2YJ5A

Conformational changes in the catalytic domain of the cpx-atpase copb- b upon nucleotide binding
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
251
structure length
246
Chain Sequence
LSLYEKMLHKGMIIKNSNVYEKIKEIDTIIFNKTGTLTYGTPIVTQFIGDSLSLAYAASVEALSSHPIAKAIVKYAKEQGVKILEVKDFKEISGIGVRGKISDKIIEVKKAENNNDIAVYINGEPIASFNISDVPRPNLKDYLEKLKNEGLKIIILSGDKEDKVKELSKELNIQEYYSNLSPEDKVRIIEKLKQNGNKVLMIGDGVNDAAALALADVSVAMGNKNVADIILVSNDIGTLLGLIKNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conformational Changes in the Catalytic Domain of the Cpx-ATPase Copb-B Upon Nucleotide Binding
rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
molecule keywords COPPER-TRANSPORTING ATPASE
total genus 61
structure length 246
sequence length 251
chains with identical sequence B
ec nomenclature ec 3.6.1.36: Transferred entry: 7.2.2.19.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2yj5A01
3.40.1110.10 Alpha Beta 3-Layer(aba) Sandwich Calcium-transporting ATPase, cytoplasmic domain N Calcium-transporting ATPase, cytoplasmic domain N 2yj5A02
3QUQA 2YY6A 5ALYA 3U7HB 3SLRA 4EX6A 4NAVA 3UMBA 2RAVA 3FGOA 3K1ZA 5ALMA 3QU7A 2ODAA 1MH9A 4QQFA 2WF7A 3EF0A 2WM8A 2PKEA 4EELA 3WGUA 3QU4A 4H1WA 5AVQA 2I6XA 2AH5A 4UU0A 1SWVA 3N5KA 2FPSA 2ZBDA 4UARA 4BBJA 2FI1A 5ALLA 3KDPA 4F71A 1TA0A 1YDFA 3OPXA 3NRJA 2QLTA 3ZX4A 5AK4A 3AR8A 3NIWA 3N8GA 5AICA 2KMXA 4UM5A 4EENA 3GWIA 4HAIA 1J97A 4YIKA 2WF6A 3DAOA 2C9MA 2B82A 2O2XA 2AMYA 3W5DA 4Y2UA 3QYPA 1ZD4A 5AESA 3ONNA 1XPJA 4L6AA 5ALPA 2B8EA 3MMZA 3PGVA 1VJRA 2BDEA 2NO4A 2YMMA 4BNDB 4DCCA 3SD7A 3SHQA 3N07A 5ALKA 2I33A 1XVIA 5IS2A 2W4MA 1EK2A 1SWWA 3L5KA 3OCYA 1U2TA 2FPWA 3TLMA 3WK7A 3QNMA 3FPBA 1U2SA 4XQ0A 2B1QA 2NO5A 4XPZA 3B8EA 3OTQA 4Y2TA 3A1DA 3GYGA 2RB5A 5A3QA 2C88A 2ARFA 3I6BA 1RQLA 1ZD5A 3WK9A 4NWIA 5ALSA 3B9RA 1O08A 4J2TA 4Y2RA 2HDOA 1RRCA 5IT0A 1YV9A 3HLTA 2HSZA 4KNVA 5AKLA 2BY4A 4UMDA 4KNWA 3QUBA 4HGRA 1QQ7A 5AKHA 5AW0A 3ZUPA 2R8YA 3U19A 2VKQA 2WF8A 3DNPA 5AKGA 2FPXA 4DW8A 4PNHA 2FPUA 4G63A 4AS3A 3WKEA 2JAWA 1VJ5A 4O8CA 1WR8A 2CN1A 4C4TA 3ET4A 2YMLA 3ESQA 3L8FA 3NALA 1Z4NA 4BYGA 3U13A 1Z4KA 3AR2A 2B8JA 3U7GA 5ALDA 4GIBA 1NRWA 1ZS9A 4UAUA 1NNLA 4ZEWA 3L8HA 2BDUA 3PGLA 1WVIA 2EATA 3CZ4A 2YJ5A 5AKJA 4OFZA 3P96A 4EZEA 5AVXA 4UAVA 4E88A 1XP5A 3WGVA 5AVWA 3OCZA 1L7MA 1T5SA 3RFUA 1X42A 1Z5GA 4HGNA 2EARA 5ALEA 2MU1A 1U7PA 4QJBA 3WKCA 2I54A 5ALUA 3WKAA 5ALJA 4F72A 3QU9A 3MPOA 1U7QA 4YCLA 5ALOA 3L0YA 3OCUA 4UATA 2FUEA 3ZX5A 2ZBFA 5AW3A 3EF1A 2PR7A 2GHTA 3PCTA 1YS9A 2I7DA 4Y2PA 3S6JA 2CFSA 4HGOA 3A1EA 3FPSA 2KMVA 1Z88A 3R09A 2HF7A 4KN8A 3I76A 5AKEA 5AW2A 1TJ4A 1ZOLA 5ALIA 2B1RA 5AVUA 4XOUA 2A00A 5AIBA 1Z4LA 3L1UA 1RQNA 3BWVA 3HYCA 5AM3A 3L1VA 3ZVMA 1U7OA 2P11A 1QQ5A 2AGVA 3R4CA 5AM1A 3WK6A 3A3YA 3U26A 2AUTA 1QH9A 1L7NA 2HO4A 2G1AA 2R8EA 1T5TA 1RLOA 3AR9A 3NANA 5AKYA 4BX3A 2WF5A 1U02A 2HEGA 2D2VA 2DQSA 2HHLA 2R8ZA 4FFDA 1WPGA 4MWOA 3MN1A 5AVVA 1ZD2P 1N9KA 4UMEA 5AVSA 1Q3IA 1NF2A 4KX3A 1Q92A 1O03A 3N28A 2JAUA 1Z4MA 4UMVA 1YNSA 1Z5UA 2HOQA 4YGYA 4Y2SA 5AW5A 2WHEA 5ALNA 3QXGA 3OCVA 2YJ6A 1YJ5A 3KBBA 5A3SA 3OCWA 3FM9A 4BEVA 5AW6A 4B6JA 2G80A 3IJ5A 3F9RA 5JJBA 3QUTA 2GO7A 1JUDA 4OD0A 3I28A 4NV0A 1RLTA 3ZTWA 2B0CA 2JAOA 4JB3A 4UM7A 3ZVNA 5ALWA 2WF9A 3AR5A 1RMTA 1QYIA 1RC8A 3NUQA 2OYCA 2IYEA 4CF4A 3M1YA 4YCNA 2ZG6A 5E0OA 3M9LA 2C4NA 1KYTA 1N8NA 4L6CA 2Q5EA 4G9BA 5AK6A 2YFYA 3ZVLA 4C4SA 3AR3A 3I1YA 2G09A 5AI8A 2ZOSA 3ED5A 1LTQA 1ZRMA 4HGQA 5ALVA 3L8EA 5ALZA 1MO7A 2Q4RA 4CNQA 2Q4TA 4BKMA 3QLEA 2I55A 2R8XA 4RESA 1TJ3A 5ALQA 1TE2A 3WK8A 2CFTA 4ZEXA 3KZXA 5ALXA 1RMYA 3NAMA 4UU1A 5IT4A 2A29A 1FEZA 4Y2YA 4BX2A 4CF3A 3L0CA 4Y2JA 1CR6A 4UMFA 1WZCA 3QU2A 3QU5A 2P9JA 2QYHA 1J8DA 3ET5A 4BEWA 4Y3UA 2ZXEA 4MUMA 1RDFA 2IOHA 4JDPA 1ZJJA 5ALTA 4FE3A 3UM9A 3WK4A 4IFTA 5AKKA 3W5BA 2WFAA 2YBDA 2OA0A 3SMVA 4HYTA 1AQ6A 1RLMA 3KOOA 2EAUA 2YJ3A 3QUCA 3J7TA 5AKZA 4AP9A 1YMQA 3IRUA 2YJ4A 5T41A 1F5SA 4I9GA 5ALFA 3ZW7A 5AKXA 1EK1A 4EEKA 1T9ZA 4GXTA 3UMCA 1Q91A 3AR4A 1VFPA 2RBKA 2P27A 5ALGA 2O9JA 4C4RA 2IOFK 2X4DA 2FEAA 4DWOA 3L8GA 1L6RA 3EPRA 1Z4IA 2HCFA 5AW8A 2HF2A 1Z4OA 1L8LA 3KD3A 5A3RA 4UASA 4J03A 4ZEVA 5AVZA 2JARA 2OBBA 1IWOA 4UW9A 3KC2A 5AVYA 3EWIA 5AKIA 5FP0A 4HGPA 3E58A 1Z4JA 3IB6A 4KX5A 3U7EB 4BX0A 3B9BA 1L7OA 2IOFA 3E8MA 4L57A 2OM6A 1K1EA 3ZU6A 5AW1A 3U7FB 2YMPA 2W11A 4Y2QA 4EX7A 3D6JA 3ESRA 3A1CA 2GHQA 3BA6A 1MO8A 5AM4A 3ZWKA 2G0AA 5AVRA 2HX1A 1RKQA 3R9KA 1L7PA 2C8LA 3AR7A 2ZBGA 1Z4PX 1S8OA 5AK3A 5AI9A 5AIAA 3SF0A 2IA5A 3MC1A 3ZWDA 1ZD3A 3NASA 2NYVA 2FPRA 4YCMA 5AI6A 4AS2A 5AW7A 3CNHA 5AI5A 3PDWA 4DFDA 1PW5A 2FDRA 4CE6A 2RARA 5AK5A 1Z4QA 2C8KA 2G06A 5AM5A 4FYPA 2JGAA 3SKYA 3ZTYA 5ALRA 4Y2XA 2YN4A 5AM0A 2YMQA 4Y2VA 3WKBA 2I34A 2G07A 3QX7A 1TJ5A 3DV9A 5AW4A 5AI4A 2GMWA 3RF6A 1S2OA 2W43A 4OHFA 3QGMA 2B30A 1RMQA 3VAYA 1SVJA 3SKXA 3W5CA 3AR6A 5AW9A 1L8OA 2CFRA 3UMGA 1CQZA 1RKVA 4I9FA 3FVVA 1RKUA 3L7YA 1ZRNA 4OCZA 2HI0A 3OCXA 4IG4A 2MSNA 2P69A 3E81A 4YH1A 1SU4A 1RPZA 2ZBEA 2GFHA 2PQ0A 3W5AA 4BNDA 4YIHA 3WKDA 4KYTA 3DDHA 3WK5A 3E84A 2G08A 3ZI4A 5ALHA 4CF5A 4NABA 3N1UA 1LVHA 5AVTA 1QQ6A 1Y8AA 5AI0A 5AM2A 3L0BA 2FUCA 5AHXA 4XE5A 4NFLA 4RETA 3FZQA
chains in the Genus database with same CATH superfamily
3GLKA 2IH2A 3LU1A 4CLXA 1TA4A 2B6NA 2BN4A 2O7RA 3USES 2X42A 5A5EA 2PL5A 3AMVA 4ZOEA 1N34B 2ACKA 1ST2A 1KBOA 1WMAA 4YCAA 4P92A 5G02A 1GU0A 5EWLA 1E4OA 2CJYA 3RD5A 5KWEA 4FHZA 4I0WB 1QSGA 4W1RA 5JIBA 1YCDA 2D8AA 4H6XA 1KEEB 1XRRA 4S2UA 3G6WA 4R1TA 2O3TA 5CVVA 1JB9A 2Y1XA 4BX8A 5DP1A 4FYXA 4KPYA 3PD7A 4XD7A 3K31A 4IVPA 4GZMA 2LIVA 4UTXA 4LE1A 3WGZA 1E5DA 5ALLA 1LRKA 4ACAA 4B17A 4LRTB 4U0KA 4HUQA 4DIUA 1SQ0A 2ZJ2A 3RSLA 1Q20A 5FUYA 2J5RA 4OK5A 2FWIA 3UV3A 2WDPA 3HCFA 3P0FA 2YXPX 1AKVA 3AXTA 3VV3A 3WLRA 4DEVA 5SY6A 1Q7CA 3ZD6A 4WOBA 3UHJA 2QPLA 1W581 1SHLA 2VZLA 4UQOA 3BDAA 4LQ4A 1KZ6A 3LECA 4P7GA 3RS4A 3EGXA 2J6CA 2X6TA 2HMVA 3FWNA 3K8QA 4Z9FA 9LDTA 2H2WA 1B73A 2ZM5A 1PUJA 2XB4A 4AJ1A 4XLLA 3GH3A 1PGQA 1W34A 1FBNA 3D2LA 3VNSA 2O8DB 4MVJE 3DOIA 3TOCA 1FMCA 2M2IA 2PLRA 3C8ZA 3TH5A 1HDRA 2RI0A 3CCCA 1JBQA 1TZKA 4ENSA 1OAAA 2G1JA 1QRDA 3PKZA 1DXQA 3GAAA 4IEFB 4D44A 3T95A 2I33A 2TMDA 2O1XA 4NE9A 1NM5A 3A4TA 3ECAA 4RYDA 1CZKA 2FG6C 2HIHA 5K4HA 3JXEA 1RJGA 3O9VA 2VDJA 3RARA 3LBFA 2C2MA 2YIJA 4O4IF 5GAJA 5MN4A 1YDGA 2A2ZA 4HFJA 1WDTA 4MWZA 3PZBA 2PUTA 4AG6A 4D3YA 1U0GA 3QQ5A 4F45A 2PZGA 3PNVA 3LC7O 5AJWA 3GYGA 1Z6GA 4UCXA 2ARFA 5JCPA 4IX1A 4L5IA 2VF2A 3D1LA 1RI5A 1XZKA 2OZEA 3ACBA 2O07A 1E7RA 3O8QB 1IBSA 4WEOA 1ORWA 4EI9A 2I29A 1A7AA 3EH1A 1YTUA 3G8BA 2WWIA 2IOYA 3B9RA 1EHYA 3OSUA 3AERB 1IEWA 4KXLA 3ZE6A 1GPWB 1U04A 4XIGS 1K5DA 3OMLA 3WGYA 1YV9A 5EHQA 2VHWA 2E55A 3A1WA 4TWJA 1LI4A 2BY4A 5FWNA 3WLEA 4PAGA 1E7MA 2QAJA 3HR8A 2ZJ5A 3U48A 1WMEA 2PUFA 4AY2A 3OHMA 4C6RA 2C07A 3BICA 3H9BA 1Q12A 3L46A 1NXXA 1ZJ4A 4DCNA 2JHPA 2M98A 2W5UA 3U19A 2GX6A 1H0SA 4DW8A 4KQ2A 5JBIA 2NUPB 5KB3A 1OA0A 2PLAA 3AM5A 2X7JA 4KPUB 3JS5A 4MRRA 1E6UA 1E3SA 1F2UB 1P60A 1QGUA 5ICSA 1USGA 1LX6A 1FL9A 4KCGA 5IDWA 3C8UA 1QKKA 2FWNA 3WHLA 4KRXA 1ZVMA 4P34A 2VJNA 2WPDD 1M2VB 4RD4A 2FN7A 1GNVA 4AF8A 2B8JA 2QJWA 4DYHA 4EKIA 4B7XA 2XB6A 1ETUA 2G72A 4UAUA 1EFRD 3TNFA 3CONA 3X1ZA 4L51A 4CLEA 5K3EA 4TZ0A 3LW8A 1M2FA 1WVMA 3DMPA 4FGZA 1L7RA 4ND6A 2J32A 1ORHA 1UPUA 4HK4A 4LVUA 4BZPA 5HE9A 3MCAA 4QECA 2WIGA 1T2FA 3WDSA 3WYNA 3DVAB 4M0EA 1D1SA 3PHIA 2CLDX 4ZDWA 3JWHA 2IIQA 2C7QA 3AERA 1MZVA 1JHUA 1VZ2A 2R97A 1COWA 4OQLA 2HA3A 4O4LA 1J2TA 1IMOA 2WIFA 4DEXA 1LCIA 2FFRA 1TZJA 5LQMA 5ALEA 2MU1A 1U7PA 4A15A 5KUTA 1C0IA 4QJBA 1T3ZA 2RHRA 3D6VA 4BFXA 4M55A 4K03A 5SV2A 5KTMA 3JQ8A 1Z75A 4NL4H 1VIDA 2KSQA 3GB9A 1JFTA 1PLLA 2JIPA 3AYZB 3FJ1A 5CLLA 3BCUA 1EVKA 2LKDA 2QL5A 4W5WA 3S2FA 3G2QA 2WM3A 4M0MA 1X1EA 1OJLA 3RYFA 4BMVA 4RXTA 1A9ZA 3G79A 3WE7A 1FS6A 1ONNA 3CWCA 4J94A 3MCZA 1N5RA 3CZMA 3ABSB 3KOYA 1FU7A 4FFNA 3K20A 1E3LA 4XGNA 4UAGA 2ZIGA 2GD1O 1NN3A 4AP6A 2A3NA 3A1EA 2ZR8A 3FBWA 1E7WA 2HLHA 1DKNA 1YJAA 3DHEA 3I4FA 2VOEA 3IUQA 4YAWA 1NU8A 3G3EA 5DV9A 3VH3A 2VK4A 3PDUA 5HK9A 3DMTC 3OQPA 4X7PA 1ZUD1 4JBLA 1U6IA 1ZC3A 1SXIA 1DAIA 1T1IA 3KO8A 4KO4S 3IAS1 3I8OA 5CM2Z 3ZI7A 4B3TB 2PXAA 2IUEA 2PH7A 1Z4LA 3U3KA 3OM9A 2GFIA 2GRUA 3QSYA 3L1VA 5ES3A 5ECGC 1NNSA 3NJRA 3MSXA 4G0OA 4KPEC 5IEJA 3V3TA 3D3QA 2O57A 1QYDA 1JNYA 4FZ5A 6REQB 1Z5ZA 4MJ3A 1LDGA 3IIEA 2R1VB 2XWPA 1TQHA 4FGUA 3PPXA 2G1AA 3TOVA 2DQ4A 4TL8A 2JCSA 2WUFA 2YNMC 3UWOA 5KNCH 1TIBA 1X94A 2FF7A 1JWAB 4TQAA 3ANMA 3IAM1 3FNQA 3Q15C 3BMXA 1V11A 3A25A 4M8SA 2SBTA 4TS4A 3AM1A 4TOIA 3WGHA 4PHHA 2DQSA 2Y1KA 1NW5A 3AO0B 3DL0A 2GI4A 5C8YA 4LX8A 2CMHA 5BXQC 4EB6A 4IGFA 4U2KA 3ZWWA 4FFBA 1R9JA 1HBJA 1PKEA 5BPFA 4NYIR 3K5HA 3PGXA 3BJEA 4TKUA 1JFVA 1XDUA 3D1VA 1ZVKA 3SHTA 5BVHB 2DULA 1SC9A 4CPDA 2PGNA 3TW4A 4U9UA 3H5LA 3IE1A 3WRXC 5K6RA 3N7TA 1KU6A 2Q5IA 4JK3A 2AG1A 3N39C 4RA9B 4EQ6A 2X1MA 4JJZA 2JJ1D 2CLHB 1AZTA 1QYXA 3FM9A 2ONCA 3HCEA 4ZZ2A 2PK3A 3EIEA 3ETCA 4G56A 1PL8A 1OD6A 1D03A 2R6GA 3F9RA 5GZ1A 3QK7A 1QIDA 3LV8A 3NBMA 1U28C 4JOSA 4QTYA 3QHAA 1QNFA 4LK3A 1N9GA 1FFSA 1UP7A 3FVWA 4LZLA 3FR7A 3WRVA 2VYVA 2DKFA 1HRKA 1PI3A 3R24A 1BJRE 4GVPA 2ZE5A 3FNBA 3QXJA 2WM9B 1BH2A 5FJJA 1EQUA 4XIFA 1L5HB 2XE4A 3MB5A 4TKMA 4PLYA 3SZMA 4NXNB 1USVA 1J8MF 4YUYA 3HPQA 4O4HF 1GAJA 4FIZA 2C5AA 4PCAA 4WNCA 3AY0A 5D3QA 3ZKWB 2XMGA 2Q5EA 5JVDB 4OREX 2J9FB 4YMGA 5CA1B 4KV7A 4WVFA 1XZMA 5FNVB 1GAQA 4D8UA 3ZEIA 4O5AA 1UC5B 2VCHA 4LYJA 3V8MA 1NQTA 1XTPA 1QDLB 2AFIA 2HA2A 2A9VA 1HH4A 3A11A 3FTPA 4M0LA 3WGJA 4JQOA 4YP6A 3GLGA 1IB6A 4ZT3A 3K0BA 4J0QA 3MG9A 4DREA 3R5HA 2W6NA 1OX4B 4ADSG 5ARDA 5IZ4A 1OI2A 1W8IA 2QRQA 2UZ1A 2CXXA 2ZYVX 3I2GA 1T2DA 3KALA 3VTFA 4G0ZA 1JPUA 1QH1A 4IWYA 2CUNA 1ZGJA 3IXLA 1GZ3A 2ZK7A 1K9VF 4XR4A 2JH9A 4D9NA 5GVRA 4INAA 2IEZA 4OMUA 4EHFA 4IWNA 5A4DA 1ABBA 4TSFA 3RTGA 1KDPA 2NTNA 2QVLA 5HCIA 4JC0A 1RKBA 4WL0A 1ZW6A 1OFVA 2H9AA 4CMEC 3L0CA 4OA5A 1TDJA 3LY5A 2Q29A 5LU9A 1RWVA 1BE0A 1DQYA 3MS7A 4BECA 1ZM9A 3A3KA 4OHYA 4WQMA 1QMGA 3NB0A 1TRKA 3IUMA 5DHUA 2HPHA 1VG0B 2Z09A 4Q1AA 3WB0A 1P1IA 3INGA 4ND1A 5DX8A 5H9VA 4Q9IA 1M3SA 4OL9A 1KORA 3DTVD 3IERA 1TCAA 1TT5A 5B3JA 1GQSA 4FWBA 2P2NA 3FPLA 2WFAA 5TB5A 3RLFA 1S4QA 3RG2A 3IKJA 1KVQA 4ZRDA 1Q11A 2QQFA 5IK2D 2PZLA 2NAPA 1ONOA 3WFIA 4DWJA 1WMBA 3GDGA 3VZRA 4E6EA 1HDYA 1T2VA 1KVSA 1RJEA 4OM8A 5DFAA 4BTEA 1WE2A 4IZHA 3AB8A 4TZKA 5GPBA 4IGAA 2D5CA 1FK8A 1MA3A 2WVAA 5K51A 5DOZA 4KVZA 4MR9A 4C3VA 3AF4A 3Q0IA 3L40A 4MYDA 2KYRA 2G40A 5TGZA 2IPAB 2AFIB 1GPAA 1A8UA 3SS8A 2RGGA 3NHRA 1E96A 1OV4A 4GI1A 4HZUB 2ZTMA 3MT0A 3OJEA 1AKNA 1L5YA 1MP0A 2Q7DA 4DLYA 3F4BA 1L6RA 3LBAA 3M4JA 3W04A 5J1TB 3HZZA 1ORVA 2D5AA 4MVWA 1I6KA 4U2BA 4CFSA 3KVOA 1GG8A 3EZ2A 3TW8B 3NNSA 1Z4OA 5FOSA 1EAMA 4EMBA 1KE1A 1E4YA 1ORIA 4MI3A 2XZLA 1YKGA 2ZRAA 5BT9A 4DZZA 2JARA 2QKYA 3ACCA 4TRRA 3SJBA 3GY0A 1WPXA 2YXNA 2FCRA 3C3YA 1H1TA 2JCVA 1IVSA 3DYVA 4EFLA 3D02A 5LOVB 3GU3A 5EUMA 4HQLA 1SXPA 3LQ2A 2W00A 3V4PB 3B9BA 2PRSA 4NBWA 4M99A 4YRDA 4Q9NA 1RPTA 3IUBA 1SQGA 3WWZA 5FL3A 3BA6A 3UXHA 1I10A 5F5XA 1S7GA 4FX5A 3U60B 1XD8A 2Q2WA 4CEIB 3L4SO 2HX1A 2IX3A 3CVXA 4GOJA 3PTLA 4OQMA 4FKZA 4LF9B 4AQDA 1X2BA 2QUJA 2XMZA 1CU1A 4EKDA 2DXIA 1SVSA 1D3AA 3GVXA 2FSFA 2GBFA 3MWGA 3UPTA 1QQTA 3HBFA 1E3IA 3GT3A 3REGA 3AH8A 4RKEA 1WHTB 4EB6B 4LXQA 5L53A 3IPXA 2DUJA 3GRRA 3IP6A 4PSDA 3NASA 3TL6A 2R8RA 2UYHA 1KQFA 4ID3A 3R9XB 1XFDA 3LVQE 3P45A 4QDOA 1LVGA 4V0MA 4RD6A 5K4AA 1JLSA 3OVMA 3HFSA 3JQDA 3QVSA 4H27A 3E9CA 4HWOA 3NGMA 4I66A 2BJHA 4DFDA 4HMOA 4R51A 3CEAA 4NSNA 3VGPA 4CT5A 1M1UA 3G1WA 3WGIA 3TLXA 1VKZA 5K3CA 5C18A 4OHVA 4DYVA 2H1OA 1OAOA 2QEQA 3CNLA 3WG9A 3ASUA 3DTYA 2AT1A 1DQSA 4ES6A 4Y2XA 1N2GA 1C7JA 2QIPA 3NW9A 4MUGA 3RTEA 4Y6PA 1A96A 1T29A 3LQYA 4X24A 1JH9A 4M9SA 1G21B 1V8DA 4DJTA 2I34A 1ATIA 1QK5A 1Y9AA 1RWWA 3BQNB 3K92A 3A9SA 4QZVA 3WL3A 4ECEA 1QZXA 3ABOB 2IELA 3RF6A 3PQ3A 4GLBA 4MS1A 1M2JA 4N5LA 1BX3A 4DLWA 1IBMB 4PCUA 5A7FA 2P6OA 3FY4A 5JS1A 2DVMA 2QF7A 2XCUA 1IN5A 3WLJA 4PW0A 3G0BA 1MTOA 2JK1A 1YQQA 3K96A 5IRCD 2V7EA 2R96A 2ZANA 4JEHA 1NYTA 3BHJA 3BK7A 4LRUA 1GTSA 1NMZA 1AQJA 3ZI0A 3A0RB 1KEVA 4H35A 4INPA 1TD1A 1OXMA 2JGRA 2JVJA 2J3IA 5CW1A 3P9PA 3ZZTA 4B3BA 4PO9A 5A5GA 1ZJ6A 3H4VA 3MWKA 3Q7SA 2C9DA 2YJTD 4BVLA 2YRWA 2QS9A 3K0CA 5AUNB 1W25A 1IDOA 1OX5A 4LHSA 4RZ3A 2II6A 3RRNA 2P2SA 4GR9A 1P8JA 1P6QA 2YDYA 3FDJA 1JFSA 1YJ8A 4MDHA 4ZC8A 1MIHA 3O8LA 1NUAA 1X38A 2H18A 1UF9A 3FWYA 5DHPA 4HTAA 4CQLB 2Q5CA 2GK3A 5KQMA 4HEHA 2H5LA 2DUWA 1FFWA 1C1HA 1N57A 3HUTA 4JJ4A 5D86A 5BSMA 2VJBA 2FXVA 4NAHA 4WKOA 3WMFA 4A6PA 1JZQA 4FZRA 5ESDA 1K6XA 2A9PA 2D4HA 1OUMA 1T8WA 2F7SA 4V0RA 1C9EA 3AL3A 1U6JA 4P2BA 4EKEA 1MDFA 5L3VA 2XUIA 2FOIA 3WLTA 3DAPA 5ANRB 1WDMA 4A0RA 4BLOA 1UJCA 2JRLA 1JWLA 5F35A 3FNGA 4NPCA 4QBGB 5F3RA 2NUBA 1Z22A 2WD7A 5EXEA 1GFSA 3AJ9A 1P7WA 3KPJA 3O6VA 1ZN2A 3SFVA 3SY8A 3SLRA 1E1RD 2OWEA 5JCXA 3RSZA 2RG7A 3KZVA 1QP0A 3U3OA 1OH8A 3VSBA 4FGJA 4UDNA 4O3FA 3AIMA 5ICGA 1KJJA 4ROTA 4CZ2A 2QTWB 1TUBB 4PGGA 1Y42X 2ST1A 3OQIB 3T9EA 3VR6D 4R9UC 1IPFA 2R4QA 2V45A 2IKSA 5JR3A 4Z0NA 5AVQA 1D2GA 3T8YA 2X8JB 2QQ5A 2VN8A 3QW2A 2FPSA 1LJUA 2ZBDA 5JC1A 3N6VA 4UARA 4YMSA 2YWCA 4KQ9A 1SBZA 1E6MA 4JZYA 3DVQX 4UDYX 3CF0A 1BVHA 5DM0A 4KIJA 4ZYLA 2Q28A 3L0SA 2Y68A 1CEXA 3KEFA 2F3TA 3LGXA 4N8EA 4XLTA 4IMPA 1EFAA 3Q9SA 5KTTA 5EHNA 4LOLA 1YRLA 2NO7A 2VJYA 5FBWB 3RHTA 3WYCA 3PE3A 2VNIA 1GPMA 3HFRA 2XDQA 1RM3A 1WP4A 3B2NA 1LBSA 5AXDA 1QRTA 2ACVA 5KYUB 1R4ZA 5C4IA 3K73O 1H42A 1ZI6A 5BOSA 1M54A 1VG1A 3FSGD 3HXOA 1ZVVA 4M9UA 2MR6A 3B12A 4WSOA 1Y6QA 5HF9A 1XIVA 2EBWA 2Q62A 2Q6IA 3QMPA 2FX2A 1SZPA 4QVKA 1G3QA 3KZ1E 1QGOA 2B8EA 1DAOA 2GERA 2M9MA 1VJRA 2YVQA 3AEUB 2EYQA 1ZL0A 4KIGA 1QANA 3OJCA 4KUGA 4BNZA 4HR7A 1R00A 2O8BB 2Z9CA 4NV3A 3S28A 4UOEA 2OYSA 3P20A 4YC7A 5LR6A 1V45E 3FVQA 4MKXA 5HCNA 4TTAA 4YMWA 4G4SP 4IEEA 2ZIVB 3DFMA 3X43A 1DJPA 2FWBA 1ZKDA 1EXNA 2GZ2A 3ZN2A 4QPCA 2XVAA 3PWSA 5A9TA 3GFOA 3A6KA 4XTCS 1U0FA 2PL9A 2B1QA 2NO5A 2R2GA 4JJGA 3M49A 2NU8A 3REFA 3VNBA 5JT1A 4TWAA 1J0DA 1L4FA 4NQZA 4F4DA 4GL2A 2HTEA 4R3UC 2UV8A 4R8MA 1H8HD 1RS0A 1U0SY 2IYSA 2WNSA 4G5QA 3F47A 2Q8NA 4Q9AA 3E9ZA 2ZUWA 2WUEA 1OLUA 5CTAA 2BM8A 1WUYA 2WP8J 5IJAA 2GSWA 3ZHUA 2C04A 2W0MA 4NECA 2FRDC 1AB6A 4PYOA 4DABA 4EFKA 4QAJA 4JKOA 4F2PA 5KYXA 3C48A 3G7NA 2IE8A 5K3SA 3SDBA 2C3MA 3R5FA 3I2YX 5SYNA 3CINA 1JA1A 1J07A 3UK6A 4RJKA 2O23A 3B5EA 3O4JA 3LQFA 1L5QA 2ZSHA 3IEUA 4KNWA 1AUXA 5K7SA 5C80A 1NX9A 1PIWA 2E4VA 4YAEA 3A37A 1A71A 4OHWA 4EVRA 2VKQA 4ILKA 2R1VA 2V5AA 3IDSA 4FZVA 5AKGA 3H2ZA 3LWZA 1ZRSA 3HYNA 3WSTA 4EB0A 4TM7A 3PUWA 1V2HE 4P33A 5J63A 3U37A 3WHPA 5JWHA 1XDDA 2QP9X 1Z56C 1WD5A 3I9FA 4TSKA 3WC4A 5M29A 1BTOA 3I64A 5DLQC 4B4DA 3TEFA 4IV8A 3X1XA 5JSYA 2YMLA 3HDYA 2BGJA 1Z4NA 4MWEA 2O1SA 4E2YA 1PL6A 2VRBA 1HFKA 3LCCA 6AT1A 5LDDC 5CRIA 4S3MA 5CPFA 3GBPA 3OQBA 4K6OA 1VYTA 1K8RA 1A2QA 1TTHA 5FBRB 3WRYC 4RADA 2ZYTX 4MGKR 3EEYA 2I2WA 4MA4A 4I3FA 3QLTA 2PKXA 5DBOA 1OSNA 2FMFA 4FQ5A 1EX1A 2VTBB 3JVEA 3O4GA 2CBXA 3C6ZA 3GJ6A 5K8CA 3HFGA 4UHFA 3RVMA 2BCGY 2ZRDA 1PD0A 3HP7A 2FDXA 2P41A 2PYDA 1CTQA 2VIIA 4P5PA 1AK2A 4RHFA 4BFYA 5KVCA 2R1TA 3O47A 5HGXA 4G84A 2BAGA 5BN1A 3OLQA 2JFPA 2HLNA 2XXJA 4HEA6 2NU9A 1IHXA 1KBZA 3KSMA 2X1LA 1WUTA 3UZUA 4U0JA 1DCFA 4COKA 1SXHA 1HL7A 4I9NA 5CM8B 3BKWA 2WHPA 3D43A 2XNJA 3O8NA 1SC3A 1KRXA 4O2RA 1W30A 3L6BA 3CVJA 2FK7A 3ZY5A 2Q7XA 1AK9A 1EDEA 2OFFA 1NF8A 3OAAA 2VJCA 2WHPB 1U7QA 1E20A 4GLJA 5CX1A 4CCAA 5LXTF 2MDTA 3R8CA 5EE0A 4YQEA 2OLJA 4V3CA 1LSSA 3BMNB 1QZUA 4QIHA 2OCYC 4FDVA 4HD8A 4URFA 1AOXA 1KVRA 4FMCB 3SU8A 3WQBA 1UP4A 1SCUA 1D0IA 1N1GA 3MGGA 1BU5A 3B53X 3PDJA 4FT4A 1T0BA 3RYFB 4CM8B 3FAKA 2FUG6 3OQJA 4R2MA 1XRLA 4CETA 3FPEA 2ZIXA 3ROKA 2Z2KA 3AF2A 1ULUA 1XYGA 3CNBA 3JQ9A 2PAAA 4FJ1A 3EWSA 1T4CA 3UANA 4D4IA 1UBEA 1XRSB 2NYUA 2AHRA 2AV6A 3VOSA 1FXWA 2AMVA 1J8YF 3DOOA 3L6OO 2VHVA 4DDUA 1P3JA 4IIFA 2VH5R 3I8SA 4EK9A 1B41A 2B7CA 5FNVF 5KNCD 5LD2B 4JUIA 1K92A 3AHJA 5G0WA 1HQDA 4QELA 1SG0A 3TRJA 4CKCA 1XZCA 3RROA 4XX0B 2C5BA 2JZCA 3W4KA 2X14A 1SC4A 4WIAA 2YWBA 4EA7A 2X4LA 5AM3A 1P4RA 1P2BA 4PQEA 4QICA 1DJLA 1EG7A 3OT1B 5B1HA 3IEXA 4NY1A 1VLHA 5FQNA 5ULLA 4L4XA 3VYTB 5I7EA 3HU3A 1YA6A 4ZHQB 1FX0B 2XNCA 5EQDA 2VQSA 4EA8A 4E70A 2WTNA 4C05A 3QA9A 1Q50A 1D5WA 2OHOA 3KEGA 3QVGA 4G41A 4E4YA 4AQ7A 1X1TA 2B21A 3GEGA 1CETA 1C7QA 1HG1A 1U7TA 5ER6A 2Q4OA 4S0XA 5SZIA 1KSHA 1E3QA 2F1IA 2ZU6A 3B2QA 4MWOA 2JGDA 3CO0S 4NJOA 4URYR 1X3SA 3GV0A 1E9DA 3OX4A 3TZHA 1NF2A 4D41A 1FUKA 2IHKA 2WIKA 3FTNA 4HNAA 4LPSA 4TVBA 5DF1A 3KQOA 2EBHX 1CUEA 1O03A 1N3LA 1NG1A 2OTCA 4DCUA 3DT9A 3NKLA 3DTNA 2W58A 4B34A 2P9CA 3B1VA 5DGXA 1DTWB 4C0SA 2CWWA 3D8RA 4NG4A 3ND5A 5IKXA 2CB0A 4RF3A 2GCOB 3NUZA 4KXVA 3NIGB 3O4FA 4R5MA 1E5TA 3ZY3A 2NZ8A 4TRMA 5CM9C 1LDMA 4Y9UA 2IFTA 4D57A 1IY1A 2XXBA 4BGIA 2WUGA 3DE6X 4EW2A 2QJOA 4UM7A 1SUDA 1HGXA 2CF5A 3AL2A 3S81A 1Q1GA 4BMCA 1RMTA 2Y2VA 2E6KA 1JQDA 1XXHE 1YWGO 2FW0A 3BGIA 3F7OA 2DWOA 3LLCA 5BQ5A 4MWGA 3ZDYB 2QSYA 3AFNA 4C14A 4C89A 4CF4A 4YCNA 2VJQA 3X2FA 2I9PA 4EG3A 1SK8A 1AHHA 2J1LA 1XMPA 4OQQA 4CTNA 1TCUA 2H4HA 3BXGA 1QHHB 1P5ZB 2CLCX 1GGMA 3IQXA 4JUCA 1IQUA 3DZIA 2OCIA 1EVLA 4BO2A 3DNMA 2JGJA 5JNSA 3G8YA 4PZLA 4FB4A 4B4VA 1URPA 3H5RA 3ESDA 2I91A 1WSAA 3EVFA 1YOVA 3F5SA 4LY6A 4DLAA 4OTZA 1WMDA 3GWGA 3JYOA 4FHEA 4ZO8A 3VO8A 2FN8A 1RXEA 2C9BA 2VTKA 2ZI7A 3HZHA 1FNMA 2QY6A 4DQXA 2AN1A 3Q41A 3AY7A 3R6WA 2D5BA 1VE6A 4DUYB 3V7NA 221PA 3PLNA 2VUHB 1FMFA 1G16A 2E9SA 4YR7A 3Q3EA 2PN1A 3PI6A 4EATA 1G20E 2J08A 4CTJA 3IAFA 3EGEA 4WNAB 1OFUX 4BX2A 5B5SA 3FCAA 2WV7A 5L51A 2XLCA 3L9WA 4TTPA 2E89A 1RQGA 4WLFA 4CTKA 1NI3A 4BHTA 1RAGA 3R0JA 2PSHA 3QVXA 2VJPA 2JW5A 4MP6A 4O0LA 2E21A 3WYEA 4BZXA 4PQFA 1PV2A 4MYHA 1KAOA 1IIBA 2O2SA 1CY0A 3IBCA 1GV1A 4BQFA 2M1XA 1ZJJA 2PXCA 3R44A 3LUHA 3ABRB 5K8LA 1EVYA 1AO3A 4LV5B 1WB6A 3MD0A 1F4LA 3O8OA 3NHMA 2G5CA 5EJ4A 2E4XA 1PBTA 2X8LA 3JRNA 1E63A 3GELA 1YUBA 3DUFB 4ZN6A 3L1HA 1T0IA 1QF6A 1L5SA 3HO8A 2BLLA 2RGBA 4G0WA 3LF1A 4FTWA 3DO5A 4AUMA 3IRUA 4MB0A 4YAKA 1LDBA 4ZPJA 4ZVUA 2O8FA 2DY1A 1QGED 1IJEA 5FOWA 2W2MA 2BKAA 1R0XA 3REQA 3WWYA 2XCLA 2QPTA 4P0PB 5TIIA 1FNBA 3P4XA 2VJKA 4OEHA 4RTQA 5K01A 1J24A 1YR6A 2JFGA 3IEVA 1T9ZA 4MCHA 2D1SA 3ZNNA 1Y1QA 2R7AA 2WJWA 3NCTA 1MKYA 2FSIA 3QZUA 2PMWB 2NXWA 1OLXB 4Y6SA 5EG5A 3KKKA 2PS0A 5ILGA 4YT4A 1BWSA 2DUNA 3AB3A 2ZRNA 1H5QA 4CR6A 1EJ2A 2VQ6A 5A6SB 4HBGA 1WRBA 3EPRA 2HH9A 2HRRA 2ZUDA 4ZDIA 4G07A 3K35A 1BXRB 4H4CA 4UFOA 3W5HA 2W2NA 3KD3A 1HSZA 2BISA 1L8AA 1GUYA 2XT6A 3C5CA 2YHIA 4BCBA 3DHNA 3TSOA 2QJRA 3HABA 3W9BA 2WABA 4X61A 1NR7A 4JEUA 3FFBA 3FYUC 4L8YA 5CYPA 3ZXIA 5MF6A 3T9CA 2RK3A 3NFRA 1GQRA 3PNQA 5CAEA 1XRMA 3EVAA 4O4HB 4ODIA 2HLPA 4IH4A 1GZUA 4MW2A 1Y1LA 4ZZIA 3P2MA 2ON6A 5TT1A 5D5PA 1YFJA 1L4YA 1XQXA 1DO2A 4YBZA 5I3ZA 4KTVE 2W11A 3PHBE 4WKCA 4C7BA 2Y0CA 2R00C 1Y8ZA 4EMSA 2CXRA 2WA2A 3N74A 3A1NA 5G40A 1HE4A 2ADMA 1QE5A 1RTTA 3RAFC 1FRFS 2P30A 3WBJA 4JSYA 1RHJA 2H0AA 2O0LA 2CLOB 2BMEA 3DBLB 1Y3HA 2MYTA 3LZ6A 3ZWYA 3Q12A 1DQRA 1GV0A 4WGGA 2C5HA 2CD7A 5AIAA 2GZAA 2IA5A 2GLTA 4PAOA 5FUMA 1RPAA 4YRZA 4OKSA 3RWMB 1RSZA 3GZ4A 3MF4A 5A62A 4R8LA 2OORA 3W2HA 1C0PA 2F00A 3H1FA 1T13A 5GGYA 3VISA 1EK6A 1VTKA 5AI5A 1OI4A 1A9QA 3P0IA 3R9XA 1WX1A 1STOA 2V6IA 4JJ6A 1UK8A 4BE4A 3MGCA 1MJGA 3GC6A 1NDHA 3D2BA 4FBLA 4WESB 5AOAA 4ER5A 4DV7B 5EJ7A 1XQ9A 3D7MA 1VIYA 3CUUA 3TTYA 5KI6A 4GPBA 1XV5A 1H4VB 3ENZA 2DQZA 1SVKA 2VR1A 2YMQA 3K16A 3DDOA 2OBYA 3TIIA 4HN9A 1VKNA 2HC9A 1EZ1A 2C2XA 3UF0A 5CA1A 3KNZA 2RIRA 1W5FA 4RHUA 3ICWA 3OFVA 2DH5A 3FBGA 1GP2A 1VBFA 2P0AA 4MQEB 4NDZA 1JQ3A 2PQ6A 3AU8A 2WTEA 2BZGA 4I1YA 4LZWA 5DM2A 1GUAA 3TB6A 3WLPA 4ABTA 5IVKA 1MVOA 1F9AA 1Z37A 2H17A 2YV2A 4J4BA 1YAHA 2QLMA 4EUHA 5CGZA 1JDJA 5F2EA 1I4EB 1NOJA 4J0EA 5K3BA 4Z7OB 1PJTA 3RUCA 3AIKA 2P68A 3B5JA 1YRHA 5F73A 5ED4A 4NRDA 3NXKA 5EXXA 3GW8A 3HR4A 3OTWA 3ZY2A 5U9CA 3R3YA 1Y8QA 1QVRA 1U2RA 5D3KA 5AVOA 4OCZA 4BLUA 1PUXA 5AJZA 1GEEA 3G2IA 3KKPA 4N39A 3R40A 4HB2A 5B37A 5REQB 2EKPA 3AXSA 1G7SA 4ZANA 2QVZX 3C5VA 3DJFA 4V0OA 1RABA 1QGYA 2NP7A 4NCXA 2JLQA 1GG5A 1XYYA 1Y3DE 4MGZR 5IKPA 4I46A 4CKYA 4HVTA 5KCMA 3ROGA 2GYVA 5DI3A 4EF5A 1NSFA 5FBLB 4EG4A 4X97A 2P2GA 2ZETA 3E84A 1LI5A 3A4VA 5KQPA 1GKLA 1ULAA 1WUHS 1JB1A 4MUXA 3W9YA 1P75A 3C16C 3TR0A 1XQ1A 5DMHA 4X00A 3ROZA 1Y9JA 3W7AA 4AJNA 2B4KA 3KELA 3OTGA 1SHJA 4L6IA 4IQ8A 4PPNA 2Q3MA 4ZMBA 5JSHA 2ATCA 3ZGZA 2I99A 2NOAA 2YFQA 3V4OA 2BC9A 3REOA 3DKPA 1DX4A 4DIEA 2PUHA 4N5MA 4IIXA 1KI6B 3QKRB 1JXOA 3OOWA 4BRZA 3Q1KA 1WBDA 4B6PA 4UNNA 5DKFA 1JDBB 3WGUA 4X20A 2C83A 2X9GA 5EN4A 2CLIB 5EKDA 1JSCA 3OKCA 5E1MA 4K8RB 1OA1A 1SWVA 3IR5A 1UH5A 1WY5A 1AB5A 1Z12A 4H08A 1N5LA 1TOAA 3T12A 4F1WA 4H7JA 2XSZA 4LOHA 4QNRA 5EIXA 4YP7A 5LBIA 2YINC 5I45A 3AJAA 2I6QA 3WB2A 4CM9D 2JFOA 2W4QA 1S2GA 3NBZC 4R2LA 3EMBA 4V02A 2CE2X 1D2EA 1JHVA 1U63A 3I6YA 3ICOA 4MQ5A 3AEQB 1A2BA 3NIBA 3A2NA 1QZZA 1N2CE 1WM1A 3EZ9A 1MC1A 1UXOA 1KFBB 2VPYA 3IT3A 5H1YA 3WV5A 3AEKA 4F11A 4JI0B 3BVPA 4H0NA 3TK1A 1WZNA 4Z9XA 1HTTA 3L9XA 2IXGA 3CRMA 3KB2A 4XYGA 1E62A 4ZOBA 1MV5A 4RLHA 1DDIA 3FSEA 3K5PA 4ZICA 1ILEA 2VLIA 2FUNB 3KRTA 1T1SA 1MOQA 1YQWA 2B36A 4G97A 4PAMA 3KU1A 3VGJA 3O7WA 1PSDA 3EY4A 1KQNA 4C7KA 3N86A 5J2UF 1QRAA 2W2XA 1ZL2A 2R85A 4CVNA 1AKEA 3Q8LA 1VKOA 3SSOA 4QRHA 4OMFG 3ZE2B 3QPAA 5CHYA 3K71B 1GQOA 1JDUA 4X91A 1VL1A 1IN4A 4CDGA 5D3MB 2DR2A 1MABA 3TTTA 2GZ3A 4HDQB 2YC4C 3DUFA 3L5KA 1C30B 4U6NA 5AUOB 1E8MA 4I19A 2VWPA 4IHQA 3GFBA 2AE1A 4N6GA 4M9XA 4MI9A 4O0MA 4RLFA 4DUGD 4B3RB 1CFJA 3PT5A 1ESMA 3TDKA 1B8PA 1M1NB 5H16A 4P4NA 3INRA 4YB8A 5TQ2B 1QZ3A 2E2WA 1LRJA 5KX5A 4RY2A 2OFXA 1ZFNA 4FYMA 2MYUA 1BOFA 1YQTA 2BOVA 2BMWA 2H3EA 1VDMA 2I3AA 3R3XA 2VPZA 3FLMA 4A7PA 2WT8A 3KVVA 4EJFA 5THKA 2A92A 4ZVTA 4GOXA 3GYBA 3BSFA 2VQDA 1K6IA 2R2AA 4TL7A 3URMA 4Y2RA 1NXTA 3QG1A 4XWKA 1N2IA 2VA8A 2GBGA 3DD5A 4H6WA 4KYUA 5C2JB 3PUKA 2DLDA 4NC9A 5T67A 3DC2A 4D8TA 1HLFA 5DTMA 2J59A 5A6SA 1VXOA 4QVGA 3GBVA 4PC7A 1RWOA 4R7ZA 1O77A 1QORA 4QEKA 5AKHA 1Y33E 3FOWA 4OJMX 2F59A 1NASA 3F0TA 3PXXA 3ZNQA 2ZGVA 3I32A 3ND9A 4PFQA 4FFMA 1AA9A 2D2IA 1KO1A 2J5XA 5GP1A 4EI8A 3PVZA 1XRQA 2QV7A 3H11B 4G8DA 3LE8A 3WKEA 5I9IA 4HH1A 2V7XA 4A0FA 4V03A 3PX3A 3E5MA 4BJHB 2GVZC 1SZDA 3E9DA 4J0DA 5DTJA 2IEYA 5IJXA 4TS9A 1M1YA 1P19A 4CHTA 4Q24A 1Z2NX 3N0WA 5HIMA 4MA5A 1ZS9A 3JQAD 2D3TA 1PG0A 4MQEA 5U4QA 4FYJA 1ZIDA 4KWIA 4IQ0A 2PZAA 3CPHA 2YV5A 4PRZA 1NW8A 4KODA 5KEIA 4BP8A 1DGQA 5TR9A 2GB4A 2ZSDA 1CEEA 2NO9A 4EZEA 5B36A 3A14A 3LPCA 4I6JA 4YI3A 1V2GA 3D7NA 3NC1C 3E0QA 3A9CA 3JR7A 1J21A 1DO0A 1DEHA 4I5FA 5I7VA 1A1VA 1T4GA 1DZ3A 3K4PA 4K9DA 3ZD8A 5KYGA 1SUBA 1U3GA 2J9FA 4W99A 4AMYA 4HFNA 3L0ZA 3JQ6A 4HOYA 4GR5A 1U2PA 2AE2A 3UBMA 3IMEA 4XJVA 2MMCA 3RJZA 2KPOA 3CURA 2ZBUA 2X3FA 3WKAA 2P2YA 4I3GA 2HHCA 2CSUA 1VBMA 2HU8A 3ETNA 3QVTA 5HBGA 3R23A 4G2TA 1E2UA 4JN6B 2XYHA 4XB6B 1UEJA 4X8OA 3VHXA 2H65A 5FTLA 5CIYA 1HT2E 3ZX5A 2WWRA 3LO8A 4OK3A 4ZU6X 2Z8YM 4HH3C 2Q5LA 3PFGA 5F4ZA 4F4CA 4DDKA 3T3MB 1SU7A 1R37A 5LQSA 3HSKA 2GXAA 1N5IA 3R7WA 4YRIA 2ODTX 4GLLA 3C3EA 4LF8B 3HXLA 3MIIA 1YI1A 1N6KA 1FDVA 2PZKA 2WFZA 3EW9A 3EXHB 3N7UA 121PA 4G8CA 4I8DA 4LV8B 2YZGA 7REQA 1Y7PA 2AS0A 2VAMA 2ECOA 5E4YA 1UDWA 1PNOA 3GRFA 2C29D 3C1TA 3L8ZA 4JU9A 3J81k 2FPOA 4ZC1A 2GM5A 3S1AB 2HSDA 3PNSA 1J7KA 1A04A 2VXCA 3I01M 4G25A 1I5RA 4XOUA 5GGXA 1E6KA 2P4SA 3N05A 4MIKA 3FKSD 1HDGO 4GMFA 4BNFA 1EE1A 3A4LA 1H0HA 3ZWMA 1II9A 3OO1A 3G9XA 1H6CA 3LP6A 3PFKA 4DXAA 1E0KA 4OX9Y 2A0KA 1QGDA 1V39A 5DNVA 2JI4A 5IKOA 4BN0A 2K7FA 2QMZA 1LPBB 4WXEA 3HCBA 3ULKA 5BQXA 2UZIR 5IJ9B 4EG1A 1YZTA 3IDOA 5B7NA 4ZEOA 3BRQA 2CT8A 2FPKA 3C7CB 3NANA 5BWCA 2J6HA 2P9QA 2AD5A 3A05A 3UT5A 3OEEA 4ZI7A 1GT6A 2A57A 4CTOA 5JYDA 1HZJA 4ZODA 1HA3A 1K3UB 4WACA 5HE8A 5LCXA 2HHLA 2I87A 4UHDA 2NU7A 4HFMA 1PEKE 2MOKA 4JC8A 3QJ5A 3RIMA 5KYNA 3B1WA 4DEYA 1V1JA 1XCGB 5DISB 5ETJA 5IP5A 3TQTA 3WV4A 5DTRA 3VM6A 1YDEA 4EDFA 5IXYA 3Q85A 1Q92A 1YA4A 1J9GA 4DPLA 2QUAA 1ULZA 3GNTA 3O21A 1IH8A 4YGYA 5AW5A 2MCFA 1Q19A 1X14A 4FW8A 4H1VA 4UZSA 2QTBA 4D8WA 2OZKA 5EJGA 2ZSBA 2BHTA 3DFUA 3GFFA 3GRVA 7ADHA 4C7XA 5J4VA 3R1IA 3RJMA 2APJA 4PTLA 5IM5A 3F9IA 3P5BA 3H97A 3FPFA 2QROA 1FSZA 1LNSA 2JH3A 3DWIA 4D0NA 1D7OA 5CFNA 2WKPA 5JS7A 3PNLA 4DXHA 2VXBA 3O3OB 1FFHA 3ELYA 4R05A 4CRWB 2B0CA 3OE4A 4JB3A 4Q3LA 2DTDA 2XOEA 1R8YA 1VJ1A 3FWKA 4J8PA 3IX7A 1AKQA 2VYCA 4PSVA 2DHDA 1NY5A 5FI0B 2PGAA 4IKEA 4UCQA 4EG6A 2IEGA 1KI9A 3W7BA 1ECGA 1KYTA 1UPTA 3TLGB 1POWA 2PR2A 4PM4A 1BE6A 2YOHA 1BXKA 3NJ4A 1U8FO 5EJ5A 2CHUA 4LQDA 3GAMA 3S2IA 4DBLC 4DRYA 3GFSA 4NZ9A 3ZXYA 5KINB 1VJ0A 1PO7A 1LLCA 3UUFA 1C29B 3VR5A 3T3GA 2P4HX 3WISA 3GNSA 1UFQA 4IGEA 5CNJA 1LTQA 2D7JA 4JH0A 1KGSA 1AKUA 1Z5PA 4FMPA 4BGDA 1MX9A 1MO7A 1HYHA 3GOQA 3NGXA 4F5DA 1CUVA 1YASA 5IKEA 2W42A 1U31A 1TJ3A 2AOTB 2IVFA 5ALQA 4B6GA 1PDWA 4P4GA 4ZEXA 3MTEA 3ZGLA 2JLXA 3E6AA 3T9AA 4X6YA 1T5LA 4KW7A 2C97A 2VYVD 5ALXA 3WIBA 1FZQA 4AYWA 1HXHA 1W5BA 1RIFA 3SF8A 2B9VA 1PGPA 3DMGA 1N0WA 1XA4A 3NHPA 3MXTA 3NONA 3TRKA 4CF3A 1SKYE 3RRZA 2NXEA 3CF4G 1Y3FE 3S27A 1WHTA 4RV5A 2AOWA 3V46A 4KL8S 2G7ZA 3RSSA 5IH3A 1EJ0A 1L4HA 2CXUA 5J5AA 3TNJA 2P9JA 4RL4A 1MR3F 1K7CA 4ENUA 4AKIA 4I4CA 4LW8A 2J9GA 2NTVA 1SA0B 1YZVA 1EFUA 3X1DA 2RGWA 3OP4A 1CUYA 3N5CA 1NN5A 3PGJA 4YECA 4FMBB 3G5TA 4YAGA 3GGPA 3EEIA 2F4VB 1OI7A 2HRCA 3VKFA 1G2PA 1X1DA 1UBTS 3HVIA 1RLMA 3G9ZA 3Q9NA 2PMCA 2ZUUA 1NJ8A 1N6HA 3R76A 3KFVA 4CL3A 2IWRA 1RHUA 4PN7A 1ZJWA 1XTVA 4O33A 2FUKA 2XUAA 2VEOA 4P4SB 4MI1A 4OIFA 2HJVA 2H0RA 1RWQA 3FIUA 2YCBA 1QHFA 5KTYA 2AZDA 4RVDA 4GBED 1PVOA 4ND2A 2P40A 2C31A 3N76A 4NULA 3TDNA 1YVPA 3PUJA 1VE7A 3PD1A 3EASA 4TYQA 1P6XA 4NATA 3UW3A 2MMGA 4LAFA 4BU1A 1H6BA 1W49A 5D00A 2UXDB 5KYYA 4ETWA 1T25A 1IXSB 1PCXA 3OJOA 4JI1B 3MJSA 1EFDN 3IQWA 4CLRA 3I9NA 2JD0A 2JA2A 5FA5A 3KYDA 1JLLB 4CM7A 5B3KA 4X1OA 1B16A 5CG2A 1RW4A 4MS3A 5LYJB 4JI8B 3M6WA 4RMNA 4E6PA 2EG5A 5B1SA 1T36B 3I0NA 3K6KA 3BUSA 2BE9A 4KQHA 2BKEA 4ZEVA 4NXMB 1DUSA 2CVZA 4UAJA 1TIKA 1H6AA 1TZ2A 1Y34E 3E2IA 1NVVQ 1T9GR 1W0JA 1W48A 3JYLA 5AKIA 5FP0A 4HDKA 3W8EA 4DNOA 2IYFA 4OOFA 2GN9A 1DFHA 3AQIA 1L7OA 3L01A 5IVDA 1NKVA 1UDRA 2XITA 4GL4A 4QPJC 4OHKA 1B6GA 2W8BB 3QE2A 3FKSA 3F1KA 5G4KA 3DMTA 3QKIA 1WBJB 1NP6A 3HKEA 4IDGA 5JJCA 1PV1A 2FSSA 4B31A 1R3UA 4QBFA 3F6SA 1T2EA 3GFVA 1NDQA 4WWHA 2W2VA 3A6FA 3S2EA 2O8CA 2ZBGA 1MVNA 2XVXA 1Z0FA 2FZ5A 4EJ2A 1RACA 2FEXA 2WAMA 4MPPA 4BFCA 2ZE7A 2W6ID 3F98A 1QFJA 4IDCA 2M6KA 3ZWDA 4BFLA 3LOQA 4NF2A 2ERXA 4OXRA 3QWIA 4MARA 4R9SA 1US8A 5DCYA 5DSTA 4KI7A 2VF8A 4BVKA 1IM8A 4DIOA 5KMGB 4I2VA 2YNMA 1GTG1 4LBVA 3EISA 3K0SA 3AG5A 1Y89A 4P7KA 2MHCA 1H2YA 1XGKA 1ML3A 4J16C 1K7FB 3GLGE 1UBFA 2O20A 4Q4AB 1AKWA 5KOHB 4FCWA 3TINA 1VM6A 1W1UA 3V33A 2FB9A 5GV7A 3V9AA 4FHGA 5DIZA 4BZZA 5CJJA 2JLCA 1JHDA 1R0WA 4Q9LA 2O2YA 1TYAE 3PRJA 2XEDA 2YCLA 2KLHA 2AWNA 3F71A 4V2UA 5AM0A 2HIGA 3DDZX 3NHJA 1GSHA 3H2BA 3QW4B 4FFOA 4HDCA 3RSOA 3WLNA 2XKAA 3HZOA 5DGDA 1GGEA 3T3DA 2EEZA 3AUFA 5BQ3A 3WRXA 3WO0A 2E4YA 5AW4A 3N75A 1KQOA 1JJFA 1G64A 2WOOA 3PFWO 1ZA1A 1S2OA 4IJQA 1B76A 1BHO1 1KAHA 1P5JA 1Z0UA 1MEOA 1UJ2A 4WNIA 3TOXA 1AMUA 2JLYA 3IV6A 2WMYA 3O8CA 1Z39A 3M89A 3A27A 2H54A 3QQPA 1F2UA 2G4CA 1QGUB 1SBQA 3TZ6A 3W5JA 4D2IA 2CNNA 4LJLA 1YRAA 2D74A 4NHOA 5DW0A 4IIUA 3T99A 4CN9A 1Q3KA 4PLCA 1KA9H 3GP5A 3I09A 4JU8A 2D1TA 4TV9F 4AECA 1KSFX 1U8EA 3FG9A 1JEQA 1Y4ZA 5BUZA 1YL5A 2JIZD 5EZYA 3RYCB 4LF5B 3A2KA 4UOQA 1SUFA 2GPJA 4LJ7A 5EXDA 5E6RA 4RA9A 1B43A 5TV2A 4R16A 2OOSA 5BW5A 3NTRA 5CJPA 3RASA 1V7QA 1BWPA 5JAMA 5IDQA 4G09A 4WLUA 4M6WB 2QMHA 2B4TO 3DZFA 3TPCA 5JMPA 3I1FA 4BATA 2PKYX 5JRJA 1V5FA 3DMRA 3ONFA 3GN1A 5C4MA 2JKYA 3A70A 2VPWA 3AKYA 1NY6A 4UVEA 1U9CA 3W2GA 4Z51A 4K9OA 4YX9A 5HKOA 5DGIA 3RVSA 1XTRA 3NAQA 4NCJA 4S24A 4BAZA 3V42A 4ZCIA 1ZYUA 3PUZA 2ZTHA 5FEMA 3B9QA 4GI5A 1SQFA 4ZVOA 2DFLA 3NP7A 2IBSA 1WO8A 3CGWA 2EOAA 5TPWB 2VJMA 4CUZA 1N3YA 3VOTA 2OV4A 3CNEA 3X1KA 3FWPA 4I5EA 1AIPA 4XXHA 1T1GA 3OZXA 5DM60 3SGLA 1F2TB 5SYMA 4EX6A 2EHJA 2WWYA 2HT6A 2FFJA 3BBLA 4ISCA 5ALMA 1N2XA 3KJGA 3M5CA 1IOWA 3MT7A 5DHAA 5FL7D 2XE7A 1YQGA 3NEYA 3R2JA 4F9EA 3OAAD 2ZSUA 3QVWA 1VLLA 2MSDB 4N76A 2ZWMA 2O4UX 4N3GA 4LEIA 1HQYE 4H1WA 4QUGA 2DBZA 1TPZA 2O06A 1L5MA 3TLYA 4ZI2A 4RVFA 1SBCA 1X1RA 3D6TB 3O74A 5B1DA 5K0NA 3RSGA 1J09A 1DC6A 2UVPA 5B3JC 1SGWA 5LP1A 3EDYA 3KFLA 2FI1A 3VU1A 4Y1RB 2RH5A 4BBJA 4D3ZA 2XXAA 1MC4A 2OENG 3OPXA 3P94A 3NRJA 3MTJA 3H65A 4H7IA 2QLTA 2GVDC 1K7EB 4H6PA 4DR4B 1VKRA 4MV9A 2Y27A 3CWZA 2FPGA 2AJLI 1EGVB 3C7DB 2NADA 4MHOA 3G85A 3VZBA 2YWXA 4JUBA 2VUSA 5E9JA 2GBCA 2IE0A 1CY1A 4S04A 1Q57A 2I5PO 4XCXA 4YO7A 5CA0B 1JZTA 4KR9A 4DZRA 2KHZA 4OYLA 3BEOA 3OIDA 2OLKA 1TF7A 4YV0A 3ONVA 1HT1E 3L7JA 1ZNZA 3BXHA 1QIMA 3QLVC 2IS1A 2AVNA 3R3JA 5FPPA 3ZJVA 2KMLA 3PQ6A 1QBGA 5BY2A 2D62A 2K2WA 1HFWA 4C43A 1R0KA 2JGDB 3IT1A 1P1JA 1YACA 3QVUA 1I6WA 4ZV9A 1NVKA 4JYZA 5F3WB 1BDBA 1GRRA 2IS6A 1SJ9A 1V6CA 1X87A 3O73A 3VA7A 1P2UA 2R25B 4K40A 4EZBA 3UA3A 4NG5A 2ZYRA 2XMQA 4W8GA 4KQFA 5DTIA 1OZ0A 4D4KA 4RMGA 2W6QA 5LOVF 1QJ4A 2FPWA 1USUA 3FPBA 1P2TA 3Q40A 5IMSA 3DE4X 3QBTA 1ADGA 3V1UA 1PDOA 4DMHA 1R6TA 3KSRA 2WT4A 3E3OA 1VPEA 2FW6A 2N42A 2ZRPA 4L22A 4DRXB 5BSHA 1MO3A 2CWDA 3KSBC 3ADOA 3ZV4A 3QLUC 1QVVA 1RC1A 4YDSA 1B0AA 3U0VA 4XGQA 4RORA 3UT6A 4MQ4A 3PQ5A 5LWQA 5J2UA 4P3NA 4CI9A 1XJCA 1E61A 5TDHA 1LF0A 2PXHA 3U3DA 1H9CA 3PP8A 4POAA 2F43A 2Q9UA 2DPYA 3A6ZA 3EIWA 2FDCA 1WD7A 1R0ZA 4LN1A 1XDWA 5M34A 4ICIA 1CQPA 2AR0A 2BFBB 3G8DA 4DE5A 2Q45A 3OIGA 2D54A 4KNVA 5BWOA 1V5WA 5EGNA 1UT5A 1ZUWA 1OI3A 1ZJZA 1GYQA 2FQQA 3L4JA 4MV0A 1T0UA 4QPPA 4S1NA 5HKAA 2RBGA 2Y1OA 5HQTA 3HJAA 4NNPA 4R9VA 2RHCA 4GC5A 1GSAA 3OG9A 3C45A 1Z0JA 3FNFA 1FDRA 3D6UA 4R8SA 5I7SA 1YB2A 1V7ZA 2PX2A 5K0EA 2CV2A 3LSYA 4EECA 1GDDA 3AINA 3NTUA 1YAJA 3SXUB 1WLYA 4MS3B 3KB6A 3ZEAA 1RM4A 1GSOA 1FYEA 4JY7A 4V3BA 4C4TA 10MHA 3LRXA 4D4MA 1YR3A 2FSPA 5I9MA 1UBNA 1TPYA 1ZI9A 3ER6A 3QUSA 4O2AA 1K8XB 3SSAA 3NOVA 5J4KA 1IJBA 3U7GA 2Q3DA 3WIOA 4UTPA 2JZNA 4B2PA 3W9SA 4Q7LA 1N5DA 4GP7A 3KKZA 2J9ZB 2RMKA 2BDUA 4IFEA 4IIHA 3EEOA 3ESZA 4LXHA 5FD8A 5IXJA 5F98A 1E89A 2AG0A 2HQ1A 2O8CB 2AMFA 2E0IA 2YJ5A 2DWCA 4OFZA 2M6SA 2AIRA 1MC5A 2GH1A 1HDEA 1PZNA 1RJWA 1O2DA 3HB9A 2IYTA 4MW9A 3DOEA 3VSAA 4PN3A 3M4NA 1NWHA 2Z30A 2PNJA 5DYIA 3ZDXB 1XEWY 3HXMA 4Q4CA 2BYTA 5BMVB 1Z0ZA 4RYLA 3DMNA 2EFYA 4YP5A 3SNKA 3HNOA 3NKFA 2OP1A 2QTVA 3F46A 4WEQA 3UHPA 4DKXA 2NW6A 3FUWA 2GCOA 5KNDD 3GVCA 1NG9A 2VHJA 3FR8A 1X39A 4FD2A 3ZBTA 2OV1A 2PSSA 3DONA 3LS2A 3NIFB 4EUEA 3KR2A 1VSTA 4ZVQA 1W9HA 4EIWA 1N6IA 4ENQA 5L4SA 4XR9A 3ACDA 5KJCA 2FOXA 2FR8A 3M83A 3W1WA 5BV7A 5HFAA 1CF9A 4P38A 5DI3B 3I37X 1XVVA 5IASA 2Q21A 2I76A 4M0FA 4ZD6A 4RTNA 3I53A 3TLEA 4GVXA 2PV0A 1S8AA 5BNZA 4BB5A 2XE6A 3D7SA 2Z5GA 5LFAA 1A77A 1ORRA 2QX6A 2RJ3A 4DCPA 3FPSA 1GGFA 4ZXFA 4OB7A 3H9JA 2ZRMA 5FWYA 1MNAA 3IOBA 3T0GA 1DDGA 2ALJA 4W5HA 2Z5FA 3HFJA 4GM4A 4QDTA 2GJ8A 2QW8A 4D9BA 3VDQA 4GSYA 5KTPA 5F51A 2RGEA 2ZWAA 3SM3A 1TVKB 2B1RA 3QMWA 3VNRA 3EBOA 1G5RA 4PZEA 4B3JA 1E58A 3MXOA 1TF5A 1XUOA 1NLUA 2JIZA 4LJ6A 2A14A 2P6PA 2R62A 4NCNA 4ALNA 1RQNA 3H9CA 4N40A 4MRAA 5A5FA 5J1SB 1X1SA 3EQ6A 4LDQA 3ZVMA 5KX5F 1E1MA 2IHTA 2B20A 4P31A 5TEVA 1T6NA 1GCAA 5E2IA 4ZAFA 3OH8A 4D4JA 4H31A 2PX0A 1Y82A 1XKTA 3VRHA 1L7NA 1KI7A 1HI9A 3WFZA 1Z6YA 2VFAA 3LX6A 4MUFA 3IHLA 4XUEA 4BS9A 1COZA 2P77A 2R6DA 1R0SA 1C3VA 1AN0A 1J00A 2DMRA 2C8VA 1W0CA 2DZDA 1TUGA 1U02A 3IUPA 1ZEJA 4RPLA 1BYIA 4MVJF 3ZCQA 3WR5A 1PV4A 1YZYA 1KY2A 1NT4A 1HNNA 4K9SA 4LYHA 2FAXA 1ZD2P 5IDXA 4EOGA 4R6WA 1N6LA 3GJ8A 3V2GA 2EF0A 4KX3A 4MV4A 2COEA 3GHHA 1FUIA 1ZM2A 2GVNA 1A98A 5IEBA 4AMVA 2GUGA 1AS3A 2R8OA 3COVA 4YHHB 4IFIA 4DR1B 1Q15A 1NQUA 4Y2SA 2QLFA 2FX3A 4XFJA 1RRKA 1B2RA 3QXGA 1ZO8A 1YHYA 3H9GA 4JZKA 2D5IA 4BVBA 4Z54A 1YJ5A 4EHHA 4JLWA 2WJZB 2ZUVA 2Z83A 3HS3A 3MMNA 1G38A 4ZHQA 4JBIA 3DG9A 5GWXA 4XRGA 4QXQA 1QU3A 4O5OA 4O4JF 4IPTA 3MJRA 3P4YA 2FMHA 4BKUA 3RRJA 1FUEA 3RB8A 4UEJA 4YS6A 3UPDA 2FZ4A 3AGQA 3U4DA 4D3XA 2V9CA 3G88A 4MIYA 4M1SA 4BDTA 1NNEA 2OHGA 4L2IA 4D3FA 2H06A 3MAGA 1BXGB 3NUQA 4FINA 4OXQA 1AD2A 1Z5WA 1CDDA 2ZG6A 1RJ9B 3WNVA 1UMBA 5KNLA 2OFOA 4H0FA 4QTUB 1G7CA 3LMKA 4KMMA 4PR0A 5BMVF 2ATXA 2WAYA 4GVLA 3HNRA 3TG2A 2PL3A 5K8TA 4RFSA 3GBSA 3VYRB 1GWNA 1KZ7B 3LLUA 1ES9A 1R3DA 3QPUA 4G9BA 2ZXUA 1IU9A 5BV0A 2EFHB 4O4IA 3DQZA 3E61A 3ZDQA 1N7JA 2P0YA 3PFIA 2E37A 3VI4B 2CL7X 3SVTA 5T4BA 5JC8A 5E1DA 3DV2A 1R6UA 5E6SA 4HWKA 1G291 2WYIA 2E5WA 4JI5B 1SN7A 2HK8A 1RHKA 4CGZA 1C9DB 2OYRA 3CIFA 2FUG1 4RAQA 2I55A 1CRQA 2HDWA 2PVPA 2JRCA 4O1HA 4TT3A 3QIAA 4U2EA 3VYUB 1PWXA 2ADFA 1CQIB 5CP8A 1RMYA 5E7JA 1R27A 3D6MA 1Y4AE 4V1CI 5JFOA 2OCDA 5L3QB 3PC7A 2X0FA 2IXAA 3QOFA 4GE0A 4N4AA 3RYIA 3OU7A 1Q0PA 2J9YB 4HRAA 2NPOA 3MAJA 2ID4A 2A1IA 2ID9A 1JQJC 3QU2A 3PX7A 2QNRA 4I4TB 4WLEA 1HT3A 2XKKA 1RTKA 1XZBA 3FJOA 4KUEA 4FWTA 3KPWA 1F06A 4NE2A 3PJEA 2JEYA 4I4TA 2IOHA 5MN6A 3LPNA 4LVCA 1OKKA 5ALTA 1PT7A 1M74A 2D6FA 5CBPB 1GNTA 1JG6A 3RTCA 1JR6A 2I65A 2F1KA 2YBDA 3D6HA 2LDBA 4X64B 5IAOA 5KU1A 1YOBA 3RS3A 4WKBA 4XVCA 4EG0A 2QRGA 2F9FA 2VUTA 1PG5A 2QG6A 2SKCA 3CEPB 4ZVSA 2ZJFA 3VKUA 1MF7A 3CZAA 4ILEA 5LM3A 3UJAA 1EP2B 2XDWA 2IU4A 4M21A 1DC3A 4WZBB 4ZYWA 2BH9A 2HGSA 2IVZA 1NJ5A 3VH2A 5IJWA 4DLZA 1S3GA 4Z4IA 4AUKA 1SOAA 4HEJA 4AWBA 1NUTA 3NM5A 4RCVA 3QFFA 2V9PA 4RY0A 8GPBA 5JRZA 3DV0A 1T4MA 2XQJA 4J7AA 1E1KA 4NR0A 2C4HA 4PICA 2OCKA 2O5VA 2J41A 1NIPA 3Q9UA 4FFBB 4ER7A 2WJ6A 3T1YB 1ISFA 3L4EA 4CG2A 4ZTUB 1GR0A 3VNUA 2Y6UA 1B8VA 2H2DA 3RJTA 4PQYA 6PFKA 5CLJA 5HM6A 5TMBA 1O89A 3EA4A 5FTWA 4IUYA 4I36A 5IZCC 1YZGA 1HTWA 2E6UX 2I8LA 3D7RA 5C37A 3AG6A 2GHRA 1R4NA 3L8GA 1GZHB 4ARIA 3WNBA 3DLCA 4XIYA 1XWIA 3B6IA 3AF3A 1Z4IA 1ZM4A 3P27A 2AK3A 4IJ5A 4BO5A 4PZYA 3ZK7A 3GFGA 3SYRA 1YDMA 4LG1A 4JXZA 3ZVRA 4XA8A 5ENDA 2DFPA 1JA9A 5AVZA 3X2EA 4EHIA 4QUIA 1TNDA 2Q5FA 5AVYA 1DAFA 4H3HB 4RMHA 1SEVA 2DHCA 5JSQA 1PQUA 4P53A 3A4MA 2HBQA 5HP4A 2DETA 3H13A 2OEPA 3HXQA 1UMDA 1FSSA 1THZA 3Q3IA 1CR0A 5D87A 1EXVA 2IOFA 1JHQA 4C9BA 4CJXA 3AFOA 1OZFA 4WCVA 2YMPA 5K3DA 1UUFA 4O2AB 4EF6A 1H2WA 4PSAA 3BG5A 3C15C 2H85A 4N5HX 1YFLA 1A50B 2Q46A 2EL7A 3WOVA 5IUJC 5KREA 3CH5A 2VJOA 1NLZA 1DC5A 3GRPA 5K2MA 4KGDA 4KZKA 2A5JA 1RKQA 4K86A 2O8BA 2P9HA 2WM2A 2WDZA 1RRMA 4R2KA 4CWAA 1NYRA 1FFYA 4HH4A 4WN9A 1KH1A 4X54A 3NTQA 3EAGA 3SC6A 3T5PA 2QL9A 4K9PA 1ZD3A 1U0JA 3LHIA 4NVRA 1LK7A 4OU4A 3K94A 4KMRA 3W90A 3O84A 1MU0A 4LGYA 4YQYA 4ZO9A 2BFAA 2VQFB 4TPKA 5BOSB 3MCVA 4RPIA 2EZUA 3A2MA 3DQQA 4HQRA 6GPBA 5M2QA 1P8AA 4E33A 1ICEA 3K05A 1WW2A 3ZIUA 1JS1X 2I4OA 2GESA 2O5CA 5BN3A 4DV0B 5A6VA 1NJ1A 5AK5A 4FSXA 4EL5A 1EP3B 3IEIA 1HYQA 4C7OB 1I2MA 4QDJA 1KXZA 4Q4DA 2A78A 3QE3A 2X15A 1RNLA 1RI1A 2VP5A 2G1UA 3VR5D 4WTOA 1NOKA 4EKNB 3CVYA 1FP7A 2DGDA 1AZWA 1M6NA 5DYTA 3QELA 2Z2ZA 1K3FA 3ML1A 1CPYA 3BDVA 4EVQA 2EKLA 1PSWA 4MKFA 3R5SA 1U81A 3BF7A 3NTVA 3PEYA 1L0BA 1M2VA 4IDNA 4IXNA 5AK0A 1CLEA 3VPXA 2XNSA 1J22A 5PNTA 3WLAA 4OQNA 4F4HA 4YUXA 1C2TA 2XA2A 1OGJA 1Q74A 4WZZA 3VU8A 4B8WA 1NVFA 1UFOA 2QVYX 1Q1NA 1XEAA 4O4IB 1REQB 2RHBA 2LUOA 1AS0A 1F6WA 3CZ9A 3TVDA 3FVVA 4YJ3B 4GGPA 3RTDA 3RW9A 1O96B 1I2AA 3PF9A 1NKSA 3PPIA 4HJXA 4LSGA 4AS1A 2V1XA 5FO1A 2CYBA 5A1JA 2HDHA 3JQGA 1C1XB 3AC0A 3HSSA 1JX6A 2DERA 1TM7E 5C81A 4HQ6A 2V03A 2AHOA 5B57C 3Q7PA 4DMCA 3BILA 4J6FA 1RYHA 1LLUA 4KQXA 2W2OA 2XI4A 4RMJA 4E0BA 1T35A 2BPOA 1JTVA 1RR6A 1J06A 1QP8A 2IL1A 2BSXA 2ZCUA 3L8DA 2BCEA 3UC5A 5BORA 1CJSA 2FKAA 1K89A 1E1QA 4MX8A 3VH1A 2O2EA 4LJ8A 4ZYVA 3PUYA 1FCJA 4QARA 3SE0A 4KXUA 4DA6A 3E2PA 3C3PA 3OX3A 1JKJB 4FOLA 4X8MA 2DKOA 5EZYF 3A9WA 3B7WA 5JYCA 1P3DA 5JWOA 2EC5A 1MO2A 4PC1A 2F8TA 1NZJA 3T7KA 3E35A 3P0EA 4MIEA 1QFMA 1YH3A 4TM8A 1NFQA 3WIVA 3NWJA 2GGSA 2CL6X 3THXB 1RWXA 1U5BB 4YJGB 1JU4A 4RTJA 4PYRA 4B8YA 4J9UE 3R0XA 1I5OA 2FSVA 4G5OA 4HQNA 4DTIA 1YBVA 3QU7A 4PHCA 4RF2A 2E18A 5IBRA 4LF7B 1DINA 1RWBA 2O2DA 3G1TA 3OM0A 2VZ9A 1QIFA 2EWMA 5FNVA 4H4EA 4BX9A 1QG6A 2VHUA 3K8OE 5ADHA 2NX2A 3KKQA 4FOTA 5L7TA 2PSDA 3MILA 5CLGA 4E2FA 1BWRA 1EM8B 2HMUA 2VS1A 2W0SA 4Q3DA 4DG5A 1ZCBA 2CMKA 1KHHA 4FYVA 1A9YA 1M1YE 4J49A 3KXPA 1OASA 2FW1A 1ADBA 1K2VN 3ISVA 3KDPA 4F71A 3KTFA 2JCGA 1JLMA 3OE7A 5EA2A 5CVUA 2QD5A 3L4KA 2EW1A 4AJPA 3B51X 4U7DA 1DKMA 2Y1GA 4OQYA 3DB2A 1XMJA 4MQLA 2QRMA 4AN4A 1V0JA 1YZUA 2ORED 2RDMA 3AP2A 4HAIA 1O5OA 1SHUX 4Q7EA 3IEKA 1JTFA 3S44A 3Q11A 4ZO4A 3DAOA 3TEJA 1NVWQ 4U8GA 4FEEA 4UXJA 5JRDS 4LWPA 4A0SA 4EBBA 4EQ6B 3CY6A 1XD2B 1MO5A 2PUDA 3LC2O 4N5IX 3ROFA 2X2FA 4YUAA 2G3YA 1UFRA 2XIJA 3JTEA 4B81A 4KSBA 4OLHA 4ALIA 1VXRA 4R0MA 4O4LF 1GG9A 4KE6A 1EX6A 2O1WA 5LMCA 4I5DA 2XQGA 4WKNA 4DR2B 2VBCA 4LY0A 4OSPA 1E6WA 5F7XA 4P54A 4DCCA 1IK6A 3SD7A 3PSHA 3ZV5A 4DJ5X 2EJBA 1ZGAA 3VZSA 1Q14A 1I33A 4LHWA 4MMYB 4EHBA 4IS2A 2BMDA 1E2DA 1FNSA 3FYUA 5B2EA 4B7UA 4Y6GB 2QN9A 4C29A 5IHPA 5LMUB 3RK4A 1IBCA 2HB6A 5HKLA 3OM8A 4B84A 4YRBA 1GVHA 4LMBA 3OTQA 1U8ZA 4PWYA 4EITA 4CW7A 5CEFA 4JMLA 3MINB 1RQ2A 1XU7A 1RLIA 3QRWA 1RRPA 4R1OA 4IUDS 2IGTA 2EJTA 5FL7A 2C2WA 1PS0A 4NBNA 4EP1A 2B99A 5GINE 3EMVA 1AH2A 2UZ0A 4MW6A 4KXWA 1N0HA 4PV7A 2UUCB 1O08A 4UEKA 3IHWA 3E05A 3PLRA 4RQBA 3TIFA 3T34A 5K0BA 4DV3B 5HMMA 3UJBA 2AG5A 4YRKA 2CBGA 2GN8A 5FI3A 2TYSB 3DEJA 1S1MA 2OVBA 2ZU0C 2BFEA 3LUAA 5KMGA 5CAEB 5AW0A 1I6LA 5IC6A 1CK4A 3QBEA 3DVLA 4TMKA 5CDUA 3BRWA 1THMA 2OORC 4MAAA 2VSQA 2AKAB 5FV4A 1JDZA 2FPXA 5T6MA 5I48A 5E9WA 4DVJA 2Q9AA 3B85A 4MV5A 3MELA 1TZBA 3GEBA 3ZHTA 4YJKA 1TAGA 3U4AA 3WBKA 3A0UA 1BH6A 1P1KA 1UBCA 1X8JA 4II7A 3DFKA 4IWXA 2BGLA 1RD4A 3H4MA 4Z9YA 5TE9A 3F49S 1TGYA 4B32A 5F64A 2WPDA 1T3SA 4W1QA 5JATA 1IY0A 1VMAA 2VVTA 2ZTSA 3AHCA 1RM0A 3OEHD 3FTQA 4C06A 4UTOA 4DA0A 1VRWA 3FCUB 1MTZA 1V4NA 1Y80A 3HB5X 5LKAA 2JFZA 1QDUA 4TV9A 2LGJA 3ELDA 3LFUA 3SHOA 3EJ6A 2G0NA 2BHRA 1PTJA 3ZDFA 3PRYA 4Q9JA 5AVXA 1PBNA 5DWVA 5I7OA 3WLHA 3K30A 4PPGA 4E88A 1E3TA 1XP5A 4LFBB 4NIMA 4X93A 4AULA 2ANCA 4NYMQ 1MGOA 4GUAA 4YAFA 1LJ8A 2L19A 1AK1A 4BV8A 2IXTA 2ZPTX 5CNIA 1NYLA 1XTJA 4OK6A 4MRMA 4F92B 1RRGA 1Z62A 5EIHA 4R1NA 1KTIA 1A5SB 3THYA 3C3XA 2HU2A 4LRXA 3A7EA 2O5RA 3WO1A 2H7YA 2OHHA 2L82A 3W2FA 2H8GA 4K0RA 4PHFA 1YB7A 2HO5A 2WOJA 1W4ZA 5FAKA 4ETMA 3P9SA 2PQMA 5DBGA 1TO2E 2OMKA 1M2GA 1VG8A 1PAUA 1ZQ9A 1J39A 3HCPA 3L0YA 4QBTA 4Q4HB 4AJEA 4QUEA 5F33A 2J3DA 5ER9A 2BF4A 2CXTA 3F90A 4EYQA 2PR7A 5JG7A 1OILA 4DSOA 4EBFA 1TVCA 2E4ZA 3R7DA 3RV4A 3ZV7A 3SJZA 4CMAA 5IVPA 4LQLA 4LRQA 3VZDA 3WXBA 4P32A 3ZCSA 2UYCA 1RZ3A 3DBHA 2PYZA 4LHXA 1BGVA 1KFCB 1T0JB 3B82A 3GFPA 1MEEA 4MTCA 4TMFA 1VI6A 2I6UA 2I8AA 1Z83A 3R0VA 3WYGA 4X63A 3SSNA 2ZJ7A 1X1CA 2PBFA 1NWCA 2XH8A 4DLVA 2BKLA 2O6LA 2XF2A 1TJ4A 2MSEB 5TQ0B 3BJZA 4C2AA 3AW8A 3GUCA 4UUBA 4BC1A 5KOJB 2PZBA 5C53B 4C7VA 2XTAA 1EQ2A 3EGDB 1FJXA 5CVTA 2D0OB 1FBTA 5IT9A 1GKYA 3HCAA 1IG0A 2E85A 4KR7A 3QVJA 1YD7A 2P11A 2FZEA 1QQ5A 3FCXA 4BNJA 5B7QA 5KWJA 2NWQA 4UBKA 3MB8A 3LVBA 3I9JA 4J7XA 2AUTA 2JGEA 2AC4A 3I3SR 4BTLA 1EZ4A 2C96A 3V4ZA 1IN6A 1E2FA 1K7XB 4ITUA 1NBOA 1TFUA 3BA1A 3F2IA 3AR9A 3NORA 3UAWA 4L5BA 4OY3A 3WI7A 2P1ZA 3M6LA 5J5VA 4QQNA 4EABA 1FFEA 1KK0A 1L4MA 4G67A 4URWR 5IYZA 1WPGA 3IJEB 2GK6A 3S2ZA 4B3SB 3K9QO 3KLMX 3KWFA 1R8QA 2NXNA 2VI5A 2AZXA 1JALA 1VLJA 4BGVA 2PGIA 1YU6A 3B52X 4BNGA 3OF3A 4G5XA 4GF5A 2JLAA 3F5MA 5FTMA 1AE1A 2PBZA 4LXYA 1T1EA 4BJ6A 8OHMA 1QC5B 5BSRA 2JFNA 1CUUA 2FWJA 1JPJA 1T5HX 2J7PD 2FZKA 3GR6A 1V9CA 3HVUA 5EJMA 5IUKC 5KHOC 4FN5A 2ZVJA 3AFHA 1W4BA 3KXIA 2G80A 5C31A 1DQNA 2QIOA 1ZMTA 2F1HA 4UBJA 3EH2A 4UBMA 3P9KA 4WCFC 5B7PA 4C0WA 5IT5A 3ZTWA 3G2MA 4CIVA 4D7AA 2G28A 3GQBA 1QIGA 2R6FA 2XGJA 4UM8B 5BV2P 2JA1A 2Z9DA 2H4FA 3RANA 1LJLA 1LY1A 4HYEA 4QSHA 3TMKA 4DG8A 3HI6A 4CKWA 3KL2A 2J3KA 3OTHA 1B26A 3VX3A 1SULA 3ROEA 3WLIA 1BMFA 4G9GA 1S3IA 1M0EA 5MGNA 3HTXA 3WLQA 2IU3A 1K6JA 1ML4A 2EJUA 2DEUA 5EC8A 5AK6A 2GARA 3X2SA 1NN1A 1EHCA 3HY3A 2QYOA 2NO0A 3CUVA 3OI7A 3R6GA 5E9QA 3LT2A 4B71A 1FDUA 3AR3A 5BWNA 1J7JA 3ZHBA 2G09A 4RJ2A 1EFHA 1FDOA 3GCGA 3M2PA 5EWLB 1JHZA 1JGTA 3BE4A 3IOMA 4ITRC 3TEMA 3QPWA 1ISJA 2X4IA 2PANA 4A5OA 1YI8A 3I9KA 2JI6A 5E4FA 1BQEA 1NXPA 4BP1A 3GLFA 1J8FA 3UAGA 2GF0A 3IMGA 4JT9A 4HLCA 5JTUA 5CX4A 4TT3D 1XCPA 1PJSA 1X7WA 1JDNA 1GZ5A 2Y1FA 4K6CA 1A4IA 1HDIA 2VDPB 2VRCA 4DCJA 1BGXT 1JKFA 1IHOA 1Q7RA 5GVSA 1KJQA 2FG5A 1LA2A 2V0CA 3GUVA 1FEZA 3GWZA 3HWWA 1DIBA 3L79A 3PHLA 2BFCB 2IITA 2JGNA 3JQFA 4I3HA 3UKOA 3I2JA 1C0KA 4M9QA 1DBVO 3OQHA 4OKNA 4BMPB 3FZNA 4Y2JA 3TXXA 3GRCA 3I9LA 1CR6A 3N59A 4UMFA 5EP4A 2OKCA 1JT2A 1ODSA 4DWWA 2FXIA 3I6IA 3SVLA 1XF9A 2PGDA 1ZK1A 1DWPA 3GUYA 1VHJA 4FXOA 4MINA 2BGIA 5JAZA 5EOVA 1KI8A 1RE1A 3FPCA 3QKTA 1ISIA 5DT2A 3WJ2A 2J6IA 4R6XA 4AX4A 1YJCA 4FE3A 3ORRA 1VE9A 1TQ2A 2F3UA 2I8CA 3DR3A 4LNUA 4F9FA 1TLFA 2QBYB 2CFOA 1W1WA 1UMDB 3O0DA 3B1JA 1WS6A 1TT5B 3OETA 3JD0A 4HYTA 5IANA 1MLDA 3VAZA 3GEHA 2YNMD 2FA9A 4KDEA 1YUMA 5FWYB 5H80A 2VQ3A 4FLMA 1TLTA 1Y6GA 1POXA 1RCUA 3H2HA 3G0HA 2ISQA 2XUHA 1JIIA 1IM2A 1Z6XA 3ZQ4A 4O25A 4RY8A 4ZOLB 4XYEA 2HF8A 1COWD 3CO5A 3IV7A 3ZW7A 4YRMA 5A4KA 2W8BA 2PU7A 3IHKA 1FP4B 1RAAA 4ON9A 1X8XA 1T6ZA 5DYNA 2YUIA 3NIDB 4OQPA 1IULA 1SBYA 2ZRLA 4XFKA 4YNBA 5F1KA 3K53A 3DMDA 2IYAA 5GONA 3ZDAA 1OXSC 1HO3A 1KIAA 2FEAA 1RBMA 1XR3A 2FLWA 2QRLA 5D5HA 3FOCA 1XSEA 4W8HA 1QVAA 4W5RA 1O9BA 1H05A 1MOSA 1TB4A 1QO0D 5AW8A 3JD3A 1Q0RA 2A0WA 1EQAA 4JI4B 2AMJA 4QL3A 4B47A 2H2GA 1YS6A 1UPAA 3D4IA 3G7SA 4U8HA 2J33A 3SG0A 4CL0A 3L8YA 4WDRA 2AJDA 3KQYA 3C7KA 3LNTA 4UW9A 5DEIA 3JQAA 5HRUA 3D9QX 5F9HA 4FOSA 5IU6A 4HGPA 2QRUA 3MCWA 3SJCA 5LUBA 1YRBA 2LCFA 3IAXA