB 2GEUA 3V7WA 3ZK8A 4LE2A 1FFAA 1NBOA 1ONPA 4GR5A 1GHTA 2H1SA 1ZVKA 2D54A 4PZ9A 1JAIA 4K6KA 2O2IA 5IYZB 3QVWA 1AGYA 1B4DA 4FD3A 4A9AA 5JAOA 3DM5A 3EPLA 4BVFA 3H1GA 3D0QA 3ZDCA 1NJ1A 3RIMA 2OHIA 3PJDA 1E99A 1QB7A 2P91A 4HLUA 3K1ZA 3A6KA 2EF0A 4UATA 5EE5B 1Z36A 4CNQA 5L3VA 1CY7A 1T3TA 4KVGA 1XCMA 3PQFA 2BBWA 1NNUA 2OZEA 2HYDA 3FHTA 3KXPA 121PA 4Y2GA 1R15A 4OA8A 3WZ2A 3H6GA 2R87A 4BJ6A 4C0KA 4KPYA 4MQBA 5FUMA 2WF5A 4ARZB 2N3ZA 1NLMA 4JL8A 3BGVA 4DUZB 2C04A 3ISVA 1C5KA 1SBQA 1KY2A 4RMGA 5LQAA 1K06A 2NXCA 1BEEA 2Q5IA 4Q3DA 4DCPA 3IO3A 4URFA 3VZPA 1Y9DA 2AD5A 4YPOA 3SQWA 4FW9A 3DOFA 1GEEA 3ZWYA 7AT1A 1QVWA 1DS6A 3DZKA 1MA0A 2PJZA 3T7KA 1IL0A 1V37A 1YDGA 3LP8A 3VSBA 4DY4A 1F2UB 5LMNB 4ZT7A 3JYNA 2O05A 4W5JA 4ZAWA 4G5GA 4B35A 1U0GA 2VQEB 1BDHA 1P0QA 1EEHA 2DR0A 4YDHB 4KQKA 4LQ4A 3RB8A 3RJMA 3DE3X 1Q77A 1RNLA 1W1UA 2R79A 2UYGA 2ZVJA 3ID6C 1XZKA 4LVCA 4R2LA 4YO8A 2NSDA 3D2BA 5FO0A 5GAJA 1KDZA 4ACBA 3AM5A 2IF0A 5C18A 4B3GA 3EX7C 3VUFA 3I04M 1FVXA 2G0TA 1ZD1A 2JCSA 5EMMA 1KTIA 1DXQA 3B8EA 1P0PA 3UO8B 1NBWB 1ENOA 4O4LF 4R7ZA 1JT2A 1NR1A 1V7PC 2ZRFA 2A0FA 5K03A 4D3SA 3WNZA 4DQDA 1TQ8A 2RGXA 2V9ZA 3H87A 5EXSA 1NKSA 3GJ0A 4EA7A 4BGUA 4DVGA 3GRUA 2PKYX 2PZKA 1TKCA 4LSWA 2H2FA 1E6KA 3MCTA 1XZGA 2GN8A 2W71A 3I4CA 1HBJA 2Y3IA 4I9FA 3IDAA 1XLTA 5HKLA 5C4MA 2IIPA 1QIIA 5T6BA 4BNFA 2P2YA 2JZNA 4Y9DA 1E2NA 1XEXA 3VM6A 4EOGA 2R1TB 4AC9A 3IKMB 3JVDA 1JG1A 3KCQA 1TYBE 3WLFA 3HXMA 4N03A 1KKUA 1Z28A 2P77A 4MGHA 5FCDA 4F84A 1JLKA 2AE1A 5F4ZA 2B35A 3RGGA 4A6DA 4HZUA 3BGWA 2CMDA 1Z6AA 3AFOA 3OFVA 3IT2A 5A6SB 4XQCA 3WYBA 5B5SA 2K7FA 4LYAA 5I9SA 2FEPA 2VBFA 1A9YA 1QP0A 3VJKA 1ISHA 1M2VB 3ZWNA 3VV3A 1BQEA 4OP2A 1Q16A 2YXDA 3Q7TA 3ABZA 1ZL2A 8ADHA 2OM6A 2BJVA 1DV2A 1N32B 2FN9A 1FU7A 3H75A 2H00A 3HFGA 4GD3Q 4ZZ0A 4GMFA 5C2JB 1UK8A 1H3FA 4DCOA 3OKPA 4F5WA 3A4LA 1T3SA 2CEKA 3LCJA 3DR5A 3GQVA 3HQ4O 1UPTA 4NZMA 2O8CB 3N5KA 4QOGA 4TKLA 5I7FA 1QFSA 1TO6A 4L4YA 4IGFA 5EMNA 5C80A 5CMLA 3ULKA 1ODCA 1V11B 3ZXYA 3IVMA 4DA8A 1GO2A 3PQCA 3HKDA 5ALOA 4BNGA 3TECE 2BYTA 1ECPA 2VJNA 5L3RA 3OX4A 1YCHA 3VJRA 1YS2X 3PVCA 4LF8B 3DDHA 5ES4B 4OQYA 4N5HX 4N3CA 1NXQA 4JI1B 1W49A 3L0ZA 1LUAA 1OY1A 4IH1A 5K7SA 2R66A 2DTDA 5SY9A 5DWVA 3LT0A 1W2WB 3Q15C 3VR5D 3UG6A 2W2XA 2MSWA 3PFIA 3C7KA 1QHIA 4CM8A 2XNKA 3W5DA 4ZPXA 1GARA 4V1CA 2JFNA 5LUBA 2IE8A 1A9OA 2NXJA 1DCFA 4JHLA 2ZGVA 3ETGA 1GYPA 4GW3A 4R51A 5IT4A 2QTFA 2D1TA 5B2ZA 2W00A 3OQBA 1KJYA 3P9NA 2ATXA 4M9ZA 3QY9A 4UEWA 2VA9A 2VPYA 4UJ5A 4AF7A 3PX7A 4DEVA 2XMBA 4L27A 1B3RA 4ZQIA 4OHRA 2JLAA 2XB9A 4BCDA 3FPSA 3R7WA 3R0VA 4EB3A 1K6EA 4DDVA 4LCEA 3U3KA 2NUAA 1VE5A 2AR7A 3R9KA 3SHOA 5IXSA 1RBZA 4BMDA 3EOZA 4HGZA 1TA0A 4E32A 6GPBA 4B6JA 1U1IA 1S6YA 3B70A 4WKBA 5H3CA 4GUAA 4DJDC 3MMSA 2W4QA 3VPGA 5KX5F 1NVTA 1RJWA 1U3UA 1JAYA 3EMDA 3FF1A 3WIDA 5LWHA 2B6HA 4MYHA 2EAUA 3LUHA 2XYQA 2HJSA 1P9OA 1YOBA 1YQ9A 5KNDH 3PGMA 1CJCA 3AR4A 3OLXA 4FN5A 2GZSA 1F6WA 4IP0A 5BWBA 1NPTO 1W36C 1LRJA 3KOYA 4HLQB 3Q9UA 1JYSA 4DLUA 4HDMB 4WLUA 3AOEA 3JSAA 2FR8C 3V80A 4H3HB 4B6OA 1SEPA 2BP7A 2A1UB 4YRPA 4Y3UA 3UANA 3AFIA 2W43A 1XROA 1N2IA 1Q19A 2BGJA 3R7SA 1NVGA 3V8NA 4C0XA 3VHRA 2J6CA 1IHYA 3N9IA 4Y6LA 5AXDA 5J4LA 5ABPA 2BEJA 4DL9A 5TIIA 2HEIA 1FDSA 5G0WA 3UYKA 1SC4A 4PS0A 1CJTC 2CN1A 2X15A 3OZBA 2CNBA 4LJYA 1SUPA 4ZZ3A 5KQSA 2OZPA 4O4IB 5AKLA 1W8IA 3FVTA 3E2MA 4AO8A 4TL7A 2A1TR 1OHHD 3GROA 3ST7A 5L8VA 2ZJBA 5BWLA 1O58A 4UC0A 5J63A 2QM7A 1GA6A 1PSWA 2X23A 3A26A 5EJ5A 1W4BA 3OIDA 2C4WA 3N2EA 4BO3A 1SXJB 1AJEA 5ENDA 2HMWA 4RZ2A 3W5UA 3WRWA 1I5OA 2J4DA 1GKYA 3PUHA 4MR7B 2HA6A 4GXQA 2W6ZA 3T4PA 2FLVA 3NNDA 4AY6A 2DQZA 5IZCC 2A0YA 3EVAA 2AIRA 1TYZA 3OFJA 5CP8A 3ZTWA 4D8YA 4ETMA 4HMPA 3OKCA 4H6WA 2BRUC 3N6XA 4MV8A 5FKJA 5ER9A 2MDTA 4QRIA 5CJPA 3D4IA 5DEOA 1QPGA 4B6QA 1PNRA 3NTRA 4B45A 3PQEA 2QQ0A 4JROA 5EWMB 1JILA 1NBIA 4D9GA 4QZVA 4X95A 1RZRD 1JIXA 2H7XA 3EWIA 3T12A 3AF1A 3TOZA 4AYTA 3GRRA 1EHYA 1VLJA 1E4EB 3EZNA 4O8CA 4PBTA 4QYIB 5E2IA 4QYSA 4PR3A 1M54A 4PLVA 4DLZA 5AJYA 4YJGA 5ETJA 1YC5A 1AMOA 3IEXA 4QGBA 3X1MA 5EQFA 1JQ5A 1O9BA 5ES3A 4G9EA 1PV4A 5D86A 1H2HA 4XW2A 4ZVLA 3JYHA 4YALA 1G8HA 4R1TA 2ZQ5A 3FMFA 5DGCA 1TO2E 2REQB 1L5HA 3WK7A 3CVYA 1LB1B 1E7WA 2BFEA 5G4KB 1HX7A 4Q01A 3IUNA 1UJNA 4RJ2A 3HR7A 1PS8A 4HQ0A 2GQ0A 2HIAA 3B5EA 4FI3C 5EWLA 3PQ8A 3UG7A 4KO1S 1MO2A 1R1DA 2WJ4A 3EUEA 3QVOA 4RABA 1F5NA 4ZT5A 3AI1A 3HDJA 5TEVA 1VI2A 3KE9A 4TUYF 1PW7A 3URMA 2VJOA 5AVUA 2J0SA 4N7JA 4DCUA 1H3EA 5LD2C 4R68A 4QYXA 1N5MA 3GLHB 1ADGA 3KFXA 4Q9KA 3USCS 1MBZA 3ZI4A 5J4YA 2GOYA 4YP5A 1RXEA 4HAYA 2PH7A 2O8DB 2CL0X 5F5NA 3DTVB 1JTFA 5L95A 5K2OA 2H29A 2OP1A 4ALLA 3CH4B 2X4LA 1KRHA 4NZNA 3EEYA 1EEXB 1JR2A 4GZ6A 4LJ4A 1T91A 3K0KA 3TTXA 3WGHA 5KMGB 3CPEA 5ALDA 3GNLA 3WBBA 1QNFA 1CJVC 2UVPB 1M1YA 1ZO8A 2CWDA 2VDNB 1NDUA 3DE1X 2V4MA 2VJDA 2ZAOA 5AJXA 2V7VA 2DECA 3FTDA 5EGNA 1D7OA 3SFZA 4DBVO 1SKMA 3VYRB 4RF4A 6PFKA 1RP1A 4AZ3B 2YIVX 1UJ2A 2IS6A 3HA5A 1FVHA 5ALLA 2C7PA 3QKSA 4L9AA 4NWIA 4W5TA 2NLOA 2OWEA 3UK0A 5A3QA 1FDWA 1NUQA 3ZHVA 3SQMA 4G86A 5MHTA 1F9AA 1B16A 1N4AA 3ZWXA 4WZAB 3T0FA 3L6EA 1TD1A 1U2EA 1JHAA 1X7XB 1ZCJA 2W8BB 3TUJC 3FG9A 2QM3A 3D6TB 4CIBA 4OIMA 4EY6A 1GNPA 3ISTA 4KXMA 2WRZA 5FIUA 3WGYA 1XMVA 2PAAA 2CLDX 5U9CA 4ISCA 2WNIA 4EF5A 2BFPA 3SLGA 2M6SA 4MS1A 4ZOBA 2ZBPA 5CLLA 3HYNA 1Y5IA 1Z4PX 4EB0A 2XODA 3LNCA 2H5JA 1NAHA 4KG7A 3X0DA 1Q83A 2RONA 1TAGA 3B53X 3ECSA 5HRAA 3RTDA 5CBPA 4D5EA 1KFBB 4V0RA 4KO8A 3NBXX 4OQQA 3D7SA 4GMHA 3T7CA 3BMCA 2CHGA 3PL5A 4M1KA 2A00A 4P54A 2P4EA 4PGAA 1JEDA 5DM60 1PZHA 4HXFB 5FI1B 3F97A 1V25A 3VXKA 4JXKA 2YWCA 1WRBA 7REQA 1JVNA 2Y1KA 3MTIA 1T36A 4A1OA 3O5AA 2BFCB 3LRXA 4YLEA 5JCOC 4PBRA 2H8GA 1P91A 4QUDA 2P2DA 3FGOA 4V0KA 1KZ1A 2RG1A 3RGWS 4RTLA 1UBSB 1LNZA 3EQ8A 3ORSA 1T35A 3V4RA 2ZCJA 1OX5A 3DE6X 4UZFA 3E7DA 1YBFA 6AT1A 3IBGA 1KVRA 3U81A 5CIYA 5ARCA 3FY4A 5F1OA 1P4AA 1W5AA 3AERA 3BMNA 1WDLA 2J0EA 2G63A 3FBWA 3W1VA 4A8JC 3KS9A 1FDRA 3K9QO 1Q44A 2WE7A 4UVIA 1SMKA 1IK6A 1JZSA 2HI0A 3HH8A 4FIDA 4NR0A 4R8KA 2VWPA 4DA0A 1S5PA 1RJFA 2UYQA 2P69A 4K6GA 3PUZA 4OLFA 3W1WA 3ZU5A 1QUFA 1DBPA 5JBIA 2QIOA 2QR2A 3DEAA 4DM4A 1AF7A 3TD2A 3EAGA 4IOLA 4IZHA 4XR4A 1TA9A 1DO0A 3VH3A 1RYDA 2PQ6A 5EIWA 5FADA 1A9XB 2Q29A 4WN9B 3VR3D 3WK8A 2SNIE 3CF2A 1EFAA 5E6SA 4V0QA 3WRVA 1JJAA 2OT3B 4OHKA 1IZYA 1G1AA 4GRDA 4I5DA 5FWXA 4Z51A 2XA2A 3TMAA 5ALQA 1G9TA 2EV9A 3L4SO 1M2HA 1EBFA 1J99A 1JLLB 2GEDA 2DKFA 3ENKA 3EBOA 3PX2A 4K1XA 4UCQA 1J5PA 4WNIA 1S8FA 3MMNA 1L5MA 1I80A 1KS9A 5BMOA 2OO7A 3JWHA 1QLJA 1YO6A 3KU1A 1TZKA 1XPOA 3O4IA 3HGTA 3VNAA 4JXXA 2ZG6A 3IRVA 1GLGA 1ZA1A 5A3VA 1DAGA 4R5MA 4HXYA 5HWSA 2SKEA 4ALMA 1F17A 2D1SA 1P2VA 2BGIA 4MQEB 1HT1E 1NJ5A 1Q2XA 3NETA 2PU5A 1PR5A 4IZIA 4PNHA 1A9TA 1J22A 3CLVA 3GGCA 3R3XA 3HS3A 3ZE2B 4ZGWA 1QMPA 4G85A 2F3QA 3VVMA 4FM9A 1S4QA 1JJIA 1K63A 4L73A 4LF7B 2E55A 4NZYA 2W6ID 1KDTA 2OEPA 4YJ2B 4C2TA 1O4WA 1BC5A 2VWHA 5IFLA 5JRDS 4ZCMA 1OT5A 3KP1A 1KMQA 4ZTUB 4V03A 3IIJA 3ILYA 2WWYA 1N8TA 1TMOA 1UXOA 1A76A 4UTOA 2EP8A 7ADHA 5FJJA 3AY0A 1JMVA 3EZ6A 1W46A 2G7ZA 4H59A 4II2A 4RKYA 1Y6GA 3TUZC 4QVGA 3GCXA 4D57A 3MINA 1EUDB 3IHWA 4I6EA 5IARA 1L4UA 3DL0A 2V0CA 1ENYA 2QGZA 4GR9A 3TXXA 1J0CA 2ZRMA 3TNYA 3FZGA 2F90A 2B1GA 3AWDA 2OZLB 3L4BA 3QE2A 4L28A 4QATA 4QXPA 2GBCA 3QXSA 4RLHA 3OY7A 5IF9A 1JHOA 2D0IA 4JT2A 1R6BX 3TK1A 3ZHTA 1XTTA 1LDBA 3L8CA 4Q4DA 1X80A 5EHIA 3VKWA 3ZYCA 5YASA 2QQGA 4YR7A 2CUKA 3K6SB 1XHEA 4KBGA 3ESXA 2HRRA 3OO1A 4JZKA 3BIXA 2PEYA 3EFHA 2D2EA 4Z9FA 4C78A 1V8FA 1M6VA 3RS2A 2VUIB 2AW3A 1P9LA 4ZI5A 4U9HS 3TBHA 1KMHA 3ZC3A 1X86B 3VPHA 4ND8B 1SWVA 3FX2A 1DMRA 3UT6A 2WWVD 2CXOA 1G55A 1B6TA 5AHWA 1L7XA 2WUDA 1ZNXA 5A4IS 5IVKA 1YI1A 2YC4C 1M1NB 4D92A 4CTOA 1GCIA 3WIEA 1RP7A 3GA7A 4DSAA 1FXWF 1JG7A 1ZQ9A 2IPNA 3FZQA 3MJSA 1OKKA 1O94A 1HG0A 3WLNA 2PUHA 3D1VA 3L84A 1U8AA 4L8LA 4MJLA 4WCFC 5KVQA 3BEOA 2W6MA 1QBKC 2R5NA 3BZUA 3S8MA 4WK2B 2GUWA 3K8YA 2YBDA 5C7OO 4PG5A 3E6AA 4PLYA 1VSBA 2IUTA 3X44A 5C5IA 3Q8WA 4AKIA 1Z4OA 3HA2A 1G291 1SPXA 2CD7A 3N0TA 3ZCQA 2EL9A 3UF0A 1QH1B 2IY8A 3LU1A 1ULTA 1FK8A 1OYVA 4COKA 4DUGA 3GLGB 2HA0A 5A5EA 2C97A 3N2GB 4DG8A 4CLXA 5B4TA 4BO6A 2GLUA 1QK4A 1YH3A 3M70A 3OZIA 5DTRA 2X2OA 4HWGA 4CPDA 3WWYA 2WTNA 4O0MA 3R7DA 5DLDA 4R2MA 3R20A 4MYTA 3GJXC 5IHPA 4B7XA 4D1YA 2FF5A 2IYRA 4UXJA 4D79A 5H7XA 5CW1A 4RL4A 1MNQA 4HQOA 3TNLA 2XHEA 1IUNA 3A11A 4IIBA 3EG9B 5A2GA 4YH1A 2JRCA 3HY4A 1H2BA 4MIYA 5AO9A 5DGDA 2HY7A 3VI4B 3U16A 4LDZA 1G0OA 3TWOA 2QRVA 4Z3OA 1X7ZB 1KJIA 4AK9A 1GTJ1 3EC7A 4IH9A 2ATEA 4GVPA 1AK9A 1SKAA 2J3MA 3N75A 4GOXA 4JLWA 5H80A 2L0XA 3ASYA 3RK4A 4AFNA 4BB5A 1PKEA 1AKUA 4TYNA 2KM1A 3M6UA 4GMXA 3EOBI 4HX5A 4M89A 1GUZA 5JHHB 2P9QA 1PNOA 2JGNA 3EIOA 3EY4A 4FLFA 2GAFA 4KQ2A 1PJCA 4RD6A 1B6RA 4YI3A 3JAWA 4OP3A 3RNOA 2LKDA 1KYWA 1V8OA 4M60A 2QF7A 1GV1A 3B6IA 3IPYA 2XSZD 5FOUA 5H9WA 4JYMA 3CN9A 1T6XA 4MKIA 2JAPA 3OURA 1BDJA 4OHBA 4DCCA 3ABQB 1TCBA 2OAQ1 3OJOA 4FMCB 4L02A 5KKAA 1U0TA 4URUR 3RSOA 5LXTF 4LDAA 3T7IA 5G3YA 5GZ3A 4FZ5A 5J1SB 4FGJA 2Q6OA 3HNOA 3CWCA 1OWLA 1NMEA 2R2GA 5CB8A 1G4AE 3P9PA 2ZJ0A 5FLKA 4RK0A 1N1GA 4HN2A 3VU9A 4BMSA 1BDBA 2PKXA 3JYOA 2HA5A 2A5FA 4NOKA 5DRYA 4ZJZA 2DWOA 4XKJA 4OHCA 3GG2A 1G42A 1DC8A 1Q5PA 5AW5A 4PYOA 3RFXA 3Q7SA 3U9SA 2VC2B 5HFJA 3ZLUA 4LV8B 3K0BA 2OFWA 1OCEA 1D0SA 3OWOA 4UBNA 4P22A 1DKMA 5LYYA 4YGXB 1QF7A 2ORYA 3FBGA 3PTZA 3MCUA 5DI3A 1T6ZA 1JT9A 3CLKA 3ER6A 4WBNF 3OCZA 3BIWA 4QL3A 3OUZA 3QJYA 4CEHB 4ZREA 5IH3A 4GPTA 4AZVA 3V8VA 1Z73A 1F4LA 3R74A 1ADCA 4L75A 4LFAB 3GEPA 3RAPR 1VHWA 2WM9B 2PWPA 2H7VA 2Y0CA 5ALHA 3SZGA 2MSLA 1IN1A 3LCUA 4X6LA 2AJLI 3ZTYA 4EY4A 5I6DA 1ZAKA 2ZRHA 2HF8A 5EJ4A 4ZFNA