2YJ5A

Conformational changes in the catalytic domain of the cpx-atpase copb- b upon nucleotide binding
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
251
structure length
246
Chain Sequence
b'LSLYEKMLHKGMIIKNSNVYEKIKEIDTIIFNKTGTLTYGTPIVTQFIGDSLSLAYAASVEALSSHPIAKAIVKYAKEQGVKILEVKDFKEISGIGVRGKISDKIIEVKKAENNNDIAVYINGEPIASFNISDVPRPNLKDYLEKLKNEGLKIIILSGDKEDKVKELSKELNIQEYYSNLSPEDKVRIIEKLKQNGNKVLMIGDGVNDAAALALADVSVAMGNKNVADIILVSNDIGTLLGLIKNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COPPER-TRANSPORTING ATPASE
publication title Conformational Changes in the Catalytic Domain of the Cpx-ATPase Copb-B Upon Nucleotide Binding
rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 61
structure length 246
sequence length 251
chains with identical sequence B
ec nomenclature ec 3.6.1.36: Transferred entry: 7.2.2.19.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2yj5A01
3.40.1110.10 Alpha Beta 3-Layer(aba) Sandwich Calcium-transporting ATPase, cytoplasmic domain N Calcium-transporting ATPase, cytoplasmic domain N 2yj5A02
5A3RA 3MN1A 1Z4PX 2Q5EA 3WKAA 2YBDA 3FGOA 5AW9A 4J2TA 1U7PA 1WPGA 3ET4A 2VKQA 2RAVA 3M1YA 3ZVNA 4Y2QA 2ZBFA 3W5DA 2KMVA 2B8JA 3NANA 2B82A 2NO4A 3SF0A 3R9KA 4IG4A 5AW1A 2YFYA 1WR8A 1YNSA 4HGRA 5AI5A 2RB5A 3SLRA 1Z4JA 2A00A 2YY6A 5ALOA 3VAYA 5AVWA 1ZD3A 4CNQA 4YH1A 2OM6A 4OD0A 2HSZA 2YJ4A 3U26A 3QU9A 3DV9A 5AVSA 3QUBA 4XQ0A 2I7DA 3TLMA 2EAUA 4EEKA 2Q4RA 2JAOA 5IS2A 5AVTA 2QLTA 2OA0A 2C8LA 2HHLA 3GYGA 4UMFA 4UASA 4FFDA 2C88A 1RKQA 1NRWA 4KX3A 4UMDA 2IYEA 3BWVA 5AIBA 5AI0A 1Z4QA 4HGPA 3W5BA 3EWIA 3WK8A 3SKXA 2JGAA 3QU5A 3I76A 5AW3A 4CE6A 1TA0A 2IOHA 3CNHA 4XE5A 3WKBA 3L8HA 4NAVA 3B9RA 3QU7A 4XPZA 3KDPA 4NWIA 3ZI4A 4CF5A 3IJ5A 2MSNA 4GIBA 3EPRA 3AR5A 3FZQA 2R8XA 3IB6A 4OHFA 4RESA 3D6JA 3FM9A 4EX6A 4Y2RA 4DW8A 3QUQA 1Z4NA 2G1AA 3WK7A 3ZW7A 3N28A 2Q4TA 4Y2SA 1RPZA 5AESA 3QU4A 2HCFA 3A1CA 1YV9A 2OYCA 1LVHA 5ALRA 1VJ5A 3NIWA 2RARA 2BDUA 2ODAA 4CF4A 2ZBEA 3L1UA 1K1EA 3U13A 1L8OA 2ZBDA 1F5SA 5AHXA 1J8DA 4UAUA 5ALFA 5AKLA 4DWOA 4UM7A 1RQNA 3QLEA 2B30A 2FEAA 2MU1A 1Y8AA 1RMTA 2PQ0A 3WGVA 4Y2XA 1U02A 3A1EA 5ALUA 4HYTA 4IFTA 4Y2YA 2ZG6A 2GHTA 3MMZA 3N8GA 4H1WA 2ZXEA 3NASA 4NABA 2I54A 5AKIA 3L0BA 4E88A 5AM3A 3KC2A 3ZX5A 3N5KA 1Q3IA 5AVYA 4JB3A 1Q92A 1U7OA 4YIKA 3KBBA 4C4RA 3U19A 3W5AA 3F9RA 4KYTA 2G06A 2FPSA 3WKEA 2W11A 4XOUA 4BX3A 4EELA 2AGVA 2HOQA 2C4NA 2W43A 2FPWA 2WHEA 3I28A 1L7NA 3WK4A 4PNHA 3PGLA 3AR4A 1Z4OA 3E8MA 2BY4A 3ZVMA 1Z4KA 2A29A 1ZRNA 2FI1A 3QUCA 5ALQA 4Y2VA 4FYPA 2HF2A 3W5CA 3L8GA 3KZXA 3M9LA 1Z5UA 2G08A 1T5SA 1T9ZA 3RFUA 4EX7A 2P27A 1QYIA 4BKMA 2WF9A 3ZX4A 2D2VA 3FPBA 2G07A 4ZEWA 4BX0A 3ZWDA 3WK9A 3OCYA 1CQZA 5AKKA 3IRUA 1ZS9A 5AKHA 5T41A 2C8KA 5E0OA 1U7QA 4I9FA 4G63A 1RKUA 1RLOA 4EZEA 4UAVA 2ZOSA 4UW9A 4UM5A 4UU1A 3RF6A 1MO8A 2JARA 4UATA 3E84A 5AI4A 5ALPA 1J97A 4UMVA 5A3QA 3B8EA 3U7EB 5AI6A 4Y2PA 5AM1A 5AM5A 4YGYA 1YJ5A 2EATA 3L8EA 4MWOA 2R8EA 5AVRA 3OCWA 3PCTA 4B6JA 2YMPA 5ALMA 4FE3A 3KD3A 4YCMA 2HF7A 3KOOA 3U7FB 2JAWA 4AS3A 5AW0A 3NALA 4Y2JA 4KNWA 4Y2TA 5ALEA 3HLTA 4ZEVA 4G9BA 3FVVA 3P96A 3L8FA 4KN8A 3QU2A 4I9GA 1XVIA 5AW8A 2HEGA 1Z4LA 5ALIA 4C4TA 2R8ZA 3N1UA 1TE2A 3L0YA 1WVIA 3NRJA 3WKDA 1IWOA 4NFLA 3L0CA 3MC1A 1XPJA 5IT0A 1QQ6A 4J03A 2IOFK 2GMWA 1MO7A 5AM2A 2B0CA 3ONNA 1Z4IA 3ZTWA 3AR9A 1S2OA 1O08A 2CFSA 2DQSA 1U2SA 1ZJJA 5JJBA 1N8NA 5AVQA 3B9BA 2HX1A 1SU4A 3ZWKA 2KMXA 3OCXA 4BEVA 2I55A 3PDWA 3SMVA 1L6RA 1SVJA 3L1VA 5ALSA 3J7TA 4OCZA 3WKCA 3HYCA 5AW7A 1NF2A 4KX5A 1KYTA 3ESRA 5IT4A 1RDFA 2G80A 3QXGA 3BA6A 1ZRMA 1RRCA 2CN1A 1EK1A 3ZVLA 1AQ6A 3UMCA 1T5TA 2RBKA 2X4DA 2G0AA 5ALYA 3S6JA 2ARFA 3AR3A 5ALNA 1LTQA 3AR7A 4RETA 1RKVA 1XP5A 5ALGA 1RQLA 3ZU6A 1CR6A 5AICA 4EENA 2NO5A 5AKGA 2YJ6A 2YJ5A 2P9JA 5AVVA 4QJBA 5AVXA 2WM8A 1VJRA 1VFPA 3QNMA 5AW5A 3E58A 3AR2A 3U7GA 1SWVA 2YMMA 3QX7A 2AMYA 5AK4A 5AK3A 2EARA 2FUCA 1RLMA 1QQ7A 2BDEA 3SKYA 1ZOLA 3UMBA 4BEWA 2P69A 3QYPA 2O9JA 3L7YA 4L57A 1Z5GA 2B1RA 4YIHA 2IA5A 5ALXA 3N07A 1X42A 1JUDA 5AKYA 5ALDA 4NV0A 3A3YA 5AVUA 2WF7A 5AKZA 1YMQA 2PR7A 4BNDB 4DCCA 1WZCA 2AUTA 2R8YA 5AKXA 2IOFA 1ZD2P 1MH9A 2AH5A 3EF0A 5AK5A 2I33A 5AVZA 1RMQA 2YMQA 3MPOA 2O2XA 1YDFA 2W4MA 5ALZA 3WK5A 2YJ3A 4HGQA 4HGOA 4UU0A 2G09A 2I34A 1L8LA 1RLTA 5AKJA 5ALKA 2NYVA 3R09A 2B1QA 2C9MA 4KNVA 2HI0A 3WGUA 3R4CA 3SD7A 2FPXA 2WF6A 1PW5A 3CZ4A 1RC8A 4Y3UA 1U2TA 4Y2UA 4ZEXA 3UMGA 5FP0A 1N9KA 3OPXA 2FUEA 4L6AA 3AR6A 3SHQA 1Z4MA 2GHQA 2OBBA 5AW6A 3E81A 3PGVA 2ZBGA 4HGNA 1RMYA 2PKEA 1YS9A 3ESQA 3L5KA 2CFTA 1QH9A 5ALLA 3OCUA 4GXTA 5ALHA 4MUMA 1FEZA 2QYHA 2JAUA 3I1YA 5ALJA 3U7HB 3K1ZA 4AS2A 4F71A 4YCLA 3OCZA 2WF8A 5ALTA 3QUTA 2P11A 4DFDA 1SWWA 2FDRA 5ALWA 4C4SA 1TJ4A 2HO4A 4YCNA 1O03A 3NAMA 3GWIA 3NUQA 5AM0A 4BYGA 3DDHA 2CFRA 4JDPA 3ZTYA 3I6BA 1Q91A 4CF3A 1EK2A 3DAOA 5AW4A 4BX2A 1QQ5A 2FPRA 2I6XA 4O8CA 5ALVA 3FPSA 1TJ3A 4BBJA 4UARA 5AKEA 3WK6A 5AI9A 5AIAA 2WFAA 3ZUPA 1TJ5A 3UM9A 5AW2A 5A3SA 1L7OA 1L7MA 2HDOA 3A1DA 4HAIA 4UMEA 3DNPA 4OFZA 4BNDA 1L7PA 2WF5A 3ET5A 3QGMA 1ZD4A 1NNLA 4L6CA 5AM4A 3OCVA 3OTQA 1Z88A 2B8EA 2FPUA 2GO7A 5AK6A 4AP9A 3AR8A 3ED5A 2YN4A 4F72A 1ZD5A 3EF1A 5AI8A 2YMLA 4QQFA 2GFHA 1S8OA
chains in the Genus database with same CATH superfamily
4ZHSA 1ID8A 4HYQA 1NF3A 3R4VA 3VVLA 2OZLA 4Q18A 1GY8A 4YRQA 3SF8A 3M9XA 1JFRA 3H13A 3TNLA 1NPTO 1HMPA 1W88B 2QM3A 2OO5C 2WHPA 2VKQA 4ODIA 4XYEA 1IMOA 1CC1S 3MTEA 4GH5A 2MMGA 1SUPA 3LT1A 4PZUA 4DR1B 1OX5A 3FOWA 4Y2QA 1H4QA 3QMVA 5FNZA 3KLBA 4KPUB 2G83A 4I4NA 1SULA 1OI7A 2QVCA 1MX5A 1P7CA 2VK1A 1BHQ1 4WNYA 1WR8A 4OI0A 1R18A 1NMZA 1YNSA 3OO1A 3SYRA 5CX4A 3KOYA 2N46A 4HEQA 2PKXA 3WDLA 1QVVA 1O7JA 2CZCA 1ZKMA 3IODA 3RRZA 2W2LD 2Q3FA 4Q7EA 4X1IB 2WQ6A 3ZDZB 1QC5B 3NTLA 2DU8A 4S1OA 5AK0A 1CIVA 1PS9A 3LM8A 3ENZA 1ELOA 1VL2A 2NU7B 4UUNA 1NNI1 5H68A 3SZOA 1OB2A 3R40A 1OV4A 2ZI3A 3NONA 2LKCA 3EC7A 3DV9A 3FBGA 1I32A 1J5XA 1EXNA 3DMTC 3IMEA 1EWVA 1AD2A 1RWWA 4W63A 2PL9A 4UM8B 1BMFA 1P0CA 1Q7TA 3HY4A 5C8YA 4YCSA 5IS2A 1CP2A 5U9CA 3BL5A 3V1YA 1NZFA 3HJBA 3VH1A 1YH3A 3QHQA 5GOZA 1OBVA 2JBAB 3B1WA 3GIDA 2BEVB 4K05A 5IXJA 1T2DA 4DB2A 4URZR 4PZYA 1EUDA 1VCIA 1LV8A 3IEXA 5L8VA 1HLPA 1QIMA 4GMFA 3KZVA 1NBMA 3WBJA 4ZT2A 1JDZA 1L4EA 4R7ZA 3SYTA 1PK8A 4BFVA 1UDXA 1W4ZA 3DPUA 2DXIA 4DRXB 3LF1A 2BEWA 2PJRA 4DYHA 3B70A 1DAEA 4GMXA 4EKGA 3OLVA 2WE8A 2FG7C 1L3IA 4IDAA 5HVNA 5CM2Z 2AMFA 2P41A 5PNTA 2HJVA 1RQXA 1NV8A 3VYUB 3MWFA 4OBBA 3B9RA 3DP9A 3QXSA 5I9IA 2VP2A 5LPNA 3W8EA 4D45A 4ABTA 2ZS7A 3WIEA 4OHPA 5KQSA 4XLTA 3JQ7B 3G7NA 3HP4A 3DMHA 4YJKA 3TVTA 5K6AC 1K4MA 1USVA 1ODKA 1DQYA 3IP5A 1THZA 2VC2B 2FVYA 1DO2A 2AVNA 5JYEA 5KTPA 1N5MA 4JI4B 5DE3A 1RC0A 3QUQA 1OKKD 5C8VA 2UYOA 1DAOA 4JSYA 2Q4TA 4R8MA 2ZS9A 3UPUA 5LJLA 3UT5B 4MVCA 3K1AA 4OH1A 1I30A 5DM1A 4A7PA 1XVUA 3CVVA 4P92A 4A6XA 2W6CX 1MRZA 4KI7A 1W0CA 4E5DA 5JAUA 4ZODA 1L5MA 3HJGA 1VJ5A 1PQPA 3ADPA 3AUJB 4HNAB 1LSSA 3BXEA 3Q15C 3VI3B 3HH8A 4MJLA 1AKVA 1TIPA 1WZEA 5U1PA 4BFWA 4R8VA 3HXLA 4EYQA 1AHHA 1UMDA 3GJZA 3CUEF 1TEXA 2CCGA 3QMMA 3DLTA 2Z6UA 1H65A 2ZBDA 4N7RA 5TC4A 4GZLA 4LHWA 3PF8A 4JLSA 3ZHRA 2GZ1A 1D1TA 2Y1EA 1FYWA 4IXWA 4ISBA 5HF8A 3I5YA 1OASA 3V6LA 1E9BA 4MPPA 1UCFA 4Y2XA 3Q8KA 4CETA 4NCAA 5EJ2A 4HP8A 4WKGA 1B4DA 2V7UA 5B3JA 4DA4A 1YR9A 2RG1A 4HYTA 1NW7A 2E4WA 5AMXA 2FETA 3ZLUA 4OKIA 3REQA 1LPBB 3G5AA 3MMZA 3HUDA 1BJTA 2ZRMA 5IAOA 5CH3A 4BJ5A 4L9RA 1FMCA 4MW1A 3QG5A 2XBMA 5IDYA 2VHZA 1EE1A 4WINA 3T52A 2WD7B 5DWVA 4LYJA 4RA6A 1YZVA 4QATA 3N5KA 2FWNA 4A23A 2XVAA 1Z33A 1UJMA 2M1XA 3SC3A 4LHSA 4LNUB 4WBSA 3OLQA 3M4JA 4WUVA 2IX3A 1BYUA 3CX8A 4UAGA 1F51E 2I4LA 3Q87B 2HT6A 3HJAA 1VCNA 4ZWNA 1EFLA 2FQYA 3GT4A 1M1ZA 1NRJB 3H8WA 3PNPA 4K6MA 4TSKA 2CYAA 3C5CA 3ESYA 3T12A 2PNJA 1U3FA 2XQFA 4IGEA 3V4ZA 3HHEA 1JEQA 2YCBA 1IG3A 2C4VA 2R87A 3JQ9C 1CZUA 2Y1XA 4N9WA 3NOXA 4FB4A 3HCFA 2XE6A 1YQWA 3DOJA 4OUDA 1U7DA 3FNQA 3ABZA 3M3PA 1Z17A 3GLSA 4BX8A 4AY4A 1OLUA 4MOWA 2IDMA 2P68A 3LXMA 3GRFA 4QPDA 4Q7QA 1QHIA 1E0AA 1X9GA 4H0NA 3I73A 3LK7A 1MJHA 5H5JA 2OXFA 3RIGA 2ZRCA 2WA2A 1V5IA 1IEXA 3RV4A 1B8UA 4L22A 4RPCA 3ZDDA 1K7FB 4M1WA 3VC3A 1GGNA 4MVJE 4BLQA 2CD7A 2GF0A 2G07A 4L4UA 5JZBA 5K20A 1K6IA 2P1RA 1I7PA 4D4HA 2X5JO 4MQLA 1F38A 2J48A 3A3PA 3OCYA 3PNVA 2G88A 2QMZA 2WY2D 3EAGA 4YP9A 2PX2A 1HG1A 2PSFA 4KDRA 1W581 2Y0EA 4G63A 5JNUA 4OYHA 4KO1S 1WUYA 1ZUWA 2ILTA 4UW9A 3E3MA 4YT5A 3WRXA 2Z4TA 4C0AC 2Z56A 1G5FA 2WZDA 1P9WA 4R2XA 1FTYA 4YP6A 5U4QA 3RI3A 1Z5NA 2CXQA 3SXUB 3VMMA 1DO8A 1GYPA 5CB0A 4IDOA 2GZ3A 3GYBA 1BWSA 1B7GO 4IJUA 4QUKA 4UATA 4Z0PA 5HGJA 1IEWA 2X0DA 4A5OA 2NUAB 2IIQA 4F45A 1RS0A 1XDBA 5JD5A 2A58A 2FPPB 2ZWMA 4DM7A 5DGIA 2NSYA 2CHUA 4NL4H 2OXTA 1R8JA 1V1MB 4OI1A 4LWZA 1AXGA 1MIOB 1RM3A 1RYHA 5E8RA 2XMRA 4YXWD 4ID3A 4FE3A 4NH0A 4E30A 3DOHA 4KQGA 1YFKA 2X76A 1GUAA 4JI0B 1Q2UA 1A8QA 1XTUA 3SBEA 2Q41A 3L6DA 1VLZA 1OBCA 3GI1A 1L1RA 3CNOA 1OMOA 4JP3A 4ZOBA 3T7KA 3GLFE 3W2IA 5AD1A 3EUWA 1GCOA 5EP2A 2FPKA 4KPGA 2WNSA 3ZDCA 1UADA 3TW4A 1R8YA 1CZKA 5KTOA 5HTOA 2JI7A 3IE2A 3ZGNA 4F7DA 2GYUA 4GR9A 2YS6A 2OV1A 1N36B 1Q0QA 1KIFA 5AOCA 2SCUA 5IDVA 5AW8A 4BEBA 4KWCA 4JVSB 1E7WA 3KIPA 3AVVA 2ZSDA 3NKVA 3P9RA 4EG0A 3CW2A 1MTZA 3IDZA 2BI7A 1WXEA 2C5AA 4AKGA 1LS1A 1TT5A 1NVAA 3EWSA 4CGYA 1ORRA 3B6ZA 3H4TA 4W5OA 3K8OE 4TTQA 1G4AE 1Z5OA 1AKMA 4I5DA 3S2FA 4ZOAA 3CCBA 3UCXA 1T0PA 5K0EA 2ACEA 1WP4A 4J7XA 1O08A 2D2EA 1LK0A 2FMHA 2D7CA 1XC7A 2DQSA 2K6GA 2NW6A 2OT3B 3EPPA 3H1GA 1DIHA 1L2TA 1PS0A 4IF6A 1T8TA 4PC3A 5L45A 4WBNA 1JQKA 1E66A 4C29A 3RU2A 5ICFA 3CJRA 1XTSA 2CMHA 1DFGA 2VUHB 3KV3O 3LGAA 4KKVA 2P3QA 3GT0A 4R3UC 1NYTA 3GD7A 1N2SA 1XMXA 1HLFA 1TJPB 2W37A 3PC4A 4D0SA 2Z98A 2ZYWX 2EX1A 4MGZR 5CRIA 4EM6A 4Z9XA 3HA7A 1W76A 4NU5A 3AT1A 4TMVA 3DE4X 3L1VA 5A5VA 3AP3A 3QP9A 4KP7A 1E96A 1P7VA 2P9HA 2ZW9A 3PRKE 5AH0A 3UJAA 1XP8A 1BE8A 3S8YA 5A9SA 4O4JA 3F6BX 3P27A 1I94B 1XO1A 3BA6A 3L3BA 3ORQA 2BONA 1HOXA 1SIOA 3FSGD 3NHJA 1II0A 5TF0A 3QLJA 5B64A 2JAQA 3HB7A 2HWYA 3WSTA 1AQ6A 2BTQA 4YP7A 4PBRA 1XDGA 3C8DA 3VMFA 1XTIA 5IULC 2TS1A 4KXUA 1U04A 1UXKA 3MJEA 2PEZA 3ELYA 3PC8A 4ZZ0A 4XYBA 5IC4A 1MZPA 2ZJ5A 5ALGA 4C0HA 1Y7LA 1L8QA 4Z3KA 4KOEC 4L7VA 2GT1A 5AICA 1QG2A 1R6AA 2J3IA 3LQ4A 4E4YA 2FWMX 3RABA 4U7TB 4CG3A 1I2MA 2ZYAA 2IEZA 3ZUGA 3GLUA 2WM8A 2FSFA 4B81A 1ZBDA 3ICPA 4FFVA 4NBLA 1QBGA 2R1VA 3WISA 1SIBE 1K5HA 3AR2A 3QIAA 3EVNA 3O3OB 5H81A 4KVZA 3AEUB 2AMYA 2J0UA 1Z6YA 4UE2A 5JU6A 4F1KA 1Y48E 1S2GA 3RSHA 1G21A 3TAHA 4CBVA 3PEYA 1GWNA 1ZOLA 4DADA 4F4DA 3VKVA 3Q2KA 3P52A 4LMAA 3V6MA 4X7MA 2DTXA 1QUFA 2Q5LA 2RCYA 5JD3A 4B7XA 4BZPA 5LZ9A 2ZZNA 2GR9A 2PUVA 3N07A 3ZWXA 2DT5A 4GE0A 3WGJA 3A26A 4A15A 3QBJA 4E32A 3WFJA 5E9QA 3M4XA 4EY7A 5EJ8A 1KYIA 2PMBA 1GZ7A 2IYTA 3F78A 4R9SA 2JGDB 4YAGA 3RS8A 3WAGA 2AH5A 5TPWB 3O9ZA 4HDMB 1SUAA 3B3GA 3BAFA 2P8JA 5EMJA 2YJ3A 4HGQA 4HGOA 4QX6A 1SELA 2X5NA 1KEKA 1OSNA 3FPGA 1QWSA 5BRNA 1XMSA 1YS6A 4V24A 2PU5A 4KV9A 2D4AA 3S44A 1MOSA 4NCXA 1MX3A 1FSZA 4J90A 4TV9F 3PXUA 1BVYF 2OPHA 3K8QA 3ESCA 2HI0A 1YFLA 4L3WA 2IXBA 3U81A 3H84A 4ND4A 2VJMB 4OHVA 3VR5A 1PYDA 3VNVA 4YQEA 4WV3A 3PNLA 1J7KA 1NSYA 2QG6A 4J6EA 2QEQA 3MGAA 1T3TA 4KQKA 1K27A 3KKZA 3SDZA 3K0CC 4TXMA 2ATXA 1BJRE 1V5FA 2PSEA 2GKSA 3KEFA 5JRJA 3GXBA 4NC9A 1UBRS 4IOLA 4NEHB 2J5XA 4ZEXA 2O0HA 4O4LA 1OWMA 5IJXA 3VVCA 3NHSA 1O3YA 2QL9A 5IBPA 3JYQA 1PKXA 1QDLB 1RPJA 5H4GA 3HC7A 3PGVA 4ZCPA 2V9PA 3GJXC 1V6SA 2FHPA 3CF0A 4CV3A 1CRPA 3UMSA 1RQ7A 3L46A 4EZBA 1PJTA 2PKEA 1GPYA 3RSFA 1A71A 3ZNOA 1SCDA 1E2GA 4LY9A 1JKIA 2ZATA 3H05A 3QSGA 5D5HA 1I4LD 4ZT6A 2JLQA 4BB0A 1VTKA 2GARA 1EQAA 2Q1WA 3OT4A 3PA8A 3QKRA 2ZYGA 1ESDA 3I32A 3QLVA 3WDKA 2WA1A 3ZJYA 3W8DA 2O7QA 4MUMA 5KVCA 1T36A 3KTDA 2EYQA 4RWZA 4LPSA 3HBMA 4RF3A 1I4DD 2Q2WA 3KSAC 4I66A 4EO7A 5ERGB 4OREX 4KFSA 5BYJA 1JDSA 3Q98A 1W59A 4MWGA 2JA2A 4N8EA 1IIRA 2Q5QA 2P11A 3NOQA 4OGWA 2FW9A 3UAWA 1HLDA 3O8OA 3TPFA 3WWYA 3IIEA 2D5BA 4KZPA 3WRYC 2GN1A 3ADBA 1LPOA 1O03A 9GPBA 1BX0A 3A37A 1DCMA 3BXGA 1YI0A 5LQJA 2QMUA 2BCEA 3NUQA 4YGXB 2QAGA 5AM0A 2ZR9A 4FDUA 2R6JA 5IJ0A 3RVSA 2LIVA 1M66A 1VB5A 3SICE 1GSHA 2HNAA 4RZXA 4X54A 2AK3A 5FAXA 2B8NA 3FPCA 1EAYA 2YC2C 4QIHA 4HYYA 4B9AA 2AOUA 4GKAA 5CITA 3BTSA 4QHSA 3CSSA 1CQIB 1PUJA 2HMWA 2I6XA 2C5FA 3HSKA 3PV0A 3M49A 4XWTA 4EYKA 2X40A 3KZMA 4Q0MA 2VI5A 5JS1A 5ICSA 4WEQA 1EG7A 2XNSA 6REQA 4WOJA 2B0JA 1TQ8A 2IPNA 3FFXA 3B5JA 1U2GC 5BQXA 5E3HA 1H6BA 2YR0A 1GNPA 2B4RO 4Y6OA 1R16A 2FSVA 4HRYA 3UM9A 4DR3B 3PD7A 4DR4B 3N76A 5CBPA 3TMAA 1DJPA 4LVCA 1L7OA 1QYCA 3A1DA 2JFHA 3LQRA 4DIKA 2PVPA 5TMDA 1Y9AA 3NOVA 3ETDA 3V8BA 4BNDA 3GJ5A 2GZRA 4QBGB 2DEUA 3QGMA 4JC4A 3GUVA 1TQDA 1THMA 2DFKB 1MOQA 3AR8A 3ED5A 2PZJA 4R40A 3IB3A 4YR9A 4KQ2A 4G1EB 2V9CA 1FQKA 4GPTA 1TEVA 2ZJ2A 4RL4A 3HVJA 3PFHA 1DXHA 1TYCA 4K2AA 4JZYA 4AIRA 1D2AA 1L5SA 1TAQA 1J1ZA 1PHRA 3GNTA 3DT6A 3QMWA 4PC2A 3TOXA 4F5ZA 1JEYB 1G2IA 1JJBA 2OPBA 1CJBA 2VSNA 5LNK6 2EFCB 3INYA 1EGQA 1Z6ZA 3B2NA 3C3JA 1OXMA 3NG1A 1X2BA 4L9AA 4NKRA 2F1HA 3EHEA 3B6MA 2XIQA 1Z2AA 3ETEA 4UBKA 3WDSA 5D87A 4DMRA 2J3QA 3LUAA 3IPAA 4E21A 4IG4A 1P9LA 3IQGX 1B23P 4ZQEA 2IYVA 5HFNA 2VZEA 4JQZA 1X1TA 2IWHA 4IHJA 5AI5A 5FTJA 2FEOA 3OKPA 3CUSA 5FUXA 1AUVA 2BUCA 1BRMA 1Z4JA 3FZYA 4M0CA 4ROSA 4UU7A 1FDRA 1OU4A 1HC7A 3ZW9A 1ISIA 1WD7A 2RD2A 4XRRA 2GB4A 1HORA 5BVHB 4CMKA 3RTDA 4RMHA 4ZTBA 2FCAA 2AFIE 1QR6A 3QU9A 3VVMA 5AP9A 2J7PD 4YRRA 2FPLA 3ZQUA 1FP7A 1TIBA 3ZPXA 3D2AA 4I1OA 4BV3A 1PG5A 4DA0A 4JLWA 5ILOA 3D8SA 2ORYA 5BV0A 4CUJA 3HGMA 3VU9B 4EYOA 5KNBA 3TW8B 2C2BA 4TZ6A 4UMFA 4UDOA 3U7RA 4FX5A 1ZM3A 1E3TA 3HFRA 3PSAA 2HY7A 4LBYA 4R1OA 3VHLB 4DIDA 1I7LA 3RVNA 5L3QB 3IEVA 2IYEA 1HETA 1P0MA 5K01A 1B6TA 1LUAA 3O4IA 4NYMQ 4TWJA 5K99A 13PKA 1YDHA 3CBGA 3Q8WA 2O8FB 2VYQA 2IS2A 5HDQA 3GBPA 1XA0A 4KGZA 3CLTC 3TQQA 3RHFA 1F7VA 3UJNA 3OF2A 3RYIB 1A1VA 1G20A 2ZUUA 5CYPA 1WZUA 4HH1A 2LTAA 2VJYA 1G63A 4Y9DA 1NJGA 3OY7A 4TT3D 5C2JB 3MD0A 4OKNA 4KQ6A 2O8NA 3H0CA 5FL7A 1QR2A 3F7NA 2ZI7A 2X8LA 3RYHB 1J39A 5FWAA 1R9JA 3IAM6 4GDMA 3TIGA 5B1YA 2Y71A 3CNQS 1GQYA 2XADA 3WGYA 1OU0A 4NYJR 3TM4A 2NT4A 4MRAA 2BM0A 3JAKA 1O95A 3OX2A 1SBNE 2HNBA 5EIXA 4TM8A 1DGQA 2A88A 1SD2A 3UO8B 2ZEJA 2NXEA 3RTGA 1U0BB 2FZGA 3PQ8A 1AF4A 1QWOA 4QFCA 3ZXSA 1V1RA 4EVSA 2UVPB 3DBOB 3QU4A 5DMHA 5JANA 5DYGA 4YV2A 1QFJA 3HO1A 2PGAA 2F00A 3I37X 4JHXA 3WQSB 4U6NA 2I3DA 3D0RA 4U7HA 3WQRA 2CXXA 4Z51A 1N4AA 4LRUA 3UOAB 3P0IA 4C6RA 2H54A 1GFWA 1X1CA 3KLPX 4OGGA 1WU7A 5ED0A 4BMYA 3A3NA 2IXGA 2KQUA 3QEMB 4MHSA 4PQYA 4KHZA 5AHXA 4JWTA 1L8XA 1FFXB 3PNKA 4IYRA 5IK2A 4BWYA 5AKLA 1IHYA 5B3JC 1P6UA 2Q6VA 3IUJA 1DARA 2Z6VA 3LKZA 3N2GA 5HKOA 1HNZB 2FJUA 2B30A 3VZQA 2FW1A 2MU1A 3KVYA 4QGGA 5FLKA 2FPGA 4XSVA 5IEJA 2GPBA 1RVDA 3ZWCA 1P77A 2AKAB 3H7IA 1QG6A 2QP4A 3M7IA 5ALUA 4BP1A 2I8AA 4CKYA 1XPOA 2O19A 1LQUA 2V65A 3AL2A 1W44A 1JF8A 3N75A 1IHPA 4JIGA 2H1WA 1RXCA 2YINC 1GLNA 1D2GA 1PZEA 2XBLA 4C03A 3GR6A 3SHFA 4DUZB 4GSLA 2BISA 4F3TA 1O8BA 2R1TA 5I48A 2WSSD 4OJYA 1TU3A 1A0OA 4JLMA 3RODA 3ZJUA 1M8PA 4MDFA 3HJFA 4OX9B 2VF8A 2QY6A 1OTYA 3WBBA 1E7QA 1Q92A 3RT7A 4CTKA 4M8NE 1U0OC 2CMKA 1DJQA 4G89A 1XJCA 1TD9A 5IJWA 1H94A 1JHXA 3O75A 1ABEA 2OCPA 3BTOA 3ZJ5A 4ZYWA 4FDTA 2QDXA 1U31A 4Q24A 4X1OA 5CVUA 5I7HA 4HVLA 2VN8A 2P3LA 2PGNA 1OYVA 4D0RA 1EFDN 2WT9A 2YHSA 1WW2A 1TUBA 5TE9A 3U3JA 3ZU4A 3PKIA 1C3LA 3GJ3A 2VHVA 5AVOA 4K88A 1WMEA 1OI3A 2DETA 4EHJA 2HMAA 3DUFA 1NBOA 2ZRKA 4QFMA 1AKQA 4WK6A 4FI3F 4ZOCA 2LCQA 3W5HA 1J2RA 2RKBA 5B3LA 1XNHA 3H99A 2B98A 4DNXA 2PS9A 3L8GA 4M9CA 4NJMA 1UBKS 3NEYA 4E1BA 1T5OA 2L42A 3ND8A 3Q12A 4FFMA 4C4OA 4CFZA 5JQGB 1Q0UA 2HH9A 1QH1A 4MV3A 3IBGA 5KJEA 4LJYA 2FMKA 3LY7A 5JAHA 1FRNA 4V0LA 1PN3A 3ROZA 1HNXB 1HMYA 1TZCA 3WRXC 4LSGA 1E1CA 1EINA 4ZOLA 4NZ9A 2HLPA 3W3AH 4B3CA 3RFXA 5F7XA 3E9ZA 1S8AA 3O8LA 4HC4A 3TLCA 2FPIB 4EFKA 4IGFA 2ZJ6A 3C7AA 1TVMA 2QTVA 3DPSA 3G17A 4W5HA 4G5GA 2O50A 3V00A 4WCVA 3K1TA 5AHRA 2GXUA 7ABPA 3PUWA 3RVPA 3Q7EA 4YV0A 3RC1A 3LW7A 3B1VA 1FBTA 4RSMA 4YRZA 4CCWA 2O7RA 3L6OO 3AW9A 3P19A 4PZCA 3TD9A 2YVAA 1YZNA 3KOWA 1JAZA 2CNKA 5EHIA 3WHKA 2PG3A 1CUEA 2XNCA 1V8DA 2JHAA 2IYNA 3F5FA 3E61A 1XR3A 2SKCA 4S1PA 2C8VA 2EBUA 1W0KD 2FZLA 2V7XA 4NU0A 1FX0A 3WJAA 3EVGA 1KSJA 3OJEA 2YNMD 2DQYA 1IN8A 3VC2A 2WG1A 5B3KA 5TLSA 1SKAA 2HF9A 2CV2A 5D5QA 4EF6A 2J6CA 5KTTA 1YCHA 3IAAA 5EC8A 3C3BA 3IQDB 3HDGA 4ERXA 2QP9X 4RAOA 2JEYA 2ZLBA 4Q4AA 1K06A 3L6CA 4FXOA 4KQFA 4PICA 4OKSA 2HLDD 4JR2A 3K9FC 1ZSYA 1K8RA 3CNLA 5EP4A 4INZA 4LWQA 1OJ7A 2ZUCA 5D84A 2DYKA 3FTPA 1NDHA 4Q6BA 5BUCA 4M1KA 1OLSA 1T2FA 2CFIA 3RT9A 3NV7A 3TB4A 1PJLA 4CXMA 1O6BA 3KQTA 4F12A 1HH4A 1JLHA 1E3DA 3C6KA 1TU4A 3D6FA 2GPWA 5JHGB 4DV5B 3PHLA 3FF4A 4XGRA 4X7RA 3RC3A 2NSJA 1IBMB 3TTYA 1O97C 1FTNA 1QV7A 4FT4A 5HJEA 1XTZA 3D1JA 5FWYB 4TSFA 4X60A 1JG6A 1HDYA 2OR3A 5FBZA 3W1WA 4BZWA 3PFCA 2WWRA 2I1WA 3E2IA 1U99A 2CFSA 3NCHA 1LGYA 2HJ9A 2WG2A 3IBYA 4IJ5A 2FX5A 1YDEA 2OP1A 4BVAA 3DEHA 1L4YA 3F6RA 3KJHA 4EJ6A 1NN1A 1KQ3A 1AGPA 4C7OA 1QZTA 4QICA 1JT2A 2VDOB 1SC3A 4J3NA 3T1QA 1OFUX 3BHJA 2GTPA 3PGKA 3LVRE 3SMVA 3T1OA 3HRIA 4PHHA 3RUFA 3T15A 3EBLA 3VYRB 1KYTA 1M2FA 4AN0A 1JG3A 2QL6A 3EXFA 1DCTA 4AL4A 1WP9A 1VG0B 4II3A 4QEKA 5TS2A 4RZ2A 3ZE9A 1A4IA 1KRHA 1O89A 1VGVA 2J09A 2XRYA 3LYHA 4I46A 3JQGB 4MEBA 1R4NA 4N9QA 4QWWA 3PC8C 3WGLA 5CDFE 1ZUIA 5LMNB 4ARCA 2BH2A 2WFZA 4BNXA 4ZEOA 4N40A 2D2FA 2LVBA 3UMCA 1U0SY 3FUTA 4S05A 2PWYA 4OYLA 3PIDA 1J24A 1WMAA 3S6JA 4LDRA 2E37A 4U8GA 3CCFA 2QVLA 1Q14A 3L0DA 1UC8A 3TRIA 2R8PA 3PNOA 2QUIA 1W96A 1ZFNA 3F8SA 2V4MA 1SXPA 4EI8A 2E4UA 4P4NA 3NRCA 1ZLXA 3FNHA 3ELUA 1TQ4A 1VA5A 2YJGA 4X1KA 3ELBA 3K35A 4IKEA 4BC0A 5IYZF 1U9IA 3BT7A 1MXFA 1MENA 1BNCA 3UV3A 5GP1A 1DAKA 5KSWB 2VPQA 4WASA 3R0QA 4JLUA 1SC6A 1P4HA 4JNKA 5EEHA 4MMZB 3MUEA 1I3MA 1SHZA 1ZESA 2EZ8A 3Q0IA 4N01A 4O1HA 4RH3A 4UEOA 4DANA 4CKWB 2KE5A 5AK4A 4IIHA 3P4UA 1AB6A 1T29A 1NW6A 2OORA 5TSDA 4ENRA 5JS7A 4DV3B 1RWQA 1WKCA 2XMPA 3S2IA 4G0MA 3TOVA 5I8PA 1QH8A 3LCCA 1KAHA 1IJBA 1QIIA 4A82A 1KNQA 2IA5A 5E7QA 1PGNA 3C1AA 1JUDA 3I34X 2C59A 3I9JA 4FHDA 4NQRA 1IOVA 1YOBA 1CT9A 4WT7A 3TGWA 2N47A 3CB4A 4B0OA 5DK6A 2ZU6A 3GJSA 3T1YB 3A2NA 1CVLA 1F17A 1GGVA 5ES4B 1ENOA 3L1KA 1I5OA 3EOBI 1I7NA 5HJ2A 4QKQA 3EEIA 2MSKA 5EKDA 3BMXA 3LCVB 1AO3A 2FFJA 3G5UA 3R7BA 3MS4A 1LEHA 2Z2YA 4Q05A 2QTBA 1DNPA 3FB1A 1YVEI 1XTJA 4PZEA 2WM2A 2B4YA 4JJ4A 3PUHA 3KKPA 4CUKA 4D9HA 2UYCA 1N8SA 1TVEA 2MMCA 4C2TA 3L6EA 4JJEA 5ENVA 3EYAA 3WB2A 4YYEA 1SJ9A 2I99A 1PZFA 4DNPA 3FMFA 4GBMA 1Y1QA 3K9GA 3MWDA 3NNDA 3Q7RA 4K1XA 3BOSA 4E4TA 5E3IA 1N2CA 1OT5A 2E6KA 4UD6A 1RM4A 3BWYA 3BXHA 3RGGA 4MARA 1FP1D 3NDBB 1J1UA 4OB6A 3OLZA 1RW4A 2CNWD 3K1JA 1XRRA 4D3ZA 1U2TA 1YDMA 2C92A 3X1KA 4YRPA 1OFUA 2R25B 2VEOA 5BRAA 3G0OA 4HCJA 1DPFA 2VQFB 1XCJA 1YJXA 3GP5A 4NMXB 3OICA 5BSTA 4QO7A 3W2FA 1PNOA 4LOLA 4AQYB 2NZXA 2D1SA 3KZKA 3IAXA 3Q3HA 1OROA 2FPMA 3NHKA 2C2OA 3K0AB 3OQIA 4HGNA 2JEZA 3MWJA 3VZCA 3WI7A 5JPCA 4TV8B 4MYCA 1IY2A 3I0ZA 4P5PA 1J0BA 1II9A 3A70A 1P19A 3NMUF 2OFOA 4FEAA 4K6HA 4YRSA 5ALLA 2MWMA 1B6SA 3GRPA 5A05A 4R8RA 4ER0A 2K5UA 1L4FA 2Z2IA 3U7IA 3FY4A 3IOYA 1AKEA 1CQXA 1H2XA 3AI2A 4PC1A 3N2KA 4QASA 4QFBA 3V4RA 3ZXUB 1FPQA 2D06A 1PAUA 1M8GA 2OO7A 4X44A 3OIYA 3SZMA 1E7RA 4F71A 2AN4A 2IYPA 4F4HA 3IDAA 3KB2A 4GPIB 4Z9BA 2WF8A 4S3MA 3H5NA 4K1LA 1H85A 3PUXA 1P80A 3PDIB 4FCWA 5K3AA 2Q27A 1CX9B 3QUTA 2QAGC 2ONJA 3Q3VA 2H31A 3ASYA 1BXGA 2FFBA 3AG6A 3B82A 4GR5A 4J1NA 2HDNB 5H0IA 5JWHA 1U3VA 2H92A 3THRA 1LF5A 2H5IA 2YICA 3UICA 5HGXA 2FGKA 2GEBA 3A6JA 3UK1A 4KOAA 2NN3C 1N2GA 2COUA 2RHBA 1UBCA 2YDYA 2YS7A 2XNJA 3FYCA 4NRDA 1U9CA 1C0IA 3NS7A 3WLTA 1U0JA 4D6PA 2EP5A 4K0RA 1ZH6A 5LP1A 1NJ2A 4AZ0A 2P6OA 2QX7A 3RVLA 4LF9B 3DAOA 1Z34A 2H4JA 5AW4A 2X1HA 1D5WA 2JJ2D 4LYAA 2XUFA 5IN5A 3FJ1A 4BX2A 3BYZA 2NPIA 3WWDA 5CLFA 4WNAA 2FSVC 2WTEA 1R0XA 3AUXA 1IBCA 1U2PA 2X9GA 1EGVB 2YWRA 2OHJA 2IVZA 3G2LA 5TF4A 1NVEA 1U5BA 4UXJA 1Z6GA 2YWGA 3U31A 3BMQA 4FQ7A 3X0DA 1FYVA 2A67A 1RYMA 4RHUA 2LZ0A 2OBLA 1KSGA 4QBFA 4DWWA 3OH8A 2QRPA 4Z7OB 3VR4D 3HK2A 2O3TA 5A4MS 2HPAA 2BVNA 2VO1A 2V0GA 4IMRA 4G0YA 1SIWA 4QDXA 1V3TA 3AJ8A 1YE5A 4GZ3A 4X1YA 4C22A 5K0JA 1TCUA 3JZMA 4KQHA 2ADFA 1LSUA 3F6SA 4YQYA 5FV4A 4CHTA 3I9V1 1W48A 4EY6A 4NJEB 4DTIA 4YRNA 2J0QA 3IBCA 5BMVF 3BJMA 5LP6C 3OZIA 1NQTA 4QXMA 4QGAA 4MV0A 3AKEA 4R98A 4CKEA 4IRMA 3FTQA 4H35A 2WIGA 2C9YA 2A57A 4L07A 4QDJA 4DG9A 2RGCA 4UNIA 4DZTA 2Z3VA 5JBIA 2ACWA 3CKMA 1Y3FE 3QF4B 5CX1A 5MDHA 1FMFA 1Y4SA 2ID4A 2SKDA 3QV1A 4M1MA 2BUBA 2F8TA 4UTZA 4MX8A 2I0FA 3VNAA 1KETA 2AJCA 2WJ3A 3ENWA 2V74B 3R3YA 2D0DA 2ZYSA 3OOHA 4UDXX 3GFRA 5DEIA 1XZNA 3QFRA 4HUQB 2AFHE 2F43A 4TKVB 4UC0A 5JSYA 3FHJA 121PA 3C5HA 3ONFA 4OBXA 3W2EA 3EGDA 3H04A 4YC7A 4LZAA 1GPLA 4RIFA 2ZWPA 3NWPA 2DFLA 1TYZA 2RB5A 1J9GA 1WX1A 3OIWA 4HUJA 3KAKA 4LHXA 4P8RA 1A2BA 2OKGA 2JIZA 1ZD3A 4DSNA 5I9NA 1XQWA 2QIOA 3E1GA 3ZCVA 3SEQA 3CPSA 3U26A 2UXDB 3UT0A 2KW5A 4DQLA 5BUZA 1U2EA 3HVIA 1Y9JA 4RXMA 2P91A 2AYYA 3D4PA 4PANA 5EZYB 2VH5R 4KMRA 3TUZC 3W06A 1Y1KE 4FMCB 4PPFA 1L5QA 4PYQA 2FQXA 1VMEA 3GFTA 5KYVA 4WMLA 3DCJA 1XNRB 1FTQA 1NMSA 3HVRA 2IYFA 5DNDA 4DE5A 4KV7A 1MJNA 2PUTA 4ZCQA 1P5JA 2HUPA 4BU0A 1JDPA 5E7MA 5A6SB 4I36A 3AY7A 3GEGA 3FPJA 3SSMA 2JIMA 4JLKA 1UM9A 2O20A 1DUSA 2YVLA 4CMEA 1XJ5A 2BIFA 3EDYA 3KEMA 3P9XA 2CNBA 3AZOA 4N3BA 2JCGA 2NUPA 1QGAA 2W48A 2F1RA 4MGIR 4D8XA 3RAFC 1QHXA 1RT9A 4ZU6X 1WUJS 1BN6A 4FGSA 2IFTA 1P8AA 2XUGA 4X3CA 5ADVA 3D31A 2VK2A 3G8YA 2EYUA 4HQLA 3KJQA 2C54A 4PAOA 1CWUA 1G64A 3OEWA 4Q21A 4EKEA 1DAGA 4BVEA 2OBXA 3HXQA 4LRYA 4GPAA 1EDEA 3OZVA 3OJCA 3NBKA 1YKFA 3IJ5A 2I1VB 3BMCB 4GIBA 1O95C 2TMDA 3KKNA 1U80A 3PHBE 5M34A 3L8ZA 3X1YA 1D5CA 4JYZA 4W8OA 1GPH1 3HKBA 3ICCA 4MRMB 4Y0AA 2WB2A 4YS6A 1A8SA 1XMVA 4Q82A 2DPHA 4O4HB 1Z5WA 3MMSA 3I9MA 1ICIA 1MB0A 4LQ4A 5TS3A 1XPRA 1GAXA 4KPFC 1A88A 4CQJA 9MHTA 3L8CA 7YASA 1ZM2A 4QNNA 2GRJA 3PE3A 3U4CA 2J3EA 4FIZA 1I3KA 2VWQA 5HKLA 2WEKA 2ZU0C 3LLUA 4NPCA 1LVHA 2QLLA 4P4SA 2OYCA 1ENZA 4EG1A 1DJMA 3D3NA 3DV0B 4ZALA 3FNIA 5DLYA 4IZOA 2RAPA 3PQEA 3WHLA 1H1DA 2FEKA 1Y5LA 2H4FA 5FOQA 4OI4A 3A4NA 4Q4JB 3JQ8A 2E18A 2HK6A 2GAJA 3U4IA 3LT5A 4QSHA 2P8SA 3EVDA 5BMOA 4RBNA 5HJ5A 2EW1A 2FP3A 3OE4A 3ONVA 2A9RA 2QQ0A 4DZZA 3T3HA 4NVRA 1V35A 1BWPA 1Y8AA 2PQ0A 2XB8A 2HW8A 4ZKDA 1Z0UA 1P39A 3DZIA 4ESEA 3ZHBA 5JISA 5K0SA 5BP7A 4YJ3B 2ATIA 1ZOSA 2ZG6A 1WCXA 1WTAA 3OT1A 4YAOA 4P0TA 2QTZA 1ZMTA 1NFFA 5DOZA 1GAWA 4RS3A 4KH0A 2BM8A 4DC9A 3KJXA 1E9AA 4KU4A 4MHOA 2I67A 5F35A 1Q3IA 2XVYA 3K20A 4L8VA 2H00A 4U7FA 2QBYA 3E5RA 3T9FA 2V1XA 3U19A 2AOVA 1K8QA 4BLSA 4TV9A 2BBWA 2W6JD 3PB3A 1TQHA 4BNJA 4KL8S 4U5XA 4I3HA 1LQ2A 1SKUA 3CUTA 3AVXA 3L4BA 4BO5A 3PYMA 3WSVA 2O05A 1QIEA 2Y93A 3A6LA 3RUAA 3HBLA 5REQB 1A96A 2BKUA 3NBUA 1RXIA 4Q48A 1D6MA 2CWDA 1SOWA 1NW9B 1J9EA 2QY9A 3C7KA 3H4IA 3PT5A 3U7QA 5FTLA 3C8HA 4PFQA 4DA6A 2J3DA 3QUCA 4QNRA 2CCKA 3F6CA 3K4HA 4RHTA 1C3EA 3I5UA 2ICAA 3N2ZB 4KQ9A 4WA8A 1XCLA 3KVNA 3GCZA 1JE1A 2NQ2C 3HA3A 3KSZO 2I4NA 3RFUA 3TTUA 5DN6D 4QZVA 2VYVD 3PYLA 4L08A 1KZHA 3UVEA 1QYIA 3T4XA 4XTRA 4EJFA 2CHQA 2D2VA 3DVRX 2CW5A 2HA0A 2VDWB 3FPBA 4W8GA 3FR7A 3U2QA 3VR6A 4A8JA 4FMDF 1FQJA 4IDGA 1T3ZA 2QSYA 2XUDA 4U3JB 4CCAA 5JQGF 5CJPA 3UGKA 2RK6A 3DZFA 3SEAA 4MYTA 3UAXA 1ZEMA 1U3WA 2CUZA 3S99A 4MUIA 4YJHA 1EP1B 4M0UA 3E22A 3EHDA 2A7XA 1T5BA 1U8TA 4E09A 2YY5A 1N2JA 2ZIXA 4TRRA 3HYLA 5FOXA 3VPCA 3ZDEA 1BQEA 2JJMA 3SNKA 4BECA 2PH5A 2P2SA 2XNDA 4HDNA 3RS9A 1JU9A 1OTXA 2A9FA 1QVWA 4G2TA 5K3FA 5KQGA 5BVGB 1MW8X 4NNJA 1GEEA 1H5NA 3P2YA 4BO2A 1UJNA 2XLBA 3TGPA 1INLA 2PUBA 1QGUB 1L4NA 5AVRA 1BWQA 1X7HA 3DWEX 1FNNA 1H0KA 2VXOA 4H7FA 4B6JA 4D4KA 5CTJA 2JHGA 2AYZA 1V43A 2HRBA 3JQAD 4L8GA 2WWHA 4H4CA 3HCWA 5EWLB 5K0GA 4QOJA 1X7XA 2W2QA 1Y3BE 4HB0A 1QDEA 2ZQ5A 4R05A 3VDNB 5HIKA 1RJGA 1AHIA 1P6XA 4OLAA 2BMVA 1KQFA 4PZ0A 2XBUA 4ZQFA 1DRVA 3IEIA 2C0QA 3M6VA 4E2FA 4OUKX 4K8RB 1T8UA 3C70A 1XZGA 5HE9A 3ML1A 2JGLA 1YZLA 1EZZA 3EC2A 3ND6A 3G0GA 3DEIA 3ITEA 1ZU4A 3SYKA 3KPWA 1QTNA 2JB9A 2QD5A 4OHKA 5ECWA 1FTWA 4GO1A 1KGSA 1XVIA 2C3PA 2NNLD 3EEQA 4I9GA 4L8LA 4WFIA 4C4TA 2BMEA 3ICVA 1VBMA 4ZARA 4DR6B 4ACAA 4Q39A 1D09A 3PUKA 2HIHA 5D7BA 3HCDA 1ZW1A 3A6ZA 3BFKA 2WWYA 2R48A 4PNEA 3MWEB 4EHNA 5A9RA 4C30A 3WWZA 2VDNB 4WKPA 2D0PB 3S4YA 2I6SA 2RGGA 1OWOA 3RBXA 1JQDA 3PQ6A 1T0JB 1V3UA 5AM2A 1U11A 3DCNA 1RLJA 1XQVA 2GZ2A 2IYQA 3K0EA 3RK1A 3QWFA 5TMPA 1WZ2A 3IVXA 5BXQC 2WUVA 1R6UA 1U8EA 1M1YB 2ETXA 4R5MA 1KRWA 4P1ZA 4GOMD 1RWMA 2PMDA 1NZJA 1N8NA 1DJNA 1WL8A 3EVTA 4S1VA 5H3LA 3RG8A 3QE4A 1CU1A 1E0SA 5E6RA 4M1QA 1U0LA 5A1TA 4PYNA 3ZV4A 3RF7A 5BT9A 3KB6A 1P45A 2DP4E 3FUUA 1D1SA 1BYIA 3L4JA 1G1MA 5ADWA 3MFQA 1Q77A 4PG6A 4PS1A 3J7TA 2IHBA 4REQB 1UDBA 5HKKA 4MPJA 3BRWD 3CPJB 2DPGA 4ABYA 2DLCX 3G79A 4O02B 1NUTA 1QHHB 5T57A 2ZSHA 3L4SO 3T1VA 4TMKA 4BKOA 2VUSA 4RK1A 2C5LA 5TEWA 4BN0A 2FJ0A 1KI6A 1EIZA 2DQZA 2PT7A 4NSNA 1CDDA 2FPOA 1Q44A 2H57A 3UPDA 3AC0A 4BNNA 1QYWA 2Q3CA 4EL0A 4HG2A 3SQNA 1T5TA 3R7WB 1GA1A 4KUEA 4YBZA 2G0AA 1RZRD 1GGHA 2FN8A 1NJSA 4LRXA 2VFAA 3F2VA 2VAVA 2OHIA 2P5TB 2QMQA 4X1IA 4ZCTA 1U9IC 1T6NA 3K0HA 4KAJA 1X80B 5CPBA 3SS9X 2NU7A 4J4BA 4JI2B 1UEJA 2I2CA 4DMKA 4EENA 5DLEA 3NLLA 4BS9A 3KQHA 1A9SA 5A2QA 4DLNA 5JNTA 4MUBA 1G98A 3KTAB 1MIHA 2QUJA 1BD4A 2OOKA 1QAQA 4HB3A 1ZMBA 5CM8B 3WB0A 1CJSA 3D6TB 4GWGA 3NR2A 2OORC 3O84A 4OQFA 4MUXA 2HU7A 4BV2A 1QJCA 2XQVA 4B6EA 5IZCC 2D5CA 2VK8A 2ZRQA 2CNLA 4FGKA 4MQ5A 2BEVA 3LMKA 4TS3A 1MB9A 1PZNA 4D99A 1SVWA 1TKRA 4YUAA 4Y0VA 5D85A 2HMUA 1KVSA 2AL7A 1FFDA 2EARA 2FUCA 2FRDA 3B2QA 5BSKA 1W52X 4WEOA 1SKYB 3C85A 3GFGA 4EFLA 4Z6KA 1NG1A 2YIJA 3KVVA 4K9RA 3G5TA 2Y2UA 4L57A 4PPQA 3OZAA 2WAMA 3VSEA 1WW3A 2Q3EA 2D4HA 3AINA 4D9EA 5D1NA 5F51A 3MG9A 2IUTA 4NATA 4UNNA 5ALDA 3A3YA 3TLGB 2XYGA 3OM9A 3OPVA 2IPOA 4DQVA 1QX4A 2V7EA 1S2LA 4ZV4A 1MOPA 1X8LA 3CRQA 4H6XA 4LMBA 2ZDHA 5EA2A 4MWZA 3EVCA 4MRNA 2Z09A 4BRUA 1DBQA 1YL7A 2IHKA 2HTEA 3G49A 3OPYI 3P1JA 1GRQA 5D1HA 1XEAA 4IWYA 4WSOA 5AK5A 2AC4A 2XD4A 4PM4A 1ZI8A 5ALZA 1Z0DA 4BGUA 2I34A 3DBHB 3P9IA 1WA5A 2WZCA 1A9ZA 3O3CA 2ZI9A 4F60A 4V0ME 2Q4EA 3UT5A 3T5BA 1G55A 3NEPX 2OWDA 4NBKA 1KVQA 4MAFA 4BVBA 2Q4DA 2ZPAA 1UBNA 4MYHA 1IY0A 1U0NA 2PH1A 4HI0E 1ZKDA 3Q7TA 1DTSA 2IXEA 4YAFA 3G0IA 4IGKA 1E1MA 3IP6A 4HNAA 16PKA 4LXTA 5KWSA 4BJ3A 1NULA 2XA9A 1UQRA 2EIHA 2YW9A 4OL0A 1I2BA 5A5DA 1YGPA 1FQOA 4FCCA 1NXVA 4JI1B 5KYUB 2Y0PA 4NBTA 4NDAA 3BPSA 3GDFA 3GXOA 3ER9A 2QPTA 5AO9A 5IVPA 2G77B 2GYYA 4P34A 3U3KA 2X9LA 1HEYA 4C20A 4QRIA 1YB1A 4GI5A 1W5BA 5K51A 1TC2A 4LWOA 2IYRA 1UANA 2WIBA 3KT8A 2QN9A 4I5GA 5KVAA 1Q0SA 2X2PA 4N12A 1XN1A 1GTMA 3A1FA 3IOCA 1V5GA 3CKYA 1GR1A 1K0FA 4G9EA 1V41E 4DV0B 1QONA 3D64A 5TVGA 3D4OA 5A6VA 2D3TA 3QQ5A 1Z0ZA 4MVJP 3WXBA 4TV8F 5FAKA 1IXKA 3R0ZA 2WD7A 2Y6VA 4FEYA 2L69A 3KOMA 3CZMA 4QYIA 2HRQA 5UKDA 1JHPA 4KAAA 4ZGBA 3H5IA 1KDVA 1R0LA 4LNUA 5TR9A 3HXKA 5CLLA 1RD4A 4GI3A 2D1QA 4V1CB 1QHSA 3R5HA 5FYDA 5JAMA 1CUFA 4HB2A 1M1NB 1JHMA 3RD5A 4RPHA 5I4KA 3AUUA 2DY0A 8LDHA 3VC7A 3TPCA 4RD3A 1DEOA 2BTEA 3BUSA 2DE0X 3DCYA 2RAFA 2BGRA 1VCMA 4PRYA 4BTLA 2EDCA 4O59O 3DKVA 3VHXB 3VO9A 1H69A 2YXLA 3COVA 3FSJX 3UWKA 3QPVA 3ZTYA 4JDPA 4DJAA 3ROMA 2EWMA 5LQKA 4ZYUA 1ZL0A 2SBTA 3SBXA 1SRQA 4EA7A 2WHYA 5IVIA 1Y0BA 2H1SA 4Q16A 2HHJA 1P1CA 3WB1A 9LDTA 1QF9A 4E3ZA 2WYIA 2HN9A 3QZUA 4S1WA 1JMYA 3WJ7A 3AHJA 1Z0FA 2R79A 2BL4A 3SQXA 2H1LA 2V54A 3HSYA 4F92B 3V7FA 1BA2A 3DF9A 3IC5A 2R8RA 4XM0A 3DM5A 1PQWA 2GN8A 2IEDA 4MYUA 1WXDA 1WEHA 1O2DA 2IT1A 2V5VA 4TLEA 3RU9A 4RELA 1L7MA 1A2KC 2HGSA 1XRNA 4EBBA 4EJ0A 2FB9A 4RU1A 4HUTA 2C0PA 5SYMA 2EEZA 2HHCA 2WUDA 2WF5A 3AYZB 3K9HA 1M2WA 4I8IA 4KSCA 4RF5A 4EF5A 5EJ7A 3QBTA 5JZMA 5KJFA 1UAAA 1YZUA 5AK6A 5J59A 3OE7D 1N0WA 1VP3A 3SXUA 3K6SA 4EFDA 3OFND 3JWEA 1RQPA 1ZD5A 4M9SA 3FTEA 2FSIA 4WZAE 4OIMA 2ZRPA 4WLUA 3EZ7A 1IZYA 2ZI4A 3S70A 4JNCA 3W2HA 2YZ7A 1YBMA 2FPPA 4EB0A 1SKMA 3MNFA 2FG5A 2XTJA 2ZB3A 4MP3A 4QJ4A 1V1MA 4QQFA 5E9WA 3MF4A 1F9AA 2O7NA 4XB1A 2W2OA 4Z7JA 4KHPB 1VJTA 2C04A 1RSZA 5AW9A 3H17A 3AVTA 3QG1A 1Y81A 3HY6A 2X5OA 3DDZX 2Q2NA 2GGSA 3S7ZA 1VSVA 5DHFA 1NUPA 2B6HA 1KMHB 1ISHA 1JR3A 2PX3A 5SZHB 3EIHA 2WR8A 4DC0A 2HUNA 5ITSA 1QBKC 3RUHA 3U9SA 1LJ8A 3H1AA 1U1DA 4AP6A 4YT2A 5KIAA 3TO5A 2DFVA 3PVZA 1ZN7A 1UQUA 3TI7A 3UZUA 1QIJA 3GEPA 1ZOIA 3C3YA 4R7GA 3S81A 4CKCB 1HDRA 4X92A 1ISJA 2NG1A 3WICA 4ENTA 3RTEA 3S2GA 4J2HA 4E15A 3ZCTA 1TW3A 3ETJA 2PZFA 3DZKA 3O38A 4F4JA 4GE3A 1WUTA 3ABSB 4MQ4A 1KBOA 5CLIA 4ZJPA 2VKTA 2ZRBA 1IG0A 5IMBA 1OV6A 2PSJA 5EJEA 3UGJA 3NYQA 3LH5A 4V0NA 2EFGA 4X8MA 5F76A 4UE6A 1QRUA 4PXAA 3TZHA 4Z8YA 4YJGB 4D80A 3AETB 3N7UA 2JLXA 2DUWA 3DOFA 2CV0A 3OLYA 4CMEC 1PYGA 1VM6A 3LAWA 5P21A 1SXJA 1VFNA 1GPUA 4A91A 2ZS8A 4OX9Y 2A4MA 4MW6A 1DBPA 1Y37A 3CX3A 4N1AA 3CZ5A 3JATB 3NGLA 3KCNA 2ZJBA 1ZCFA 4GMKA 5TPZD 1PJBA 4CYMA 2Q0SA 2HXYA 4NECA 3B9PA 1BS2A 1AS2A 3AIIA 1NBME 1Q0TA 3I76A 1GPKA 2C7QA 2OV8A 4L0QA 3COJA 2IIBA 1BG6A 1I0IA 4HDCA 2VF5X 5C34B 2DGDA 1GNTA 1S3SA 1IZ0A 3AX6A 3I5AA 4GVPA 3STHA 2FWJA 1FFBA 3A05A 4WLFA 1ULSA 1MJ5A 4YAEA 2VLBA 2YRWA 4LDJA 1XQ1A 3PT9A 3E8XA 4G09A 2PA0A 4N3AA 1CR4A 3OZEA 4EA8A 3X3HA 1OILA 4XGIA 5DOVA 3G5MA 4H27A 1O9BA 1CK4A 3LWNA 3KBOA 3UJ6A 5HQJA 1YZQA 2FTKE 2HD4A 5FI1B 3WG9A 2BGJA 3C8ZA 5CVDA 5IYZA 2WUWE 1RFGE 3L7DA 4JH0A 1IZ8A 2PLAA 2R4QA 4O4HF 4Z0NA 4BFYA 1FIUA 1ZNZA 2VPXA 3MJDA 1EXDA 1W2WB 1GA4A 2W6PA 1XRQA 1UPXA 3E9NA 1PCXA 4IL5A 1CXZA 2WFMA 2GJKA 2IE8A 2GPYA 4H3SA 3LQ2A 2DUJA 2FR1A 5BPFA 3EEFA 2GA8A 3CO0S 4GECA 3O4GA 1BHSA 4S0XA 3IJRA 3QK7A 3UF0A 4C06A 4W5TA 4E6PA 5AJHA 4ADSG 2II6A 3WGKA 2COKA 4RLFA 2C5BA 2Q8NA 3GFVA 2AXQA 1N7HA 1NLFA 3DP7A 2MSDB 4EG4A 1T1GA 3MOGA 5MGNA 4Z99A 4TYWA 3Q7QA 2UXBB 1K88A 1GTZA 1L4LA 4WK0B 4X63A 4E3WA 1SA0B 1T13A 4EAQA 1RE1A 1RLUA 4QTZA 4ZOQI 1SEVA 2IDZA 3BAZA 2D0OB 1Q57A 2VYND 1H8EA 3CXRA 3U09A 1K2WA 3QVLA 2CBGA 5IC5A 4Z0TA 3MLAA 3ZQ4A 3AJ9A 3NDRA 4LYYA 1YE3A 4BMZA 2R9VA 4JSRA 4YJ3F 4YQZA 2NTYC 3KC2A 1ECCA 1TFRA 2G25A 3L4BC 2JGDA 2X13A 1QIGA 3AWDA 4JB3A 1ECBA 2J8ZA 3SEFA 3BBLA 3H8JA 2E49A 3B60A 4EW1A 4PRLA 5B6IA 2XQIA 3JR7A 3ZIAD 4CQMD 4HDMA 1E8NA 4HMOA 2V5AA 1L3BA 2HGZA 5E4JA 3QSYA 2G06A 3AL0C 1QIFA 1U2ZA 4HH3C 2ONKA 1U7WA 3TE7A 5EXEA 5K0LA 3X1XA 4EJSA 2QUKA 3DE0X 1OXBB 2JH8A 3OIDA 3RC7A 4DV2B 3HO8A 4ZQIA 1O5IA 2Q8QA 1I9CA 5BYBA 5T4EA 3RS7A 2GPJA 4GRIA 3HABA 3DWIA 1XPUA 2PAFA 2FW7A 4L76A 4C78A 4BKPA 2J9XB 3DBRB 3SVZA 4PIVA 2Y1WA 2Z9DA 2VJMA 4R9VA 5CNKA 3M5CA 1ZRNA 1CB7A 4CM1A 5JROA 5ALQA 4FYPA 3GLGB 4YY3B 4A8JC 2HQ1A 3R3VA 4AJLA 4LISA 3ROGA 3TTWA 1OXUA 4BDSA 3UJBA 2JGKA 4D3DA 2MSCB 4ZIRB 1Z62A 1KMCA 4PGFA 1J4AA 4L0MA 4A27A 1QO7A 3LX6A 3DONA 4JBXA 2C83A 3UK6A 2JLYA 2QTFA 4L7QA 2GD1O 2O0MA 4BX0A 2QU7A 3A7DA 4TTIA 4AICA 5JMTA 3O94A 4WCFB 4DGSA 1W85B 1LI7A 2YUTA 3LUPA 1JH9A 3AV3A 3ZZNA 4CM4B 4YMGA 2ZP1A 3OEHA 3ENNA 2GHRA 2DH5A 4RK0A 4WN3A 3U3XA 3P5SA 3RM3A 5BW6B 3GMSA 1RLOA 1MTOA 1HZJA 3F47A 4YDQA 5IDWA 3KAPA 3SP1A 3NIBA 3PXCX 4FMPA 5KS2A 4PQEA 2J3LA 2F17A 2CDBA 2HJSA 4Q6WA 1ZC4A 2AG6A 4WJZA 4MVXA 3CKLA 4BPBA 1E32A 1QOZA 3AF3A 4QUHA 2WIDA 3WJ1A 2IX9A 1NF8A 2OXCA 3EDMA 1U1EA 3CV3A 4JB0A 3H9UA 3T3EA 3WMEA 4QVIA 1UR5A 4Q5IA 5FXMA 3JD1A 2XHEA 3SKVA 1Y33E 1U3DA 3VTFA 1T4GA 1KIAA 1L4MA 3SR3A 2C4WA 4MITA 1CJVC 2OLKA 4QBHA 4ZCSA 2FW0A 2NPOA 2WAXA 1PR1A 1PUIA 5K05A 1MAHA 5IUKC 2EC5A 4DA7A 4WN9B 3A3OA 4WOPA 2OBYA 3PJFA 4KXYA 6CHYA 1C0KA 1SQ6A 2WUGA 4Y9SA 3QE9Y 1W94A 1SD1A 2R1UA 4Y2JA 4MEJA 4HNGA 2D1FA 3AWIA 4NCNA 4CF3A 1HGXA 3QE2A 1JB9A 1HLGA 2GFQA 2MYNA 1CQIA 1L3CA 1VE1A 5ILGA 3ICEA 3H6GA 3BA1A 1GGJA 5JFOA 4R54A 2GO1A 1CBUA 1DIGA 2FCRA 4GOKA 4BWVA 4CQMB 1WKBA 4B1FA 3FLAA 2PE5A 2HEGA 2V0NA 4XQCA 2I66A 1VI5A 1C80A 1QNLA 1RJEA 1TK2A 1FXWF 1TE2A 1N9GB 2CZQA 2X0FA 3SSAA 2DWUA 4FKMA 3SG0A 3BIFA 5KYYA 3A04A 4JC0A 1SHLA 3HZZA 4MUKA 4Q1DA 2ZCVA 3W90A 4C89A 1J8MF 4KYIB 2A4KA 1QHEA 4DIMA 4UVGA 1EDDA 2Q5FA 4D8VA 1SUFA 5BMVA 5HBRA 3CLUC 4DOMA 5ANRB 2SHKA 1BA3A 3T3DA 5K6RA 1ILEA 3NAQA 4UNRA 4FUTA 3I6MA 1MVLA 3IAFA 4CM9A 1SCNE 2ZAMA 4MTCA 1JKJA 4CMAA 3CH4B 5AVQA 2FMTA 4GVXA 2PANA 3DHEA 4UFPA 1I4OA 3K3PA 4P83A 3TJZA 1F2TB 3DH0A 3TTVA 1EVEA 1B15A 2B37A 3B1XA 3FJYA 2A3RA 3OCXA 3QVTA 3UGQA 4KQEA 4BEVA 2R8BA 2AT1A 3K6SB 3B53X 2I55A 1E3WB 1KEVA 3GGSA 4K9LA 3HB4X 1PJ3A 1JEYA 1NX9A 3HBAA 3HYCA 1NI3A 4QUAA 4KX5A 2AOWA 5EZSA 3U4DA 2Y1GA 2YV3A 1W0JD 4PSCA 1P4RA 3LIPA 4RTRA 1Q2XA 1G2QA 1DC4A 1CIPA 3LZ6A 2M1ZA 2P0YA 4IVNA 4V0OA 3ZWVA 2XQKA 2ZTHA 1CS4C 2PL5A 3QPWA 5BSFA 3LRTA 4LVUA 3FWNA 1CNMA 1PSZA 4P58A 2PRIA 3UKOA 1F8XA 1JB1A 1MO4A 4PYLA 1N6OA 2XYHA 2IY9A 2RBKA 1CJCA 1LZLA 3I12A 3JZIA 4M1ZA 3VKWA 2ZIZA 2A9OA 3BFXA 1S2NA 1D4FA 4LQCA 2CV1A 2NVOA 3IHTA 1T2CA 3L7LA 5HCUA 3VZPA 3WLPA 2C3OA 3BK2A 2ZR7A 1L5OA 1YL5A 3OIGA 4HO1X 1P1IA 3OFVA 3CRNA 4PIMA 4RX1A 4WHMA 3PXGA 3SM9A 2YJ6A 1NI5A 3PBKA 4G56A 4XYMA 4WX2B 3VX4A 1FA9A 2GHIA 2XW6A 1BE6A 3JVEA 3I3OA 4D8YA 1MEOA 2BRUA 1VL0A 1NV9A 2WZQA 1FXUA 2FRDC 5DT9A 4U02A 4YASA 5HG0A 4EKYA 2F4VB 4JJKA 3EC1A 2RHCA 4CI9A 1SWVA 2EBFX 5IG2A 3O93A 4LJ5A 1MB4A 4WD3A 3LUHA 1B8VA 4IOKA 1O1YA 3PHHA 1IWPB 1Y1RA 3CRZA 5EJGA 1SPBS 1CY4A 3VJMA 4C4XA 4Z4CA 1VI2A 4AJHA 1W5FA 4AX4A 1G21E 1M9NA 1P9OA 2O8FA 2Q28A 3CA8A 4G67A 1QHNA 1XXLA 2WNIA 4GX0A 4DCTA 1AY0A 4OU5A 3RYIA 4AF6A 2FSGA 2E4XA 3S1AB 2P2CA 2YXDA 1UMCA 1YR8A 1DAIA 3NEJA 2VTVA 4XD2A 3SZGA 1VMAA 4ZXPA 3HPQA 5E1DA 3GFOA 2VJLA 4GP7A 3VBEA 5BOVA 1UBJS 4F3CA 3EPKA 4DB4A 4E11A 2JLVA 1ONSA 2HTFA 4J0JA 5AOVA 5K4AA 4R8SA 2UV8A 3OE5A 3TUJC 4RTNA 3GA7A 3DMNA 1S9HA 2R4UA 3G8CA 3MINA 1R15A 3T8YA 3N2IA 1XCOA 2PMCA 3ETGA 1FCJA 4UUOA 3LPMA 5L6MB 2C8JA 2HZ7A 2YMQA 4LQLA 5EQTA 2VYCA 1BIFA 2W4MA 1XT6A 3QTLA 4YDRA 2G09A 1LBHA 3BVPA 4IS3A 2X0RA 5CVJA 2ZK7A 5FOSA 1J8FA 5JJLA 2WJHA 1BO6A 2UVPA 3TTXA 4MKHA 4MQUA 4S2UA 3UUFA 3PFGA 4DIUA 4ZJUA 4OEHA 3LV8A 3W9SA 1KFJB 1YUMA 1X3LA 4YQFA 2FV8A 2AX3A 1ZPDA 1SXHA 5IC6A 5JYDA 1JBEA 1MG5A 1PU2A 2XMQA 3ZZTA 4RGVA 3GLHB 1VYTA 3PQDA 5GAJA 1P7YA 4PVCA 4D8TA 1FRFS 4W8HA 1H66A 1BVUA 4H77A 2WJ6A 2FYTA 4Y2UA 3QEMA 5CEFA 1GNRA 2HJGA 4F5DA 1I1OA 4MKXA 1HBJA 4NBNA 2YWJA 3ZE7A 1TM3E 2I62A 4LE2A 5BQOA 5K0CA 4G3XA 4JI3B 3GP8A 4WKOA 2Q3LA 2ZBGA 4ZQHA 4WI1A 5BO5A 1I13A 2NZ8A 1S9DA 2W2PA 1JDBB 2Z8YM 1DZ3A 3CU5A 4AMGA 4UBMA 2H7CA 3EGIA 3M1IA 1I4EB 4L74A 2G76A 2VQDA 2MSLA 3AY0A 2RJ3A 4GOOD 4UM9D 1S89A 1XWFA 2YZMA 1SUIA 3VV3A 1WZIA 4CODB 2ZR8A 3AQIA 3NKLA 4BE4A 5A4FS 2XCRB 1A82A 1Q1BA 4DBZA 1GG2A 1Z5ZA 2R4TA 4QXAA 4AS2A 3OCZA 4GSKA 1Z0IA 2MJLA 1C4WA 1RU3A 2P2YA 1HFEL 3HR4A 3MBIA 4GFDA 1UF9A 3T9DA 4FI3C 1JSZA 1GXSB 3QJYA 3PEVA 4IINA 4PLCA 1R6XA 4QYTA 4OXQA 2IS6A 1CERA 3M5DA 2EGGA 2ZRNA 4KXMA 4YCNA 3UJ8A 1PL8A 4TKUB 1WD5A 2GD2A 3TSYA 2KHZA 1JR4A 2O3UA 1IPHA 4RZ3A 2OOSA 3T7SA 3NVAA 2WB4A 1GG8A 3JWHA 5I3CA 2A6PA 3JSXA 3WNDA 2GRAA 1CUDA 3GB9A 5IEBA 1Q7GA 3WDMA 2O3QA 2I8LA 1OXSC 1FP4B 1BD3A 4P22A 2FW8A 4PGGA 3W2TA 4XVCA 5JSUA 1FFYA 3TL3A 2WVAA 2P62A 5F2OA 4F38A 3OESA 1AMUA 2WFLB 1Z8NA 3P2OA 4IBOA 1EFTA 1NVXQ 1YWGO 2GPSA 2VDKB 2YWDA 4KE9A 4LHEA 4MVJD 3D8BA 4F2GA 5JQGA 3B48A 1GZ4A 1P33A 2Y9PB 2AG1A 3JW8A 5JG7A 3L9WA 4AS1A 3I04M 4N7BA 1IN5A 4M9ZA 1XKTA 4FFLA 2J32A 3WHIA 3B78A 4BV9A 3X2EA 4MIOA 2A7QA 4MZXA 4QQRA 2FPIA 1L5LA 4YONB 3D1VA 4HN9A 4GZ6A 3K2QA 3PTLA 1H0RA 1EDBA 4LKOA 3ANTA 3FDZB 4L6CA 5CXQA 5I7RA 3D7NA 4QXQA 3SXJA 2GO7A 1PJSA 3LBAA 3NVDA 4FNMA 4JT9A 4OQNA 3VBCA 3WB9A 1BDJA 4HPXB 3E9CA 2R85A 2WV9A 1J70A 3BF7A 3FPKA 3AM3A 3NHYA 4U7GA 1AK9A 1HDOA 1VL8A 2FUG1 4G01B 1NBIA 3HYTA 1ECJA 1AGYA 5LYJB 2Q46A 1QMPA 3DAYA 3W1EA 2PIAA 1M2EA 1J42A 5HRCA 5LLDA 2O8BA 4XA8A 2C2HA 4FPXA 4YREA 3W5SA 3FYUB 1UOOA 2FUKA 4WRRA 2LRHA 4OJTA 4B8YA 4RWEA 5ABPA 1COWA 4G8JA 1WM1A 3DVSX 1QCCA 3KQKA 3FNFA 3ET4A 1NI4B 2VP0A 4MVWA 4XKJA 5HW0A 3LL4A 4M8KA 2WHXA 4BRWA 1SOAA 3RUIA 4D3FA 1R0BA 1Y34E 1KKUA 2QXUA 4M0KA 3GBVA 2CY0A 1L9XA 2QYSA 3T9BA 3FMVA 1CR2A 4QU0A 5D3MB 5LU8A 2VJCA 4UM9B 1Z63A 3R6WA 4LW8A 1R7RA 2VTEA 3EGXB 1D6SA 3TR0A 3G9UA 1RWNA 4YDSA 1J2UA 1BFKA 1E2JA 3FKSA 5JBNA 5KNCD 1U4OA 2PMFA 2WKQA 5M29A 4JXXA 1W36B 1CUWA 5ERYA 3V48A 3K5PA 1LBEA 5ALOA 4JR1A 5JY6A 4H1HA 3WNCA 2I76A 3N05A 4HDKB 4BLPA 1ONPA 5K3OA 1U9YA 2HSZA 5JARA 1G6Q1 4FSHA 3F74A 4QG3A 2V7QA 3V8PA 1BHJA 5INTA 3H3JA 3V8MA 3QUBA 3GEBA 4YB8A 2EL7A 3DOCA 2FF5A 3I42A 3WWEA 3K4PA 5JSZA 3I53A 1VPVA 3IH5A 2IHVA 2YZKA 4IHKA 4AWBA 6Q21A 2X3UA 5LQAA 3TQIA 4B6PA 3UHPA 1VBNA 2JLWA 1Q0HA 4OXXA 2JFXA 3GCWA 2VJKA 4EGFA 1IULA 3MGBA 5JPDA 1G2OA 4QWMA 2NXJA 1KK0A 1M8KA 3P97A 2O23A 3DTVD 1QYRA 2GEKA 3Q88A 3QPUA 4JKOA 3EZXA 5FPSA 3SWWA 4F2PA 3MK31 1NJ8A 2MOKA 2RGDA 4F4UA 4KFCA 4OQMA 3WK8A 4E51A 2YV4A 4ARAA 2B25A 3WGOA 4QQNA 4U39A 1YRQA 4YK7A 2VJAA 2NLOA 5ERXA 3VZSA 2CCJA 1JH8A 3M5WA 1NURA 5DMXA 2DR0A 1DKPA 5KEIA 1LPSA 3ILYA 4I1VA 2C3MA 1G20E 2O2DA 4NNPA 4LQDA 5TJHA 2EKZA 5A7FA 4IG9A 1L5ZA 1RM0A 3T7AA 3G85A 1PWYE 3VR3A 1UXHA 2IHUA 1TMYA 1VYUA 5DGCA 4D79A 3IIJA 2V6BA 3R8CA 3VOAA 1EM8B 3QY9A 4G5SA 3AR5A 2YYAA 1LJLA 3R3WA 4KRYA 4QO8A 3CWCA 1JWBB 3DZHA 3JQGA 1DKUA 1W4RA 2X5XA 1JKMA 1T15A 3BHMA 4HBGA 4G37A 3TKAA 3TQOA 3JYPA 4UZEA 4YLEA 5HOEA 3FM9A 6PFKA 4E2XA 1PR4A 1DQRA 1RHKA 4MCJA 5AJUA 5DTRA 2JCBA 4C0BA 5J4KA 1F2DA 3KQNA 4Z4IA 4P84A 1XNJA 3JZFA 3N28A 4WK2B 2KS6A 3TLJA 5FPKA 3EJWA 3LUDA 1X13A 4CIWA 4HQOA 1L5VA 5MHTA 3GRKA 3AYXB 3LNTA 4U00A 4RJ2A 4PS0A 4OGKA 5KWIA 4O2BB 1XEFA 2AN3A 4QPNA 3QM1A 4RLHA 2XAUA 2RC5A 5GM1A 3EULA 3EG5A 3URMA 3VO2A 3GW8A 1G8FA 2RGWA 3PLRA 1ZR4A 2GETA 4KXXA 5HX7A 2ODAA 1E1KA 4CF4A 3KJFA 5C80A 4RMGA 1E8MA 1RWVA 2ZSFA 5HM6A 3D7SA 3QMPA 3I72A 1C30B 5H83A 2DFTA 3ITDA 4OA8A 1L8OA 2YX1A 3R6LA 4CKWA 2J0SA 3E5MA 1ZJYA 3AHIA 1NQVA 3GF4A 3KSDO 4LZZA 3NM4A 3CE9A 4WERA 1IONA 1GUFA 5KHAA 4LRWA 5HQTA 1NSFA 2ZIUB 4AZ3B 2FEWB 3CZQA 1I9GA 1NR5A 2QDKA 2C58A 4UVIA 3ILSA 3CRW1 1AV6A 4OFWA 4ER6A 4EUSA 5JEDA 4RTQA 3JAWA 3OSZA 3Q5EA 2J41A 2HYIC 1ZGJA 3LCUA 3LFTA 4F3RA 5FFNA 3UJ3X 4EI2A 5BSRA 1MH1A 1DXYA 5I7EA 1XRMA 2X7JA 4NU8X 4PSDA 4R1LA 2ZUDA 4XIYA 1YI8A 1T0HB 1UKBA 1UOPA 1Y7PA 4L72A 7REQB 1VGQA 5JCJD 3DTVB 4KBFA 5IHPA 3KBBA 4O63O 1ULTA 4ER5A 1J00A 3MJTA 5DO9A 2CZGA 3MHTA 5GJBA 2B4AA 2H0AA 1AMOA 4AWXA 4EUKA 5LD2C 4BX3A 3Q7SA 3WNVA 1DO0A 5IJAA 1ZIXA 1B76A 2AGVA 4JOSA 4MV9A 4JASB 3ULKA 1SBQA 4R8LA 4JT4A 4QQ8A 2MR5A 4GXRA 5E1BA 5THXA 1BN7A 2BFFA 3I4CA 1KO8A 3X43A 4US1R 3E53A 3B36A 3ACBA 3JSAA 1KOFA 1TTTA 2YZ2A 1Y5MA 4KUHA 2CL0X 1P5FA 1FW6A 4Y2VA 2IZ1A 2ECKA 1T4CB 2RGEA 4Y6QA 3BXFA 5FBWB 3PNBA 3U4HA 4JLAA 1AJEA 4DSUA 3O03A 3KCQA 1V39A 1T5IA 1YULA 3ZV3A 4AF7A 1AVTA 1CUGA 3EXG1 4JV5B 3ZX4A 1Y1SA 4BQRA 2GK4A 2FZEA 4LE1A 5FD8A 3ZQJA 1H5UA 2BDTA 2K7ZA 4Z1MA 4X0EA 1LBSA 5D86A 3K0AA 5C81A 3I9KA 4GG1A 4QVKA 1O58A 1N5OX 2F8MA 2RSLA 4TV8A 4RQTA 2X3YA 5LMCA 3U5ZB 4LV5B 4OGFA 1AZTA 3AF2A 4UEQA 3MS7A 2Q1YA 2O06A 3D4LA 3R77A 1UFOA 2C9BA 4UU1A 3SQDA 4CL8A 1X9HA 1RWXA 2EP8A 4QPPA 2IYXA 5AJZA 2FRXA 4TZTA 3GLKA 4L95C 1WUKS 3AP2A 1GZDA 3FUCA 3K4QA 2AF3C 4JENA 1F8GA 1Q83A 2GAIA 2GZMA 1LX6A 2BFAA 2REQB 3UV7A 5KHLB 2IZ0A 3PDIA 2IW3A 2X2FA 4UDYX 3OCWA 4CPDA 4Y1GA 3TEMA 2XVZA 3S2SA 1EUCB 3HLYA 3GVCA 4GP9A 3U3MA 3ETLA 4LGMA 2HXSA 2G4CA 1J6UA 2HMYB 1E1QD 2GAOA 2QZ9A 4ITVA 2FWAA 1ST2A 1WXFA 4O3MA 4ZYZA 3CMMA 3VFDA 5TXGA 3GPCA 4U7WA 2BBTA 4M0PA 1BCRA 4HFJA 3UXEA 1I5EA 3G2NA 3MGCA 4TL9A 4U7PB 5LSAA 3RE1A 2XUZA 4G1UC 1KI3A 3H9QA 1NLMA 2OVBA 1T0BA 1GFIA 4Z53A 2OV2A 3LOUA 1I4WA 2O59A 1OD6A 3U40A 4X91A 5EJIA 3R9WA 1T8YA 4UREA 1KYZA 2Z0MA 2FGJA 4ENSA 3GDOA 4XFKA 1NW3A 3KQPA 3TMYA 4JJZA 4WWHA 4K2HA 2OBMA 2QE6A 4FGZA 3G2HA 3WADA 3IP1A 2CLIB 2K87A 1YONA 4I8DA 3BXOA 1LWNA 4B47A 5H9WA 1U1IA 5ICEA 3NTVA 2F1JA 4XVQA 3GLIA 2EIXA 3BX1A 1L9KA 3ZTWA 1Y3CE 2BH9A 4X8OA 3LT4A 3PVSA 1NA5A 5FEUA 2GXQA 5IKXA 4NJEA 4PFJA 2BFPA 1ZJZA 3UXMA 1O8CA 2J3HA 4EPXA 5C4IA 2PBZA 3AERB 3GGOA 3HWWA 1GPWB 3CH6A 2Q9CA 1EXMA 3HWX1 3NBQA 4WZZA 4CT4B 1T9GS 3KEQA 3U44B 1HI9A 4M8LA 2GCGA 1PF7E 1T9GR 3GEEA 3QF4A 4YMWA 5E4YA 2KLHA 5A4AA 1VCOA 1SVMA 3ZDYB 4TQ9A 1G38A 2HO5A 2A5JA 3A2MA 2NO7A 4A8TA 3N8DA 1TB4A 1PDWA 2R00A 2W6QA 2EHJA 2JIRA 5ARBA 1GG9A 4EG6A 3O74A 1GA6A 3CURA 2CYBA 3Q85A 3ZDFA 5ITVA 3S5UA 4GM4A 1XQ6A 1JALA 3VR0A 2KSQA 4BCBA 4HUQA 1PL0A 4JYBA 1D0VA 2G0TA 4TKVA 1WMDA 2F48A 3AM4A 1X70A 5BSVA 2OKCA 1W1IA 3QTBA 5BWOA 5EHXA 5EINA 4HFNA 3JQ6A 2A9QA 1JJAA 3PUVA 3PJDA 1KJYA 2PWBA 3I8SA 2AMVA 5JSKA 1VJCA 5ULLA 3VNBA 1UP7A 3AFOA 5EE9A 1XP5A 2BRUC 4TQAA 2GN0A 4YWJA 2XOXA 4FHZA 4S1TA 2XJ9A 3PFBA 2PZGA 1CR6A 1M8FA 3G2IA 3NTRA 2NO5A 3EXG2 3OUZA 2N1MA 2OWEA 1DAHA 1Q22A 2XVXA 3M1AA 2NX2A 3DZGA 1VJRA 1K8XB 2GLUA 1HEUA 4TWAA 2OAGA 2OYRA 2CDCA 1NBHA 3FOAA 2RH4A 2Z1NA 3RSGA 3LHFA 1U5AA 4XAQA 2IKSA 5CDHA 2ADOA 2X7XA 4LDPA 3S29A 4AJJA 4B7CA 4KWHA 1EK0A 1CJKC 1N32B 3C4QA 2ZWVA 3IPCA 1P5RA 4RACA 1MAUA 9ABPA 1CRZA 2GOYA 1D7AA 3D54D 5C3UA 3WNZA 4ZTZB 3KTFA 4LFBB 2F9MA 3A6KA 3RVKA 4PWYA 5CCBA 3VSCA 1V8ZA 1DG3A 1QNFA 3CX4A 1ZHHA 1JX6A 4PSAA 3C3WA 3B3FA 5ELLA 5HTKA 2IV2X 2RIPA 1YS4A 2JC3A 5D01A 1L5KA 3HACA 1Y80A 2CK3D 4M55A 4R4JA 3PFKA 2M6SA 3UAOA 2WF7A 5IAGA 5CYGA 3H5RA 3PR3A 4N0MA 5K3DA 2C03A 3ANMA 4ZJZA 5HKAA 2NXCA 2OVFA 4LK3A 5IWAB 5DTEA 3N3AC 3BMCA 1QB8A 4HEHA 3RC9A 2EXXA 3B1FA 3AVYA 4DG8A 1U8AA 3MQ2A 3S40A 4ZCRA 1PV4A 2HA5A 4PPYA 3LYUA 4IIJF 2YHIB 3EF0A 3GWGA 4ZV9A 4TMZA 5A3JA 1CD5A 3E48A 4LXUA 4QECA 5EIHA 2XKJE 4K6FA 4O4HA 1HFJA 1B1AA 1F6WA 3PWKA 5E6UB 3FTNA 2YFQA 3HB0A 4FC7A 3R76A 4A1OA 1NU6A 4KGVA 1P60A 1L8LA 1D2NA 4BJ1A 4CMIB 5B1HA 2O0JA 3QV2A 1HDCA 4Y6RA 1A9QA 2QJRA 3E3AA 3H2SA 4J0QA 2DFDA 5EPOA 1IB6A 1X38A 4URUR 3VAZA 2XDWA 1Q20A 3K05A 4AG5A 3EGVA 5DW3A 4QDOA 4OO3A 4OHYA 1UC4B 5EVCA 5CM9C