2YJ5A

Conformational changes in the catalytic domain of the cpx-atpase copb- b upon nucleotide binding
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
251
structure length
246
Chain Sequence
LSLYEKMLHKGMIIKNSNVYEKIKEIDTIIFNKTGTLTYGTPIVTQFIGDSLSLAYAASVEALSSHPIAKAIVKYAKEQGVKILEVKDFKEISGIGVRGKISDKIIEVKKAENNNDIAVYINGEPIASFNISDVPRPNLKDYLEKLKNEGLKIIILSGDKEDKVKELSKELNIQEYYSNLSPEDKVRIIEKLKQNGNKVLMIGDGVNDAAALALADVSVAMGNKNVADIILVSNDIGTLLGLIKNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COPPER-TRANSPORTING ATPASE
publication title Conformational Changes in the Catalytic Domain of the Cpx-ATPase Copb-B Upon Nucleotide Binding
rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 61
structure length 246
sequence length 251
chains with identical sequence B
ec nomenclature ec 3.6.1.36: Transferred entry: 7.2.2.19.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2yj5A01
3.40.1110.10 Alpha Beta 3-Layer(aba) Sandwich Calcium-transporting ATPase, cytoplasmic domain N Calcium-transporting ATPase, cytoplasmic domain N 2yj5A02
3AR3A 1IWOA 5ALYA 2CFRA 4C4TA 3MC1A 5ALDA 3KDPA 4E88A 1LTQA 1RRCA 3W5BA 5AW7A 3OCYA 3AR7A 1EK2A 3QYPA 4Y3UA 1L7PA 4UAVA 3SD7A 2MSNA 2WM8A 3M1YA 4ZEVA 3AR2A 4KN8A 2R8ZA 5ALWA 5ALUA 4UMFA 4RETA 5AHXA 2HO4A 4UMDA 5AI6A 1QQ7A 3L1UA 4GXTA 3GYGA 4I9FA 1Z4QA 3R9KA 2WF9A 5AM0A 1ZOLA 4J2TA 1YV9A 4BYGA 5AICA 2P27A 2WHEA 3KD3A 3U19A 1U02A 1SWVA 2P69A 5AI0A 1CQZA 2P11A 2O9JA 4AS3A 2I54A 2C4NA 4ZEXA 4CF4A 3PGLA 5AI5A 2YMPA 5AM4A 2C9MA 1SU4A 1Q91A 2R8XA 1RMYA 4XPZA 2CFSA 1YJ5A 5AVVA 5AKHA 4NFLA 4KX3A 5AM1A 5AVWA 1MO8A 3WK5A 4NV0A 2Q4RA 3FPSA 5AIAA 2YJ4A 3MN1A 3ESQA 3QUQA 4L6CA 5ALJA 3U13A 4YH1A 4UAUA 3FM9A 2WF7A 4UASA 4XOUA 4UATA 4F72A 2QLTA 3NRJA 4FE3A 5AIBA 2FPRA 2PR7A 4CNQA 4EEKA 4NWIA 2QYHA 2B8EA 5AKZA 3DDHA 2PQ0A 3ZVMA 1VJRA 3K1ZA 4BX3A 3U7HB 3UMBA 2ZXEA 5ALVA 3PCTA 3W5DA 4C4RA 2W43A 5ALZA 4XQ0A 4YGYA 5ALSA 2FEAA 5T41A 3ZWDA 3E58A 2I55A 1XVIA 3ZU6A 1YNSA 2VKQA 4KX5A 3I6BA 1XP5A 3A1EA 2HF7A 4OD0A 3L7YA 5AVQA 4G63A 4OFZA 2DQSA 4MUMA 4BBJA 4DW8A 5AK6A 2OYCA 1VFPA 2RB5A 1RKQA 5A3SA 4YIKA 3SKYA 2JAWA 4AS2A 3ZI4A 1RKVA 4RESA 5ALFA 3QX7A 4Y2SA 1SVJA 1WVIA 3N28A 5AK5A 2YMQA 4DCCA 3QUTA 1RLTA 3WKCA 3WKAA 2BDUA 3RFUA 5IT0A 1Z5GA 3OCUA 3FPBA 3AR9A 4Y2PA 3AR5A 4HGOA 2FPXA 1XPJA 3WK6A 1WR8A 4G9BA 2YFYA 5ALTA 2RBKA 4UU0A 2D2VA 2YJ3A 4HYTA 3WGVA 5AW4A 2JAUA 3A1CA 1JUDA 2CFTA 3J7TA 3OCZA 3EWIA 3QLEA 1RLMA 3R4CA 3PGVA 1WZCA 3WKDA 1ZD5A 3ONNA 2G0AA 3U7GA 3N07A 1NRWA 1ZD3A 1YS9A 3M9LA 4MWOA 2B1QA 5AESA 4IFTA 1EK1A 1Z88A 1T5TA 3QGMA 5AVYA 2AMYA 3N1UA 1U7QA 1RQNA 4YCNA 1RLOA 4F71A 3AR6A 1X42A 3FZQA 3P96A 3NAMA 4JB3A 4BX0A 1RPZA 2I7DA 3UMGA 4EX7A 5AKGA 4ZEWA 2G06A 4KNWA 3I1YA 3IJ5A 3W5CA 2ZG6A 3GWIA 3QUCA 2YMMA 5AKLA 4BEVA 4HGRA 3E81A 4B6JA 1Z4JA 2FDRA 5IT4A 1MO7A 4YCMA 2WF8A 3WK8A 1ZS9A 3QU9A 1Q92A 3PDWA 5AVXA 3BWVA 1RC8A 1FEZA 3QXGA 3QNMA 3OTQA 2BY4A 5AK3A 5AKJA 1L7MA 3WGUA 2HX1A 4BKMA 3L8EA 2B1RA 1RQLA 5AM2A 4GIBA 5AI4A 4O8CA 5ALEA 3ZTYA 5FP0A 3QU7A 1ZJJA 1WPGA 4BNDA 2IOFK 1J8DA 4KYTA 2C88A 5ALNA 3SLRA 5ALHA 2ZOSA 1TJ5A 4BX2A 3WKEA 4IG4A 3SF0A 2A29A 1N8NA 2YY6A 5ALPA 3L0BA 2ZBFA 1Z4PX 2Q4TA 3BA6A 5ALKA 3I28A 1ZD4A 5JJBA 4HAIA 1RMTA 4AP9A 4CE6A 4HGQA 5AW3A 3AR4A 3EF1A 3NUQA 2BDEA 2ARFA 1Q3IA 4EZEA 3ESRA 3OPXA 4Y2RA 3R09A 2C8LA 1L6RA 3B9BA 3MPOA 4Y2JA 3DV9A 3F9RA 4UMEA 2MU1A 4QQFA 4UARA 1L7OA 2WF5A 3L8GA 2W11A 1SWWA 2KMXA 2RAVA 4Y2TA 4C4SA 2I33A 3ZWKA 2YMLA 2GO7A 2G08A 2JAOA 2HDOA 4PNHA 2AH5A 3SMVA 4UM5A 3KOOA 3VAYA 2FI1A 3W5AA 3QUBA 4UW9A 4HGPA 5A3QA 2G1AA 2A00A 1NF2A 1ZRNA 3NANA 2C8KA 2B0CA 3I76A 2HF2A 5ALOA 2B30A 3SHQA 2HOQA 1Z4KA 4I9GA 1K1EA 2YBDA 2AGVA 1RKUA 1Z4IA 2IOHA 3ZVLA 4YCLA 1O03A 1TJ4A 3FGOA 2OM6A 2OA0A 3EPRA 1KYTA 1T9ZA 3KZXA 5AW1A 2P9JA 2I34A 3L8HA 3NIWA 5ALXA 3U7EB 3OCWA 1U7OA 3WKBA 2WF6A 2NYVA 2Q5EA 4EELA 1QYIA 3CNHA 3ZW7A 4CF5A 1QQ6A 4J03A 1Z4MA 5AKYA 2HCFA 5ALQA 2HSZA 4Y2QA 2HHLA 3D6JA 3ET5A 2GMWA 4HGNA 5ALIA 2GHQA 2ZBEA 2X4DA 3A3YA 4XE5A 3SKXA 1Z4LA 4EENA 5AKKA 5A3RA 4NAVA 4FYPA 5AKXA 1RMQA 3E8MA 2NO4A 2G80A 5AW8A 5AW0A 1J97A 3ZX5A 3ET4A 1QQ5A 2GFHA 2JARA 5E0OA 4Y2UA 3L1VA 3ZVNA 3RF6A 2OBBA 3L5KA 2IOFA 3KC2A 2G09A 3QU5A 1RDFA 3L0YA 2HEGA 4DFDA 4DWOA 2WFAA 5AW2A 5AW6A 1TA0A 1L8LA 3IB6A 2FUEA 2FPSA 4Y2XA 2GHTA 4FFDA 5AVZA 2PKEA 5ALMA 3WK9A 4EX6A 3TLMA 4UMVA 4JDPA 5AKIA 3CZ4A 1ZRMA 3EF0A 3FVVA 3ZX4A 1U7PA 3OCVA 2YN4A 2I6XA 4BNDB 1S8OA 3N8GA 2CN1A 3UM9A 3B8EA 2AUTA 5AVSA 2B8JA 4L57A 5AM5A 2KMVA 3NALA 2ZBGA 2HI0A 4UU1A 5AVRA 3E84A 1Z5UA 2EAUA 5AKEA 3QU2A 3L8FA 3U26A 1U2SA 1Z4OA 2R8YA 1Y8AA 3KBBA 5AI8A 3S6JA 4Y2VA 2G07A 4Y2YA 4NABA 1F5SA 1TE2A 2IYEA 3ZTWA 4YIHA 3L0CA 3B9RA 4CF3A 2RARA 3U7FB 4QJBA 3HYCA 4OHFA 4UM7A 4BEWA 3A1DA 2W4MA 1YMQA 5ALGA 3WK7A 2IA5A 2FUCA 4L6AA 1L7NA 1L8OA 5AVTA 1TJ3A 1N9KA 2R8EA 1ZD2P 3UMCA 4H1WA 1Z4NA 2FPWA 5AM3A 3HLTA 5IS2A 2FPUA 1S2OA 5AI9A 3DNPA 1O08A 1YDFA 2YJ6A 5AK4A 5ALLA 5AW9A 5AVUA 1LVHA 2B82A 3DAOA 3IRUA 3NASA 2JGAA 3QU4A 3ED5A 1PW5A 1CR6A 2EATA 1NNLA 5AW5A 4OCZA 2O2XA 2EARA 2NO5A 1QH9A 5ALRA 3MMZA 3ZUPA 2YJ5A 2ODAA 1AQ6A 3WK4A 3OCXA 3AR8A 3N5KA 1U2TA 1VJ5A 1MH9A 1T5SA 2ZBDA 4KNVA
chains in the Genus database with same CATH superfamily
1JI3A 5BOSA 1ZNWA 4HDMB 2VHTA 1X9IA 1W0KD 2ICAA 1NXPA 3LKBA 2R751 3D31A 5DNVA 2G70A 3CO0S 3RU9A 3T7IA 5LIPA 2GERA 4ZVOA 5BVHA 3HO8A 1VE1A 3GGCA 1SIOA 3LPMA 1LBTA 1R4AA 1F2TB 2I8AA 3GRVA 4IH1A 4JJEA 2N3ZA 5G1NA 1JZTA 2M2IA 4LPSA 1FDWA 1EUYA 4UOEA 3GRAA 3JRWA 3AJ9A 5CEJA 1XLWA 4D42A 3WVNA 3Q1LA 3GVPA 4I5DA 4X1KB 5JBIA 1TIPA 2C0PA 4I6GA 4P5PA 4PEVA 4PX3A 1CEQA 4C6TB 2C7OA 4L75A 1TUGA 1QHYA 2YH2A 3S5UA 1LXCA 1NU8A 3EYAA 4O4IA 1U8XX 4HFMA 4C0JA 5JUWA 4HB3A 3HBAA 1DU4A 2G76A 4KR7A 2H1LA 2ZT7A 3C87A 4YMGA 5JJIA 1ZNZA 3RKUA 1ONNA 2HNAA 4XTRA 1TYCA 4LHSA 4ML3A 3TNJA 2F43B 3PGXA 2R79A 3VMFA 2J4DA 2UXBB 1W5FA 4R2WA 2IPOA 4BAGA 1UWLA 4EJSA 2PHZA 1YV9A 4BWVA 1L9KA 1ADFA 1SCJA 1XTQA 1J0BA 1PQPA 2CNOA 3DMTA 4H2DA 4KGXA 1QWOA 4OIFA 3U19A 4CN9A 1SWVA 3R8CA 5BMVF 4CDGA 5BYAA 1LD3A 1PD0A 1YU6A 3MPUA 3V1MA 5BRJA 1X0VA 5JDIA 3ZZMA 5TMBA 4S12A 2CHUA 3BYZA 4MEBA 4CF4A 1COZA 3W5JA 3FVTA 3NBUA 4Z4CA 5LWQA 4R4JA 4JEMA 5IDYA 3TDNA 4BN0A 5JO0A 3A4VA 5ILOA 5LD2C 1YJ5A 3CGGA 3O8OA 2BGMA 2DLDA 2FX2A 5AVVA 3C3BA 1NRJB 5AM1A 3DHYA 1NM5C 4TM7A 4MUGA 1MO6A 4QOFA 1U8CB 1XDBA 1H5UA 1GPBA 2WYHA 2QT9A 3CNEA 1NVUQ 3QUQA 3DV0A 4LRWA 3CRZA 4Z9XA 1ZR2A 3GY0A 4L1KA 3HRHA 3UMVA 3WRWA 4CIVA 5IFKA 4I99A 2JFGA 3Q8WA 3H6GA 4MQUA 1C7RA 4GFDA 1QU2A 4YRKA 1KWKA 1V7CA 2I78A 1I7LA 1N25A 4L74A 2QZJA 3OLWA 3CCFA 5CFQA 1AGXA 3EVTA 3KLOA 1EQUA 1RXVA 3DDHA 3N6VA 1YT5A 1FU7A 3LWBA 4BX3A 4IDNA 2OXFA 2PN1A 1J70A 2L2QA 3PU6A 1UBJS 1DCKA 1ZITA 1V9CA 1LFDB 4KMMA 4BBPA 3HJHA 2VRCD 5JQWA 1GJRA 1C3EA 1EINA 3EDQA 3Q10A 4C4RA 1O8CA 4BFLA 3D64A 3GYBA 3KUDA 3KXPA 3U9LA 3WI7A 1P73A 5TNXA 4DSUA 3D3EA 3QY0A 1OD6A 1JLMA 1P5JA 2XLCA 3CZCA 4TXMA 1DC4A 2V98A 3DTTA 2EIXA 3II6X 3KZVA 4OXRA 1PBTA 1P9WA 2I55A 3TQRA 4TUYA 1C4OA 3RAEC 2WUDA 5KQSA 1WG8A 1OV6A 3E22A 2JF0A 3T9CA 3AWDA 4IDBA 4JT9A 4NYMQ 4D9EA 3IUNA 1IUOA 1DTEA 1GCUA 1TF2A 1YZ3A 4FHGA 1AN9A 3ZBPA 4O59O 1YH3A 2PVSA 5TJHA 1NBHA 4E2YA 2C9ZA 3FUXA 3QA9A 4H4EA 1QO0D 1DFGA 4XA8A 3TGLA 1XZNA 2AXNA 3GCGA 3R5FA 4YIKA 1O3YA 3T38A 3TZQA 4FR2A 3TZEA 1CUFA 1K27A 2HB6A 4OSEA 4WBNA 3DB2A 3UPTA 5IVHA 1OCEA 2KLBA 4RESA 4F45A 2J9FA 1GG5A 4HATA 1YCGA 4TWRA 4CEJB 3QBVA 3UOWA 3GPIA 2Z57A 3GJRA 3QELA 2JVIA 2WY2D 3AHHA 1PJ3A 4F4FA 3GO4A 1CB0A 3D6AA 1L5FA 1IK6A 2HIMA 4V0NA 2CKMA 2FETA 1HDYA 1UC4B 3N7AA 1N2SA 3AR9A 2FP4B 5I7FA 5CFOA 1B1AA 3KETA 3KYDA 5H9WA 4ZIRA 4ETWA 5H7XA 1UP7A 3F96A 1DV1A 1E0KA 3EE6A 1P4GA 2QL9A 3WC4A 2H3HA 3JQPA 2OO5C 3R7NA 1KFJB 2OILA 1XEXB 2QN6A 2PGIA 1QYXA 1Y5MA 3BJEA 4G1BA 4WXYB 4A0GA 4QAJA 1T9KA 3A2LA 4YR9A 1GQFA 3B7WA 4HBGA 2AD5A 4XVQA 5K8JB 5DEIA 3EXHB 1FPQA 2SBTA 3T3IA 4W5QA 3AF4A 4TMXA 2AYYA 3BB3A 4X1IA 1IY2A 4Z7QB 5HYVA 2ZIFA 1WEHA 2ZWMA 3QK7A 1VJTA 4V02A 3KLPX 1MGPA 3GQBB 1WZCA 2C31A 4J91A 5TX7A 4ZYZA 1R5BA 1E2EA 4B82A 2LCFA 2ZUTA 5GJBA 3TLJA 3ZCXA 4B3SB 1G2QA 2FQYA 4DMRA 3TF5A 2OV2A 4KP7A 5ESXA 3RVBA 3C3YA 1BQEA 1MAWA 5H0IA 4YAIA 4ZI7A 1A7KA 3ZCPA 5FUQA 1B73A 2EFYA 1E9DA 5KYKA 4QKQA 3ZDAA 1UBOS 3PVZA 3EMVA 4YRIA 1Z6TA 4UE3S 4KPFC 3KWFA 3M3HA 3FYUC 3G7UA 2RHCA 3EFBA 3DF7A 1X42A 2GH1A 2ACVA 1YCDA 4XPIA 5DSXA 4NBKA 2QDXA 2F48A 2Q0HA 1FP7A 3M6LA 4MVJF 1W0CA 1XVUA 2NUTB 2PO7A 3IMCA 4W4TA 1L5HB 1Q44A 1VBNA 3FMOB 3KJNA 3I23A 5EMJA 1XD9A 2B6HA 5I7UA 4GI2A 1RRVA 5IH3A 3F0TA 2V7PA 3UWOA 3KJHA 1U4NA 1IMOA 2BR3A 4JY7A 2A58A 3CPEA 3E9QA 4N6GA 1QR6A 3FF4A 4G09A 1F6BA 4N7MA 1JG4A 3DTNA 4RANA 3W2IA 2VHVA 5EJIA 4D4JA 5LOVF 5EJAA 3QUAA 1E9VA 1G0OA 1D0IA 2ZLBA 3FJ1A 4WNAA 4ENVA 2CDNA 4RD6A 1JU3A 4LYYA 1VI6A 1G3RA 1LF0A 2Q49A 5T4HA 1NDUA 3SS8A 2BJVA 2J3MA 4LY0A 1ZIYA 4RIIA 5ITVA 2GTPA 1O6BA 4U3JA 2JLWA 1CUYA 3CRVA 1FS5A 1V45E 2CFCA 3GJ0A 4KVGA 2FMIA 1RC8A 1FEZA 3A1UA 4L8VA 1GT6A 2TMYA 1MIOA 1V5IA 2VUHB 2GSDA 2A9FA 1T0JB 2JEYA 3TNDA 5F3WB 1TM1E 2XGJA 4LDJA 1FDRA 1HQKA 2W2PA 3K5HA 2H2HA 2CBZA 3HKDB 4AMVA 4KFTA 4DV2B 1M5RA 1ZW6A 3H3XA 2PMFA 4JJKA 1QLHA 4WBSA 3SQDA 3QIAA 1SCNE 4CTJA 2O19A 1WSDA 3S8EA 1Y7LA 3ZKAA 1E1DA 1WPGA 2XSZD 4BVHA 4OMUA 3KZOA 3SSOA 3WB9A 2OCXA 4C6SA 2ZOSA 5A4MS 5I5EA 3SWWA 2V0GA 3D02A 2QTLA 4UU7A 1NXXA 1TCCA 2XDYA 1SKMA 1UOEA 4IXTA 2YY6A 1GA1A 1IWPB 4ARAA 4BNHA 3BERA 3UMRA 2P7HA 1MORA 2C2OA 4XDGA 1SNYA 8GPBA 1USUA 2GRJA 2NTJA 5IT9A 4GLFA 3IR7A 4DCTA 3FPHA 4PLGA 4CM5A 4DCGA 1UJ6A 3V7WA 3AR4A 1I13A 2QJTA 4FD3A 1T9GR 4ODIA 1GITA 5B12A 2ARFA 2BFWA 4ERXA 4Y2RA 2PUTA 4E5DA 2R97A 4HF7A 4MITA 4E08A 1G6OA 1SURA 3B9BA 4PLZA 4FS3A 3R7LA 3BXEA 2KW5A 3UA3A 2V9PA 2QTAA 3JU3A 3PNKA 4HLUC 2JGKA 2IYNA 3IP6A 5B7NA 5DM0A 4A2QA 4GX1A 5JMOA 1A7UA 2G17A 2WD8A 2C9DA 3DZJA 5JROA 3IXQA 1MA3A 1NW4A 1MC4A 2E1PA 3OEYA 3LV8A 3VKGA 5ELXA 5FTLA 1PBNA 1M8PA 1H0SA 1IBLB 2C4UA 1GGFA 2WUVA 3JWHA 3NS7A 1X39A 1FDIA 1FLAA 2OL4A 1M10A 1N9GB 3KOOA 1D3AA 1JN0A 2GJ9A 3QVOA 4GRIA 2G5PA 4QRIA 1W36D 2DHRA 1B0UA 2FGKA 5LLSA 3QG1A 4YYZA 2RJNA 3PQ3A 3BZBA 3V1NA 2JEZA 5K4AA 3RVNA 1YQWA 3ZU2A 3VR4A 5LLDA 5F9MA 5A7GA 5HM8A 4DJEC 3BGOS 2HREA 4Q1FA 2QX6A 4I9GA 3RE1A 3TD2A 4S3MA 2FQQA 2DBZA 1UZMA 2VF4X 3PLRA 2DPLA 3AZQA 4LXUA 2G1JA 3TSZA 2I9PA 3ZUGA 2DUNA 1T9ZA 1WU8A 1TM4E 2XRMA 4QBGB 1JDJA 1T9CA 3PJRA 4P0QB 2B3TA 1RWOA 1X9GA 2YV3A 2PS0A 4C6HA 1G5HA 1H85A 4J0FA 4XGNA 4P5DA 2C54A 3VV2A 2XOKA 2ZBQA 1K7FB 1QZXA 1SKAA 2Q5EA 4L95C 3AUFA 4RVSA 2RHLA 5LQDA 2BMJA 4JODA 3IALA 4LA4A 2O07A 2XNHA 4AO7A 5DOZA 4BFWA 3K9LA 4C0AC 1XU9A 1BHQ1 4NVRA 5AKYA 4PF1A 5CA1B 5L8VA 5KVAA 3F4KA 2YXNA 1WHTB 1X7DA 4QFDA 5CJPA 2JH9A 4TLEA 2GMWA 4ZCSA 4AZVA 4B3CA 5IU6A 2I6UA 1DJNA 2Q41A 1NLUA 4O4HA 3IQIX 3AONB 4ZCTA 3RSOA 2A84A 1LJUA 2X4DA 3D8TA 1QVWA 2IUYA 4CKEA 1QS0A 5D6OA 5IDQA 4IDAA 3NM4A 1U2DC 4OH7A 4E4YA 2NO4A 2QSZA 1CS4C 1CP2A 1VI2A 2BFPA 3FBWA 3ZQKA 4X60A 3ZX5A 2HADA 2ORVA 4ZMSA 2JARA 1A2OA 1VC2A 3E9CA 2FXVA 1A8PA 2R87A 3LQ4A 2Z2XA 3MOGA 4G4JA 4J43A 5KOHB 1E8DA 5A4JA 1HF3A 3CZRA 1XD8A 2PXAA 2O52A 3L4BC 3SMQA 1H93A 2HEIA 2XE7A 1E6CA 1SBQA 2MTBA 4Q3EA 2PCLA 1FNNA 1ZJ5A 2J7PD 2VF7A 2O3SA 4JI4B 4IIYA 4YV2A 4ITVA 2BSXA 3DV2A 3EXEB 2YFHA 3PFFA 5G0SA 4S0ZA 1USVA 2JRLA 1Y9AA 2Y8EA 2P0AA 3PYLA 3DMFA 2XA1A 4MRAA 4CG0A 2PD6A 4LJ5A 3N2NA 1G6KA 1Y81A 2GYYA 2IDZA 1IJFA 4JWKA 1NR7A 2RGBA 1Q21A 2GAIA 4RA9B 5TQ0B 1YJ8A 4MUEA 3QVXA 5IDWA 4JFAA 1RRKA 1QP0A 1V5GA 4AYTA 2BGTA 4DLUA 1EFRA 4ZCQA 5HA5A 2O0JA 5IDXA 1XJWA 3U3KA 1K86A 3UN1A 3BHJA 5IKEA 2CVFA 5AJWA 5ITZA 1E9AA 2UZ1A 2ZAGA 3IKLA 5HJ2A 4Z7NB 2KMVA 1CRWG 1GSAA 3K0AA 4L9RA 2F55A 4JC5A 5L6LB 2J9XB 1GGMA 4Z0TA 2A0WA 3K3PA 3OIFA 4MI9A 5JXGA 2J45A 2WWHA 1I51A 3PSAA 4OGGA 3THWB 2B94A 4MV3A 4U6QA 1Z4OA 3U3XA 2H1SA 3LOUA 2LE0A 1NI3A 3K4QA 5JAIA 1P6XA 3NRBA 2SKEA 5AXCA 3C6XA 2AG5A 4WBXC 3OSZA 3AEKB 3GRRA 5FAXA 3RIGA 2B7CA 2XZPA 4BMPB 2H7YA 2VDVE 3L0CA 3ZTWA 1HORA 3B9RA 3R8XA 5TGTA 5LP6B 1L9XA 4YCDA 4ZAZA 4A26A 1JHOA 2AE1A 3PCRB 2IU4A 2DFNA 2IPAB 4XR4A 4U6SA 5CP8A 2PMWB 4AO6A 5FX2A 2O8FB 3FNRA 5DGIA 4NOMA 2JHFA 5BUSA 2VP6A 1UAAA 3IV9A 4RACA 3X43A 4QOJA 3DOOA 1O54A 3DTVD 2ZI7A 3PIRA 1R37A 1FJGB 2DFLA 4OK5A 3IP9A 4YRLA 5G1OA 3WRYA 4JXZA 3WQSB 2I4LA 2LKDA 4GKAA 1ZQ9A 1ZXLA 5I9MA 1JBEA 1F0PA 2J4FA 3O4GA 4QTUB 1DKRA 4IBOA 4FYJA 4B73A 2AEMA 2JHPA 2Z95A 4RGBA 3N2GA 1OFGA 4PPFA 2C3PA 2O8CA 1SD5A 3P9CA 4G2NA 2GYUA 2ZSBA 3MWGA 4MI1A 4O4IF 4Q18A 4UVGA 5AK4A 3RVMA 3STUA 4F1WA 1IOWA 2HWUA 3EXFA 1BXRB 4G56A 1XWIA 1CQJB 2O0LA 5EJFA 3V00A 4AKGA 1JKIA 2VAXA 3T5PA 1AZWA 3PXAA 2V8BA 1OGYA 1NOIA 3M4YA 5ALRA 5H5JA 3UWMA 2OK8A 3CVJA 3OCXA 4WVLA 3A11A 1VZ3A 2OFOA 2BH2A 1UBRS 3KTFA 1T5SA 1VG9B 4LJYA 4DCVA 5CH3A 4D2IA 4ND1A 4PCUA 3LVRE 5ALYA 1RI4A 2MT9A 2VAWA 2V96A 4KSCA 1JXQA 3RGGA 4MUFA 5IZ4A 5D86A 4QRDA 1UPCA 1X92A 2M1XA 1W2HA 1SKYE 3IAXA 2ZWOA 4IIUA 5EKXA 3NXSA 3RVQA 3VO1A 4DA0A 2Q0SA 2HK6A 2PRKA 1XBTA 1BU5A 3H0KA 1PQ4A 3H2JA 4QU0A 5EXPA 4CNBA 4LE0A 1L7PA 1TJPB 2P4UA 3T3GA 1GPJA 3WLAA 3P7MA 1I4LD 1V1RB 1IEVA 1ZL2A 1EEXB 3OPYB 2FPGA 3OKCA 4Q7MB 1C1XA 1M2JA 3NHZA 3OM0A 2C07A 2JCVA 4G5OA 4Z9BA 5FF9A 3UAWA 3ZD9A 4DDHA 2JKVA 4NKRA 3HR4A 1L5OA 4G8JA 4QUDA 2X23A 1FVOA 5K51A 1LDNA 2QN7A 1IH8A 3I01M 3GU3A 3UGTA 1KI8A 2HCJB 2I2FA 1L3BA 2OLKA 4QFBA 4WEQA 4ZFNA 3USES 2XPCA 5C4GB 4CFZA 2Z98A 4KQIA 1EGHA 3WO0A 3WXBA 3GBVA 1DVRA 1TZ2A 4CLOB 1UXHA 4G36A 2GD0A 4QDJA 5EFOA 2BYTA 4KQMA 1MFPA 1ZOLA 2EQAA 1OLUA 3FSRA 4FUQA 4KO4S 1U98A 5EAIA 2PLRA 3ROXA 3W6OA 1N2JA 3R0JA 5DXJA 4G1UC 1R8JA 3CVOA 3WYNA 3OQHA 1I7DA 3BSYA 5LA6A 1BX0A 3KYCA 1QYDA 4WXPA 3RT9A 3MEQA 5ERXA 3UB3A 2XIQA 4D8UA 4GWKA 2HY7A 1QHHB 3H9CA 4I55A 2IEAA 1SB9A 1CUSA 1O1YA 4WINA 1ABEA 3QFCA 4P7KA 3GEMA 3QMPA 3JASB 5ICFA 1RMYA 3NNNA 3VDQA 2GZ2A 4HRAA 5JC8A 1UQTA 2BONA 5I4BA 4TUYF 4KX3A 5UKDA 4RF3A 4CTNA 2DSTA 2OG1A 4ESHA 1NR5A 2WKRA 3IT2A 3D5TA 1RIFA 2FRDA 3PHHA 4NL4H 4RVNA 3W7BA 4EFNA 3IPCA 3RBVA 3DMHA 2HK8A 2ZB7A 4BFTA 3WLEA 1E9BA 2ZJBA 1A71A 2NTNA 2HA4A 3PPYA 2XAAA 3DE4X 3R5KA 1XZKA 1BVUA 2GN8A 3HZRA 3RG2A 3PEWA 1ATIA 4GPBA 2QEQA 4WOPA 1DDOA 1OE0A 2N1MA 1GY8A 4R54A 4RSMA 4D8VA 2VDRB 5DI3B 3OU2A 4WBNF 1J06A 3TIIA 3EIXA 4LOJA 1U2PA 4PZEA 4DMMA 3WV5A 1YACA 3PDUA 3HEAA 3HI6A 4HSGA 4K6KA 3PHLA 5BWCA 5HZHA 5J4VA 3FY4A 3R3ZA 3SJAA 2V74B 1KGDA 2HHHB 1N2IA 1NG1A 3HEBA 1BMDA 3ZVRA 4C7JA 1NMEA 1QZZA 2R2AA 3Q3HA 4ZI5A 3EPJA 3FRIA 2GN9A 3PX7A 5FUVA 3RUAA 1I3LA 1Z75A 4XQ0A 4X95A 1TYAE 1VE9A 2PGLA 3DLPX 4EKEA 1ZINA 4RY0A 3PVCA 5ALSA 3ZDXB 3JQ7B 1SVLA 4PRKA 3ROMA 1A5AB 4ID3A 4P33A 1H9BA 3EDOA 3OFVA 4CM3A 4YT4A 1XTZA 3O8DA 5IKOA 4WOCA 1TUBB 2NO0A 3OLQA 3T12A 2ZUUA 1DAIA 1XZBA 3HUTA 3L7YA 3A4MA 4DADA 3K72B 3A25A 3LLUA 3PLNA 4P4UA 4QEKA 5DCYA 4G63A 4ESOA 2OO3A 4KREA 2IBTA 3T1TA 3QWBA 2WG1A 2YUTA 4NCNA 4V38A 3VYVA 2GEDA 5AFSA 4H16A 2PU5A 3UFBA 5AK6A 3GUVA 2I1QA 4WZBB 1VFPA 3QV1A 2Q9BA 1XMJA 4QYWA 2W70A 2JJMA 3DB1A 1T1GA 4LRYA 4WZAB 1CFZA 1ZONA 1P1HA 4LMRA 3NHMA 3ZI4A 2XUZA 4FR5A 4MX8A 2KMXA 3MB5A 4JB8A 3ENQA 3IOMA 1UKVY 5ILQA 2JH3A 2PSFA 1O0SA 2AB0A 2WFLA 3F7OA 5CT4A 3TVYA 4CQMD 4EO7A 4HWKA 3SLKA 1N0UA 4ZI7F 1D6SA 1I0IA 3G2LA 3OEED 3AUSA 3JQQA 5CDHA 5JD5A 2O54A 2EJTA 5HBRA 2XCTB 3A6JA 3O84A 4DABA 3H75A 1X3LA 3AHCA 3CKLA 4QBIA 2E4AA 4QUEA 4XJVA 3HA7A 2AOXA 3OCUA 3AG5A 4HDSA 4DC0A 4Y2PA 3GBPA 4B33A 4BNTA 1Z7YA 5GZ3A 2KJQA 4PBTA 5IXJA 1WR8A 4HQLA 4IY1A 4HKTA 4RXMA 5T64A 3IVXA 2I4NA 2F8TA 1PWZA 2G9UA 2KE5A 2JIPA 1RWWA 3EWNA 3R44A 4GPIB 4OL9A 4EG7A 1CQIB 5C5DA 5KMGA 3LD9A 1TOAA 1GFWA 3IMEA 3NJ8A 3WGVA 4I6JA 5K3CA 3DW3X 2DQYA 3CC8A 3FPLA 3I9MA 4KZKA 5E8JA 3FUTA 3RUDA 1O5TA 3ZE8A 2AW5A 4MV1A 2L82A 2H1HA 4IGFA 2IWHA 3PNOA 3GPBA 1OHHD 2W6MA 4QIHA 3WDLA 5KSYA 4F5DA 4YMUA 1SQ6A 1M73E 1BJTA 3FHCB 4RHEA 2G0AA 5U9CA 3N07A 4U2GA 1NRWA 2KSQA 4ZO9A 3UK1A 3NNSA 3NV9A 1NQUA 3UB2A 3M81A 1BFUA 1PEYA 1XTJA 4TZTA 2TS1A 2WU8A 1DC8A 2B1QA 3VO9A 3VJLA 1JSXA 2C7RA 3X1KA 4RY2A 2YX1A 5FFFA 2RMKA 3JAWA 5LXTA 2H0AA 5EXEA 5KC9A 1SCUA 2B5WA 5FFMA 4HK4A 2AOTA 4EJSC 2HMUA 2J7KA 2P9YA 3FZQA 3OE4A 3DMTC 4PVCA 1SHTX 3LYHA 4JBHA 2Y77A 2J3KA 4I4NA 1QIMA 3R0ZA 4JENA 3RCBA 3RS2A 3P2EA 2EXXA 2QVYX 1UFKA 1XGKA 5EEGA 4DCSA 1RXWA 4MV8A 2HQSA 5HK9A 2AEEA 1DBRA 2ASEA 4YUWA 3A4NA 2IZ5A 2OD9A 2J3LA 2YWBA 4QXOA 4FCTA 5AKLA 2B2NA 4Q4JA 1YRBA 3CEPB 1C7FA 1SXIA 5IT4A 2BKEA 4G65A 1LU9A 4IVNA 3RNOA 1Z13A 2G4LA 4FZVA 2ZRNA 2ZRDA 3OTWA 4X20B 3S8YA 3FIJA 2PUVA 1NPYA 2QZZA 3K2EA 4INAA 4WXMA 4FLMA 1ZCZA 1Q84A 1CZKA 3LC1O 2RGNA 3O9ZA 4RW0A 5TQ2B 2MSEB 4YJ3A 1MO5A 3ADBA 1QHFA 3NHPA 5JAUA 3JATB 2IKQA 3C3DA 4KJZA 3LXRA 2W2OA 3INGA 1A9RA 1IAQA 2AJ8A 4EO4A 1K3FA 2VDUE 2Q3HA 3NUGA 3RAGA 1O58A 2WJWA 4UHEA 4CMEC 2KM1A 1JQLB 4YJ2A 2O5EA 3OT1A 2ZYHA 4B7XA 4HMOA 2HJRA 4HWPA 4Z3DA 2HLPA 4JBWA 1SBHA 2IUEA 4OLHA 4Z51A 3MWLA 1E63A 1E3IA 2ZJ6A 5GVRA 3ZIUA 4D57A 2CB0A 4MWZA 4PIVA 4P22A 1ESDA 1MVOA 1MG0A 2GAAA 4ZAXA 1W36B 2F2TA 4GSYA 4CMHA 5L3SB 1XZLA 2ETXA 4RSGA 2YC2C 1EU1A 3SIPA 3HFJA 2IIBA 5BMOA 2FOIA 2V3WA 1VQ1A 5DWVA 4HNUA 5K99A 3P4XA 3I5YA 2PVCA 1X70A 1FNSA 2OZPA 4PC7A 4KUHA 4D81A 5IVPA 3HVHA 2JASA 1OFIA 4HJRA 5F9FA 4LXTA 3IHKA 3QLVA 3KSMA 2CZCA 3CX4A 3Q7PA 1TM7E 2LV8A 1LRKA 2XKJE 3DSRA 3KAPA 2OECA 4G5FA 4I4TA 4INPA 1QAOA 4KE6A 4WL0A 5AJVB 2DBVO 5B37A 1TLLA 4JI1B 5JDCC 3UYLA 3VKFA 1C9EA 3MINB 3OX1A 1HSOA 3HCWA 3G17A 3VTZA 1G2IA 2BFEB 3DV9A 4TGLA 1V95A 3W34A 1DXYA 3M6MD 3B5EA 5E4TA 4G5HA 4UARA 3WX0A 1NMYA 4CFYA 5BV8A 3BFPA 1IN4A 1Z6PA 2G36A 3M2TA 2WAMA 4FCWA 4JX9A 4B80A 1Z3IX 5HHTA 3G2HA 1XPUA 3AV0B 3FHLA 3PSHA 7REQB 1BKYA 1FPMA 1PR9A 4DJJA 5KTPA 4DBLC 1AD2A 1FXWA 1T1RA 4JXJA 3WJ2A 4O4HF 1CR2A 4JP1A 2TRSB 3T52A 2AXQA 4X41A 1XV5A 1ZNQO 2FDXA 4GNKA 3IHTA 4RJIA 4ZA2A 3HN6A 3IDSA 4V3CA 3ZCVA 2YXPX 4C21A 2WKQA 4KO8A 4NV1A 3SJ7A 2GGSA 3H8SA 2IE8A 1KHTA 1ZRNA 3H84A 4AC9A 4BNYA 2BMWA 2W6OA 1NVMB 4PRYA 2B0CA 1GFIA 3GEEA 1GQSA 3M1IA 4HN9A 4MQ4A 3S68A 3ZWNA 5JADA 4I46A 3OZSA 1JTFA 3FNFA 3NU1A 3STHA 4IF4A 2GTHA 3RVLA 1E2IA 2O1XA 4FNGA 3FAKA 2ZIVB 1JLKA 2WM9B 3CH6A 2WICA 4PW0A 4ZYUA 1XKTA 1K68A 2QPLA 1K98A 1YB6A 3LCJA 3DZGA 4M8KA 4B3MB 2XQFA 2AA3A 3Q6MA 1ZIXA 3TYXA 4E0BA 1CV2A 5JSQA 3ZKWA 4DR5B 5FQNA 1I2AA 1BMTA 1YQEA 3I42A 2WWYA 3DBOB 4BNVA 3EIQA 4KV7A 3SXUB 3ZE2B 5LP1A 1QIJA 4RL6A 3THYB 1U8EA 3L4JA 1WD7A 5ENZA 3AYXB 4IIGA 2PSHA 2XUOA 5BSHA 1TT5B 1ZZEA 3SBEA 4M1SA 4XTCS 1IAVA 3KLMX 1UADA 1QIFA 2BBSA 3FTPA 1OY1A 1Z4MA 3KZ1E 1L5KA 1ZD9A 1C7ZA 4PO9A 16PKA 2WIFA 3TZHA 2FCAA 4XYMA 1C9KA 3X2SA 4QGAA 3AQ4A 4GRDA 5DYGA 2MDTA 1PI3A 1TW3A 3D6JA 2W7TA 3AHJA 4HYEA 3BPSA 5LDGA 2QP9X 3DKRA 3EYWA 4EPVA 2GHQA 1W44A 4J1TC 5HFJA 2ZBEA 3H9EO 1GQYA 4N5NA 4WADA 5LFAA 4YMWA 1Q74A 2CWDA 3ETJA 2K7ZA 4NK5A 4KR9A 4W9RA 3I3SR 1CR0A 2H92A 3OZBA 1S8FA 3Q5DA 4ACAA 1NFQA 3ESAA 1KQGA 1Y33E 1FP2A 1Y1TA 2EKQA 3EMDA 2FTKE 5HZKA 1CUJA 1O5OA 3DTYA 3JZAA 4LVCA 3SSMA 3ZXXA 3OTOB 3D7MA 1F60A 1QQ5A 3HJNA 3CT4A 3JZIA 3RIXA 1H22A 2FWRA 2QTGA 2EDCA 1M7BA 1ZJYA 2F6RA 3G8CA 4ZVRA 1NQWA 2ZS8A 4R8RA 4ZZ0A 2BGGA 4HJXA 2GZDA 3AVWA 2IOFA 3KKOA 3A2NA 4CIAA 4DVGA 4NCKA 1IY1A 5CGZA 2QU7A 5FEUA 1F1JA 2PX4A 1GG2A 1C7EA 2QN1A 3AFNA 4BMZA 1VE5A 4URWR 5DGTA 1SCBA 1PO7A 1DELA 2A1UB 2P41A 4JK3A 4G0YA 3QEMA 4S1PA 2R8OA 3HJAA 4RE6A 4U0KA 3R3VA 3DOFA 1GA6A 2R4QA 2VHQA 3AV3A 1YRLA 5K3FA 4BTVA 2DUUA 5C7YA 2BHTA 4ZVKA 1MFZA 3IAM6 3WIDA 1C80A 3DTVB 4MW6A 4JXKA 3ZH2A 3FH0A 1IHDA 3HCPA 1PV4A 2VQDA 1FFCA 2Q5QA 1VHJA 1QKJA 4FKZA 1XHEA 3AH8A 5JT1A 3R9XA 4AN0A 2BFFA 2OWDA 3SSAA 3ZWQA 5HCIA 3MLBA 4OI2A 3H5VA 2ZYSA 1A76A 8LDHA 2NVWA 4PHHA 1GV1A 2HI0A 2IF0A 1Y4ZA 2JBAA 2ZU0C 2ST1A 2Z9CA 2LWIA 4GQAA 2HCBA 2PD3A 4INZA 5C31A 5IF9A 2F3PA 1XROA 1W6UA 5KNBH 2ZE8A 3W3AA 4RD4A 1YA6A 1FL9A 3TKLA 3LGXA 1NJ2A 4ZCIA 2F1OA 1X1EA 4PYQA 5KNLA 1EZ1A 1I1HA 1RQ7A 2BP7A 3KAQA 4RMJA 3T1VA 1O9BA 3ZG6A 4LOHA 4IUYA 1E58A 4GC5A 2F1HA 3SR3A 2RIRA 3ANSA 3ZIDA 1GL7A 3FD8A 1QR2A 2B8TA 1FS6A 1JIKA 2HJWA 2P9BA 4Y30A 4D74A 4ZQIA 3RTCA 5LMCA 1DGQA 3U9SA 1X7XA 4O1IA 5DTRA 1GZ4A 1KU6A 1W48A 2BBTA 1Z0FA 2X0JA 3FE2A 4PZ0A 4BZWA 4Z4IA 4NE2A 1Y3HA 3DEFA 2YYYA 5IUNC 4QYTA 2O48X 2PX0A 5G40A 4KO1S 4PM4A 1NQVA 3HO1A 1QHSA 1GVHA 3G0DA 3R6DA 4FDVA 1EB9A 1TJ3A 2XD9A 1TEVA 1UEJA 1VFNA 3PENA 4EH1A 1ZD2P 5IC5A 3DOUA 3FPCA 2IIPA 3SS9X 2M6SA 4KXWA 5DHFA 2QSUA 2QB5A 4JLSA 3HWRA 2X8AA 3QBEA 4M89A 4TVOA 3MRTA 2VWHA 3VZQA 5AM3A 3UT5B 3HLTA 3TVDA 2JL1A 2FPUA 4P0TA 3DNPA 3L7LA 4O3FA 2C7PA 3BS4A 1M6VA 4H0FA 3CS3A 4NY1A 2HTFA 2R7AA 2XTMA 3NASA 3PJGA 4MS4B 5AQEA 3UG7A 4E09A 1TUIA 4GZLA 3ED5A 1R9JA 2G88A 2QMZA 2EATA 2IHJA 5DBGA 1NATA 4LZZA 1DUVG 4AIIA 4OGWA 1UZUA 3B20A 5HKAA 1GNQA 2RONA 4M99A 4RQAA 2JK0A 3P27A 1VIDA 1OBHA 5JVDA 3GNSA 5A9TA 1D6NA 3FMVA 4EK9A 3PGJA 3TTVA 3C1TA 1M72A 1OPRA 3TEFA 3AX6A 3GAZA 5EP3A 5LA6F 2BFMA 2X7HA 4MUXA 1IWOA 3NG1A 4RM3A 3TTSA 4AJ4A 3MC1A 1CE8A 4MP3A 3UJ9A 1N5OX 4KN9S 2X76A 4I55F 3B38A 1NU6A 4K9KA 3WGZA 3CXRA 4WK2B 3PP8A 1OPXA 4E03A 4TS4A 3H5AA 4RD3A 2OV3A 4LOAA 2XB4A 1T6YA 1X15A 4QYXA 4RZUA 5LZ9A 3B1VA 3DD5A 1HFKA 2WJYA 5DGDA 4G1FA 4QU5A 4GC9A 5F2OA 5CA0B 2AEFA 1YQXA 2IYZA 2OO7A 3W5UA 4IJVA 3A6DA 1MN6A 3EXG2 3JW8A 5AXDA 1T10A 2P9HA 5FWYB 4F21A 2FWPA 3WWCA 5JFTA 3CW2A 4D0SA 1XNRB 4R81A 1CQPA 1KZ6A 1A5ZA 1PT5A 1PFYA 4J0QA 2C0CA 3QJGA 4WQMA 3K2IA 4BIIA 1A72A 3GYGA 4MV0A 4LQLA 4BGEA 1WMSA 4OQXA 3SM9A 3VYWA 1YSCA 3D6NB 4D9JA 3OHMA 1WUHS 1VZ2A 1NQTA 3G6KA 3SZ3A 3PPVA 3F6YA 4JH0A 1NYRA 4C7OB 2MR5A 1N33B 3WRXA 1JILA 2WUEA 4CLRA 1P4HA 2ZIGA 5LCXA 3KQHA 2MSWA 2VRNA 4ETNA 1AB6A 3OY7A 2WWRA 4QDKA 4MRPA 4UXHA 4QOGA 3SC6A 4LXYA 1I6MA 3QTLA 1JFLA 2E2WA 3BIOA 1DIRA 2C4NA 4QULA 3SF8A 2XWSA 2YMPA 2XOKD 3MILA 2GBLC 3CLVA 4BVBA 4QT4A 2NXJA 3VPAA 1GO2A 1U5BA 1ICIA 1JHRA 2B0JA 3HYNA 4LVOA 5KU1A 3B70A 2E4WA 3B82A 1A2BA 1JA0A 4PSAA 2WUGA 3NYWA 1R6BX 5T8KA 1XHLA 4EYKA 4B7AA 3WY9A 2H06A 2FWIA 3LCCA 4UD2A 1GLGA 5JCJA 5AVKA 1GAJA 4MAAA 1V1MB 4EPYA 5JSZB 1BDHA 1Z7WA 3GCWA 3BE4A 2AN1A 2ZPAA 3OQIB 3K6SB 1Y4SA 3QJ5A 1B2RA 4F1JA 5IVKA 1Q2UA 2C58A 3A9UA 3EH2A 4R6WA 4UATA 3ZPXA 1CR4A 2VT3A 2TECE 4FE3A 3ZTTA 4QE3A 1B76A 4ZJPA 4KPYA 4L5IA 1CVIA 2J0SA 3QNWA 1DB3A 2O0MA 2O8BB 1EFHA 4TRNA 4CQMB 4OHYA 3FNQA 4O1HA 1Y7IA 4UBMA 3SP1A 1T2NA 5I3ZA 4MEJA 4YCSA 1YQQA 4RDCA 4D8YA 5KTSA 1A2KC 3GJ8A 1E3QA 3HGMA 4I1UA 1XEWY 4P7GA 2VVTA 2Y1CA 1EVYA 2FJ0A 2NYRA 1MLDA 3QENA 2FW7A 4EQZA 1T3SA 5CH8A 5D5HA 1LQTA 3C14C 1LPPA 4G5XA 4N0QA 2PL9A 4P81A 1FSGA 2C4VA 2HBZA 4X54A 4RDIA 4X61A 4I9NA 3E1GA 4LF9B 3QHAA 3VMMA 2A8YA 4B3DA 4X9XA 5HQTA 2BL4A 1XPOA 2WIAA 3JQ6A 4UFOA 2Y9MB 2F17A 1R0CA 5T5QA 1E1QD 2QRGA 4IGIA 1BRTA 2G9VA 4XI9A 1EFRD 2BGUA 3ADKA 5M5BA 3T7AA 2OV6A 1JQBA 4OUDA 3KZCA 1XK7A 2QHXA 4C0BA 3WRYC 2TMGA 1AS3A 4DLXA 2W6IA 3G5UA 2GZHA 5T3YA 2NU6A 4DW8A 3HKBA 3K05A 4C7VA 1QCDA 1BSVA 4Z9FA 4JT8A 5THKA 2NACA 1KJJA 3HDVA 1P81A 1B15A 2IYUA 3X1DA 1YQ9A 2Q4DA 2Z8ZA 4FMDF 4WH0A 3IILA 4BKPA 3A1TA 3PI6A 1GNTA 2ZIUB 2VOEA 1ADGA 1FFXB 3AVPA 3CLKA 3CW8X 3I8SA 1ZK3A 4BLVA 2AX3A 1XK6A 1ZOPA 1UXKA 5E7MA 2GEKA 3WKCA 5B2FA 5BUCA 2NZVG 1WABA 5LXTF 3SYKA 2KQUA 4O33A 1XAHA 1XZAA 3WJ1A 4FGKA 1WAMA 1NN0A 1GTSA 1PEDA 2PZ8A 3H1TA 3EULA 3SY8A 4WLVA 3QXSA 5BVHB 1IONA 2A5FA 3AHGA 4FHDA 4Q66C 4W1QA 4KJXA 4LRQA 5DTEA 4BLRA 4I9HA 1VBMA 1QX4A 4BUCA 2IGTA 3ZXYA 3P9YA 1F1BA 4XB6B 4D9BA 2FOLA 2YV2A 5J2UA 1XPRA 3GLQA 2FLKA 2HZBA 1NRXA 1P33A 1JUDA 1RW4A 3C6ZA 5FBVB 1YMVA 2EQ5A 3BOSA 4LEIA 3QOFA 4H3KB 2QI9C 1YC2A 3A4YA 3E6AA 4L0MA 1JMKC 2IU0A 1UFQA 2ZSEA 1BIFA 1U2GC 3ILYA 4K6FA 5D5QA 1SOVA 2EFGA 1OLOA 5G0VA 3RSSA 3U7GA 4FOTA 2W00A 3AF6A 2IEDA 2V7GA 4IMIB 1HT0A 2JHCA 3AEQA 3LH5A 3Q12A 2WVJA 3G0OA 4YJ3F 1E2KA 2WUFA 4HS9A 3MTJA 1L7BA 4N0EA 1E64A 2D13A 3RDPA 4K87A 3WDKA 1WVMA 2GA9A 4X8LA 1O87A 1QJCA 5SICE 4GG1A 4DY6A 4CIWA 2I4TA 4DL9A 3HBMA 4RVHA 3B51X 2ZM6B 3ZC3A 5F98A 1UP6A 1AKMA 1E2HA 4EGCB 2HRDA 3DBLA 4LQDA 1DT5A 1JNYA 1UL1X 1RXCA 2QPAA 4HOYA 4YJ2F 1N6PA 1XZFA 2P0EA 1BVYF 1L4KA 4O6VA 4Q01A 5E3JA 3MJVA 3RV3A 3FFTA 3I0MA 4BX9A 3SVLA 3LSYA 4FHZA 2RSLA 2WE7A 2H8KA 3O8OB 1L0BA 1W1WA 3V8MA 4RCVA 5JRDS 2BF7A 2HRBA 3V2UA 3DP9A 3E1KA 2PPVA 3GDHA 1GGJA 3I45A 1U9ZA 1UDRA 1EE2A 3I2HA 5F2KA 3K9BA 2UZAA 3NYRA 4F5WA 4LZNA 3TTUA 3HRIA 2P4SA 4ITUA 1JSZA 3K92A 3LHSA 1YA4A 2HXYA 1D4OA 1YRQA 3HNPA 1U11A 1ISIA 1R6UA 2D7JA 3G5TA 1YB5A 3RUFA 4BASA 5IKPA 5IUKC 1Y1KE 4KLAA 1GZ5A 2GJKA 3GW8A 4RKEA 2HHJA 4J3JA 4XXHA 4I4TF 3BWEA 4G8BA 5CM9C 4D0NA 5JV5A 4DQLA 1L5RA 4MV9A 5J59A 4RTLA 3W9YA 2YJNA 1DLIA 2GD2A 1DNPA 1GADO 2IUSA 2JFPA 3IHLA 1JHXA 3LGAA 4QJ5A 1KI3A 2M9MA 4XEUA 5AKJA 4K6GA 3WGUA 4QG3A 3L7JA 1HE3A 3KQLA 3PX2A 1ELOA 1J25A 1F51E 2C77A 2C29D 2C9CA 5AXAA 1QRSA 2ZB3A 2CV1A 3P9XA 3WL7A 3HR7A 2QAIA 2EZ8A 3BM5A 3U3JA 1J8DA 2RHDA 4KYTA 1UJ5A 3PR1A 5ALNA 1Q12A 3JD3A 2EKPA 4BMXA 4UREA 3RAPR 1XTPA 4HAYA 4IXDA 3SYTA 2ZXUA 1V9SA 2VDMB 4TUYB 1H6BA 3PRKE 2VJYA 4MUYA 2VQ3A 4IJWA 3PDJA 1FXWF 4IIXA 5JCPA 3T7EA 1PJ4A 2JC3A 1NJ1A 1YC5A 1T8PA 3C6YA 3OO0A 4W8OA 1T0UA 2PXXA 1RAEA 3RASA 4UAGA 3A1VA 5C80A 4PAOA 2ZI9A 3OU7A 3FX2A 3DONA 2OVBA 3MRSA 3NOXA 1KO4A 2G04A 4L22A 5JG7A 3NFYA 3U39A 1I2DA 1P1JA 1D1TA 1IB6A 2GDZA 4XQEA 2DWQA 3W78A 1ECLA 4BWFB 4WBNB 4K9OA 5AUPB 2BCJQ 2J9FB 5TY0A 3X1XA 4CDMA 4HNQA 4NHEA 1D4AA 3GH1A 2BI8A 2ZIXB 2NU9B 3REQB 5IANA 1L8AA 3WJAA 5FA8A 1NBAA 1MTOA 1DQZA 1XE3A 4JL8A 4ZOCA 4TVKA 3CPJB 3L7OA 1KE1A 3K4HA 2GEFA 3L7NA 3LPLA 4CG2A 1DRKA 4GKJB 4XIJA 1GTG1 1MGOA 4H6PA 2B92A 1G5FA 3SJBA 3C48A 1WTAA 1PTJC 4OHKA 4LNUA 4ZIRB 2OZVA 3MWYW 1SWWA 3AOEC 3LUBA 2ZQZA 3N2IA 3PWSA 4HNTA 4L8FA 4RF5A 2PA3A 2HSJA 4R51A 1RXEA 4RD1A 4DV5B 3EUAA 1W4LA 4LNAA 5LYYA 4EHAA 4YB8A 2CJFA 5KO2A 1I3NA 1KZYC 1UPAA 2WMYA 2JIOA 1I3KA 4UHCA 3NAQA 1T2UA 1WO8A 5JCOC 2I2BA 1U8YA 3H6HA 1DBSA 5A3QA 5BV0A 1ESMA 2Y0CA 5TXGA 2Z6QA 1GV0A 2UZIR 1CVRA 2XF2A 2PNFA 1T9DA 1L7QA 4J7AA 1GTZA 4X1IB 3UUGA 3DUWA 1E2GA 1RRPA 1SRQA 3ZEIA 5IW8A 1JSRA 1RD4A 2ZKLA 1G5PA 2OFWA 2WPDA 3BF8A 2NUAA 3OZCA 1JMYA 3T9AA 1RE1A 2HLHA 1SBNE 3OZIA 4C2AA 3GN2A 3NAZA 4ZGGA 5KJFA 1F7VA 5GPBA 1O89A 2JHGA 4BMDA 2FLWA 4TXLA 4ALMA 3TKAA 1SVJA 1XCMA 2GBIA 2OT3B 4ND8A 3SIRA 4KDRA 4ZI7B 3FRJA 2F9LA 1TZMA 1ZOIA 3KELA 3Q0IA 1I7NA 5ADUS 3CTMA 1E7MA 3OJCA 5BW8A 1SXJA 5LQCA 1LI5A 3H6KA 3IOBA 3Q40A 4QLAA 3ZY2A 2PYZA 3EISA 3O5AA 1NN5A 1TAHA 2P2GA 5KNCA 4NZZA 4RTQA 4TKMA 4XAQA 4LWPA 4I1OA 2EFDB 3IQWA 3KKKA 5BORA 4IUCS 4XPIB 1E69A 2QD1A 3QEOA 4A6PA 4EWLA 1AHHA 4UPDA 1FSSA 4XSHA 1SZCA 1MV8A 4Q7KA 3DLBA 2WYUA 4ZOQI 1UBKS 2I65A 4RPJA 3D8HA 3OWHA 3TH5A 3L40A 2BEVB 4ZXPA 3AESA 1MZPA 1Q22A 1I8TA 1ULTA 9LDBA 1GCAA 4OX9B 4PWZA 4BU0A 5JEDA 4DSNA 3WBBA 1EX1A 3IBCA 2Q9AA 4XQGA 2PSEA 4WNAB 3P8ZA 4YTEA 3TL3A 4YCCA 4JVOA 1IDOA 4M1OA 4UBKA 2YVUA 5DH9A 3L1VA 1MAVA 3ZVNA 1WE2A 3SX0A 1TAUA 4ZV4A 5AJTA 3G02A 2EP5A 4JJ8A 4HPXB 5BQ3A 3COSA 4U3JB 3OZRA 2OGUA 4QHYA 6ABPA 4COKA 4CM1A 3AF5A 3IC5A 3KQNA 4J8PA 1DG9A 3AJEA 4L15A 3H8JA 3EF3A 4QWMA 5AW6A 2DTXA 5C8YA 4DQDA 2H65A 5SY4A 3H3FA 2B1GA 1QLJA 3G49A 3H1PA 2HDWA 5DCWA 1HGXA 2CE7A 2RI0A 1ZSVA 3NDRA 4TQAA 1W4AA 1YS6A 3LI2A 4UMVA 5J40A 1VPTA 3VPGA 4BAUA 4F11A 5AVJA 3V6LA 3ZWCA 2I80A 1DAMA 1PX2A 2V58A 5I01A 1JJIA 1UUFA 3A4IA 3N74A 1MRSA 4YP9A 5TS2A 3KSDO 3K70C 1I4OA 1K97A 2LP4Y 1G4AE 3DDWA 5IARA 1CUWA 3O9VA 4EO9A 5JXWA 1ETUA 5SZIA 1V11A 4HG2A 2V03A 5CLHA 2OB1A 4H60A 5HS4A 3EA5A 1IVSA 1U3DA 3DCNA 5DP1A 3BQNB 4Q1BA 3LT0A 1KBZA 2QQ5A 4JUDX 2PTHA 3EZ2A 2BBWA 3UFXA 4IHAA 3A14A 4KWTA 5HIMA 4FB5A 3QU2A 3OZFA 5L3VA 1XDDA 2GKSA 3R3WA 2I1LA 2E49A 3RUPA 4QG7A 1UC9A 4PZUA 2Q62A 1Q0ZA 1Z3CA 4U1RA 1T2CA 4ZJUA 1VMIA 3GOHA 5C5CA 4PR3A 5DSZA 4TWZA 3O93A 3HM2A 2D3TA 4MI3A 2QU8A 3HCEA 2A0KA 5JVDF 4MYRA 4CCWA 3MS2A 4AJJA 2ROQA 1QQBA 4Q7LA 1U31A 5H59A 1RNLA 3ACBA 1CC1S 2HTEA 2HZ7A 6PFKA 2ZRHA 3U6KA 1JTEA 3LUJA 3OZUA 1DC5A 2PGAA 3C3KA 4L4YA 3QKRA 1FIUA 2XYHA 3PE3A 4RGYA 1VOTA 4C2BA 4GMHA 2VUUA 2WJ6A 4K5QA 1U1IA 2G63A 3LW7A 3R7WB 2Z2ZA 1FYFA 5KCZA 1UT8A 4OQEA 3ECSA 1KMCA 1K7XB 1N9KA 4NAHA 2IYLD 4WZZA 5H80A 1LSOA 1EWYA 5GIPE 4DM3A 4A6EA 2O3RA 5EPEA 5M29A 1PJZA 4CMIA 1KHHA 2PUHA 4RU1A 2UUPA 1O08A 3KXKA 1OU0A 3DKIA 1I01A 3PC4A 5AVUA 2O2EA 3B5JA 1EFVA 3CRW1 4JJFA 2J0VA 1GN9A 1P8AA 3E53A 3TKYA 3OWOA 5CB4A 2N0SA 1NNLA 1IUNA 4H15A 3DUFA 5JMPA 3RJZA 1ZISA 1G8KA 3WNZA 4XD2A 4GBMA 1YJBA 4RV4A 4DDKA 5IM4A 2ZJ0A 1GL3A 4G5QA 4W5RA 2OD7A 1YHNA 4NYJR 1S2NA 5ADWA 4RHUA 2QD3A 1OQAA 3H13A 2ZWIA 3INTA 1EP3B 4I8IA 2ES4A 2PWPA 3HUUA 4IR7A 3LRTA 3WMXA 1SXQA 1P61B 4O25A 4PONA 2OC9A 2MJLA 1A4IA 4K6HA 1IXRC 4FDAA 4OQZA 3OCYA 1CZUA 5AYVA 3RC9A 5FR1A 4E33A 1PR4A 3AUJB 4UCXA 1QIIA 1U0LA 4KGDA 4HGYA 2G1KA 1N6NA 1YUBA 2PLWA 1RLJA 3IDZA 3LDFA 2QENA 5DX0A 4NCHA 4MTLA 3NGMA 1ZIOA 4O4HB 4OB7A 4U63A 3HK2A 2R8ZA 3A1NA 1JIXA 3BB4A 5CW1A 4CKEB 1ZYUA 1U2QA 3JWGA 3M49A 5JH7B 5TDHA 3BGWA 4S2EA 5J4LA 3OD5A 1EBUA 1ZM3A 4NCIA 4ZREA 1VPVA 2PT5A 3CVWA 4MVWA 1FFSA 1FYXA 2IYXA 5K6TA 2Z5VA 3AIIA 5FPYA 3IMKA 4QVGA 2ZRMA 4G8DA 5AOCA 4KQ6A 2OTCA 1YBAA 3DAHA 3G9QA 4JYZA 4MJXA 1NZFA 3KOZA 4TLBA 2QTVA 5C1OA 4GOXA 3HDQA 1DG1G 1UOOA 4GLLA 2P6RA 3LVBA 1V39A 3MG9A 4MCAA 4YRTA 1N32B 1YK1A 1KJYA 1X7YA 2XY4A 3U80A 2I87A 5EJ9A 4U2FA 1JHPA 1MX3A 2RCNA 3FDXA 1J2YA 4L4RA 3PE6A 4QU8A 2EL9A 2J6CA 3EFOA 1E3WA 4F4UA 1HT2E 1Y48E 2IZ7A 4ECAA 2I67A 2BH9A 2R00C 1DLJA 2A2ZA 5DTQA 1JB9A 4URZR 3HVKA 2GPTA 3B1WA 2BLNA 1P7WA 2ID7A 3IXLA 1XZHA 3WB0A 3FF1A 1MO8A 4B6RA 2HNKA 2HD4A 2Q4RA 3IERA 4PRZA 5ENDA 5HNKA 2Y1GA 2EFHB 2YICA 3AJDA 1K6XA 5DLDA 4HB4A 5AOBA 4JOCA 1WMAA 3U09A 1Y0BA 5I7WA 5ITZB 1Z36A 5B64A 2UZ1B 3GGGA 4DV6B 1P91A 4UAUA 1II0A 3K0AB 1SUDA 1DT3A 5B3JC 1E2BA 4JUBA 4YMHA 3IBYA 1LK7A 4M38A 5DHSA 3THRA 3IR6A 1LV8A 2F9FA 3OTIA 4E94A 1B6TA 4KLZA 4YX9A 821PA 1E9EA 2H2IA 3C8MA 4BGVA 1H3FA 2GD1O 4HZUB 3WS7A 3IUPA 3KR2A 5COBA 3GT0A 2PQ0A 3VPCA 4EF4A 1NRIA 3ZVMA 1VJRA 2FSGA 3UK2A 1GPMA 1WY7A 2O0KA 1EEHA 1TQ2A 2ZRBA 1QK4A 2E4UA 3BMOB 5K8CA 2BWJA 1ZVJA 2ZTUA 4OKSA 5LNK6 1PJLA 3D3NA 4JITA 4KAAA 2A1TR 2ZBRA 3VBEA 1SA0B 3S1SA 3A28A 3HJRA 1VJDA 3GXBA 2BM0A 2JBHA 3ZWDA 1L8QA 1KJNA 4NU0A 4FGSA 5AUQA 5AQ1A 3FGZA 4P2BA 3FR7A 1E32A 5I4IA 1VSVA 3LXXA 2PDAA 3EDYA 3HBJA 1AKYA 5J2UF 1Q17A 3JWPA 4DMGA 2CUTA 1ZGBA 2GASA 4OYHA 4BVGA 3ILVA 5FTMA 4CGYA 2DQSA 4EHKA 2X40A 3L4SO 2EFEB 1Q6ZA 2P4HX 2DFVA 2G5TA 3VUFA 3N2GB 2N75A 4MVJM 2O8CB 5C5IA 1U7XA 4XQCA 3A3KA 3R3YA 1OH5A 2IS6A 3LQFA 2WMOB 4G4SO 1ZH0A 4MO2A 5HPYB 1FTQA 4YLYA 3MWEA 2H4WA 5EZYB 3VR6H 3ZHOA 2X7JA 4BBZA 5BNIA 2QIOA 4ARUA 3O4JA 1SD1A 2ZAIA 3MAAC 2YMQA 4OHRA 4EJ0A 2PMCA 2C7QA 2CJWA 2JDIA 1GZ3A 3LZ6A 3IIJA 1X7WA 1RKXA 2E6KA 3FPBA 3MQ2A 2RGCA 3NHKA 4JLUA 3O4RA 4PSVA 2QOEA 5F7XA 2CE2X 1YBFA 5D3QA 3I2FA 5DXFA 1IJKA 5TMEA 3O8CA 1XU7A 4R98A 4ZCMA 4QNNA 5DIZA 1OT5A 3A9CA 5IH7A 3EVGA 2YV4A 1KA9H 5JI2E 2J46A 5HJ7A 3UJ7A 1R4MA 1LBQA 4FWBA 2Z43A 4P7FA 3PLAE 3P94A 4HMPA 1A5BB 1ICEA 4WWHA 3T06B 1TJYA 2FPGB 1D04A 1C1XB 1I0ZA 1EXWA 1KY4A 1UKYA 1XXLA 1Y42X 2F59A 2FAXA 2HU2A 2VP2A 4BKUA 4X71A 4BNLA 1K75A 1EVIA 2QJRA 4X93A 4MV5A 4CLXA 2NAFA 4CM6A 3QNUA 3H8WA 4S2UA 5DV9A 1YBVA 3NIBA 5F1OA 5JXJA 4ZYYA 5KYXB 1M8JA 4B4DA 1CUDA 3ROGA 1EE9A 1Q3TA 2FEKA 4UU8A 2JGRA 2P8JA 1T24A 1XEAA 1GR1A 1Z8DA 2P6UA 2VCYA 3H5RA 1OH6A 1MR3F 3M9LA 4I5EA 1RYNA 2CSUA 4I1RA 5BNFA 4UNRA 4P0PB 4Q3KA 1H0RA 3H5IA 5K0GA 3DYBA 3T4PA 1OLUB 3Q3GE 1G9SA 3LUFA 3AKEA 4XIFA 1N7JA 2XTNA 3DQQA 3NBFA 2NO7A 4NONA 4DPLA 1P9RA 4JGGA 4YCNA 3KYCB 3BZWA 5HGJA 3LQKA 1ZXBA 4RNCA 1DJPA 4R7ZA 2AD1A 3X1YA 2XJ4A 4S05A 1NPTO 4I55B 1PG5A 2QQ0A 4EX7A 2ZTMA 5BSVA 2J9YB 3UJ8A 4AKTA 1M6NA 4BB6A 5L7TA 2YIMA 1JR3A 4I1IA 5J1TB 2GLTA 1ZN2A 2OENG 4FSDA 3LYAA 1WXHA 5IBQA 2ZE7A 5FUXA 4DBLE 2XUKA 3ZE6A 1A27A 2YHSA 4CQJA 4J0KA 1KVUA 3QOXA 5HCUA 1XCPA 3AZOA 3E70C 5E6SA 5TEVA 2DPMA 1XR3A 4GX5A 5T6BA 3C24A 2XADA 1TM2A 4HFRA 5KSOA 5ELMA 2JH8A 3M4XA 2XUAA 3LP8A 3VZSA 1RVDA 2H59A 4YCMA 3CWZA 1JEQB 3NHFA 3G0BA 4K3VA 2HW8A 2PUBA 5T4EA 1LDBA 3L0PA 4AF6A 2GCGA 1F2UB 3TCNA 3AFIA 3T3MB 2M1ZA 2V9ZA 4YJGB 4R6XA 5HUQA 5KVVA 5FNVA 2R48A 3RYHA 1EGMB 4OBBA 2P79A 1HE5A 3D5QA 1SBZA 1W4BA 1Z6QA 1ISHA 3OFSA 4I0WB 4L02A 4YECA 2XGGA 5F1KA 4CGZA 2QMUA 3CINA 3CLRC 3ABRB 4FBMA 1P6UA 5EVCA 2NV2B 4DWVA 3MJFA 4LBWA 1N1GA 3HR8A 1IEQA 3UMFA 1I1QB 3SIWA 1BN6A 1FRNA 4C76A 4E5YA 3ILHA 4QQKA 2IP2A 2PRJA 3FCXA 2ZYUX 5EP1A 1ULUA 4EGFA 3NHUA 1XZIA 1YZFA 3LXUX 3EOBI 3CEJA 4FYWA 2GN4A 4JSTA 5DTMA 3SF0A 1GTJ1 3PGKA 1D2NA 4D0GA 4JI6B 3Q6NA 4EOGA 5HOQA 2H6EA 4P4GA 2ZBFA 3OH8A 2A3RA 1KOJA 4TS9A 3BHIA 5JCJD 1WNTA 1YDMA 1GRNA 4KH0A 4OM7A 3VO2A 1PNRA 3QKUA 2PKXA 4KUEA 1PUIA 1S8AA 2Q3BA 3FYTA 5JJBA 1PX0A 2VFAA 3FHOA 4HAIA 1NVEA 3GLIE 3FAZA 3N2EA 1XNGA 5AW3A 4OOFA 2CL6X 3JTEA 3V4VB 2REBA 2BDEA 3OP4A 5LQJA 5THQA 3ENWA 2DBQA 3GIDA 5IYZA 4ZVPA 5SYAA 3VR1A 1P4SA 1SIWA 2FCRA 4N3BA 3L4KA 1AV6A 1KRWA 2VPQA 3KSRA 1ZH2A 3S8MA 1F7UA 1PP4A 4O4JA 4XDYA 4DSZA 1WULS 5DCLA 3TRKA 1MKYA 2J3IA 2EKLA 4G85A 1EBBA 1VKZA 1HDEA 2PWAA 4FZ3A 4PYJA 1H2YA 9MHTA 2A5DA 4YMSA 5LBIA 4A9AA 3FBGA 1BDIA 4LCEA 3MGGA 4Q48A 1E94E 1K6EA 1LSJA 5IN5A 2VI5A 3D7KA 1HK7A 1G20A 3D1LA 2XBUA 4JB2A 4N40A 3TMAA 1II8B 4Z4EA 2JAOA 3E9NA 4PNHA 2MINA 3ORRA 3UY4A 5ESWA 5TS3A 2A0XA 4PQFA 3V8VA 1EK0A 2VH1A 4RORA 1P0MA 3QUBA 3WYBA 4C3VA 3H9QA 4E5MA 4D9NA 1VLVA 2HV9A 3IPLA 5FWDA 1AQIA 2J6BA 4MS1A 1YRHA 4ARBA 3O73A 1NF2A 2R6JA 2W6ID 2YZNA 3NWPA 2BEJA 3E61A 1ABBA 2OB2A 3QPCA 4A8PA 2P4EA 3I76A 4BVAA 4YBZA 1XJ0A 4GM0A 1CERA 3T54A 4QLBA 1D4ZA 2HOQA 3F74A 4KTVE 2C78A 3GDGA 3PFCA 4R9VA 1EFLA 1Z4KA 1PUJA 4J9UE 4BUZA 2AGVA 2HK7A 3KKLA 4FMDB 1MJNA 4FMBB 4XD7A 2C2HA 5D3ZA 4EG6A 2XXAA 5GM2A 5A7FA 1RWXA 2FWJA 3E7XA 1OIXA 2IXGA 2ZWVA 3AP1A 4HQKA 3PGMA 1FDOA 4OHVA 3F5SA 3LIIA 2WTEA 4C4AA 5C8YF 4LJ9A 1C7IA 1O6FA 1ZH4A 5CJJA 4AJ2A 4B44A 1YB7A 4G0PA 1JI0A 2AOTB 5ULLA 5EJ2A 3BHMA 4RK6A 5DXAA 1H69A 3ZW7A 2O5RA 5I8WA 1NR1A 1PFGA 3TDMA 2W0MA 2ZW9A 5CK4A 2NQ8A 1WDWB 3H4TA 2QSYA 3HMQA 4MGYR 2J09A 1Z07A 3UK7A 3H2ZA 4ESEA 1QG2A 1KY2A 3LQRA 3CZ5A 3H9UA 2J5RA 3BHNA 4L3OA 3W2FA 5H4GA 5CVCA 3ZWVA 1KMMA 4NU8X 1U5CA 5KJCA 2E82A 2JIZD 2WJVA 3A1FA 4ZMRA 1I2CA 1CYDA 1PS8A 1S2GA 2D5AA 4Q4JB 3KXIA 1L5GB 4L0CA 1VKNA 2VC2B 1Z2NX 5GGXA 1WSAA 1Y89A 4G37A 1OASA 3T7TA 3KL2A 4Q03A 4RV5A 2OBBA 4DR1B 1KS9A 5LU8A 3R7AA 3DMDA 3BE5A 4R2LA 3GCXA 3SC2A 3OUUA 3ANTA 3CRNA 4Q5IA 3JS5A 3F2IA 3A05A 1B0AA 4R84A 4YS6A 3PNSA 4NEQA 4YJ3B 2HEGA 1NONA 5BN1A 1HX7A 1WB5A 2J5QA 1TA0A 1XKLA 5E4JA 5F4BA 2JI4A 4X8MA 2W9XA 1H8HA 4V0OA 4KRGA 3N3BC 2UYQA 3KYJB 4YLGA 3LHIA 3QEJA 4GI3A 4FYXA 5F12A 2XDQA 1IBMB 2GN0A 2IV7A 1OBFO 5BR7A 4F5YA 3SK0A 2VDKB 1OA1A 3TB4A 4YJ2B 2ACEA 4WK4B 3GVXA 3OT1B 4HQNA 4Y18A 1IEXA 3GRCA 2CCGA 2Q21A 2QNIA 4WY8A 3ZWWA 4F9EA 4IKOA 1HQCA 1USWA 1MB4A 2BFBA 1KR5A 3Q4GA 4LTMA 4XSGA 1MU0A 1XSEA 2HJVA 3IKJA 1JAXA 2X8BA 5G3ZA 3VM6A 3B7PA 3M7IA 3AFGA 1VL2A 4GEGA 4J1SA 3IAM1 3R2JA 3LBFA 3OQJA 5AKEA 1QXSA 2JFZA 3C0KA 4KDEA 4HDNA 1PKEA 3BIJA 4JWTA 1Z26A 1PR3A 2YZMA 3NH6A 2CLIB 3JQEA 3HDTA 5FPPA 2OXIA 1OB2A 2H18A 2A0YA 2DY0A 3O8NA 4YC7A 3YASA 2ZTLA 4CG3A 4I4TB 5IM4F 2OKCA 3PJEA 1F5SA 2PIAA 4NABA 3I05A 2RKWA 4R1NA 3FZEA 3SDSA 5JRZA 4XUDA 2HRQA 3KOXA 1BS2A 1VXOA 3O3MB 4M1TA 1KEPA 2DR3A 4KYUA 1AJEA 1SC9A 4Z5XA 4PQRA 4LHVA 2WWTA 3TTXA 3S3TA 4M0CA 3OA2A 3V4PB 5KSWB 1KO5A 3VSBA 4ND4A 5EQJB 4C0XA 3NR2A 1P72A 3CG0A 4YWHA 5K0NA 1OILA 4X1YA 2P1RA 4DIMA 5ALGA 3SFVA 2OSVA 5E38A 1IOLA 1J22A 4Q16A 4PYRA 2OZLA 1JR3E 3B1KA 5CIQA 2WYVA 1RFGE 3X1MA 5K8VA 4RZHA 1GKKA 1Z4NA 1M2GA 4FONA 1QDUA 8ADHA 3OX4A 3SJUA 1JEOA 2QLMA 2X2OA 4Y9UA 5L51A 3NVMB 1S2OA 5IZCA 4CKBA 4K9PA 4YREA 5D3KA 2BT4A 5HE8A 5AOAA 1QRTA 1V8BA 3EC2A 3VNSA 1M76A 4YAGA 1U9CA 4KIWA 1L7XA 4QBKA 5EXSA 4EAAA 4AY2A 4EY8A 3U5TA 1QP4A 3LZDA 4FBLA 2G67A 1TVEA 4LI0A 4TROA 4AZWA 1U0FA 4ZMBA 1THTA 4B5LA 5K6RA 4WHMA 1ZQ1A 1W87A 4CM9A 1JDZA 2SCUA 5JMWA 3WGIA 3RHSA 1FDTA 2KPOA 4MR9A 1G6HA 2GXSA 1K3UB 3QFTA 1P31A 1G5IA 3T95A 3VKVA 3X2EA 5LQMA 2MYUA 3ND6A 3T3NA 4FDUA 4PHCA 4OBWA 2WSLA 3JR3A 4BC0A 2RH4A 2QUBA 2CMGA 2X6QA 3G2NA 3O92A 1NMSA 3NPMA 2NNWB 4MAMA 1R4NA 4M1MA 4D41A 1NJFA 2ZS7A 3RRYA 1YS2X 3R77A 2OHXA 3DBIA 4IL5A 4NEHB 4JI0B 2FPIB 3L1HA 2GZMA 1OIVA 4Z8YA 3JQFA 2B4AA 8AT1A 5KHAA 2HQOA 3RS7A 3BXGA 3L7MA 4RAOA 2ZK7A 5EIAA 4EGJA 1SKQA 4RL4A 4MDYA 1QB8A 1V96A 3EZXA 2C98A 4MARA 1C30A 3DYIA 3P9ZA 3VTAA 1R50A 4KYIB 4NK4A 4DCPA 2WVGA 4C4PA 2PH1A 3CZPA 1MAAA 1N3LA 1FY2A 3HNRA 3HPRA 2ZETA 3N87A 3T61A 2LR0A 3VU0A 1V4BA 2XUQA 3JQCA 8OHMA 1F0NA 4LYDA 5T7BA 5FO0A 5B1DA 4G1CA 2Q6KA 4ZTZB 2WPDD 3AIKA 1JECA 3K6JA 3U4CA 3OPYI 2W22A 2VNJA 2WI8A 2WMDA 3LCMA 5HP4A 3GELA 4ZN6A 4U2BA 4IV8A 421PA 4ANFA 1ORDA 4J2TA 2QG6A 3D2CA 4P7JA 5HEKA 4PNZA 1GQRA 1IZ0A 3OTGA 4M7PA 3PUHA 3RD5A 2DVMA 2L0XA 2BI4A 3N8NA 1SXJD 1TVKA 5CLGA 2NU8A 2R62A 4BZXA 4LCJA 1O95C 3PGLA 4MYUA 1IULA 2V0NA 2ZULA 2PQMA 3GEGA 5AM4A 5K3FB 2D7DA 1X80B 3IMFA 3LY8A 1VTKA 3VOTA 4TZ6A 4IJQA 2ENUA 1G20E 3C98A 1SVKA 1O6GA 1OC2A 1TIBA 5EUMA 5BSKA 1F0KA 3WLTA 4IS2A 1SPXA 1PJBA 4C7KA 1N6IA 2ZIZA 4AN1A 2WQZA 4P6VF 4FW9A 4CKYA 4EHBA 4K9NA 3CVVA 3BWMA 4LS3A 2BFFB 5EXXA 1KP2A 3OOJA 1YR3A 5DLPA 1J07A 4GMFA 5J3JA 3TEJA 5FOXA 2FRXA 5EZ6B 4RQBA 4E13A 4N47A 2CHQA 2JBAB 1Y37A 4H1TA 2ZS9A 4FQ5A 3N2LA 1T1SA 4Q39A 4F72A 1EUQA 4QM7A 3IA7A 4CNQA 5IF3A 4OQMA 4DHWA 4CDNA 1DL5A 2H7VA 3O1JC 5G1PA 2B8EA 2BP7B 2GVZC 2P90A 4E7PA 2J6IA 3MOIA 1NHWA 4LTNA 2Q8PA 5GJCA 4EI8A 3PF8A 2YRWA 4ZT3A 2DXIA 4XVCA 3U7HB 5A62A 5FLYA 1L4LA 3IUJA 5BWBA 1M1UA 2BSAA 2ZTHA 3LCRA 3RC2A 2ZJ1A 4HXGA 1G64A 3AB8A 4EVIA 2V6GA 2FMFA 2DSNA 5EYPA 4LDAA 2YZ7A 3ZWPA 4BUJA 2Y0BA 4DJDC 3TLGA 4X64B 3NHYA 5B7PA 1CUVA 5A9SA 1U1EA 3TPFA 3K4PA 1JHZA 5AR1A 1YS7A 2OUIA 4WDQA 3D4NA 1VE7A 5F7ZA 3FJOA 4YJHA 2I7CA 4FKMA 3VHXA 4AG5A 4ZGWA 5JEEA 2UVQA 1EX7A 5KWSA 4TTPA 2ZE6A 4XQ9A 4D99A 1IDN1 4YAWA 1Q57A 1XL1A 2ODNA 1OLXA 3DE3X 1SG9A 3RUEA 4B87A 2X1HA 3M4JA 1TM3E 2Y2VA 4BBJA 1ZMBA 3AIMA 4NOKA 2ZJAA 2HJHA 5EJEA 4B79A 2FSHA 4TT8A 1YHYA 4B0PA 4DMKA 3EK2A 3HFRA 3PD0A 1M6VB 1R0RE 2HF8A 4FR0A 5AT1A 4BQNA 5B57C 1R0ZA 1U8TA 4K26A 1GQOA 2F1RA 3ELYA 3IEKA 3WMRA 5EMKA 1A88A 1XALA 2YFQA 3TIGA 1Z62A 1SUBA 2IJGX 5AUNB 3C8HA 5HQJA 4FMCB 3F6PA 3MRXA 2AR9A 1XTRA 2GK7A 1AURA 3MWDA 5JVDB 1NVVR 1JFFB 3OESA 3TQFA 3WKAA 3DBRB 4MIKA 2LDBA 3WGMA 1V6AA 4B3HA 1SXPA 3WIVA 2AWOA 2GF2A 1IHPA 1GNVA 3FB4A 4F4CA 4XUEA 3I52A 1Z33A 3ITKA 2O1WA 3F6BX 3PG5A 4HGOA 4HS4A 1CE8B 3C3JA 4IQFA 4M1KA 4XYGA 3M4NA 3NV7A 4MA5A 1HKHA 4JLPA 4F6CA 3PKZA 3EG9A 3QFHA 3RPEA 2PJRA 2IQ5A 2RK4A 4C9BA 4JLWA 3NM5A 1Q7BA 3DXFA 1UQRA 2GFIA 1Z5WA 2VA9A 2WV7A 1O96B 3C39A 4KFCA 2D2VA 2CHGA 4NH0A 3V8RA 3V7NA 1J1IA 2YNMA 4B40A 5I3CA 1ND6A 4IICA 3EXIA 4PICA 3MB8A 4C2TA 3A3NA 2JZNA 2XWPA 2F3TA 3KHTA 2R65A 2IYPA 5J9FA 2HFJA 2ZSIA 4K9DA 2KWIA 3NHWA 2MYNA 3O90A 1JDNA 1EDZA 4FGUA 1HZZC 4GNRA 1RPAA 3CE9A 4RPHA 1GR0A 4R68A 4TL7A 1UFRA 3Q87B 4ZVMA 3VYRB 1OX5A 3UJCA 1NE2A 1FFBA 2BMFA 5DHAA 2CSXA 1TI7A 3EPKA 4MLDA 1AQNA 1E9SA 3JQ8A 1NC3A 5EZSA 4B7ZA 2H51A 2HMWA 1YS9A 2NYUA 2QT0A 2RAPA 3WGTA 4HAWA 4KNYA 4J6EA 2WA2A 1H65A 2AMJA 4MINA 1ZN9A 4ECEA 4JJZA 5CIWA 1Z5VA 5F3RA 5FFNA 2WM2A 1GKLA 2X3UA 4WKPA 5FNVF 4OSOA 3RTGA 1YBHA 4DLBA 2AMYA 1B23P 1F2TA 2VIIA 1TYZA 1Z7EA 4N03A 2VHCA 3RC1A 4P32A 4LXIA 4R16A 4CWAA 2YJZA 2JPDA 1T9GS 3JARA 2YYAA 3NAMA 1RRGA 4I36A 2QRQA 2PLNA 4KFSA 1D2AA 2GK6A 3SF8B 3ASUA 2JZCA 2R11A 3GDWA 5F23A 2RC5A 3EA4A 3SSNA 3STWA 1SKBA 4C6TA 1Q1EA 1PL8A 3KFLA 3FWZA 3RNLA 3E1SA 1WCIA 1A9SA 3IJ5A 1PS9A 1GGEA 2VHUA 3TE6A 1BQ4A 3QPAA 5A6VA 3PUWA 1N2EA 5ED4A 3BL6A 3EXAA 2AUNA 4AW9A 2B1IA 4WNCA 3ZH9B 1JQKA 3VNUA 3FOCA 3BFKA 3TGWA 5IWAB 2FSVC 2VDJA 3AI2A 1GRRA 3LDAA 2F43A 1WV0A 1LPNA 3E81A 2WYWA 5LYJA 1P7ZA 4DAOA 3JZDA 3DZBA 5LL6P 2P67A 4QL3A 4EL0A 1UMCA 1S4QA 1CUCA 1X8LA 2AYXA 1KTIA 2XEDA 1L2TA 4Q05A 5REQA 8MHTA 3RVSA 3KPWA 2I29A 3L82B 5A04A 4R2IA 4XDZA 5DNAA 1NX6A 2WT4A 5IYZF 1XAJA 3FN4A 1L7VC 5C1BA 1HNXB 1K63A 1R6AA 3WTBA 2NO9A 2QXYA 3NNDA 3OTQA 4C6RA 1T4GA 4JA0A 4O4JF 1Z35A 2ETVA 3PYMA 2HX1A 4RTSA 1VHQA 1DQYA 1J5EB 1M2EA 1XI2A 3G7NA 3INNA 2IYVA 3QTTA 1Z5OA 2ZCUA 1AXRA 3T3HA 3MTIA 1ZJJA 2HT6A 5I6DA 3TQCA 4HTFA 3L18A 3HU5A 2PKCA 2YXBA 3JPYA 1NXQA 2IOYA 2XF8A 5BN5A 3GFPA 1Z0AA 4IZIA 3CA8A 3D0RA 3O6VA 1FU4A 3DCIA 3SDZA 4FWTA 3L7DA 4RYLA 1R5JA 2PGOA 5M34A 1BG6A 2HU5A 3IHWA 4DNFA 2DR2A 4OUDB 4I9UA 1JHMA 3B78A 3HDYA 3AFMA 3L5OA 3EIHA 4IS3A 4Q9DA 4ZU3A 1E1LA 1GUFA 1U3VA 3G59A 3G0GA 3H16A 4RCZA 4D80A 4EB3A 4JYCA 4NR0A 3N86A 3SM3A 3CUSA 3MT9A 4B3IA 1ENZA 1IK4A 1E2NA 2VSNA 2VUTA 4J0IA 3LJKA 3KEMA 3E5RA 5MDHA 1V7ZA 3TDKA 2R6DA 4OO3A 1OVMA 4JQZA 1BWSA 3KOUA 4K6OA 1PT7A 2VZEA 2Q3JA 1LFAA 3H0CA 3P52A 4TYPA 5D7BA 4I5IA 4J6FA 1PNTA 1W29A 1G8SA 1OUMA 1UKZA 3ASYA 3NHRA 4QHSA 3PHGA 1T0IA 3K20A 1OB5A 1HRDA 4ZT2A 1L4MA 5FOVA 4I50A 1Z5PA 2IXTA 2X0DA 1QZUA 1P2TA 4G1MB 3K2QA 4D3YA 2JKYA 4O63O 2YMLA 3WGKA 4AZ0A 5FPKA 3AETB 1JSCA 2QS9A 1EDEA 3I0ZA 4TTAA 4Y9TA 3WZLA 4WN9A 3ACCA 3KE9A 4PZPA 5J2UB 3HBFA 3WYCA 1W5AA 1P7CA 2AI3A 3IUYA 3OPVA 5LQKA 1S5PA 3COPA 1HOTA 2A00A 2ATVA 4OSPA 3W8FA 4CEJA 1R1DA 3RVJA 3TLZA 1H1TA 5FOQA 5ARCA 3CLUC 3DHEA 1URPA 3K0CC 5DGXA 3L7AA 4JASB 5ILGA 1ZNYA 2NOAA 1VPEA 4GD3Q 5KYUB 3PQEA 4UNSA 1ZNXA 4IDEA 4YMVA 5F1YA 4KO3S 1PNQA 2IPMA 3TI9A 4GZ5A 4ON9A 3AEQB 3L0SA 3CF2A 3BH0A 1F2DA 1F8XA 4DEXA 5L3QB 1D2RA 1NVKA 1JBQA 3WB2A 4TLDA 4A6XA 3HXOA 2JDID 3WKBA 5BN3B 1RAAA 1SUWA 4WESA 2R6CA 3X44A 4YP1A 3MJ4A 4YMIA 3CNHA 4YQYA 4DCNA 3OQNA 1QQ6A 1XUOA 3DBLB 3PD1A 1KYVA 3GJZA 10MHA 1RI3A 2CMDA 4IMRA 2ZYAA 3CH5A 1HTTA 4RF4A 1ULZA 1U9JA 2VCEA 2WJGA 2WWGA 2QY6A 3HJBA 3P0FA 3DJFA 4PQYA 5EE0A 4AZTA 1E3DA 1DFIA