2YJ5A

Conformational changes in the catalytic domain of the cpx-atpase copb- b upon nucleotide binding
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
251
structure length
246
Chain Sequence
LSLYEKMLHKGMIIKNSNVYEKIKEIDTIIFNKTGTLTYGTPIVTQFIGDSLSLAYAASVEALSSHPIAKAIVKYAKEQGVKILEVKDFKEISGIGVRGKISDKIIEVKKAENNNDIAVYINGEPIASFNISDVPRPNLKDYLEKLKNEGLKIIILSGDKEDKVKELSKELNIQEYYSNLSPEDKVRIIEKLKQNGNKVLMIGDGVNDAAALALADVSVAMGNKNVADIILVSNDIGTLLGLIKNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COPPER-TRANSPORTING ATPASE
publication title Conformational Changes in the Catalytic Domain of the Cpx-ATPase Copb-B Upon Nucleotide Binding
rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 61
structure length 246
sequence length 251
chains with identical sequence B
ec nomenclature ec 3.6.1.36: Transferred entry: 7.2.2.19.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2yj5A01
3.40.1110.10 Alpha Beta 3-Layer(aba) Sandwich Calcium-transporting ATPase, cytoplasmic domain N Calcium-transporting ATPase, cytoplasmic domain N 2yj5A02
5AM3A 2R8YA 2JARA 2YBDA 2GFHA 3MC1A 3OCXA 4UM7A 3CNHA 1U7PA 3CZ4A 1XP5A 5ALQA 3SLRA 3OCUA 2VKQA 3E58A 1CR6A 5AVXA 1SWWA 3WK6A 4HGRA 2HDOA 3BA6A 1Z4MA 3WK9A 1TJ5A 3EF0A 1RMTA 2PR7A 3BWVA 2I34A 1K1EA 3NAMA 3UMBA 4BEWA 2P69A 3L8FA 3FZQA 3ET4A 3HLTA 3ZTWA 4BEVA 4CF5A 5AI4A 2CFTA 5AW0A 1RMYA 3ZI4A 4KX5A 1EK1A 4UATA 4JDPA 1AQ6A 2R8ZA 3A1EA 3WKEA 1TJ4A 2FUEA 5AVRA 5ALHA 4QQFA 2RBKA 4QJBA 1NNLA 4ZEXA 2CFRA 3OTQA 1RQLA 1O03A 3OCYA 4KNVA 3M9LA 4H1WA 1TA0A 1YS9A 4EENA 2G0AA 2PQ0A 4CNQA 3W5CA 3QUBA 4MUMA 5AKKA 2IOFA 5ALIA 4EEKA 3VAYA 2FPUA 3AR4A 5AVSA 3U7FB 2G1AA 2AH5A 2YMMA 5AKYA 1XVIA 2C9MA 1Z4LA 3FPSA 2A29A 2ZBGA 4YGYA 5ALPA 2C4NA 3A1DA 3AR8A 5ALOA 1QQ7A 3A3YA 3FGOA 4Y2YA 5AK6A 3WKDA 3R09A 1VFPA 4KX3A 2X4DA 4O8CA 4GIBA 4L6CA 5ALMA 1S2OA 4IG4A 2CFSA 2EARA 5AICA 3ZVNA 3IB6A 4BX3A 1ZRMA 3L7YA 1F5SA 3QUQA 4HGNA 4EZEA 5AVQA 3ZW7A 5AI6A 3DNPA 4DW8A 3EF1A 2ZOSA 2BY4A 1QH9A 2B82A 3E81A 2KMVA 4YCNA 2P9JA 3OCZA 5AI8A 3B9RA 4XPZA 2QYHA 5AKZA 3SKYA 5AESA 4L57A 4UMDA 4UMFA 1Z4KA 2FPXA 1WZCA 5AW3A 4G9BA 3QXGA 3I76A 4NAVA 3ED5A 1FEZA 3N1UA 2WM8A 3I6BA 4BBJA 3ZX4A 5ALVA 2OYCA 3EPRA 3KBBA 4FE3A 2IOFK 5E0OA 2WF6A 5AVWA 5AW2A 1U2SA 1S8OA 5AVZA 5AM2A 1Z4IA 2FEAA 2DQSA 2R8EA 2HHLA 3FPBA 5ALFA 5AKLA 4BX0A 2CN1A 5AI9A 2YJ5A 3ZWDA 4G63A 5AVTA 2WF5A 1TE2A 3ZUPA 3MPOA 1Z5UA 2EATA 4UMEA 2YJ4A 1ZJJA 3L0YA 2JAUA 4Y2QA 4Y2TA 2HO4A 2IA5A 4Y2PA 5ALWA 1Q91A 1ZD3A 4OCZA 4UU1A 1QYIA 4KNWA 1RLMA 5ALKA 1RRCA 2P27A 4F71A 1L7OA 1Q92A 1MO8A 2WF8A 5ALDA 4RESA 3NIWA 3IRUA 3SD7A 4UARA 2ZG6A 1RC8A 4I9FA 4UW9A 3WK7A 2NYVA 3W5BA 4J03A 3N8GA 3NRJA 3UM9A 3L8HA 3ESQA 4KYTA 1Y8AA 2YJ3A 2HOQA 1WR8A 3QUCA 3RF6A 2JAOA 3AR6A 1PW5A 3K1ZA 2B1QA 2O9JA 3QGMA 4HAIA 3L1VA 4Y2VA 3QUTA 3ZU6A 1Z4NA 5AIBA 1IWOA 5ALTA 4OD0A 3WK8A 1ZD2P 5ALYA 1LVHA 2OBBA 3DDHA 4AS2A 3SMVA 2WHEA 5AW9A 1RMQA 4DCCA 2WF9A 2YMQA 1O08A 4B6JA 5AVVA 1LTQA 5AM5A 3ZTYA 2I7DA 3PDWA 4ZEVA 2JGAA 2MSNA 1L6RA 1U7QA 5AW4A 4JB3A 3U7EB 3KC2A 1Z4OA 3U7GA 5AW1A 5AKXA 3GYGA 5AM0A 3L0CA 3IJ5A 5ALJA 2W43A 2Q4TA 5ALRA 1J8DA 4E88A 3R9KA 1RLTA 1RLOA 4BKMA 3NASA 1T9ZA 3HYCA 3N28A 1EK2A 2AMYA 3ZVMA 4UMVA 1N9KA 2D2VA 3ET5A 2Q4RA 4DFDA 4EX6A 5AK3A 4YH1A 3KDPA 5AI0A 5A3RA 2I54A 1RKVA 4HGOA 4XQ0A 3NALA 4NV0A 3SHQA 2QLTA 2YN4A 5AM1A 2AGVA 3U13A 4XE5A 2R8XA 1J97A 4HGPA 3OCVA 3ZX5A 4ZEWA 5JJBA 4NWIA 1VJRA 3S6JA 2JAWA 5AI5A 2OM6A 4UM5A 4C4SA 2B1RA 2FUCA 2G09A 1YNSA 2FPRA 3UMGA 2HCFA 1ZOLA 3AR3A 3AR7A 1YJ5A 1QQ5A 1XPJA 3MMZA 3F9RA 1U7OA 3PGVA 3L8GA 5AKEA 1SVJA 2HX1A 2GHQA 3AR5A 1ZRNA 3FVVA 2YY6A 4UASA 2ZBEA 3TLMA 3QYPA 4BNDB 5AW6A 3U19A 2W11A 5AKJA 4I9GA 1CQZA 1RDFA 2ODAA 3QU4A 3PCTA 2BDUA 2BDEA 1L8LA 1Z4QA 4F72A 1Z4JA 1L8OA 5AKGA 1U2TA 5ALSA 5IS2A 2RAVA 4MWOA 5IT0A 1T5TA 1U02A 3WK5A 2G80A 2G07A 3AR9A 3ZWKA 4J2TA 2YMLA 3QX7A 3EWIA 3WKCA 3A1CA 4FFDA 4YCLA 1RKUA 3N5KA 3WK4A 3I1YA 4XOUA 4YIHA 4BYGA 3W5AA 1ZD5A 2B8EA 4C4TA 3WGUA 3QU5A 3QU2A 2I6XA 2O2XA 3DAOA 5AW5A 3E8MA 4GXTA 3ZVLA 2G06A 2ZBDA 5AKIA 5AM4A 5ALZA 3U7HB 3KD3A 3L5KA 5ALXA 2I55A 4YCMA 1SWVA 4Y2XA 2ARFA 3ONNA 1Z4PX 1X42A 3B9BA 1JUDA 5ALGA 4YIKA 5ALUA 5T41A 2C8LA 3WKAA 3L1UA 2ZBFA 2WFAA 3PGLA 3QU9A 1NRWA 5AVYA 5A3SA 5AW7A 2A00A 2W4MA 4HGQA 3WKBA 2YJ6A 3NANA 3QNMA 4UU0A 3W5DA 4UAVA 4C4RA 2ZXEA 3FM9A 1WPGA 2YFYA 4KN8A 1YMQA 4BNDA 1SU4A 2HF2A 4RETA 4EELA 1RPZA 4UAUA 2IOHA 5ALLA 3U26A 1Z5GA 3GWIA 1MH9A 3L0BA 2FPSA 2IYEA 2KMXA 5AK4A 2HI0A 3DV9A 3P96A 1N8NA 1L7MA 2FPWA 3NUQA 2G08A 4Y2UA 4Y3UA 1Q3IA 1RQNA 3M1YA 1ZS9A 4IFTA 4EX7A 3QLEA 1RKQA 1Z88A 1TJ3A 2B30A 1QQ6A 1VJ5A 4OFZA 5FP0A 2HEGA 3SF0A 2GHTA 2WF7A 2Q5EA 3KZXA 2PKEA 3UMCA 4AS3A 4CF4A 3N07A 2YMPA 2NO4A 2MU1A 4CE6A 2C8KA 2P11A 3D6JA 2RB5A 4NABA 1T5SA 1MO7A 3KOOA 2OA0A 2EAUA 4L6AA 5AK5A 3RFUA 2FI1A 1KYTA 3AR2A 4NFLA 2I33A 4Y2JA 4CF3A 4DWOA 3MN1A 3J7TA 3E84A 1L7PA 3SKXA 3L8EA 2C88A 4PNHA 2AUTA 4Y2SA 5A3QA 2HSZA 3QU7A 2FDRA 3I28A 1YDFA 1ZD4A 3B8EA 3ESRA 5AKHA 1WVIA 5AIAA 4AP9A 4BX2A 5AW8A 5ALNA 2GO7A 2RARA 2B0CA 4OHFA 5IT4A 2B8JA 1L7NA 4FYPA 3OPXA 1YV9A 2GMWA 2NO5A 4HYTA 1NF2A 4Y2RA 3R4CA 2HF7A 5ALEA 3OCWA 3WGVA 5AHXA 5AVUA
chains in the Genus database with same CATH superfamily
5K3CA 5AM3A 5CHEA 4RANA 3OCXA 1YJ8A 2FW0A 5DSZA 3W9BA 2X23A 2X0JA 1KQFA 2JAQA 1K2WA 1G5HA 2C29D 2XTZA 3CUEF 3D8UA 4FKMA 1U2GC 5JXWA 4PAQA 4X6XA 3RWOA 1PGQA 4KKVA 3KPVA 2ZAOA 1H9AA 2XVAA 2ZB8A 5IAKA 2IUFA 1QF6A 1NP3A 4Z9BA 1T4DA 2W2LD 2IH2A 4XZ3A 1SVKA 1J0XO 3DBVO 1NSFA 3NAMA 1NMQA 2BFEB 2RHCA 4DEYA 2BEJA 3BD8A 3IODA 3L8FA 3UJBA 1WPRA 3MRSA 1ULUA 1VE6A 1VKZA 2Y0PA 4AB1A 4B7AA 4DGQA 5KOJB 4XIYA 3CWCA 4O4HB 1AB6A 3IE2A 5BOVA 2GLUA 4QFCA 1W93A 2FWIA 2GNOA 4N6GA 3TM5A 3WL5A 4FR2A 2UYCA 3RTEA 1DJPA 3IVAA 3DJYA 3M70A 1YZKA 4UXHA 5EE9A 4JIMA 1JE1A 1TJ4A 6NULA 4ENPA 4O2AF 1NY5A 2O14A 4W9MC 1CNMA 1ZJWA 1RQXA 1SMKA 3AF0A 1MUUA 1F51E 2C4KA 2WWWA 1YZ3A 3HJRA 1XNQB 5K20A 3BXHA 2JEYA 2NSHA 3KQMA 4WBNB 1NE7A 3TTUA 9LDTA 4ZYZA 3T7SA 1FY2A 1M34A 1HUQA 2Q4OA 2NUPB 4NSNA 3VBCA 1QONA 1R6TA 4IMJB 4BQRA 4JJGA 1P75A 3MCVA 3ZQ4A 1UDBA 1YZUA 3C3CA 4HN9A 4HDNB 2Q99A 4R9UC 4JX9A 1YCDA 2V7XA 3ZQKA 2Z6VA 4MJLA 1Z2EA 2XKBA 1HE8B 5P8WA 2HSWA 3PDHA 3U7FB 2PR2A 1X9IA 2C2XA 2Q1WA 3FPSA 2A29A 2BFCB 1ZN7A 2XUGA 4KZPA 3ORFA 1FFXB 3SIRA 4LOAA 3C6BA 3RQIA 2VO1A 4CEHB 3K20A 3OZCA 3BMNA 1ESNA 4HYQA 3TVTA 1YOVB 2JW5A 1X8KA 3A3OA 4YRCA 4ZVTA 1SKBA 2NVWA 3TX6A 3TG2A 1NVVQ 1Y1KE 3LT4A 3HVRA 1G0NA 1ISGA 3DTYA 3F5FA 3LK7A 3OKAA 3ONEA 4N3CA 3WWYA 4AY4A 2HR1A 5ER9A 1OI4A 2Y8EA 4MP3A 3GRKA 4IKOA 1RADA 2B7LA 2FN9A 3DC7A 1X1SA 3TFQA 2A33A 4K6FA 1V1JA 2YXPX 1DIAA 3KQTA 3NHUA 4AQDA 1RJGA 4BDTA 4NIMA 1SOAA 3JWHA 3D4LA 1FFSA 2FJPA 4FJ1A 3RYCB 2MSWA 3U4QB 4NATA 3OSZA 3RRJA 4MUYA 4LYGA 3IP3A 2NTJA 4MQMA 3WVNA 5EE5B 4EUSA 1NJSA 3Q3HA 3RANA 3KXLA 4G67A 4NQRA 2APJA 5KDLA 3U1VA 3QEJA 1IMJA 3EGDA 4GMKA 4XGRA 1L4NA 1AUXA 3RV4A 4KU4A 3PS9A 2EC5A 3UHAA 1NI3A 1YHZA 2EYQA 4OUDA 4JUCA 4HEA6 4HRVA 2FRVA 3LCMA 1MDBA 4XI9A 3FTCA 3A6PC 1QTQA 4XEHA 2Z58A 3C16C 1D5CA 1OIXA 2BKAA 3EULA 4KC0A 3LE8A 4Q18A 1BAPA 2GBCA 1V39A 3GA7A 4EWLA 1G21E 2N1BA 4MA5A 4WA8A 2IOFK 3V8NA 5M7EA 2AZMA 4NENA 3I04A 4NHOA 4W5NA 2HDNB 3KJXA 1KI4A 2C95A 8OHMA 1PE0A 2H54A 3CWQA 4C0JA 2BBSA 3AFIA 5ARCA 4C7BA 4GI3A 2O8CB 1KOJA 1YRHA 2DQSA 2R8EA 1S1MA 3MTGA 1Z38A 1UXHA 1T13A 3GYBA 1B1AA 3IT1A 3K32A 1AMUA 2CN1A 4WFJA 4ZQBA 3SX0A 3FPLA 2B2XA 2P4HX 2XXJA 3I2GA 1L5ZA 4MW2A 2RC5A 3T9BA 4GLJA 5A4IS 2ES4A 3JVVA 4KH1A 4WLEA 4C5CA 3TBHA 1CC1S 2H9YA 5CA0B 1UOOA 1Z2PX 3UHPA 4EW1A 2JAUA 2WR8A 4MKRA 1F3LA 4YJFA 1Y6RA 1J7KA 3ZE2B 1XN4A 3LUFA 4MRMB 5TY0A 1E3WA 1OD6A 1AGXA 4FI3C 2XVYA 3LCVB 3T7AA 3WBBA 1F2UB 1WM1A 3PLRA 1OYVA 1KEWA 3INYA 1D2GA 1TI7A 1CJMA 5ARDA 3HEBA 4TKLA 4BAGA 1Q92A 4C89A 3M5DA 1AK2A 4GQIA 1DG1G 4XQEA 2BONA 4M8IA 2YFKA 5JDIC 1Z7GA 1W29A 2OXCA 4P3NA 2O0LA 2XWQA 1BA3A 4JUIA 1KFBB 1Q7GA 4GPEA 3L8HA 1FL9A 4XW2A 4CM1A 3S8YA 3V9PA 2C3UA 2XUJA 4J0KA 4Q4HA 2Z8YA 1WXFA 2Q9UA 3MILA 4K46A 2P62A 5A4FS 4MYSA 2O9JA 2DJIA 1DT3A 4QXPA 5D3QA 2P4EA 4FLFA 5FRDA 2CSXA 3L1VA 3UKJA 2V59A 2MT9A 4EDHA 2BWJA 1RBMA 4J91A 3WK8A 4B8WA 4AT1A 2ISCA 1LPOA 1RD4A 4CYMA 1C4XA 3BPSA 1KQPA 1YIDA 2J67A 2Q45A 3PQ4A 3IDOA 4X91A 3VTFA 2XMBA 4XQGA 4AROA 4ER3A 3E9DA 1TPZA 2BRUA 4QSHA 4Z9AA 3ZWNA 5I7VA 1GG8A 2JZNA 2Z1MA 3GNQA 5EI5A 1E8NA 2VDVE 5AVVA 5AM5A 1R16A 3JQ9C 3SLGA 1HZZC 2EHDA 3OOSA 4KIJA 4DSZA 3N59A 2FLVA 4UD6A 1ZK2A 3UW1A 1XVVA 1WBJB 5FPHA 4EUHA 3IT0A 2NU6B 3I01M 3IP6A 3NHLA 2K2WA 1WQ1R 4YJ3F 3RJZA 2QT9A 4XCXA 5DULA 4MIYA 4P35A 4DY6A 1UOQA 1UZUA 4BRSA 4FTWA 4C0HA 5AW4A 4CL3A 4Q7QA 1ONOA 2J48A 4XDGA 1GKIA 3U5ZB 3GRVA 2H57A 3G68A 3OZGA 2Z6AA 5JU6A 5JWOA 2YS7A 2HJGA 2PVSA 3QVGA 1ONPA 4B7XA 3FCEA 3C87A 1VDMA 2Q2WA 2VJNA 3LHKA 2ZAYA 4GG1A 3NRBA 5SYAA 2WWRA 1EE2A 3DFUA 4BRZA 4LOLA 4Q4LA 2SKDA 3UN1A 3UA4A 1EHIA 1NQTA 4X85A 3C7TA 7AT1A 2FZEA 3ONVA 4EX6A 2IIVA 5KKNB 1AV7A 5LZ5A 4RFSA 3TWOA 1H5UA 1JKFA 1QHHB 5DBIA 2DFKB 2AHOA 1GP2A 4G1BA 4P4SB 5FBZA 2IZ5A 2OGSA 3ND6A 3MWGA 2AYZA 5DIZA 3W9UA 4AXBA 2X2FA 4NV0A 5JFGA 5JZBA 5KYYA 3JWEA 3BUSA 5GMOA 2G1KA 3DF7A 4NMMA 4Q16A 5LFAA 4K5QA 1NFQA 1E79A 3ASUA 3V97A 2A5YB 2C9BA 4R7GA 5A4MS 2QW0X 1GKUB 3BICA 1DRVA 2XLCA 5DVZA 4Z2YA 4J6FA 2YXLA 1TIPA 1JQLB 1YE3A 3EVGA 2CXOA 3P0EA 5KU7A 1P5ZB 2FHPA 5DT9A 1AUVA 4C7OA 3A06A 2PSHA 3I92A 5AI5A 4DBVO 1PWYE 3AERB 3EYAA 4PTZA 1RYDA 4Z4EA 2G09A 3LHDA 4MGEA 1PFVA 1C7IA 1EP2B 1FX1A 3OU2A 4G01B 2MSLA 1UJ5A 1ZD8A 1ZGGA 1XZCA 5IVIA 3U31A 1VB5A 2VBGA 5CDFE 3C7AA 3VVCA 3AWDA 5LP6B 4GSKA 4DUGA 5UKDA 4MGYR 3PGVA 3AOEC 4YFVA 1F4VA 1JDZA 1BFKA 4DV5B 5BN4A 1JHDA 3TPZA 1KC3A 1QIKA 1DOZA 3FOBA 2OV2A 4AVYA 1YK1A 1X1BA 2ODQA 2RGYA 2IYUA 3C45A 3QMWA 1UC4B 4DRXA 3Q3EA 4LXGA 1A82A 1F2DA 3TL3A 3QSGA 2ODTX 3HDVA 4LXQA 3V8QA 3EW9A 1SBHA 4QU5A 3L0SA 4Y1RB 4DMLA 4JCOA 3GGSA 1ZC4A 3C6XA 3JD3A 5K0JA 4R01A 2DUNA 1CY7A 3H86A 1MP0A 3SG0A 5LD2B 2GD0A 3S2FA 1BWSA 5IS2A 4ZAXA 1MO5A 1PWXA 3LY9A 2C9DA 3HABA 3M6UA 1SVOA 2OWDA 3O91A 3NR2A 4P0PB 3OIDA 4G6ZA 3QX7A 4UU7A 3AP1A 3BBLA 3BB1A 4FFDA 4KGVA 4NYIR 3HP1A 1BWPA 3H1TA 4JLPA 3N5KA 1CRWG 3AETA 3HL0A 5DYYA 3FF1A 1GN9A 5U9CA 3V4SA 4CDGA 1R5NA 1VSQA 4NXNB 2REXB 4QG3A 1ZHOA 4DCOA 3IDFA 1KU6A 1W0JD 2I6XA 4YT5A 4EA7A 2Y67A 1YZNA 2FXIA 5A3JA 4FINA 3E18A 5IF3A 3JY6A 4MCHA 3IL2A 1HKHA 2DY0A 4B6SA 3AG6A 3IV7A 3OIGA 3QKSB 1TOAA 2AN3A 2ZLBA 3KZKA 5ADHA 4UUQA 4XJTA 2QX7A 2YWHA 3WO1A 3I1FA 4E22A 1EVIA 2VRBA 1QZXA 1WJGA 1EUCB 5KTSA 3QFCA 3KD3A 3ITKA 5T6BA 3THOA 2D1RA 1DKOA 1Y9DA 1SWVA 3AGPA 3AEQB 3DMRA 1FLVA 2DBRA 1SUEA 3F5QA 2K5UA 3JASA 4U2FA 1RXYA 4ALIA 4QVGA 3QE4A 4ZAWA 1A88A 3EDOA 4AN1A 2I65A 3BJMA 2AEJA 2PJRA 3CLVA 1CUIA 1P2BA 2CVHA 1K7EB 4KQ6A 2NADA 1KU0A 5E2AA 2C8LA 2REOA 1C9MA 1THZA 2P90A 3IJRA 3MJSA 4YAFA 3ZG6A 5IJ0A 3I9LA 5KTPA 5J2UA 2X40A 4G0MA 2E3JA 3JQ7A 2GT1A 1MHPA 4TT3A 1XTSA 4YJ3A 2Z57A 4RPGA 1GAWA 5DYTA 1MKYA 2ZUCA 1DAFA 5HIAA 2OHHA 4JVLA 3AJEA 3K9NA 3QTLA 1KH3A 3PFBA 5K3DA 5TGTA 3EXAA 4UAVA 3ZCVA 4EB6B 2JK1A 1YDEA 4HDKA 3MRXA 3NYIA 4UCQA 1IY8A 3IP7A 2NU7A 3UQYS 1HYBA 3HZOA 1J21A 1SOWA 3JX9A 3VYWA 3ROXA 2WK1A 3NZEA 5TB5A 3J80A 1NPTO 2X0NA 2C1EA 4FFPA 3IVMA 4C76A 2LKCA 2CDAA 4P4NA 1E9DA 3F6BX 3CISA 3PGKA 4R05A 4WK0B 3LUKA 2CLCX 1SC9A 1WTAA 4RZQA 2W2PA 5H3CA 2FPWA 4EBFA 1YKGA 5IC5A 3RU9A 3NUQA 3RVBA 2VP6A 2ERYA 1T4GA 2BHLA 2CCGA 4ZODA 4B81A 5AH0A 2FH5B 4X66B 1OC2A 1RKQA 3OUZA 1EP9A 4PZPA 1O58A 2B0JA 4X45A 2ONKA 3DGEC 3OJFA 1MFZA 1VJ5A 2FF5A 2OBMA 2BJVA 2IF0A 2WTUA 2WKRA 4MHOA 4XX0A 1IY0A 1HBJA 4QU0A 5B6PA 3LPMA 3MLAA 3WLPA 4NS1A 3G02A 3QMMA 5FCDA 4O4LA 4YMTA 3Q3JB 2JEOA 1J70A 4GUDA 3IHKA 3UMCA 2NZXA 2C5GA 1HE4A 4DNPA 3UGJA 1N8TA 1QHIA 2ZREA 3TJMA 5NULA 3LGSA 1O57A 1TECE 2X7JA 5E3IA 1V8DA 1QM5A 2D2IA 4PVCA 4X64B 3ZR4B 2XXAA 1U7TA 3VC7A 2FUKA 3G9XA 3D6JA 1G9TA 4J1SA 5JISA 1XTQA 4JBNA 4RS3A 3STHA 3PC7A 3UATA 3M0EA 4FFRA 1M7HA 3L04A 5L4SA 2ZUVA 4J6EA 3D6NB 4J9VA 1KETA 1EJ2A 1YS1X 1XRQA 1E2JA 1CG6A 1ZMBA 3SEFA 2BSQA 1JEQB 5KYYB 2ZYRA 3A26A 2PGDA 2NGRA 4E6PA 5FA6A 1P9NA 3FOAA 3SKXA 2K87A 1XMVA 3AF5A 4PHHA 4UTZA 4BV8A 1PJLA 2C88A 2AJ8A 4XLLA 1PS9A 3CH5A 4LXTA 1H8EA 4MI1A 2OOKA 4WZBB 3R44A 3MCTA 2M6KA 2P35A 4WXYB 3WL4A 1HORA 2UKDA 3GJ8A 3I2FA 4YONB 1S8AA 2C20A 1XZLA 5E1DA 1W5EA 2XMSA 3KUXA 4KXWA 2FP3A 1TJPB 3BWMA 2CF5A 3DPUA 5IAGA 3ZEAA 2P4SA 4LGMA 3OWOA 4F5ZA 4INOA 1JRLA 4W9RA 1YI0A 3GARA 4M0KA 1LBTA 4NPAA 4PCLA 1K5PA 1ZOOA 3BDIA 3GDFA 1P1CA 3VVMA 2XTNA 3GLGA 3H42B 1QFYA 1CZKA 3M3HA 3FPHA 4FD3A 5KNBA 3BDAA 2FQXA 5IJ9B 5TVKA 5IP5A 1QH1B 1E7SA 1EP1B 4CKCA 3AI7A 1KO5A 3G0IA 4MCIA 5EWLB 2AG1A 3MM4A 4PEVA 4BP3A 3H1FA 1HQKA 1SXHA 2PXCA 4P1ZA 4EA8A 3N8IA 4R71A 1T29A 1E94E 4UCXA 1R4MB 2Y3IA 3D2AA 3Q9LA 5H3LA 5MN4A 3DB1A 3K6SA 4B5KA 1X7GA 1GU7A 1IONA 1L3BA 1LQTA 1SPBS 2VTDA 3A9CA 3KU1A 4YP6A 3UT6A 2CF6A 4DJTA 3HB5X 1FFAA 3ZHBA 3ESZA 4PM4A 2I8LA 2CXPA 3MTDA 1EP3B 4BMCA 5IKPA 5FBQB 4KK3A 1PZNA 2IUYA 5GTDA 4LSWA 2EKZA 3CEJA 1GEGA 2OBNA 3CPJB 4FMBB 3TL2A 5JASA 4P34A 4DY4A 1G7SA 1WU8A 2QPTA 4WERA 1GFZA 3KSUA 4KVFA 1Z74A 4EFDA 2IIQA 2J30A 2AW5A 1UKYA 3BCUA 1YR9A 2C7BA 3PYMA 4BWGA 1QVAA 1FTYA 3KXIA 3GVCA 2HBYA 1D03A 4GECA 2I9PA 1J2JA 1I0LA 3EXFA 3P2OA 4BQFA 3HDQA 4QA9A 4B7CA 2CMGA 3D59A 1MORA 3I2YX 3IOCA 4FDVA 4PYIA 4MP8A 3RABA 2O5RA 3U37A 1VPWA 1DWQA 1P8JA 3TZEA 2QDXA 4IWXA 3R3VA 3BKWA 5JNTA 4MR8B 3N7TA 3R3WA 1KNXA 3IIEA 1E1QD 4LOHA 4QDJA 3HSKA 3TPFA 3UCEA 1NT2A 2IS2A 3OO0A 2ATCA 4ZEXA 3MTAA 2CFRA 4J16A 4YLGA 3C97A 5SYNA 3GJQA 1ELOA 3D5TA 3DLPX 2XIQA 3KP1A 4AICA 4BIIA 5M34A 2IQ5A 1UEIA 3LW7A 3CH6A 4L2IA 4OHVA 1JIKA 3UJ9A 5BWMA 1G8YA 5JY6A 2QG9A 1E1CA 4RTKA 4MS1B 1Q7CA 2MTBA 4YROA 3IUYA 3A6DA 2ZT5A 1R10A 4ERXA 1DGQA 1UFRA 2X7XA 2X5XA 4H7JA 2FR0A 3NM4A 3C7CB 5AVSA 5JYEA 1C5KA 2PRZA 2ZIXB 4H6WA 1RXSA 2DFNA 2C9MA 3DE0X 3BWEA 1D1SA 3GQBA 2PX6A 4TMZA 4LRXA 621PA 3KT3A 1M7GA 1DCMA 1N9GB 1T6BY 4MJ3A 2JFBA 2JGEA 4BQOA 2BCJQ 5JSHA 4RAOA 3WAGA 2IL1A 4IJWA 4ZT2A 4AKHA 2UZ3A 2FJ0A 1YBHA 2WPDA 1KPGA 1QQ7A 2FLWA 1JLLA 3EAQA 3QY0A 4G3XA 5DEIA 2DUUA 2DPMA 3CUWA 3L0IB 3PDIB 1VCHA 2WSIA 2IVZA 4GP9A 1AA9A 3GFOA 1G8SA 1TVKA 3BIXA 3PSHA 4KYVA 3TXYA 3GWZA 3OFKA 2MR5A 4Y7DA 2J3KA 3KOYA 3MINA 2FEPA 2H9AA 2BFFA 5AOAA 4W1QA 1MENA 1NUAA 2QEQA 2W90A 2WZDA 2ZSEA 3AHFA 3JU3A 4NU8X 1LBQA 4XVRA 3NIDB 2OFFA 3U3JA 1N2XA 3INTA 3OU6A 1GKLA 3OZFA 1O97C 4RTMA 3ZWQA 3FROA 1HURA 5KSYA 3CCFA 3EF1A 4FYXA 1Y42X 2W8ZA 3N3BC 1WW2A 1Z0FA 3DVQX 3O8OA 2O0KA 4HJRA 3ZN2A 5DH9A 2AOUB 1MO6A 4GD3Q 4F3KA 4L0CA 1PUIA 5KPJA 1KEPA 2F17A 2KM1A 2NAPA 1E7RA 1FS6A 5LMCA 3D2CA 2VPWA 3LTNC 3NDIA 2OFOA 5BSKA 2R96A 5KJ6A 3PI7A 5BSTA 2HPZA 4R51A 1NUSA 3PQ5A 2XJ9A 3QXGA 4FS3A 4Q1CA 1PJBA 3N1UA 4II2A 3D3QA 1VGVA 3PEEA 3B1ZA 2JFQA 3LLSA 3QPCA 1RHUA 2R1TA 3FHCB 3OX2A 4KQGA 4RSMA 4D9EA 5KYWA 3LDAA 2FPPB 1ODLA 4BNTA 5AVWA 3OX1A 2CFIA 3E7WA 1W9MA 4Z3DA 3DEJA 1XCLA 4H6PA 5FPSA 1CB7A 1RLJA 2DH5A 1N6LA 2OTCA 2YOGA 3ZGNA 1AKRA 4FQ7A 2CY0A 3QVSA 5DP1A 2CXNA 1JFVA 3E5MA 4J0IA 1J2UA 1P2SA 5FBKA 2QVLA 4KXLA 2DTEA 1DBPA 3VU8A 4OYLA 4Q9IA 1FNSA 1OXUA 3TAXA 4G9GA 2BFAA 4HZIA 2TRSB 1QIGA 3PC6A 4YMWA 2WF5A 5H80A 5CBKA 3OETA 4DQLA 2G0TA 3KYJB 4DDHA 1CZLA 3L0YA 3I5XA 2WIGA 4UC0A 3B5EA 1P74A 2BZ1A 3O1JC 3T7DA 3X1JA 2ZSUA 1P72A 1VLLA 1TM3E 2QOEA 3AESA 3FNQA 4JNCA 4L8FA 2ASVA 5CK5A 1GO2A 4PBRA 5ERXA 3RS4A 4DSUA 4Z4CA 2ZJ1A 2G1JA 4MGZR 3QH4A 4HEHA 4FBGA 2Z5LA 3PUKA 1TEXA 5A03A 5HQ3B 2YZ2A 4G5RA 1MEJA 3GG2A 5T4FA 3OQPA 5F7ZA 3SSAA 4DA0A 3AGQA 4L5BA 1RRVA 3OF3A 3QM1A 4PC2A 3FIJA 3DUFA 1T2EA 4G37A 1LY1A 4RHXA 1FUKA 5CLIA 1VXOA 1T4CB 4UARA 4WIAA 2HHHB 2WG0A 1Z39A 2EFDB 1II0A 4U7PB 5K51A 1KMHB 3NDBB 1UDWA 3AJDA 4BGVA 3X2SA 3DVLA 1E3LA 4GOKA 3UM9A 2I7XA 4G81A 4KYTA 2XUPA 3IMGA 4BP8A 4YAUA 3U3KA 4HLUA 1D9XA 3IVGA 4U8GA 1QYXA 3OPNA 5HX7A 2H1VA 4JSTA 2RGBA 4P4LA 3PHLA 3QGMA 4WZ6A 4Y1EA 5CR9A 3UK7A 3M3DA 3UAYA 5C5CA 3G2IA 2TMGA 2I7VA 2QRNA 4WD3A 1J07A 4HNHA 1GGVA 1PR5A 2DPYA 4OSPA 5K6RA 3D7MA 3L8ZA 1ISJA 2H2WA 4JVMA 1EFHA 2ZJ4A 4YEDA 1QGED 1G2OA 2QYOA 3UY4A 3VTAA 3QPVA 2NUTB 4G65A 4PGMA 4DKXA 3L5OA 3PNSA 2PUFA 2RCYA 2OUIA 4OXYA 1DC7A 4KPEC 2PZMA 1SKQA 4L0MA 5D84A 1N6NA 4NEGA 1EGAA 3UMMA 4TV9F 4JP8A 1MB9A 1C41A 1ZXBA 3JYHA 1ONSA 2VYCA 3NRCA 3PDUA 3ORHA 1CDZA 5KVVA 2XZLA 4AQYB 1L6RA 3HP7A 2NX2A 2CUKA 2QXTA 2ZYTX 2FDCA 3BCRA 1J24A 1AH2A 5AUPB 3ZJTA 1NNUA 1O95D 2VDKB 4FMCB 1AZSC 1ZNYA 1LH0A 1TZKA 2OQRA 2PKYX 4JU8A 4PRKA 4Q3OA 1MJHA 2J3HA 1Q14A 1R64A 3N28A 3RVLA 1E9FA 4ZPJA 2FCRA 5BYKA 2V54A 4JY7A 5E6SB 3A3KA 4I3HA 1KI2A 1TKBA 4OLAA 3AV0B 4N48A 3W34A 3ZC3A 1NZDA 5K8VA 3GFFA 3E3AA 1ZLXA 1JBKA 5SZKB 2H3EA 4F6RB 2CL5A 5DMHA 3BULA 3LGXA 3SHQA 1UT6A 1HM5A 1PI3A 4OLFA 4GI7A 2ZQZA 3B6JA 1YRYE 4S0XA 2NO7A 4RKYA 3V3KA 4CL8A 4XRGA 1C30A 2UAGA 5C7OO 4W8GA 3OCVA 2CV2A 5L9AA 3TL6A 2F3TA 2B20A 1SKYB 2AS0A 2XAUA 3CF6R 4IINA 4NU6A 1E0AA 2C2KA 3OFJA 4NNJA 1VJRA 3CYFA 3DDUA 3L79A 1DEHA 5EESA 5EG5A 1MX5A 2NU8A 1FDRA 1LFDB 3USES 3QPDA 2FUCA 3FBWA 4EG1A 3NUZA 3BGSA 3A0RB 2O8BB 3FWZA 2Q0SA 4JWKA 2J0VA 1MPXA 3D81A 3L9WA 4HVTA 1EBBA 1X6VA 4IDDA 1IEWA 2W0MA 3OOYA 1X13A 4A3SA 3LCRA 3RHSA 2FTKE 3A4IA 4EPXA 3AJ8A 1Z17A 3TD6A 1J33A 3ST7A 1TTHA 5FXMA 2HHJA 5JS6A 1ZO8A 3KNZA 3L02A 2EWMA 2ZVQX 1L5LA 3T0IA 4D8YA 1PLJA 1T2DA 2FFRA 3L05A 2FFQA 3O3MB 4I0WB 5KAMA 2JRLA 2WSLA 1XZDA 4P4UA 4CLHA 2UUBB 2OVBA 3FNBA 4QXAA 2JNWA 5FL7D 4RHEA 2VDUE 4KPYA 2YJZA 3H4IA 4UNSA 2A1TS 4YAWA 1G6Q1 1E2GA 1L8OA 2X2EA 3H11B 3I9KA 4QOFA 4ETMA 1Z0JA 4EW6A 2BFWA 2GCOB 4NRDA 1PWZA 3I61A 2J3IA 2P65A 2CVOA 2BLLA 2KS6A 3FN4A 3ZCPA 1EUDB 4Y9UA 2G8NA 5EZYB 1KXZA 2FMFA 3GLHA 3RAPR 4PYOA 3F96A 3QFSA 3GLGE 5CDSA 1N36B 2R44A 1T1RA 2WHRA 3HI6A 2XA1A 4FHZA 4NE9A 3BWBA 4AY6A 4CF7A 2JFHA 1AS3A 1ZZGA 3T7CA 1KWGA 4KBFA 4V24A 2VQ3A 4BNJA 3KTOA 4X63A 4D4LA 4CMCA 2AMVA 5BMOA 4DUPA 1O8CA 3QU5A 1C3VA 3NOOA 3OD1A 2BCGY 4G0XA 1A2QA 1G17A 1ISRA 3WJ7A 1KNQA 3HDTA 4IFEA 2X8WA 2QORA 3MSXA 1IUNA 3KOUA 5KNCA 1GA1A 2Q3LA 4LI3X 3AY6A 1UJMA 4IJ6A 1RWBA 5EXDA 2WJVA 1DFHA 3M6FA 2CNLA 3BK7A 2QMUA 1QQBA 5C5EA 1Q0LA 4N5NA 4R68A 5EYPB 3RI3A 3L5KA 1P9RA 3DBRA 1CVIA 2O1EA 1NHGA 4M98A 2CJWB 4V1CA 3VKHA 2G1PA 4P7JA 3SR0A 4F3NA 3IKLA 4MR7A 4LG1A 4V0OA 2RGUA 1RI3A 3MJFA 1H4VB 3TTYA 4YI3A 3CKLA 1UJNA 2NSDA 2Q2OA 3C1TA 3RUFA 4AWBA 4P6VF 3CNEA 1IUKA 4FXOA 1DAIA 3ZXUB 2MDTA 3H3FA 5L3ZA 5LQNA 3AT1A 3RBAA 1GZSA 1LRKA 3RHZA 4K6OA 3ZHXA 4QU8A 3LWNA 2NNLD 1BXGA 1U9ZA 2PMWB 3QF7A 1Y3IA 2PGIA 3ER6A 1YJBA 1T2AA 1OX4A 2OQ2A 3CRW1 4CUZA 1O6CA 1IZZA 5H9VA 3AF6A 4LJ6A 5JOQA 3L07A 4U5XA 3QEOA 4ARUA 2GKSA 3RHFA 3FM9A 4HX2A 1VJDA 1L8QA 1KY5A 4V02A 1YJXA 1FP4B 1B74A 2BSAA 4KN8A 3V9AA 3WC4A 5EJ7A 4RETA 1BJTA 6ADHA 4IWYA 3VR0A 1TTQB 3D3KA 4UAUA 3AY3A 5LOVB 5HKBA 1N1EA 3VV3A 2VK2A 4JU9A 1JDPA 3RS5A 2WI8A 4H27A 2ABWA 3THYB 3LXRA 4FW8A 1LX6A 5HILA 2WYVA 1FP6A 2KLBA 3HPRA 4INPA 3HTXA 2G08A 2CK3D 2XQIA 1GGKA 2PGXA 4Z7JA 1NZJA 3WGQA 4NH0A 4JT9A 4Q4AA 1M1NA 4N39A 3ZDFA 2E87A 4RD0A 1KZYC 4GE0A 3H9GA 1TJ3A 2V7QD 2C07A 1YC5A 2W2QA 3SX2A 3K4PA 3TQFA 3ELBA 4CKWB 1T3ZA 5LYJF 4GT1A 4JC4A 1MG0A 5FP0A 2PZLA 1NGSA 1SUFA 2HREA 4AO8A 3IEUA 5LMNB 1R0CA 4HXYA 2B8NA 1MRSA 3M4JA 1VLMA 2ILVA 2WE8A 2ORYA 2YQ4A 4C1NA 2LTAA 1JHQA 3SC4A 4FN5A 4BNMA 4PXYA 5LQMA 1AM4D 2PWBA 4QGSA 3A6JA 4Q9HA 3VOSA 2A92A 4QUEA 3S2UA 3V33A 4ALJA 3DTNA 3EMKA 2PV0A 2UXBB 1BOFA 2FEXA 3HZZA 5TQJA 1N5RA 3RQSA 1XKTA 3FPCA 5B1DA 1GUYA 3ERCA 5HM6A 3BJZA 4KZKA 4P3KA 2IXAA 4FR5A 4B73A 1Y89A 1G7TA 2YYSA 2MSDB 2OCGA 3A25A 3AJ9A 4P33A 4UVDA 1XHFA 1FW8A 4HH3C 2FI1A 5EWJA 4RL4A 3U3OA 2FVYA 1BWQA 3GFPA 4TLBA 4J3NA 2JJYA 1BD4A 5FLKA 4AJNA 1A95A 1EMDA 2ZJBA 4QBHA 3TW8A 3ZLBA 2IEIA 1DX9A 2C5HA 1MGOA 1Z82A 1PR1A 3J7TA 1EFLA 5TQ2A 4ENQA 1D1PA 2HA2A 2X4GA 1D5WA 3I3OA 3DTVA 3KVYA 3DOIA 1CUDA 3KE8A 5EERA 1RAGA 4FGZA 5REQB 4V1CI 1JHUA 1DKRA 1JFLA 3AHDA 3FWNA 3CRMA 4CIXA 4MKXA 1CFZA 1S7GA 1TCUA 1LXCA 1E9AA 4Z7QB 2ZVPX 3T7TA 5KNDA 2ZSFA 4AY3A 2BLNA 1GPMA 5AKHA 1T3TA 4AJ4A 3PLNA 3EPJA 2A0WA 1H5NA 2AHRA 3ZWCA 1TEVA 5FKJA 3ZBUA 2RARA 2GSDA 5L3RA 5GGYA 3RWBA 4CLRB 1KJQA 4X1YB 3E35A 4QSMA 4UUMA 2IYLD 4UVGA 3OX3A 4I55B 3O2JA 3UFBA 3DZDA 2F48A 1LDMA 3IALA 1M2OB 4BE7B 4FX5A 3O75A 3GCXA 1Z26A 4GM4A 2CMKA 4WCFA 1OPXA 3R6GA 3BJRA 3ZCUA 5JQGA 5LQCA 1RI4A 2W2LA 4KSCA 5EN4A 4N5MA 1W25A 3ADPA 5HE9A 1CX9B 1KEVA 4NC9A 4ENTA 5HZKA 1W47A 2QD2A 2PA3A 3UKOA 4AKEA 4Z2AA 4FEEA 4Q15A 4FYJA 2OXTA 5CVTA 1QFXA 1M73E 1KBZA 5ALQA 4CVNA 5INTA 2DB3A 1ZBDA 3CBQA 1ISPA 1O2DA 2HJSA 3DOJA 3DZHA 3CRVA 3G0GA 3NW9A 1L5QA 4RQUA 3QP9A 3LX6A 1TZCA 2PN1A 2JLBA 2WHYA 3CO0S 3P2KA 4QT4A 2IHNA 3GJ5A 4I4NA 1HOTA 2Q6LA 1QP8A 2R2GA 2UYQA 3DMNA 3RREA 2XUKA 1QMGA 2Y1WA 1I3KA 5BW8A 5C8ZA 1JDVA 4OMFG 4BEWA 2AOXA 2YC2C 4R3UC 4RGQA 5IBQA 3WGJA 4M87A 4D0GA 2OFXA 2XCSB 1FSZA 2INGX 3RIEA 1LSUA 2BP7B 3D1JA 2IZ0A 5EVCA 2ZJ0A 3ZTWA 2O8DA 4QATA 3JQ8B 3IKTA 4XYEA 2LDBA 4QT0A 2CFTA 1U28C 1NZFA 3DZJA 4TWZA 5NLLA 2Y4OA 3SIWA 3SQLA 2HFKA 1KWKA 4CEIB 1UM9B 1HFJA 3IA7A 4KX5A 4MINA 4JYMA 5DYIA 5A9TA 2VPTA 3EA0A 3RGWS 1AKYA 2HA3A 2HWWA 4BMVA 2IPXA 4CNBA 5HK9A 1XZPA 4BN5A 1W35A 1EIZA 4MZDA 4KWIA 1AB5A 4Q4CA 4FCTA 7REQB 3OX4A 2OHIA 4GSLA 2NPIA 4GR9A 3SZMA 2C00A 3Q3IA 5GAJA 3WL3A 4DQDA 4O0MA 3U39A 1U1CA 5IHPA 2Q6KA 2YQ5A 2YL2A 1HC7A 2Z3WA 4WY2A 4URFA 2VCEA 3M5PA 1KIAA 3H99A 4KQXA 2G77B 2HGZA 2O6LA 1H2ZA 3FWHA 2RIPA 2H5EA 4YV2A 3GAAA 3RSZA 2C42A 4KFCA 2IP1A 2QM7A 5A06A 2J5KA 1B6SA 3QLJA 4E5UA 1RPNA 5JAHA 2YMMA 2ZTVA 1XAJA 4EW3A 3V7NA 1HTWA 1XVIA 3CRZA 1GKKA 4DQKA 2J0SA 3EHDA 5IDWA 1AV6A 4YGYA 2CDCA 3RUHA 3UV3A 3ZQUA 2GN0A 1IQRA 1RHKA 1TVCA 2GRAA 1Q1GA 2QT1A 4KN9S 4QDUA 5CDGA 1CR1A 5ALOA 3NP9A 4UTRA 3GUCA 2DBQA 4EA9A 4P9NA 5KKCA 2ZR9A 4QRDA 1ZA2A 1I51A 4C88A 5DRTA 2ACKA 4OV6B 3G2NA 3NDPA 3TGWA 4WZZA 5BMVB 1VHLA 1XHLA 4DUYB 1MJ5A 1QNLA 4YRPA 2HMAA 4YNBA 1KYXA 1GZ6A 4X3PA 3ZVNA 3IB6A 5CA0F 2O1WA 4HH4A 2AYXA 3T1YB 3I12A 2I22A 3ENQA 3QV1A 1F5SA 4D0RA 1Q0RA 2J0UA 1K7CA 2K2QB 2ZANA 1M2JA 4EZEA 1B0UA 4KXXA 3DNPA 1Y81A 2P9BA 3GZJA 5CAEB 1U0GA 4URXR 2CV1A 1CR0A 2DVMA 1JQ5A 2DPGA 2GTPA 1QYWA 4HUJA 4IXTA 1JJAA 2JBAB 2X8JA 2JJMA 1ZJ4A 3TNLA 3PRYA 2BFEA 4HUQB 3UXYA 5JD5A 2BGGA 2VLBA 3HLKA 4YDSA 2OPHA 3AIOA 2ZI7A 2PJDA 3CT4A 4AJ1A 1VJTA 4X1IB 4O4HA 4Q9JA 1E3JA 3VOAA 2E7ZA 3TEJA 3KJNA 2QJTA 1IM8A 3GBSA 3N2NA 3Q3CA 3CLUC 3I76A 4LCJA 5FFFA 3WGMA 4Z53A 3QWBA 3FCCA 5KNBH 1X1DA 5F7OA 5C2JB 3B9PA 2HA7A 2MSKA 2VSQA 4DM3A 3T7IA 4HWSA 1R4ZA 2XNCA 5CGQB 3S0JA 4LJ7A 1JT2A 1VLQA 2WKWA 3WMWA 2JI9A 2NUBA 3AF3A 3EW7A 4EUEA 2HBRA 2PXAA 1AK9A 3LOQA 3UUFA 4G07A 5DM4A 3FKQA 4R9SA 3JPWA 2H1HA 2EFHB 1TMGE 4WBNA 4MKGA 4OBXA 1NLYA 1Y80A 2X0RA 2BGWA 2YJ5A 1II8B 3ZWDA 1U1IA 3P0HA 1D4AA 2NUPA 3GVXA 2RAPA 4XM1A 1IRXA 4PG7A 3P4YA 4M1EA 1P44A 4GMXA 2XE8A 3TUZC 1SGWA 1ZXLA 1IHYA 4HDNA 1ODSA 5IC6A 3H5IA 2EBHX 2V55B 3NV9A 4WK4B 1P5HA 3I9V6 5U4XA 1EFUA 1UC9A 2ATIA 2P6PA 3DT6A 3AQ4A 1W85B 4CIAA 4LZPA 3B5IA 3MS7A 3M6WA 3Q15C 4FDTA 4CXMA 3O8QB 3C5HA 2LD4A 2BFCA 3CXUA 2XNDA 3GLHE 1FFXA 3AIMA 1XEWX 2G7MC 4AKGA 3O94A 3TH5A 1VHWA 1JQJC 1PWHA 5EIWA 3UCXA 1A9OA 2IKSA 2R6ZA 4LJ5A 5JPDA 3S1LA 1ZOSA 4K9RA 3L0DA 4OI1A 5KZMB 1YOVA 4R1PA 5TF4A 2DQYA 3IXMA 3UUWA 3EODA 3GDWA 2E4XA 4FBLA 3RU2A 2GD2A 2AMLA 3NIWA 5MDHA 3IRUA 2I99A 3U3DA 3WZMA 1RC8A 4MRRA 1GUFA 3WK7A 2DPHA 4YR7A 2GN8A 5JAOA 2I4OA 2WJPA 2XA9A 5FA8A 3HFRA 3N8GA 1XZNA 1R3DA 3GJ6A 2ICAA 3D1VA 3QITA 3TLCA 2XQKA 3A9SA 5L3SB 5I01A 3RYCA 3P0RA 1C1HA 2CHFA 1IN6A 2FP4B 3ABOB 4RZHA 2PJUA 5KYXB 2C54A 3AR6A 4EPWA 5D86A 1FYVA 1DIGA 3B89A 2GAOA 2HV8A 1OBOA 2Q5IA 3UXMA 3BFJA 3MHPA 3QG1A 1IHDA 3PX7A 2Q49A 4QJ5A 1JJFA 3WBFA 4G25A 2H4JA 2F62A 1J09A 2R00C 2BUBA 3I34X 3M5CA 3KOXA 4G24A 4WXPA 1KYVA 3C39A 2V6GA 4V0MA 5KSPA 4II3A 5IKMA 3SMVA 2NZ2A 1N5IA 1VG8A 3KHTA 1EVJA 2MR6A 1V5WA 5LMZA 1ZJZA 2HJ9A 4RNDB 4I6GA 1T5DX 1HYGA 1NI4B 1XRPA 8ADHA 1UEXC 1VKHA 5J43A 3PPIA 1RXWA 1W0KA 4XXHA 1A7UA 3IO5A 4PSCA 4PV7A 1X8XA 4RJIA 1RFGE 2IS4A 2O8CA 1PT7A 1X14A 2Q3JA 1FPQA 1U7QA 1NXQA 4LXYA 5FYQA 3SR4A 2J7PA 3HH8A 3IMEA 1Z7WA 1D8TA 3CUYA 1SD2A 4HWOA 2BTEA 2W43A 2DP4E 1RLOA 1G6OA 3JWGA 2XB9A 5TT0A 4QHYA 1WMFA 4AP5A 1XMIA 2PCLA 4IOKA 5CA0A 3LOUA 3M2TA 5CTJA 3SQMA 1E5QA 5IX8A 1GRQA 3QPBA 3QE9Y 4QGBA 4B3CA 5E3HA 4MRMA 2JL1A 4H17A 3HSYA 4U2BA 4D98A 1JEOA 4A15A 5JAMA 2WOJA 1HPLA 5B7NA 1F2UA 2QKYA 3JWPA 3F98A 3L1IA 2WWVD 5TARA 5I4IA 4D97A 3ANLA 4PC7A 4A2PA 3PIRA 1KI1A 1KVRA 1P2UA 1XTKA 3FZYA 1L7XA 1P1JA 3VVBA 5A4JA 4WK2B 4M1QA 1FDIA 4R5HA 4KTTE 2ZSKA 1D7AA 3IBFA 2FSFA 3RBZA 2RGAA 4N0QA 4FFWA 3G5UA 1WUJS 3HRHA 3T9EA 3VR3D 1T1GA 4RORA 5FPQA 2OILA 1YVDA 5DV9A 4TZ6A 4KDFA 1JU4A 1OA0A 1JDNA 2BHRA 5EQDA 4EI9A 3MRTA 3ZWYA 3EPHA 1BJKA 1Q74A 1QQ5A 1GRNA 1ECBA 3ZHUA 5M04A 2EQAA 3DFIA 2HRCA 4QXMA 4Y6LA 3V1MA 5DCUA 4WASA 2WA1A 4HO1X 4WOBA 1M3SA 1WNFA 3HCFA 4JN6B 5F7JA 3FVVA 4TROA 4Q6WA 2A78A 1Y7IA 2O2YA 1TUGA 2FX3A 1NXPA 1BS1A 1Q2UA 3LUGA 3QYPA 3RSCA 2B92A 4MUFA 1UDXA 2PANA 2FZLA 4LNHA 4BB0A 1ZPDA 5JCXA 1S2MA 1WXIA 2Z1DA 2C78A 2XTAA 1RJDA 5EHGA 3JZFA 2XGOA 2WIDA 1K89A 2GYVA 4XB2A 4G89A 3VJRA 4QJIA 2ZU0C 2DULA 3PZBA 1JT9A 1XMPA 2BIFA 2IHZA 1YIAA 3ECSA 3LK6A 4FUTA 3AZQA 4P5PA 4TVKA 5ALSA 3Q6MA 2XGSA 2B3DA 4IIGA 3ZVKA 2NU6A 2XW6A 3L1KA 1N32B 5B1IA 2G07A 1Z0DA 2JBHA 5JFTA 4IIEA 4OG2A 2F9MA 4JGBA 4P2GA 1R74A 1S8NA 1U7DA 2E1PA 2BFBB 2V3WA 2XMQA 3KQYA 3BZWA 2JGFA 3QJGA 4R1OA 4BZPA 3R20A 1PSDA 2QAGB 5ERYA 3OZWA 1Y8ZA 4TXHA 4DDWA 4JS0A 4YHBA 5JDCA 3AUSA 5JYBA 1RRMA 2B8EA 4HNGA 1XCGB 3DHYA 2Z0MA 3LBNA 4QARA 1G291 3SHVA 3BJEA 1Z6TA 3HB1A 3QU2A 1X77A 3I1JA 3UH1A 2F9FA 4KBYA 2ARKA 4F6CA 1PEKE 5EUMA 3EIOA 2C4UA 2NP7A 1YMUA 4NH4A 3ENNA 1YRLA 3JQGB 4I4IA 3RS7A 4CW7A 1QHHA 2B8TA 4X24A 4P4SA 4E3WA 3UG7A 3ZE9A 1NQWA 2PMDA 5DHRA 4YMLA 3TECE 3JARB 1XTUA 1M8GA 4YLEA 1ADGA 1EPUA 4RNCA 5BN1A 5KREA 2H8KA 2NTVA 2IEBA 3BHNA 5CLLA 3UWKA 1V4BA 2JVJA 2V7VA 3RFVA 5B1SA 1U6KA 1N2ZA 2IPOA 3L0ZA 2ARFA 2VXYA 3WMXA 4ZCLA 3BQMB 4LXHA 1X42A 3G0HA 2WKSA 1I1NA 4YAKA 3AERA 1EJ6A 2H7CA 4ND2A 4O2BB 1BKYA 1QFZA 3TEFA 3R1IA 2H1IA 2HPVA 4ARBA 3ZDAA 1KR5A 1TO6A 2A0YA 4E30A 2I1VB 4KO4S 5LP6A 4YREA 1EXDA 1NRWA 1TYAE 1NIPA 4GWKA 3GBVA 1EGHA 3TN7A 1TADA 5AVYA 1U3UA 1H9CA 3K16A 3MT9A 5ES4B 3TINA 4MUHA 4NULA 2C9OA 2CHQA 4DQVA 1GGEA 1ZGCA 3UPDA 2OO5C 1MQ9A 2DFVA 1X2EA 1Z6QA 1IQUA 1E60A 1X3LA 1XX6A 1MX9A 3GJYA 3H5OA 5FBWB 4YRJA 1W44A 3PQDA 4A10A 1RPZA 4RF3A 1KRXA 3R0ZA 4Y1RA 4XUCA 3IBGA 4RMIA 3AHGA 5AT1A 2VP9A 4HMPA 4HDAA 3B3AA 2ZZKA 1WDTA 1WBBA 2Q4EA 4D3DA 2QX9A 3N6VA 4DVJA 4JJAA 1EK5A 2HK8A 1HY3A 1KFJB 4MQLA 1Q3IA 2GBGA 4RD1A 1C3LA 3M1YA 3FLEA 1H2BA 4HQNA 3OQBA 2YJGA 4AO6A 1GARA 2QD5A 4PX5A 4IFTA 2HK7A 1SQFA 3AUXA 2R7NA 1MT3A 1M8KA 1A5SB 3M4YA 3U40A 1VLJA 4QBKA 5GZ3A 5HOEA 5IJ9A 1AHPA 5CHYA 5KVAA 3NJRA 2VF5X 3OLYA 4GF5A 2D7CA 4MUEA 2D06A 2FVXA 2R3SA 2W48A 4OF4A 3VHLB 2YNMD 4OU4A 3RYHB 3ZHCA 4R6WA 4P83A 2X0EA 4L0QA 4ZOQI 1NVKA 2R84A 3BFPA 2W2OA 1VL5A 3S44A 3VHXB 4YV7A 4LDQA 1COZA 3P32A 3QKSA 3ANYB 4YFYA 4N12A 4X94A 5K2OA 4NZYA 4PSKA 3COVA 1EUCA 5KBYA 4GKJB 4Y18A 1MX1A 1UMBA 2Y1CA 1U5BB 2AK3A 4JASB 1AKEA 5CVDA 4B34A 1BDHA 1IY2A 1GPH1 4E2XA 3AEKB 4WFQA 3MA0A 3W3ZB 4IFIA 2OUKA 5TPWB 1M1ZA 3SFVA 3TQQA 3K5HA 5FWYB 2WAXA 3FDFA 4CF3A 4DE5A 5LLTA 1C80A 3M6AA 4XJVA 3RR2A 4DBLE 4CTKA 3SU8A 3I09A 1MO3A 2QVCA 3W8FA 1SKMA 3VM6A 1JMYA 3ZIUA 1I4WA 3EB9A 3WL8A 5CFMA 2Y27A 3JD2A 4KG7A 1K27A 4M8NE 2QL7A 4ZEOA 2WHPB 4M0CA 1AO3A 2BR3A 5L4LA 2D13A 3NHRA 3WR5A 1XKXA 3PVCA 1JHVA 4I5DA 1GTMA 4HADA 4KLRA 4EB6A 4ENUA 1F0PA 4F4CA 3TM4A 2VPIA 3B8EA 1E18A 1ZISA 2QIOA 3ESRA 4FDUA 4HDSB 2Y1GA 1Y48E 4MPDA 3PWSA 2XCLA 1ZUWA 4KE8A 2WIBA 4QPZA 4BX2A 4E12A 5GVSA 5HCIA 2B0CA 4BTLA 1ZIYA 1BGVA 4RVDA 5KNCH 2CLSA 2VJKA 4LDAA 2HHAA 3C4QA 3I05A 1I6LA 4OHFA 3MXTA 4TSKA 3LDFA 1Z2AA 2OCKA 3O4FA 2ODWA 3OF2A 4IDBA 2Q3CA 5GINE 2QVXX 1Y5NA 4RD6A 4X9XA 3BIOA 2CW5A 1Z6ZA 2GMWA 4WBXC 1NNI1 1IH8A 4LDNA 4ND8B 1P6UA 2ZRLA 1Q11A 1EBUA 2J4FA 5E7MA 4HATA 2WWHA 2RGWA 2ZRDA 3U3ZA 4P58A 4R2WA 4DMRA 4BUZA 4UE6A 2FZWA 2C77A 3CG4A 4XCVA 1E2DA 3B3JA 4MV7A 2Y6UA 4XVCA 1KDYA 1LWNA 3BHJA 4JKIA 1E5VA 1E3IA 3QPWA 3HR7A 1T4BA 2COKA 1GL9B 4JOBA 3H2BA 3EFOB 4A26A 4RULA 4MEBA 3V4ZA 2HLHA 3F6SA 2E4UA 2H2FA 5FLYA 1SU6A 2IZ1A 4G5SA 1R6AA 2FSUA 2KB0A 4P0QB 1I4LD 2WJ4A 4JUBA 3UO8B 3AX6A 4QDXA 3SN6A 2BH2A 1W2WB 3D1LA 3LBYA 1VLZA 1V6SA 3HG7A 1A9YA 1YONA 2OL4A 1QIEA 1PYGA 3EVEA 1JVNA 4JZYA 1OY1A 1YTLA 2B7CA 2HIHA 4ND1A 4B0OA 4YAGA 3FB1A 4ZYXA 1O6ZA 5GZ1A 1VP3A 5EAIA 4F84A 3ORQA 4JDPA 3PFIA 4IGAA 2P0AA 1PIWA 5ITVA 3WNBA 2C2BA 5I9SA 3PQ3A 1JEQA 2GR9A 2FUEA 2PL9A 3H2IA 4LTDA 3TXXA 4DLBA 4F9EA 4KRXA 5ALHA 4OJYA 2XGJA 5LBUA 4CIVA 4RSHA 4CTOA 3BCSA 1K8RA 1VYUA 2BISA 5HF9A 4V0ME 4O1MA 1LJUA 3A2KA 3IDQA 4RTQA 3DSRA 1GL7A 3GP5A 3C14C 3D4IA 2BR5A 2M1ZA 3GGGA 4M0UA 3S99A 1CZUA 5IXJA 4CMIB 1LDGA 3PXCX 4FT2A 3LXXA 5ALIA 1LCIA 1BSVA 1U0TA 3C3EA 3BD7A 3JYQA 1E66A 3S2YA 1C4WA 4JD5A 4F46A 4ALMA 3GEIA 1U1DA 2D7JA 2GJ4A 4DA7A 2GAAA 2PKXA 5DGXA 3HB0A 2JIOA 1IQPA 5FEMA 1FOEB 1YR7A 2VDQB 1RE0A 3IT3A 1QH1A 3MZ0A 4OHRA 5CW1A 2C2YA 1IOVA 2QTNA 3CSSA 1UBTS 1T35A 4DLUA 4PVDA 3LYAA 1VXRA 2IC5A 4MV4A 5EWLA 1VSTA 3CVWA 4JYCA 1GUDA 4RZIA 3NWOA 4NLLA 2QTFA 1DIBA 4LYHA 4KX3A 3LH5A 1FDSA 4GIBA 3FHOA 2L2QA 4C7MA 3GJRA 4KRGA 1U7ZA 1NURA 3WSWA 1I0IA 1OQAA 2PSJA 3BAZA 2XMCA 3EVAA 1IFXA 5AICA 1J1ZA 1MV8A 2GBPA 3QX8A 4PGFA 1J6UA 1UDAA 2OHJA 3L8DA 2PVCA 4JXJA 5DT2A 3QUQA 1OWMA 2J3JA 2PQ2A 1WXWA 4UNPA 1KZ9A 1UMDA 1SUWA 3JXEA 2B4YA 3NBFA 1IY1A 3WB9A 1YZGA 5HQ3A 2BY4A 2ZJ2A 3UXHA 1EGMB 3NX4A 1HZJA 2WVHA 3BKXA 1YCFA 1R0KA 2EP5A 2H18A 3WRVA 4LY3A 4OIMA 3WLOA 1J5EB 1YU6A 4IUCS 4FSXA 2RSLA 2ZDHA 1ISMA 1M2GA 4XPZA 1ULSA 5KNDH 5AESA 1WDMA 4W5TA 2UXCB 5CH5A 3T1VA 1BKDR 1CUGA 2ZPTX 4ECAA 3D0QA 1IC6A 3RTBA 1EU1A 3AEXA 3K4QA 3OP4A 3QLUC 2CDRA 3ED5A 5IH3A 2ZIGA 2G67A 5C8DA 5E1OA 3H4VA 3JZAA 2XEXA 4DMUB 1QQTA 1LRLA 5JYCA 3QOXA 4MR8A 1Q20A 3H1BA 4GGPA 5GONB 1P39A 3P94A 2BH9A 1X7HA 3X1KA 3UENA 3HVHA 3FUXA 1SRRA 4GRIA 1BQ4A 1X7YB 3B60A 4E2FA 1DU4A 1XMXA 1NPYA 2GCGA 2VH5R 3V7WA 3RCBA 1M7BA 5C4MA 1I36A 2D4HA 4PBTA 3UNXA 4YXFA 2GD1O 4TS4A 4IIJF 3KD2A 1KEZA 3AEUB 3BHIA 4QQNA 5P21A 3BL8A 1NG1A 1BVYF 4JI7B 5FNVF 2G9ZA 2FRDC 1BS9A 2ZIXA 5JMOA 5IAAA 2XT9A 3BTVA 4GRDA 4IRMA 4MV8A 1N9GA 1P2FA 4DQXA 3AI3A 4J49A 1Q91A 3GFSA 1RFLA 1PAUA 1Y3BE 2ZRJA 3IV9A 4KQFA 4WEOA 1G1AA 1LRJA 3QMPA 2DHCA 5LXTF 1N2CB 3PDIA 4PZ0A 1U0SY 4JLSA 1U3WA 4YT4A 4MZXA 5SZHB 1F5NA 4I19A 2JIZD 4Z3OA 1BCSB 3INRA 1JPUA 2R4QA 3Q7EA 4RHUA 1N8SA 3FSGA 4KAAA 3CF2A 4OLHA 1KK1A 3PEYA 1P1FA 4ZQEA 4NYJQ 4IDGA 4OGFA 5BSGA 2X7HA 4S3MA 1ISFA 5TIIA 1GVHA 1QZ3A 4BCBA 3RF6A 1U3GA 3VPBA 2D5CA 1UP7A 4MVJM 1PTKA 2ZTUA 4UHHA 2AOUA 1LKZA 1Z33A 3MBIA 5AIBA 3ANNA 4FXPA 5IJZA 3ZZ1A 2YFQA 3GELA 5AHRA 4EOGA 4E6EA 4HUTA 2H8GA 4AYXA 1T2VA 4TSFA 3TB4A 3DAFA 3DDHA 5H02A 3DDSA 4AJJA 3MCWA 3SJZA 1JNXX 1U2DC 2E49A 3LFHA 3TIFA 1RI1A 2BM9A 4G4IA 4GVXA 1C7EA 1Q16A 4FMPA 3KWFA 1HQDA 3T3HA 1SVNA 3FJ1A 1VPLA 3DCYA 4IDEA 3KB8A 2LV8A 3PRJA 1EG2A 4KDRA 1OXSC 2DQ4A 2PGOA 3A4YA 4NNOA 3UTCA 2E48A 2YBEA 1QQAA 4UQOA 1ZNWA 2I7DA 5KQGA 2DGDA 3I53A 4WAUA 5BSMA 1JR6A 4MW0A 4X54A 3KPYA 3O82A 1J0AA 4ERNA 3KM0A 2ZRKA 4NEQA 3U7EB 3C8HA 3W3AA 4WDQA 3PGXA 2LP4Y 3KKOA 1M1YA 2K6GA 4JYZA 3WA7A 5HRAA 4FR0A 1E63A 4FVTA 1X94A 1EFDN 2G04A 4NPHA 3L7LA 2FN7A 1GQYA 2XLBA 2Q4TA 4R2XA 2I2AA 5F3RA 3BE5A 4LRYA 4FM9A 2B36A 3E4CA 4OHYA 2WQ7A 1G5QA 1Z6YA 2VRCA 2RONA 3DOEA 3M5WA 1RBQA 3KZ1E 3LGAA 1F20A 1OLSB 4KOEC 1H8HD 1TAHA 2XB6A 4MP6A 3JWIA 2WW8A 2EJCA 4MS4B 3WQHA 1NQAO 4IO0A 1U3FA 4AJ9A 2ONZA 3KBOA 5A71A 1JQKA 5D7BA 3ZWWA 2Q5CA 2WUWE 5LL6P 4YDRA 4DVGA 1F17A 4PZ9A 1IL0A 4PN7A 4ZQCB 2CJXA 4GBED 2H52A 4KPUB 4YJKA 2YVKA 3MXOA 1KBQA 2NU9B 4GOOD 2AIRA 4A91A 2RHWA 4EY8A 2OHXA 1WCYA 1ZNZA 4GBMA 4DJJA 4GVLA 3ELYA 1CP2A 4X0EA 1CIVA 1J90A 3Q9SA 3PHIA 3L0PA 1DADA 3E0XA 3K15A 3NAZA 3QIAA 1Z2DA 5CH3A 1T4CA 1QLWA 1OXKB 3CVJA 4LQLA 4MVJG 2WPNA 3ZDEA 4R2KA 1KMHA 3JYPA 4MLDA 1UL1X 4Q3EA 3VAZA 4UPEA 3KLMX 1JDTA 1COWD 3B1XA 1NW4A 1DKUA 4OM8A 4LFAB 5FPKA 1CY0A 4ML3A 4NMLA 4BKQA 3QVTA 1I30A 1JDUA 1EFTA 2WABA 3KKZA 1BOOA 2N47A 2PS3A 2RHHA 2UZIR 3CWZA 1H6DA 4N03A 3RFTA 1YJ5A 1G2PA 1ULZA 4QULA 1FX0B 4GKAA 3OEEA 5IVHA 1L8AA 1RWVA 4JQYA 3LYLA 1JILA 4RW0A 4LJSA 4EAAA 3KQVA 4WSOA 4UNQA 1VE9A 1EX9A 1JU9A 2CNWA 1L5HB 5KHLB 3E03A 3TSZA 2PS9A 4W7SA 3DZKA 4DJAA 4EY7A 1QR2A 2V96A 2H4YA 3WLHA 3SBDA 4BNDB 1E6UA 3QNWA 1GLVA 1Z62A 5BR8B 2FCAA 3A7EA 5D7NA 2NUTA 4Y98A 4TPKA 3HUTA 1YR8A 5A3VA 5G0SA 3FNEA 2A59A 3LLUA 4NP6A 5HUHA 3O8CA 4KTVE 3HXLA 5AVKA 2VPXA 2I87A 3PVZA 2X77A 2VK4A 4N5HX 3BRQA 2WSBA 2R5FA 1XSEA 3TKLA 3IDSA 2Z5VA 2Y1KA 4F4JA 3DUWA 3IAM6 4CODB 3E22B 4EO4A 1OAOC 3AU8A 5BR7A 3CB2A 5I8WA 5ITSA 5JEEA 3WK4A 3PD0A 4Z86A 1QIIA 2O0JA 3DEYX 4MDHA 3DT8A 4Z0HO 5FJIA 4BMYA 3DLBA 1EXNA 4XGKA 2HU8A 4A6PA 5LOVF 3MJTA 5E6SA 3RK1A 4ZV4A 3F9CA 3A10A 4XGQA 2I6UA 5COBA 5CURA 3D8HA 4CT0A 4Z6KA 1P7VA 2FE4A 3GZ4A 3KEFA 2WFZA 3KK0A 2V8OA 3BFXA 4F6RA 3WGLA 5HR5A 1Y8CA 3AJRA 1DIHA 1WDKA 2H2AA 1QYVA 3GEMA 3G2KA 4OFWA 3OESA 4PNZA 3RRMA 3OLWA 3ZVLA 2JLXA 4TXMA 1L5YA 1UFOA 4NFYA 5K4GA 4XDYA 1M83A 4BO3A 4WW0A 3U0BA 2G7ZA 1AXGA 4G5HA 1L9KA 3SJCA 4BVEA 3RG8A 1CY2A 3G13A 4E1BA 1R0XA 2EKBA 4LNAA 5J4VA 4ARZB 3B6KA 5KJEA 2Q28A 4ZT7A 1YQTA 4MV3A 4ZJUA 6AT1A 2HYDA 4LQ4A 1JA1A 2OWEA 4D7AA 3SS7X 4D4IA 4QGGA 2A9KA 3GRYA 5ALUA 1Y4AE 3EMDA 2UU9B 3Q5GA 1JDBB 3PGLA 2WWTA 3IOYA 3NIGB 4JMLA 2BAGA 1N5DA 1WMSA 2ZI5A 4ZC1A 1X7WB 1L5GB 5F9FA 3I3SR 4EB8A 5KNLA 4C01A 3QNMA 4CM6A 3STWA 5CX4A 4YP7A 4MVJP 4BO1A 4Y6QA 1E4EB 2W6PA 4QLBA 2WIAA 5IT5A 1JEAA 5AOBA 5EJ8A 2BTOA 2JS7A 3WLTA 3Q10A 2PH3A 1I2CA 3EWSA 1SHTX 3AB3A 3OZXA 1MCZA 1U3CA 4ZI7F 4DXHA 3EZ7A 3T5BA 2R5NA 3KZVA 4IH1A 1EX6A 4OSOA 2VYVA 5SZJA 1B3RA 1GT91 1J5PA 5KYUB 4NBLA 1LI4A 1SG0A 3H11A 3S5JA 3EGIA 5BNZA 1YVEI 4BP9A 1KTIA 2AN4A 3NVMB 4INJA 2GCOA 3FSEA 2L18A 2GPJA 2P2LA 3TRKA 2HIMA 1DRUA 1EUDA 4C2AA 4XVUA 5EZYA 4RZSA 1ZS9A 2OENG 5CT5A 4EX7A 1E2IA 3LX8A 1J2TA 4I4CA 2BFMA 1T9KA 1OJLA 2GYYA 3VU9B 2E1RA 1Q0HA 5CXXA 4FDAA 1U0BB 1F1JA 1WV1A 4N6OA 3TI7A 2HT1A 1IOLA 3COSA 3B48A 4GUAA 4UBOA 2NG1A 1RRFA 4MRNA 1ODKA 4OX9B 3I83A 2XCQA 3FY4A 2DJ5A 4MVCA 4DR1B 2ODPA 1J8FA 3DE1X 3MUFA 4G2NA 1XC7A 5CM8B 2ZAMA 3V32A 3MT0A 4I55F 4AF7A 3IQEA 3KSZO 4HX9A 1QRRA 3ZD8A 2Z04A 5ED0A 2O6HA 3L6DA 1PT9A 4LF4B 2AMFA 4R2JA 1RYYA 5E9QA 5DGIA 1PL8A 3TS1A 2GN9A 4DL9A 3HCEA 1CEXA 4DG5A 1IBMB 5EYPA 2RB5A 1X7XB 2Z3VA 1G4HA 2XYHA 3BBPA 2Q62A 2C5BA 3DA8A 4DCTA 5IASA 2CJWA 3SJ7A 1H4QA 2AN9A 2OY0A 1VG9B 1XF1A 3MHTA 4LE1A 1NHWA 1S3SA 5JRJA 2P6RA 2QRKA 1AY0A 2RH4A 1U8CB 4MIKA 3FKSD 3ZDXB 4EG8A 3T3OA 1OREA 2XE4A 3HU1A 3OBIA 2I33A 4HCJA 1SXJD 2YWCA 5CXQA 3CZ9A 2O52A 5KX5B 4C2TA 2AR7A 3IUJA 4WX2B 5BQ3A 3TD9A 4DCSA 3PXBA 2RHOA 3HCNA 3KOWA 5TDHA 3V6MA 4MGIR 4EECA 1XDSA 4S2EA 1V8ZA 4GI1A 5L7WA 1ECPA 1G8GA 5J47A 1YDFA 2C2MA 3ND7A 4L75A 1ZD4A 1FP4A 2OV4A 3Q98A 4J0JA 5FUWA 4AMZA 4MJXA 4I66A 4D9HA 1IWBB 3C7DB 4H77A 5LOVA 4IJQA 2ZE5A 2FFJA 3MT7A 3CY6A 3P2MA 3WZ2A 3EZNA 3IUNA 3G8YA 2E6KA 2OCAA 3NH9A 1S01A 1QKIA 2GBIA 4OSEA 3THYA 1DKQA 1NN1A 2B4AA 4FWBA 1DLJA 1NYLA 4BU1A 3LA6A 5K09A 5H3HA 5HE8A 1BN7A 1XDDA 3STYA 5JRDS 2ZM6B 5F9MA 5AHXA 3PBKA 4BNUA 2IY9A 2VATA 2ZRPA 3PE3A 3D7LA 1V48A 1YFZA 2VG8A 4RK7A 2IYPA 4HGZA 2G8LA 4JGIA 1QV6A 5JJ5A 5DTEA 3PEVA 4CKWA 1OCEA 1YT5A 4M0PA 4X00A 1MH1A 4PZUA 2DLCX 4TRJA 3TTSA 5CRIA 4EL5A 4AYTA 2IRWA 3RUDA 2HDOA 3O2SB 4GI5A 4OH1A 1G19A 4LBVA 1PFQA 2E5LB 2BZGA 4RLQA 1F2TB 2ZCJA 1TQ6A 5K4HA 3CW8X 4DPKA 5DW3A 4REQB 1L2TA 2PXHA 1UDCA 3JCZA 1C1XB 2PKQP 4MWEA 4WXRA 3ZWAA 4NK5A 3FZGA 2JI8A 4M49A 4NYMQ 3DXXA 5B58T 4PLWA 3P4XA 3K0SA 4MYCA 1Z28A 1KY3A 4N49A 4B33A 4FP9A 1O95C 4KO2S 3WLNA 3F2VA 2NZYA 4MVXA 4CF6A 2AJCA 1WXDA 1XNGA 3AM5A 4IXMA 2AFRA 2JHFA 4DIKA 3BX1A 3F73A 1E62A 4D9KA 1GD1O 3A6LA 2FYTA 3ETHA 5SY4A 2QTVB 1MQAA 1OXXK 4CIYA 1TUIA 1PEYA 4E11A 2E55A 2NO6A 5REQA 1FUYB 2IEGA 4I4TF 4CTMA 3GP8A 3DMYA 4EM6A 1TTPB 2BMFA 2IOFA 2OZLB 1LS6A 4I7EA 1U3DA 2RK4A 4OAOA 3Q8XB 4WK6A 3HB9A 4MUJA 1FMTA 3NHPA 5DLYA 5CEEA 1NU6A 3G0CA 1F9AA 4TL8A 4A73A 1FTWA 3L6BA 2C83A 2IF2A 1Z4LA 4JSRA 5C8VA 5B7QA 4CLRA 4X1YA 2X6QA 1M1YE 3FYCA 4I55A 1XDZA 2QMYA 3A3YA 1PHPA 1J20A 1M2OA 2EJBA 4Z0TA 3ZH2A 1YQUA 2ZKLA 4TM7A 1UBUS 5DLEA 1U0LA 5IAOA 3LM8A 4E51A 4DJ5X 1MJGA 2ZATA 3HDJA 4MYHA 5F12A 1NJ1A 1F6DA 1V4VA 1OFGA 4GQAA 5H1YA 3S5UA 4C78A 4ETIA 5L53A 2B35A 1OYYA 3OD5A 3PUWA 2HF9A 3FE2A 2JH8A 5A0VA 3H3XA 3QIVA 5CYGA 2BEUB 2XA2A 1NUTA 4F06A 4YMVA 3N53A 1GFWA 1NLUA 1GGFA 2WVJA 3M83A 4IIYA 2I66A 4MVJD 2W6ZA 3FVRA 3R5JA 2W2XA 1DKMA 2WUVA 1VI2A 2CD9A 3RRZA 4DW8A 3OTWA 4EY5A 2AV6A 3U7JA 1BHJA 4NOLA 2G9NA 2V58A 5EZ5A 3C24A 2J0EA 2WMYA 2QU7A 4TLDA 4AP6A 5JHHB 3SJBA 4PO9A 3ZJVA 2IE0A 4FNGA 1U8AA 2OB1A 5AKZA 1CUBA 2ZSHA 2BP7A 3PENA 3SKYA 3ZGOA 4AW9A 4BJ6A 3VU3A 1B23P 2C7VA 3JQ8A 1R00A 3UC5A 1KGDA 2R85A 3AH8A 3X1WA 6GPBA 2FOLA 4FGJA 1FVFA 1PU2A 4CEIA 1LLDA 1UM9A 2YCBA 4MYRA 4BOYA 1PNQA 3S81A 2ZT8A 3USZA 2Z2KA 1E1MA 1HMPA 1RRKA 2HUNA 1UJ6A 2QZZA 2GVZC 1BWRA 2VNSA 3RSQA 4JI8B 1E2QA 1IE3A 4GNRA 1PDVA 5JI3E 1BU5A 3QHAA 7REQA 1ZC3A 1ZONA 1R18A 4LDPA 2EOAA 4YTEA 2I3DA 5AKLA 1GPYA 5TT1A 2GZSA 2HBZA 1AF7A 2BBWA 1N5MA 2JHCA 2UYYA 4CN8A 3CKYA 2WJ3A 1JAZA 1GSHA 2FQWA 4PYNA 1XRNA 4NAUA 3M1IA 1N4DA 3P2IA 1EWYA 4MXDA 1ZWLA 3PFHA 1TGVA 5B58C 3ED1A 4RS4A 5K6AA 1I2ZA 1XUOA 1SHKA 2V5AA 4UMEA 5EVJA 1QC5B 2F9LA 5DM1A 1XQ9A 2GA8A 4Y2TA 4U63A 4ASUD 1JI3A 2IA5A 3K0HA 3FBTA 5KVCA 5EL0A 2W70A 3RS9A 4MQ5A 2QVYX 3HJUA 1KMMA 3TB6A 2FMUA 1WKBA 1DO0A 1C0KA 2QRQA 3NBXX 4Q3BA 5C7YA 2VHWA 3AVQA 3CN9A 1L5OA 2YXNA 5ALKA 1EFRD 1TYBE 4JVNA 3QE0A 4QDTA 4CI0B 4CEJB 1TT5B 4E2WA 3IXLA 2BL4A 4NZMA 1ZYUA 4JVSB 4IDFA 5IG2A 3GUUA 3FTPA 3RVOA 2V1UA 5CJ2A 5HKKA 2CXHA 5JSFA 4L74A 3LKBA 1CDDA 3L46A 3BC1A 5A5EA 1VMEA 1C1YA 3PA8A 5E6RB 3JZDA 3R75A 3D6FA 3K0KA 3LPNA 3HJHA 4F9FA 2PG3A 2VZEA 3W1EA 1HRDA 1ZGJA 4OKNA 5A4AA 2CHGA 1Y8AA 1OMOA 5I9TA 4NZNA 4C4AA 4E7OA 3QVLA 2GM3A 5K1ZA 5CAEA 1KZ1A 4P53A 3T5CA 1KIFA 1KO8A 1PNTA 3KLBA 2XRZA 4LRQA 1JJIA 1TPYA 3IR6A 1MNAA 2JBAA 2RIRA 4JX8A 4B44A 4F3CA 3WISA 4HUQA 1IWOA 4QEDA 3WRWA 1F06A 3O8NA 2JCBA 3A9RA 4UHCA 5IMBA 5T3UA 1CQIB 1ZD2P 3HN6A 4I4TA 3FOCA 1MRNA 4X1IA 4Y9RA 4F2GA 1AMOA 4OAPA 1GZ3A 1QTRA 2O5VA 5E4FA 1YHNA 4J0GA 1JQBA 2ZYWX 1IZ9A 1CLEA 3FCUB 1CJUC 4FYWA 1O08A 2P40A 3NC1C 4GH5A 2ZUDA 4O59O 3CGWA 2RHJA 3VI4B 4Z51A 1DARA 1V71A 2KX7A 2X0DA 1ZAKA 1JXMA 1ABBA 4PLFA 1MMFB 4OPMA 4ZEVA 1A9QA 4CR7A 3DP7A 3O1IC 3PWKA 4RA6B 1NP7A 3Q88A 4BNFA 5B2FA 2XAAA 1YF3A 2CLKB 3X44A 2WJAA 2P30A 3KVNA 2VZ8A 3ABRB 2EJWA 4HYYA 4OQEA 3S2SA 5LN1A 5AM0A 4DSTA 1II8A 3ENVA 2ZI6A 3MUEA 3NAGA 3JQFA 4DV2B 2AZXA 2A1IA 2Y1DA 4FFLA 1K4YA 1YCHA 3WI7A 1S7CA 4WJZA 1U7XA 3LC1O 1QU3A 1T9ZA 3HYCA 1DX6A 1I7PA 2AMYA 2KPOA 2QP9X 5COAA 1N9KA 5CFNA 8GPBA 3LKDA 4I6EA 5EUQB 5LZ4A 1HGXA 1W85A 2O3SA 4YJ2B 5HCNA 4PANA 4ZCPA 5DLPA 1SC1A 3NBYC 1ZM3A 1TM2A 1KL7A 4IQFA 4QGAA 3UH0A 4PHCA 2H2GA 4ZZ1A 3IP1A 4F1JA 2JFOA 2I54A 4RPLA 1H69A 3RB8A 4K8OA 5IT9A 2FXVA 4LSZA 4W7IA 1P8AA 5C34B 3JAWB 4C9BA 2R7MA 1P2DA 2OBYA 4MTLA 3HY3A 1VSBA 3WJ1A 4BO8A 3FYUC 2IH5A 5TLSA 4RSGA 4X3CA 3U13A 4ZVSA 2FG7C 4BVJA 5E9JA 4JLBA 2ZDGA 1TFUA 1SUCA 2DE0X 5C18A 1VRCA 1E7MA 2GRJA 3DOUA 1OYWA 1BCRB 1RWMA 2W7TA 3DMFA 4U3JB 4PLCA 3SF8B 2BKUA 1Q1BA 1E1NA 2FSSA 2XDAA 4RKFA 4B4VA 4DLNA 4Q48A 4COKA 5F5LA 5L3SA 3AVVA 3N0WA 1YNSA 2A9QA 2WWYA 1CR4A 1DBWA 1TC2A 2YHAA 2FP4A 1PLLA 3A6GA 3DZGA 2G6BA 4UFOA 2QE7A 3M9WA 5DZSA 3ZHRA 5KYXA 4Y6RA 1VIAA 4H15A 3LP6A 1G4UR 3ZLUA 3E1SA 4MKIA 5A7GA 1ECLA 1TCBA 1CY6A 3Q5DA 4MW9A 3RUCA 1Z15A 2GFIA 1ZITA 3IQDB 2DHDA 2X9NA 1KMQA 1Q3HA 3L1HA 3R6DA 3OKCA 5JQWA 5LQUA 1QRAA 1ZRNA 2RBEA 3MWLA 4IV5A 4K3UA 1JG6A 3EEOA 1D2AA 1XBTA 3ILVA 3V8VA 4LW8A 4L15A 5E95A 1JN0A 1LUAA 4EPYA 4I9GA 4AAYA 3U48A 5BV2P 1U9IA 4ZC8A 4JXZA 5C4IA 2ACVA 4DJEC 1C8LA 2WJHA 4IQGA 1B6GA 2BDEA 2I2CA 3DMTA 4O2BF 1NA5A 2J6HA 4HQRA 1NI4A 4YK7A 4LKRA 3TOSA 5LWQA 1Z4QA 1EVKA 1ZRSA 2QVZX 3G0BA 2EZ8A 2I71A 2R6JA 4KYIB 4N3BA 4B17A 5I7WA 3EPPA 4MWOA 4RE5A 1GKYA 1E99A 5FPPA 4BMOB 5KU1A 2H1LA 4EH1A 2JIBA 2PBZA 1MC8A 1OWLA 3UC9A 2BM1A 1NW3A 2BGNA 5CUQA 421PA 4YCDA 4HV4A 3C2QA 2WU8A 3BWCA 3MWDA 5F5XA 3S28A 4YCLA 1TA9A 1UK9A 1RKUA 3DNMA 3HFJA 3SMQA 4BRUA 1IYZA 3D0RA 5BXYA 5IU6A 1UKBA 4IIDA 3W5VA 4YUAA 2E4WA 3BMNB 1PJZA 3IELA 1QYDA 1U8ZA 4C4TA 3HDGA 3JAMA 2WFLB 3BE8A 1QUEA 4OKSA 4U1RA 1R1DA 4RH1A 1OZHA 5DTIA 1NFFA 5BQPA 4QX6A 2VPQA 3H8WA 1SUIA 1T1SA 4RFVA 4CQMD 3ZWXA 4J0FA 4GXTA 2UZ0A 1U8XX 4JKYA 1G5RA 3BWYA 2Q5FA 5AJWA 3MJEA 5D1NA 5AM4A 5CM9C 4QYWA 2JLUA 3B3GA 3BB4A 3WA6A 2YH2A 4BMNA 1UJCA 2OT3B 3HADA 4ANFA 3RS8A 5DTRA 2R1VB 4YO8A 5EPEA 3FGNA 3SZGA 2YKGA 3UT0A 1PK9A 1DKNA 4B2IA 1HTBA 1ZOPA 1CZRA 1CWUA 1P4AA 1QIHA 5KQRA 2IDJA 1Q0ZA 2JJ1A 2XBUA 2QUHA 1M2NA 2M9MA 3BXPA 3LWZA 4GYYA 2A7QA 2V0NA 3RVMA 3TLZA 3QELB 3WQSB 1AKTA 2XUAA 5BR4A 2NXCA 2GVNA 3SOPA 3R40A 4WE3A 3SZ3A 3TW4A 1HNNA 3UJ6A 4PQYA 3WDLA 5LZ9A 4BNWA 5I4BA 5JBIA 5F21A 1ID1A 3W3AH 4XSVA 2ZBFA 4ZI5A 4FB5A 5JNRA 1NVEA 4W6ZA 3RODA 3H5AA 2YHIB 2IYYA 1R8XA 3WDKA 4OQZA 1ZX1A 2JANA 3DMHA 5DJ5A 5ESWA 2BI8A 3H2HA 2RH5A 3WDSA 3JSAA 4EVIA 4NENB 1P17A 2V7BA 4MH0R 4ARVA 4PWYA 3Q4GA 1UODA 4LF8B 3RFXA 3KZCA 1HE5A 1NBOA 3K0CC 4PLTA 5IBRA 1NVDA 5DO9A 2WLSA 3S70A 2QX4A 2C1XA 2Q6VA 1F8YA 2UV8A 3ZD6A 5BV8A 3KYIB 1T25A 5FHRA 1U8EA 2CJFA 4M0EA 1B8VA 4TTJA 3TRJA 2JCVA 3GWIA 2PU7A 4BZXA 1VJ1A 4YBRA 3EQ9A 1JAIA 1M5TA 1P73A 2CFCA 2OCYC 2R6FA 2ZS7A 3DHEA 3HJTA 4R2LA