2YJ6A

Conformational changes in the catalytic domain of the cpx-atpase copb- b upon nucleotide binding
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
251
structure length
248
Chain Sequence
ALSLYEKMLHKGMIIKNSNVYEKIKEIDTIIFNKTGTLTYGTPIVTQFIGDSLSLAYAASVEALSSHPIAKAIVKYAKEQGVKILEVKDFKEISGIGVRGKISDKIIEVKKAENNNDIAVYINGEPIASFNISDVPRPNLKDYLEKLKNEGLKIIILSGDKEDKVKELSKELNIQEYYSNLSPEDKVRIIEKLKQNGNKVLMIGDGVNDAAALALADVSVAMGNISKNVADIILVSNDIGTLLGLIKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COPPER-TRANSPORTING ATPASE
publication title Conformational Changes in the Catalytic Domain of the Cpx-ATPase Copb-B Upon Nucleotide Binding
rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 68
structure length 248
sequence length 251
chains with identical sequence B
ec nomenclature ec 3.6.1.36: Transferred entry: 7.2.2.19.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2yj6A01
3.40.1110.10 Alpha Beta 3-Layer(aba) Sandwich Calcium-transporting ATPase, cytoplasmic domain N Calcium-transporting ATPase, cytoplasmic domain N 2yj6A02
2A00A 5AIBA 1X42A 4HYTA 3I1YA 4HGRA 3RFUA 5AW8A 4I9GA 3E84A 4KX5A 2P69A 3A1CA 3E81A 2RARA 5IT4A 4NWIA 5ALTA 3MN1A 3FM9A 3EWIA 1RRCA 3A3YA 3CNHA 2FPSA 1O03A 2G07A 5A3RA 2HI0A 3NUQA 3VAYA 3MPOA 5AW5A 3NRJA 2R8EA 3NAMA 2OA0A 2WF8A 2BDEA 3N28A 3UM9A 4Y2PA 1N8NA 2C8LA 1MO7A 3EPRA 5AW0A 2NO5A 4RETA 5AW7A 4F71A 2FUCA 4BX2A 5ALZA 2GHQA 4KNWA 4YIKA 4ZEWA 3WKDA 3ET4A 2JAWA 5ALHA 2Q5EA 3WK6A 4G9BA 4BX0A 1U2SA 2YY6A 1QQ6A 5ALDA 4UATA 3QU4A 3QGMA 1YDFA 2IYEA 3U13A 3FVVA 2G1AA 5AKKA 4OHFA 1RPZA 3K1ZA 1U2TA 4OFZA 4YIHA 4HGPA 4UAVA 3AR6A 4HGNA 2NO4A 1ZRMA 5ALPA 3ZUPA 3AR3A 3UMBA 5A3SA 5AVVA 3A1EA 2FPXA 4BNDA 4HAIA 3KDPA 3L0CA 4UMEA 3U7HB 1Q3IA 2FEAA 4AS2A 3OCZA 1IWOA 2IA5A 5A3QA 2P11A 3NALA 2W4MA 4OD0A 3AR2A 5AI6A 5AKZA 4AP9A 4ZEXA 3DAOA 3KC2A 3QU2A 3AR4A 2HF2A 4MWOA 1JUDA 3IRUA 1EK2A 5JJBA 3HYCA 4L6CA 4XE5A 2WF6A 2YMLA 2I54A 3L7YA 5ALUA 4CF4A 3ZWDA 4MUMA 4KX3A 3FPSA 3QLEA 3OTQA 1MH9A 1EK1A 4Y2QA 2A29A 2CFTA 4FYPA 3L1UA 3QNMA 4KYTA 3QX7A 2W11A 2PQ0A 3AR7A 4YCNA 4F72A 2C4NA 1Z5GA 1T5TA 3EF0A 5ALMA 3L5KA 4Y2JA 3ZI4A 2OBBA 5ALWA 5AI0A 2GMWA 3B9BA 5ALXA 4GIBA 3WK9A 3ZX4A 2ODAA 2HSZA 1NF2A 5ALLA 5AM3A 1F5SA 3QU7A 1U7QA 2PR7A 1Y8AA 5AW9A 2HX1A 5IS2A 1RQLA 3WK5A 2YMQA 2FPRA 1S2OA 5T41A 5ALOA 2MSNA 2GHTA 1RKQA 5AVXA 4YGYA 4XPZA 4JDPA 3SKYA 3WK8A 1MO8A 1RLTA 1NNLA 1RKUA 3U7EB 2EAUA 4BX3A 5FP0A 3L8GA 3R9KA 1RLOA 5AICA 3WKCA 2YJ5A 3F9RA 1RMQA 1XP5A 2YBDA 5AKYA 2KMXA 4Y2UA 1YMQA 2C88A 4KNVA 2I7DA 5AKLA 3QU9A 1SWWA 2QLTA 1RMTA 2FPWA 2MU1A 2HOQA 2R8YA 3L8HA 4Y2VA 2CFSA 4UM5A 1CQZA 4L6AA 1YNSA 5ALSA 1XPJA 3ZTYA 2FI1A 4OCZA 4ZEVA 1QQ5A 1L8OA 4PNHA 4EZEA 5ALRA 4RESA 1Z88A 3ED5A 3W5DA 4EX7A 3GWIA 2R8XA 3WKEA 1LTQA 3QUQA 2G0AA 3ZVLA 2AH5A 2G09A 5IT0A 3NIWA 2G08A 4KN8A 3U7FB 3ESQA 3OCYA 2WFAA 5AM5A 2GO7A 1Z4IA 2B0CA 4L57A 2B8JA 2YN4A 3L0BA 5AKEA 3SMVA 3ET5A 3L8EA 3DNPA 3UMGA 1Q91A 2FDRA 2HCFA 3E8MA 2ZBEA 3SHQA 2C9MA 2B30A 1YS9A 1Z4KA 5AM0A 3QUBA 2ZBDA 4NV0A 5AKJA 4G63A 4UAUA 2ZOSA 1WZCA 3QU5A 4Y2RA 3W5BA 5AVRA 2CFRA 2WM8A 3PDWA 5AK5A 4QJBA 2WF9A 4C4TA 4JB3A 3EF1A 3I76A 3ZVNA 2HF7A 3AR8A 3N5KA 4BBJA 1L8LA 4BYGA 2R8ZA 4Y2TA 3W5AA 1QH9A 3UMCA 2YJ3A 3SF0A 5AKGA 1SWVA 5ALYA 3RF6A 3J7TA 5AI4A 3ZX5A 3QUCA 1K1EA 1RC8A 1VFPA 3OCWA 3KZXA 4NABA 3WGVA 3GYGA 4C4SA 1VJ5A 2ZG6A 1SU4A 3I28A 3PGLA 1WPGA 4QQFA 5AKHA 1AQ6A 4NAVA 4EX6A 3OCXA 5AK3A 4CF5A 3FGOA 5AVSA 2ZXEA 3KD3A 2JARA 3FPBA 5AW4A 2AMYA 1RDFA 4J03A 1VJRA 3B8EA 4UMVA 4O8CA 1S8OA 3N1UA 5AVWA 2FUEA 3W5CA 2HEGA 2CN1A 3WK4A 2NYVA 1SVJA 4I9FA 3MMZA 1Z4PX 4BEVA 5ALVA 4H1WA 3PCTA 2W43A 2QYHA 4Y3UA 4B6JA 3L8FA 2JAOA 2OM6A 3L1VA 1Z4QA 3U26A 5ALGA 2I34A 1NRWA 2IOHA 1TE2A 2HDOA 1Q92A 1T5SA 1Z5UA 2X4DA 1WR8A 1KYTA 4HGQA 2DQSA 2Q4RA 2P9JA 1ZD4A 3AR9A 4GXTA 3M9LA 1RKVA 2B1QA 1TJ5A 2RB5A 3QUTA 4UMDA 1Z4OA 4CF3A 2B1RA 5AK6A 1ZRNA 2PKEA 5AW2A 4UASA 5ALEA 3KBBA 1U02A 1U7OA 5AHXA 1ZD2P 2AGVA 4HGOA 3QXGA 3S6JA 1Z4MA 3ZTWA 2JGAA 3BA6A 5ALKA 3L0YA 2IOFA 2ARFA 4DWOA 2C8KA 1L7NA 2B82A 2YJ6A 2HHLA 3BWVA 1TJ4A 3P96A 5AVQA 3PGVA 1Z4JA 5AI5A 3AR5A 2O2XA 1RMYA 1L7MA 4FFDA 1YJ5A 2ZBFA 2RBKA 1PW5A 4Y2XA 5AVUA 4NFLA 4YH1A 1TJ3A 3R4CA 4AS3A 3E58A 2HO4A 4EEKA 5AM1A 4DFDA 4IFTA 4C4RA 2YMPA 2VKQA 1L6RA 4XOUA 4Y2SA 2WF7A 4UU1A 4CE6A 5AW6A 2EARA 3ZWKA 4BEWA 5AI8A 2EATA 1ZJJA 3DDHA 2OYCA 2P27A 1L7PA 3DV9A 2ZBGA 5ALIA 1LVHA 3ZW7A 5ALNA 5ALQA 5AKXA 5AK4A 1N9KA 1RQNA 5AESA 5AW3A 2YMMA 4FE3A 2RAVA 3D6JA 3A1DA 3FZQA 2FPUA 2Q4TA 3M1YA 1WVIA 2G06A 5E0OA 3WGUA 4J2TA 2AUTA 2YFYA 3SLRA 2I33A 1T9ZA 1U7PA 3R09A 4DCCA 5ALFA 3QYPA 5AM4A 3KOOA 1ZD3A 3ESRA 3WKAA 2G80A 3N07A 4UU0A 1L7OA 2B8EA 2I6XA 1ZD5A 4UM7A 4CNQA 2BY4A 3N8GA 3WK7A 3IB6A 3ZU6A 4DW8A 5AM2A 4EELA 3WKBA 5AIAA 4E88A 4BKMA 2IOFK 1J8DA 2BDUA 2D2VA 3HLTA 4UMFA 5AW1A 3U7GA 3B9RA 3U19A 3NASA 4UW9A 1Z4LA 1XVIA 3OCVA 1RLMA 2I55A 3IJ5A 1CR6A 5ALJA 1YV9A 4YCMA 2YJ4A 5AI9A 1TA0A 3CZ4A 3ONNA 5AVTA 5AVYA 1FEZA 3MC1A 3SD7A 5AVZA 4UARA 3TLMA 4Y2YA 4YCLA 2KMVA 4BNDB 3ZVMA 4XQ0A 2GFHA 3OPXA 3I6BA 4IG4A 1ZS9A 2O9JA 1Z4NA 3NANA 3OCUA 2WF5A 3SKXA 1O08A 2WHEA 1J97A 4EENA 1ZOLA 2JAUA 1QQ7A 5AKIA 1QYIA
chains in the Genus database with same CATH superfamily
5CFRA 3L79A 4P98A 2QD4A 3E9MA 4Q7EA 4YMTA 3DB1A 5ERXA 5SZHB 1JR6A 3I9FA 2Z3VA 3RRYA 3FRIA 3W34A 1KAHA 2GH1A 4GX0A 4RPKA 4OX9B 1GLGA 4EGCB 2GVNA 3W79A 1EVJA 4U3JB 5FJIA 4LF8B 1J5XA 1P8JA 2DMRA 4LGMA 2QNIA 3LBNA 1VDMA 1WMEA 2JIPA 4C0BA 3ZWVA 3FTEA 2H2GA 5TF4A 3V8VA 4I50F 5BWOA 3NHMA 1GU1A 4YBRA 2QRPA 3IAAA 2FV8A 3PNYA 1ACJA 3FI0A 4EA9A 1MAAA 3NRJA 3T7KA 1JG3A 3NH9A 5BVHB 1FCJA 2J6IA 3CTPA 4ZI7F 5B58C 4E4YA 1CDOA 5AVKA 2CDRA 3HZZA 3N28A 4NPAA 1FMFA 1ZIXA 3OURA 1VPEA 4FE7A 1NPTO 1FTYA 1V1JA 3U7QA 3PUKA 2JGDB 4HXYA 1NFFA 2VQFB 3QY9A 1WNTA 3OPYA 5KINB 2QLLA 1V1MB 2IUFA 3DAYA 3V1YA 3DNMA 1OGJA 1OAKA 1M1ZA 1YBMA 5SY6A 1PUJA 3PNVA 2CK3D 1BOOA 1P1HA 1MU0A 4DR7B 4JL5A 1L5HA 1NVWQ 1Q22A 3M82A 1TB4A 3C3AA 2BM1A 3PNLA 2HA7A 4AX4A 5DU2A 3ZOZA 3TD6A 2EFHB 1GV0A 5J4YA 1C4WA 1TKCA 3C4VA 5EUCA 2WYWA 2MHCA 3SYRA 1BKSB 1XEXA 5E6UB 2XMQA 1WY7A 5IYZF 4F4UA 1SKMA 3KJZA 1ZC3A 3OU6A 1BIFA 1Z7EA 5JQGA 3NETA 4G97A 1X7WB 4OFZA 3EG5A 3RVQA 3WJ2A 3EGXB 1OKKA 4FYIA 2E48A 1AC5A 1OLSB 1I94B 1DFGA 1O95D 1ZLXA 2AQHA 3GGSA 3HLKA 4AB1A 1YQ9A 5KVVA 4PC7A 3ZUPA 4LE2A 3X2FA 3PDJA 1U3WA 4NEHB 2GNAA 2P1ZA 3M49A 2XYQA 5A4FS 4U6SA 1OY1A 5ITSA 2WU4A 1GGVA 3THXB 1WB5A 4DM7A 1QRTA 4TGLA 4HAUA 2HW8A 2BMWA 3G5TA 3DZJA 1G7TA 3I1IA 2A5FA 2GK4A 1B6GA 1X14A 3MCVA 3QPUA 3QPBA 3UMSA 3Q8KA 1B2LA 1N2ZA 4UHKA 4YRIA 4EHJA 1WLYA 1G2QA 2PBLA 1WCIA 2D06A 2ODEA 2XVYA 4DCOA 3BE8A 3P2KA 4BN4A 1NN3A 2Q9UA 3P8ZA 3N2EA 4DWJA 3ZD8A 3WFZA 1JDSA 1LBEA 2D62A 2QMOA 2V5VA 3HU1A 5EPOA 5T4BA 3SFTA 3DAOA 4KI7A 4CTOA 3T3NA 1E1LA 1IEVA 4WDQA 3OKCA 2Z0MA 4OSPA 2FCRA 3ANYB 4X71A 1EK2A 1XBTA 1ECCA 2VZ8A 3LDFA 4BOYA 5D3QA 2QNRA 3K96A 3MCTA 5I8PA 4CT4B 1RAHA 4L8FA 4EH1A 3I6ZA 4S05A 2HQ1A 3OJWA 3LWBA 3H4MA 4B4VA 3IULA 4TT3A 4C30A 3GA7A 4D0NA 5LSAA 1DO2A 4FDUA 2ERXA 2J9ZB 2F4NA 1BFKA 3EFOB 3F46A 3JWIA 4EW2A 1HT1E 2FE1A 2X7XA 3MGCA 3OQ6A 1E0AA 1L7XA 4A23A 1D0VA 4Z5XA 1WSWA 3QOWA 2D0PB 3TFQA 1O4VA 3BICA 4A82A 2Q49A 3L6DA 2GXSA 1BMTA 1PR4A 1Z37A 4N5DA 4CIXA 4DIUA 3DLTA 2NU9A 4UOZA 3AESB 3SWWA 4CR6A 2BBSA 3DXZA 3W2HA 3I04A 5FI0B 1KR2A 5ENZA 5I4CA 1XTKA 3FMGA 1CRQA 1MB2A 4OAPA 1P81A 3C6ZA 3E61A 4GSLA 4L07A 1FRNA 1VLMA 1X8XA 1H3NA 3I37X 1JB9A 4GFDA 3L1HA 4BO3A 2WUVA 1KBZA 4C3UA 4F5DA 5A03A 4U0KA 3ZJYA 3W05A 3PC6A 4QUJA 2AVDA 4JL6A 4HLCA 4P4GA 4HATA 5J2TB 4KYVA 2RHRA 3I05A 1U4SA 1GZSA 2VHJA 3ZX4A 3PHGA 4LBZA 5AM3A 2W93A 3W5UA 4MITA 2CCJA 3OHMA 4FUTA 4AW9A 2PR7A 3KYCA 1GQOA 4L3WA 1BRTA 1CP2A 4ISBA 3NR2A 2DZDA 4LXQA 5F52A 1SIUA 4JA0A 3EIOA 4J9VA 5KYUA 4CETA 5KNBH 1C9NA 3GT3A 3T5AA 1A9OA 3TW6A 3W8DA 2M98A 3EIHA 3O2QB 3BAZA 3ABZA 5B57C 4LVOA 2DT5A 2VRWA 2FJPA 2ZAGA 3OM9A 4NBRA 2MSNA 5HE9A 5TT0A 4B33A 1RT9A 3EPJA 3GWGA 1B8UA 4QRHA 3WDMA 4JC5A 1H5NA 2R4UA 1BCSA 1E2KA 1LPAB 1UFVA 2I65A 1U7DA 3QJYA 1KKLA 3VKFA 4D4LA 1GSOA 4QDJA 3GDHA 1PYGA 3SZ3A 1CEEA 1FQJA 2H2IA 4WZAB 5I6DA 3HXPA 4Q1BA 1HH4A 1VZ3A 3G9UA 1M2GA 1XLVA 5DHFA 1V7QA 1Z34A 2QMYA 3NRCA 1RQGA 2JIBA 1EFAA 2XMRA 3GA5A 2BJHA 4MB2A 3ZWMA 1DADA 7REQA 3RRXA 2P4HX 3M5CA 3RRFA 1SQFA 3C16C 2J7PA 1L4KA 5A3VA 4EB8A 4KNVA 4WFKA 5J9FA 2G1KA 2QUJA 3TL3A 4MYUA 3SBXA 4GMXA 3WGTA 2HU8A 1L7QA 4K6MA 4PG7A 4BQOA 5B36A 2Q3FA 2R6FA 1PEYA 1KTIA 5K0LA 3WSWA 5HKAA 1KRXA 3QE2A 5KYYA 4R4JA 4ZYUA 1YNSA 4HS9A 3GFBA 3NUZA 3Q1LA 4W82A 2VNKA 3N2ZB 3PUVA 4HL6A 1G4UR 4I4NA 3KT6A 4FDAA 4ODIA 5EGSA 2EW1A 3NRBA 4KRXA 3WA6A 2AFVA 1JSRA 3B12A 4XSGA 5HZHA 1W49A 3DTVD 2YV4A 3GLFB 3GWIA 4EX7A 1G8JA 2DVMA 4GBGA 3WGIA 3CVXA 3I4LA 4J75A 1UH5A 1YZTA 3K05A 5B1HA 4URXR 2G04A 4Z4FA 1LUAA 1P31A 3OECA 3DAFA 4R2IA 4ZYVA 2WABA 4D3SA 3PLNA 3O82A 3WXMA 4HYYA 3DTYA 3DMRA 3AL3A 4HWPA 4HDNA 1V1RA 4C0AC 1J33A 2VSFA 1BWSA 4GP9A 2AE2A 1PWHA 1TVKB 1TM7E 2B1GA 2IKSA 4MJ7A 3LKBA 3EZNA 3S99A 4KDRA 4BP9A 5IBRA 3B3AA 5IKXA 1X2BA 5EC8A 3V6MA 1XMSA 1G18A 2R6R1 3E9YA 2ZLBA 4BNWA 4RZ3A 5TPWA 1TCVA 1KYZA 1O96B 2GPSA 3EC2A 2ORYA 4XCVA 4RWEA 3LHKA 1UCFA 3U31A 1OAOA 4N0QA 1FZQA 4DV2B 1OH7A 4V1CA 3AXSA 2BOVA 3S2UA 4RXUA 3MTIA 4K6CA 1A5BB 1W6UA 3GFQA 1OWLA 2FWPA 3KSUA 1XVAA 4FN5A 2VAWA 4MGIR 4GO1A 4WK0B 4JZKA 4C4TA 3O1HB 3ELDA 3F6SA 4WESA 1IN8A 2BI8A 2X2FA 1DKOA 3D7SA 3OJFA 4UBKA 3U4AA 4LJ4A 1N9ZA 2X7JA 4XGKA 4Y2TA 1FNMA 1IPHA 3IUMA 2JG3A 2P1DA 3RJ9A 3SIWA 1ZGAA 2DY0A 5MGBA 2C77A 3RG2A 3NC1C 4XGNA 1EM8B 3HHPA 3ASVA 3GEGA 2Q1YA 1I6LA 5CIYA 1CEYA 3WOVA 2VR1A 3FIJA 5E1DA 4AY6A 5EL0A 5K3OA 1XHEA 4AO7A 2PXCA 5JARA 1I36A 2G7ZA 2P40A 3I9V6 4OVKA 3PTZA 2YDXA 1N5LA 1ORVA 4F2WA 4CIAA 4OXIA 4B3IA 2WFZA 4WZAE 3PC8C 1Z6XA 2XE8A 3A6GA 4CF5A 4PIMA 4ID9A 3F2IA 1QG6A 2OXFA 4NYJQ 1SHUX 3GLHB 4AG3A 5T4FA 3RT1A 1T3ZA 3LVQE 1XYVA 3EBLA 4ALIA 2IDZA 1INLA 2WSBA 5CT8A 3A36A 1Z36A 1T4CB 1YD7A 3CFYA 3KRTA 4UU7A 5AVWA 2YV1A 3LMKA 4DLPA 2CN1A 2I6GA 1HQDA 2VYVA 3A4VA 4RVDA 1DE0A 1DC5A 4I66A 1B00A 5D2CA 4ESEA 5LR6A 4QXAA 5ANRB 1JE1A 3U3KA 5I7UA 1EG2A 3REOA 3KUUA 4ZHSA 2PL5A 5IJ0A 1XLTC 1VP9A 2CB0A 5HCUA 4YFYA 3A9CA 3L1VA 2XMSA 1QVVA 1E89A 1GEEA 4QPPA 2O7VA 4W5HA 1FFXA 3VPFA 1JDBB 1JDJA 4NJMB 2O2CA 3HQ4O 1HLFA 3EE6A 3OJXA 1Z5UA 1GU7A 3T4XA 1HOTA 2BWJA 5TMPA 2B34A 2EFDB 3CRVA 3AY3A 4O3MA 3FDZA 1S6YA 4AWAA 1R0RE 1ST2A 3KP1A 3NGMA 1YQUA 2D0IA 5CB4F 4B7UA 5JD5A 1TJ5A 4Z0TA 3P4UA 5LOVB 2A9VA 3P2YA 1V3TA 4O33A 1EFUA 3LLSA 2BI4A 1RJFA 3AFMA 3VU9B 3WAGA 3DCJA 4NE7A 3MTGA 4F12A 2X6RA 3DDZX 3PF9A 4EBFA 4NJOA 3PHCA 1NJGA 4EPRA 1DV2A 2HPAA 3HL0A 1KFJB 2Y92A 2VXOA 5KTTA 4HSEA 4H1VA 3WWPA 4C5CA 1HDCA 1PI3A 1PSWA 2O6LA 3K6KA 4XVUA 4YV1A 3F5MA 5CAEB 3IDZA 4PYLA 2BZSA 1B6RA 3ELWA 4QJ4A 1RU3A 1Z4MA 3KL4A 4XWYA 5EQTA 3QF4B 1WP9A 2YWRA 4KMOA 3E22A 4P1ZA 3ZTWA 3NKLA 4PO8A 3OC0A 2OCGA 4V03A 5GJVC 3B82A 2II6A 1BA3A 2YC2C 4YALA 2B82A 1JTVA 2AA3A 3Q9UA 2EZ4A 1FNDA 2WP0A 4G5QA 4D74A 1W8DA 1ZI6A 2XTZA 4PQEA 5L3RA 5TVKA 2B4KA 4JZYA 4RLSA 1AK2A 4PG5A 1RWPA 4OQ4A 5CYPA 2YJGA 1MO3A 1ZH2A 4Q24A 1EFRA 4RACA 3RHZA 3MT0A 4A8JC 2A35A 3QOFA 2DHRA 4Z9XA 1KE1A 3EIQA 2PFSA 3GZJA 3H2GA 2W2LD 4YXWA 4MVJD 3C41J 2C03A 3GLIA 2G9QA 1Z5OA 5HFJA 1FDTA 2GBPA 1HRKA 4TTIA 5KTNA 3NYIA 1AUVA 2A9FA 4RL4A 1S89A 1E0DA 3G5AA 3WL8A 4L6IA 5TMEA 4CFSA 1DX4A 1U3UA 1WUHS 2PMEA 4CRWB 4C4RA 4IKPA 4EJ6A 4P3YA 1ZJ5A 1H3FA 3EB9A 2P9TA 1J7JA 3ZJUA 1C3OA 3LDUA 3M4YA 2J9RA 1LZKA 4Z0NA 1NUSA 3EQ7A 5AW6A 5J2UF 4G1BA 2XGSA 3BHJA 1MHTA 5AI8A 1GNQA 3IPXA 5JOQA 3DFZA 1K88A 5IN4A 4QOHA 4KNYA 2ZVDA 2ID8A 2ZRBA 4Z9AA 3M6LA 4ER3A 1J39A 5GZ6A 2QR5A 3C3KA 4GLBA 2QTLA 4PBTA 1I7PA 3I2YX 3K1AB 3Q0EA 1Z26A 2ZJOA 1MBZA 3R20A 3RSFA 2ZYVX 2P67A 3JARA 4JU8A 2WG0A 3PNQA 2E5LB 4AJJA 5BRAA 5C5IA 2DBRA 3KPWA 1D2HA 5B6IA 3FNBA 2W8BA 1ZICA 3H2KA 5EIFA 3UF0A 3JQFC 3VKWA 1T8RA 4YJ2A 3N2GA 5IAKA 1QIMA 4M4SA 3FOFC 1YS2X 2H0AA 3D4LA 1VXRA 3KKZA 4WW0A 3WYCA 2V6FA 2J3KA 4BQSA 4ENQA 4Z7NB 4E94A 4XB2A 8ATCA 1Q7CA 3GLGA 3OIVA 5J47A 1FMTA 1ZMTA 3HG7A 4K6FA 3TNFA 3WKAA 4M7PA 5L4SA 3SSNA 7AT1A 2FRDA 2Q2QA 3BGVA 3I2HA 4LGCA 1TQ4A 1EU1A 1GQRA 2I6XA 2RK6A 5JAZA 2BFPA 1O94A 3AVOA 4JXJA 4TSFD 3I5AA 5JXIA 1XI2A 2ZUBA 5DTQA 4EMBA 2ZIFA 3EVGA 3FKSD 5COQA 2I3GA 4YLEA 1E6WA 3ECSA 4WLFA 1QP7A 1JWLA 3COYA 2PIDA 4E03A 3HB4X 4XGQA 2Z8ZA 4FBLA 5CDFE 1WRBA 3BK7A 2F1KA 4JB8A 5KTMA 5G4LA 1K63A 1XP8A 3D3WA 3IMFA 1L1QA 3KPVA 2I55A 1SUPA 3FGNA 1WNFA 3KTAA 3R3JA 5DGTA 5K3AA 2BE7A 4CLOA 3D2CA 4L0MA 2Q1XA 3BQ9A 3SXPA 4OHVA 1Z7GA 4DSAA 2I7TA 1NBEA 5AVTA 1XL0A 3GDWA 1HSOA 4Z4CA 3S81A 1DIGA 5IAEA 1ZL2A 1KEEB 2Q0QA 3GD7A 4M60A 5T67A 5CD1A 4XWOA 5FWYB 5BSKA 2OHGA 2MSEB 5HZKA 4KQXA 3ANSA 4HDKA 4IBOA 2JAQA 5D5QA 3Q5GA 4B31A 3UQZA 4AICA 4LBYA 2Z9DA 1MR3F 4OLFA 5A5DA 4LDNA 4BJ1A 3H8SA 3E9ZA 3ZYZA 1OT5A 1DAPA 2Q29A 1FDOA 5AH0A 3UW1A 3DYBA 2UYHA 4U0JA 3RFUA 4CEJB 2EJUA 4IJ5A 2ZAMA 3A1TA 3BSSA 4FI3C 1ILWA 3EVCA 5EA2A 1J9EA 2RGXA 1T35A 3PRKE 3QWIA 4RF5A 3MT9A 4O4IA 3DMFA 1SOWA 4WY8A 2OM2A 1U2GC 4H31A 4NENB 5DMHA 1XZCA 3G7SA 2XWPA 2A33A 3JZDA 2OAEA 3CNOA 2PSHA 2BISA 4IRMA 2VQSA 2YWDA 4IWNA 3CG4A 4J0JA 2VP3A 3DOEA 4WKBA 4X1KB 1GRRA 1A9TA 1VP3A 4CLRA 3A3OA 3C3MA 1E3WB 4LWOA 2H7CA 1FP4B 4TKVA 1XWWA 5A2GA 3L1JA 2I6SA 3V4SA 1VL6A 4HFNA 4IOJA 2BGUA 2HC9A 1E0SA 1QH1A 2P62A 3HR8A 5AJXA 3IVRA 4KQEA 4UNNA 1XD2B 4GD3Q 2JK0A 5DCYA 4AY4A 3W4JA 5BUQA 5HR5A 1M34B 4RIFA 3DE0X 3ROGA 1KS9A 1UFQA 2FY8A 4R81A 3RK4A 4F6CA 4DLNA 5KNCD 3DOUA 4HEHA 5F2KA 1LX6A 4MA5A 4PGAA 4RETA 1RYBA 3DQPA 5DT9A 3RJMA 2VT7A 3O0TA 1KK2A 2LUOA 3EZFA 3WHLA 1FUUA 2ZJYA 1U98A 2OO5A 3JRWA 4X85A 4KGZA 4OQZA 4MIKA 3VNVA 1QAQA 3N53A 4CCYA 5ICEA 3QMVA 4GYWA 1UKCA 5BNZA 4ID3A 2UYYA 4M87A 1RWQA 1RP7A 3CRW1 2HSJA 2XYHA 4ZT5A 5KX5F 1LLUA 4CKZA 1NU6A 2YCLA 2Z8YM 2OY0A 2YJZA 1C3XA 2IYEA 2V9CA 2P4SA 4DGSA 4TMZA 1XZFA 4C05A 4B7ZA 4PQYA 4YO7A 2PGJA 3OESA 1T25A 2EF1A 5FFFA 1EJ0A 1VMEA 2G72A 3RIGA 2IZ7A 3HA3A 2CXQA 2LW7A 4BNZA 3CKMA 1FW6A 3IA2A 1IPFA 2Y2VA 3DBLA 3BX1A 4P84A 3PUZA 5EEGA 2A5GA 1EXMA 5C5DA 3UMBA 4OBEA 2HU2A 3ZZ0A 4Y9DA 1SG9A 4HAIA 2BHSA 3DC7A 1MT3A 1EKXA 4CUJA 2X4IA 4JLUA 3HKBA 1W85A 1D04A 3L9WA 3A10A 4C5BA 1VE3A 1CT9A 3IUEA 2I99A 1G291 3GXBA 3LBHA 4BMVA 3HS3A 4OQYA 4AS2A 2D5IA 4R98A 5BNFA 1KNQA 1CRWG 3RC9A 1QORA 4NHEA 1B43A 2JDIA 3I92A 1ZN8A 4MEJA 4BDTA 1NHGA 4ZGGA 5J3JA 3BF7A 1I13A 2XB4A 1GKKA 2NXWA 5F4BA 5TJHA 4G6ZA 2BH2A 3PUXA 1JI3A 1L5VA 3TF5A 4NBUA 5FO0A 1YNOA 2C5LA 2YL2A 1KXZA 1E6CA 2QLBA 1FX0A 4QQ8A 3W3ZB 1KAGA 1XT6A 3RVJA 2C61A 3S68A 4BKRA 3P7MA 4JBNA 1FJXA 3F4BA 1TLLA 1VKRA 3EY4A 2JFOA 4LNUA 1ZEJA 3KEFA 2P2GA 5ELXA 2F64A 2DHEA 5DM1A 4WBNA 2C2BA 1ZJ6A 2VP6A 2ZTLA 2EP8A 3BXEA 3FH0A 1HV8A 3C4QA 4RY9A 4A8HA 5AXDA 2EWVA 2CBZA 3IUYA 2WQ7A 3OVMA 1ZHHA 4LECA 4NMXB 4M1WA 2VDOB 4OUKX 3MSCA 5C8YB 2O3RA 1ZOOA 2D5AA 2P9ZA 3HJCA 3PDHA 4YQZA 5F73A 3TLGB 4C1BA 3RYIB 1SBCA 4TXNA 5FQNA 3SC3A 4BWFB 4EK9A 2W11A 5I3CA 4EA7A 3LQFA 1UBHS 3CSDA 4KQWA 1YA8A 3DL7A 1NQXA 2EBWA 4F72A 1P75A 2ZE5A 2XZDA 2J9GA 3C14C 2HU5A 3CB4A 1QC5A 4BLRA 4E2FA 4YCCA 1K4MA 1A4XA 2GMWA 3Q6MA 3NBFA 4ZC8A 4Z9YA 5INTA 3CE9A 3G5UA 3IE1A 4GL2A 3Q0IA 1UPAA 2W6PA 3PC7A 4IIBA 5A9SA 1UJNA 3VJRA 4YBZA 4O2BA 4B5KA 1BN7A 3ONVA 2OQRA 1E7WA 3NEJA 3OLXA 4IIJA 4EAAA 1J8MF 5MDHA 1U7QA 4NQRA 1P5ZB 1XQVA 2BUAA 3L7IA 1CY6A 2EL7A 3BC1A 3D8UA 3HN6A 1D6NA 3LOPA 1G5QA 3MWKA 4XLZA 3UC5A 1EVZA 2O2ZA 2EZUA 5ADWA 4DIMA 1RXUA 1ORIA 4LFBB 4GLOA 4PCLA 1Q0QA 1KI9A 4KB5A 4MLCA 2R11A 4JJEA 3T7RA 4OTZA 2XECA 1I4EB 1N7HA 2OCYC 4TTAA 2O8DB 2RKOA 2I2DA 5DTJA 2QD3A 1UBKS 2Y27A 2DRIA 4ND5A 4HVTA 3CBGA 3ANMA 2EZTA 3WGQA 2W98A 5U1PA 2CJWA 2M32A 2NQ8A 2BFFB 4YROA 1Y6GA 4XVRA 4BRSA 4ZHQA 2AR9A 4LTDA 4R2KA 1W30A 2ZR9A 1QQAA 3MOGA 2UUPA 3E9CA 4NV3A 3SZUA 1XZMA 4E46A 2D1QA 1S4QA 1V11A 5BN4A 1Y9DA 4MI9A 2F43A 1Z8NA 1R12A 2JI9A 3BK1A 1YMQA 2WWVD 4D98A 1ZK2A 2I7DA 1Z82A 2W2KB 2NG1A 3ZZTA 2D2FA 4KZPA 3ZCVA 5IZCA 4MVXA 1WABA 4OK5A 3TECE 2FK7A 1RMTA 1U0RA 1JKXA 3AJDA 3STXA 2ZDQA 1MB4A 2V7XA 4WACA 3GR6A 4B6EA 5LQNA 3E9DA 1KAMA 2C4MA 2FPIB 1FRFS 5CDSA 3U56A 2J6CA 3UGKA 5DW3A 1IL0A 1A8PA 1AG9A 4HLQB 1XPJA 4P6VF 1IN1A 1HETA 4BTLA 1XZQA 4ZEVA 4FC6A 2OSVA 5K8LA 4EJSB 1K66A 1EFDN 1YONA 1GVNB 1U04A 2HAEA 3FSRA 2JJ2A 4RHEA 3SFZA 2R8XA 3QELA 3O93A 1M2EA 1W25A 2ZTHA 3JSAA 5BO5A 1T6XA 1FS5A 4J7CA 4LV8B 3CNEA 3A6KA 4Z2YA 1U7XA 4FM9A 5E3JA 4NMWA 4RZHA 1YJCA 4ZQHA 2JF0A 1J4AA 3MB8A 1ZXLA 4EUSA 3TSZA 3A31A 2ISCA 2RAFA 4GGPA 4GI3A 1G21E 2GKGA 1OBOA 2GJAA 1VA4A 4JYPA 1E20A 3EODA 4HDSB 1EDEA 2XF2A 2PXHA 3UMGA 1RCUA 3DBVO 1RHRA 3KXLA 1MOQA 1O6GA 1Z68A 3O4IA 3AJ9A 3MTJA 3JD1A 4QEZA 1E9CA 3LAWA 1FFCA 1HDEA 2QSZA 3R0VA 3O3MB 3TZLA 2A3RA 4N39A 3L4EA 4FW9A 4IXTA 4RANA 1JMKC 3T5DA 2WWFA 4NV0A 3VZPA 1AKWA 4D9FA 5F1KA 4CI9A 4FT2A 3OZIA 2ZOSA 2ZRGA 3BXZA 2XX3A 1NMYA 3KWFA 3VUFA 1DV1A 4FOOA 5CB0A 2QK4A 4ZYTA 4O4LA 3ZDCA 3GEHA 2A2ZA 2JFVA 2XZTA 2LZ0A 3F6RA 4HQRA 2HF7A 3AR8A 5CT4A 3LT1A 3VQTA 4XOIA 2H4WA 4WZBA 4D3YA 4QEDA 1HY3A 4BMPB 1DKNA 2AOUB 1EK6A 2BT4A 2GEDA 1ZSVA 2AOXA 3EZYA 3OFND 4LDAA 4L9SA 3ZHYA 5AKGA 2JC3A 4MVJE 5CFQA 4IIGA 1XUOA 3JYHA 3ZX5A 4F2PA 4FGKA 3MOSA 2VHCA 4FZRA 1R0KA 2NZUG 3AC0A 3LF1A 4IDPA 1I1HA 4ARIA 1JI0A 1A3CA 2C5GA 2QHXA 4OI0A 2IYAA 5CEFA 4PV7A 3NHUA 1NDQA 4QGFA 1D2NA 2GPAA 2P4EA 5G02A 1FDRA 4MXDA 4ZDWA 1CFZA 2LKCA 2OEPA 3TFWA 3QPDA 5A6VA 5FBQB 3IEMA 3UK0A 2YNMC 1W5TA 1ZSYA 2QJOA 1UT6A 3O8LA 2FOXA 3TGWA 4BECA 4ZVVA 1ZGCA 3K09A 1OXBB 4AKHA 3ANTA 5JUWA 1U31A 2ZWMA 1H1LB 1S9HA 2KYRA 3G9ZA 1MNAA 2G83A 4UDNA 1V7CA 3EIEA 1YQDA 3OPVA 9ABPA 1NVKA 3LC1O 2W6ZA 1KR5A 5AKEA 2DWUA 3ENZA 5K6TA 4OKNA 4QPNA 3IQIX 3S2ZA 1OF1A 1T3HA 1GZ6A 3KKLA 3WK4A 4CV0A 5H9WA 4RA9A 1S1MA 1U5AA 3HCEA 4I9FA 4BEVA 2PWYA 4HNHA 4L5BA 2NU7A 3UGTA 2P9GA 2W6IA 4GPIB 4B6JA 1KI7A 4FGSA 4Y2HA 2B83A 2OXCA 2W0SA 3CZ9A 1FU4A 2QN9A 1TAHA 3DDCA 3LRTA 3HVKA 1UK6A 2Y71A 4HQOA 1SXHA 2J3MA 1R9GA 4K9NA 2X22A 4HADA 2O3QA 1ZQ1A 3WAJA 1F8FA 2IOHA 3F7TA 3ZHSA 4EABA 1WZEA 1T2AA 1ESCA 1N2JA 2EYQA 5DHUA 1TE2A 3TR0A 2Q3BA 4BAGA 1AKYA 3TTYA 3PUHA 3W2EA 2ZI5A 2GN4A 3IMCA 5BYKA 5I7SA 3V9AA 3NX4A 4YP5A 2A7XA 1RVDA 2RHLA 2J8ZA 4IR7A 1AE1A 3UIEA 4AK9A 3OAAD 4J0DA 5EE3A 4BP1A 5C37A 5KOYA 3D1JA 4PINA 1JDVA 4PTZA 2C5BA 4UCXA 3M9LA 5AHRA 3HYNA 1T8SA 2LIPA 4K2AA 1RKVA 1I51A 1E3TA 1F6DA 1XYGA 8AT1A 3IBSA 3OX2A 5BV1A 3EPKA 4DZZA 4D56A 4X20B 4RJIA 1P39A 2I4NA 4G4SO 4PWZA 3S2SA 4FHEA 4G37A 4PZYA 5EYPA 1B26A 4XUCA 1XPOA 2GDZA 5HA5A 4KVZA 3T3MB 2JFUA 2ZJ1A 2KS6A 1LXCA 3O21A 4OHXA 2VL7A 3ORYA 5JISA 1CY0A 5ALEA 2HXGA 4G85A 1U1EA 3L4BA 3GUHA 1WPRA 2PTGA 2QUKA 1ZIDA 5E4JA 5BV2P 3IBTA 4LQDA 2GM9A 4RHYA 1WSBA 5KDLA 1EXVA 3QXGA 1BMFA 3I23A 4JNCA 1BYIA 4YAOA 2HYDA 3FNFA 3ZBQA 2XQKA 4BCBA 1X15A 1JLLA 4MLZA 3TVYA 5GONB 3HRKA 2QVLA 3QBJA 4R5MA 2DSNA 5B4VA 2WMNB 3OM0A 2P35A 3WL4A 2C1EA 4J0HA 2G6BA 2QL5A 3VVCA 1JKJB 2FW9A 1PNTA 3VR5H 2DXIA 2PZEA 3MD9A 3Q9SA 1OLXB 1XKQA 2ZUCA 4IDFA 4NCKA 3RFVA 1RZVA 4M1KA 3MTAA 4HGZA 1EYZA 2VN8A 3HR7A 1YJ5A 1I1OA 5HFAA 4HZUB 6ADHA 2RBKA 4RK7A 1CERA 1P7VA 4DYHA 2Y67A 3U0BA 2ZSJA 5MFZA 1N2SA 4PPGA 3R75A 4CN9A 1D6MA 1P29A 5CR9A 3TMAA 2KHZA 1HZJA 1HOXA 2D1YA 4WCFA 1V41E 2QD1A 2RIPA 3H42B 1DVRA 3HSSA 1DX9A 4IFTA 5I9LA 2OOSA 2X6TA 4PONA 1GD1O 2VKQA 3IOYA 4H27A 4MPTA 1FRZA 2C4HA 2PLNA 4ZD6A 3TDNA 2H2HA 5HX7A 5JO0A 3L1IA 1DIHA 5L4NA 4B3HA 4XVQA 1W96A 1DAEA 3GRRA 3GUYA 2DJ5A 3BGOS 4WBXC 1GNSA 4X54A 4XGIA 3V4PB 4ENTA 3D2AA 4V3CA 5DV9A 2JHAA 5HIIA 1WXIA 3LY5A 5B5SA 3QLUC 2AG5A 4R8LA 2HCBA 1YKFA 2VHTA 1GL6A 3IP5A 4NK4A 1ZMXA 2A67A 2D2EA 2ZBGA 3EG9A 3GLVA 3MJSA 5DKFA 1CDEA 2K2WA 3ZQUA 4YRGA 5CFLA 3MWGA 1YUNA 3K2EA 5AKXA 1JNYA 1T6YA 2HMUA 3JQ6A 3PNMA 4AN0A 2IITA 1DCTA 4ZAYA 3ZU2A 2VDUE 3TKAA 1UDCA 3VHLB 3VNSA 2O3TA 1I32A 2XGOA 4R7TA 3M1YA 4IVPA 1AZSC 3EXEA 4TQUS 4PRLA 5C7YA 2XKAA 3P9RA 4XARA 4D0RA 1COWA 3NWOA 2GRAA 2WIBA 4X8LA 4NBSA 3S29A 3U3RA 4RMIA 3KAKA 4P2GA 1EXWA 5J2UB 4MUBA 3SQDA 3TE7A 3N07A 4S24A 2YOFA 2OO3A 1UZNA 3NIGB 1N2EA 5DN9A 4W6QA 3K9BA 5TF0A 1K5HA 1CG6A 4UM7A 1C80A 2D74A 1IHDA 3UJCA 4K28A 2P90A 4KQ9A 2PQ2A 4MKFA 4J3NA 1T4MA 1ZA2A 1W87A 4JQCA 3UHJA 2V3CC 2I22A 2P9YA 5G1NA 3FBWA 5G4KB 2MOKA 1GCUA 3U81A 1BCRA 2FZLA 2HIGA 1JHDA 4B1FA 3WKBA 3RSQA 2BF7A 2K7FA 4D9MA 4XPIA 4XX0A 3SZGA 4X66B 2VDQB 4YMHA 4L3OA 1CIJA 4HWKA 2OCIA 4KO2S 3SKVA 3K73O 4H17A 3NT4A 4TX1A 1Z45A 1O97C 2H1OA 4JIGA 1M2VB 3NASA 1E2IA 5EUMA 1WUKS 1RXCA 1L4UA 3CB2A 3NHJA 3OT1A 2JLWA 2Z2KA 3LXMA 3SX2A 3IJPA 4M37A 3K92A 4TLAA 1NY5A 3CUEF 4JNKA 1SQGA 5GOZA 4FZVA 2P2ZA 3ZHTA 4RJKA 4JP3A 1MX3A 1YQQA 4JLDA 1IRXA 3C3EA 1ODIA 4INOA 2NTJA 1RYNA 1G6Q1 5BQ5A 5AVYA 1QDLB 4PZZA 4I4TF 3GVPA 4GOLD 2F9FA 4RVNA 1HZZC 3L01A 4PBSA 3ZVMA 3IUBA 3O31A 4XQ0A 3U49A 4EY6A 3K6RA 2FEXA 2HM7A 2ZIXA 3OPYI 4LZZA 1NBMA 2Q8QA 2YZGA 1H0KA 4HYEA 5TXGA 3NANA 1TKRA 3LL7A 5DNAA 5CX1A 4TV9F 1OZ0A 4AT1A 2VUSA 2JAUA 3M70A 5GM1A 1BDBA 2JK1A 3M1IA 3OEHD 4O8ZA 3EEYA 4RDHA 3Q41A 5BUCA 3A1NA 4G09A 1WHSA 4FYYA 4HGRA 1G4HA 2WVHA 4UM9D 1P2UA 4OIFA 3X1XA 4QUKA 1QNFA 4ALNA 3TZEA 3PEYA 1KJ8A 2X1VA 1A82A 1ODTC 3A1VA 2LP4Y 3OE5A 2QUHA 2HA2A 2O1XA 4U8GA 4ZZ3A 4PYMA 2BIFA 3PICA 4NBNA 1FBNA 2C2MA 1B1CA 1EQ2A 2RMKA 5HF5A 3MS7A 2ZRIA 3CR7A 2RGBA 3PQDA 4RKQA 3ZV4A 5C4IA 3EK2A 4AKEA 3NUQA 3FJYA 4HAVA 1N6KA 2PGXA 2W42A 2H3EA 1MC1A 2C2HA 2PPVA 2OA0A 3ZJVA 3PEUA 1BGXT 2X8JA 4EYSA 1GGMA 2YZ7A 1H2YA 1QZZA 2JI6A 1W47A 1Y3AA 1MAUA 3ADOA 1QGYA 4BDSA 1LF0A 4M0DA 5AYVA 3BFVA 4MRMB 1F1JA 3T7JA 3JAKB 5E95A 4JJAA 3H1FA 4JUAA 4MB6A 3ZHOA 2X23A 4HPWA 4RO0A 2XD9A 2EDCA 3TI9A 2CJPA 4TWJA 1ZK4A 2O2IA 4KLNA 5FYDA 4XD2A 3TIXB 3RADC 5HM8A 4UULA 3SF8A 1XN4A 2WWYA 2WICA 2Y1XA 1YO6A 5L9AA 3O38A 3WMFA 3KALA 1XR3A 5EVJA 1RWVA 1X87A 4YUZA 5FTKA 1QIIA 2ODQA 1NJ8A 1R4MA 5D85A 4UM8B 4EUNA 4X3CA 5AJYA 1FZTA 4I1PA 2HJHA 3EIFA 3U13A 3NM4A 3KBOA 3JZFA 3DCYA 2AT1A 4OHFA 3BH0A 4O5OA 1E4VA 4JWTA 2QMZA 4NAUA 1U2TA 1N6LA 1VJTA 2CLEB 3L8CA 4KFRA 4TTQA 1XU7A 4HN2A 1ZIOA 2I7VA 4FZJA 1XF9A 1KJYA 1OGIA 1I01A 2Y1LA 5H59A 1KDRA 4MJLA 2CJYA 4KVAA 5E2IA 3AR3A 1U8TA 1RJGA 1DG9A 3HCBA 3JQ9A 3VSDA 3DMTC 4QE3A 2PJZA 3CJTA 1LVUA 3Q8WA 4H3SA 3R5XA 3FNGA 1KZ7B 3OP1A 3RFFA 4JLMA 5LL6P 1XTPA 1FDWA 1RPJA 1TO6A 4NNPA 4BBPA 4E0BA 4LOKA 5NULA 3BRCA 3I83A 3QMPA 1R8XA 2DKNA 5B3JC 4P4NA 2PZLA 1W5AA 2VJLA 3IXLA 3WP0A 3ZZ1A 1C7QA 2WHXA 3ANXA 3KL2A 4LAFA 5FBRB 1JVNA 2UV8A 3KC2A 3NOQA 5LYJF 1KEUA 1BA2A 2XYGA 3WDSA 2PKCA 2B8WA 3BXOA 4E3ZA 4NX2A 4C7MA 2UXBB 3OT4A 1N8KA 2QOEA 3A2KA 2HU7A 3PZRA 4XE5A 3TAHA 5BY2A 2HNKA 2Q5QA 4M8LA 4BZWA 5KOJA 1OPRA 1YI8A 2D0OB 3I34X 5M3BA 2FX2A 1HQCA 2V0CA 5JLJA 1YFZA 2ZR8A 5F2NA 2V5AA 1TCUA 1RRFA 5FB3A 3K0EA 1V7ZA 2F8MA 3QXXA 1B16A 1QHSA 1S7CA 1D1TA 1A4UA 4JN6B 2B7CA 4X5OA 5HQ3B 3RU3A 1RYZA 1XA4A 3U4HA 4PZLA 1H8HA 3H5OA 3NYQA 3LKVA 4HXGA 1UP4A 1JQJC 3KOXA 4L8YA 1HTWA 2XT0A 2CFTA 3CVOA 1GA4A 1NNUA 3D59A 4K6HA 4R69A 1WF3A 2UZ3A 2R5NA 4PNPA 4WLEA 4YP0A 2EW8A 2M6KA 2G5TA 2Q62A 1C9DB 2ZGVA 3AH8A 5C1DA 4YCNA 2XGMA 1NW6A 4B2IA 1E60A 4GICA 4ZT6A 3OI7A 5ALMA 3V7NA 1E2JA 3Q8MA 3WRXA 2WG1A 4L74A 4DLRA 4DF3A 3ORFA 3VC2A 1ISFA 1JVBA 3B5IA 3VZCA 3JYOA 4OXKA 1G3MA 5CB4A 4TV8B 5BMVF 3ASZA 4TVSA 4D9KA 2QKYA 1GRNA 1FOEB 4U6QA 4XH9B 2PT5A 5FBLB 2AC2A 3JWJA 5LNK1 1T1SA 1RTTA 3PWTA 3RFXA 4K9DA 5FBWB 4F1KA 2YMQA 1IVNA 2XWQA 1DIBA 2XLCA 3L6OO 2H08A 3MA0A 4GVPA 4R8RA 1KFKB 1KL7A 3PFKA 2E0IA 5JJCA 4DWWA 1W88A 1M6YA 1FSGA 2RBGA 1A5TA 1I3CA 1V0JA 3BBLA 2GHRA 2VYQA 1AV6A 1Z7YA 5BV7A 1M2OA 2X14A 5FRDA 2J87A 1D1SA 3GOQA 4PPNA 4ZAGA 1L8XA 4NH0A 1L5OA 1BTOA 2W2OA 3KB8A 3KQPA 5D3ZA 5U4XA 5DLEA 2B5WA 3ILYA 2QTAA 2XPCA 3A25A 1RLOA 3QIVA 5YASA 4Z1MA 4NZOA 1LWNA 5KYXB 2AF3C 2DQYA 4G1FA 5AKYA 4L02A 2CMKA 4F5ZA 3JALB 3QSYA 1SBQA 1IULA 1U3GA 1QK3A 1QVWA 2DG2A 2XTNA 3EH1A 3WBKA 4BJ6A 4V1CI 3DLCA 3QU9A 2V74B 3MJVA 5DTRA 4ZZIA 4LHEA 4KPYA 2F8TA 2R47A 1KSHA 2HK6A 5HJEA 4OHBA 1T15A 2OV8A 2PYDA 1SUSA 2X5OA 3DEZA 3IEKA 4H08A 4O4JB 5TPZA 4LXTA 5LQRA 4NOKA 4WWHA 2GKOA 1DL5A 4PLTA 5DXAA 3DKVA 4UTOA 2COUA 4MI3A 1D2RA 1F8UA 3T3GA 4EOGA 3G0GA 2JFFA 1U0BB 2ZM6B 5F5XA 1S1CA 1Z88A 1BQ4A 3C6BA 2VJYA 3JW8A 2EFYA 1U1IA 1MQSA 2QGFA 4MIEA 5UKDA 3OOJA 3WO1A 1X9IA 3K0FB 1SC1A 2X5XA 1DB3A 2W90A 3STWA 4FE4A 1PQ4A 1KO7A 2P4QA 4FNGA 4YRFA 4TYPA 4JB2A 2DR0A 3M3PA 4XB1A 4YACA 1F0KA 3PQ4A 3KFLA 1ECGA 1OX6A 3QLTA 1IWBB 3EQZA 1W0JD 2IP2A 3BRWD 4LOJA 4QU8A 4M8IA 5KKCA 3R8FA 1SHJA 4N41A 4LF4B 4UZEA 3DZGA 4QYSA 1LRJA 4GXQA 3L8DA 1J8VA 3HI4A 3FZGA 1IN7A 2C20A 1FP2A 2J4DA 2OXRA 2XDYA 3T3HA 3VHQA 1LC3A 5HP4A 3WRVA 2C9MA 1T0UA 3KOUA 3ZGXA 2PRSA 3EAGA 1TOAA 4PZPA 1K8YB 3PTAA 5ITZB 5B30A 5C4GB 4WJZA 4Q6BA 2E5WA 3E3MA 1DI0A 4PX9A 1L5GB 1WZCA 1HYBA 1YQGA 2X19A 4LYYA 3RIMA 3WQBA 2IY7A 3PDWA 2QY6A 3D7KA 2JGRA 2PKRA 2WHPA 1E59A 4QJBA 1E1RA 1I2AA 4BAZA 1EXDA 2WJWA 4LG1A 5DB4A 5H5JA 3N5KA 2Z1NA 2FX3A 3C3JA 4OQXA 4BNIA 2G3YA 2QPOA 1PBNA 3OEEA 4MULA 2YJ3A 4M9ZA 4YWHA 1KY4A 2FFJA 3JAWB 5J1SB 4B3GA 1J7KA 2NQ2C 1VFPA 4CIVA 3LWNA 5EN4A 3NJ8A 3U7IA 3DFUA 3WS7A 5IUNC 4E33A 1B23P 3I28A 1U4NA 1WW3A 4MKRA 1J0AA 4E3WA 4YMWA 1HORA 1TQ6A 5HRUA 4OHWA 4KZKA 1FB5A 2R85A 4EX6A 5CXXA 4GE3A 1YIOA 3K71B 4CMGA 2B4QA 1ZI9A 1UKZA 1FP6A 3K9NA 3NHRA 2FZVA 3FHLA 1DEAA 1UL1X 3NO4A 3PE3A 4JKIA 5AHKA 2FNAA 2MMCA 3SZMA 2DEUA 4N5MA 1IXKA 3IE2A 3MBOA 5CLLA 1WSDA 1LDGA 3T12A 1PBTA 1RJ9B 5DM4A 2XZLA 3ZGZA 2V4UA 2DTXA 1PGOA 3RI3A 1ZYUA 3MILA 1CQIB 1Z6GA 4CCWA 4PC1A 3E70C 4CCAA 4TZ0A 5EJ4A 1WX1A 4U6NA 3E8XA 3EAQA 2YYSA 2Z09A 4LHVA 3KCQA 3OQVA 3RHTA 1XKXA 4DIKA 3CW9A 2Y05A 3BFJA 2CLCX 5DXJA 3LGAA 1CE8A 3MTQA 1YE8A 3MUNA 5JASA 3TSWA 5EFOA 2M1ZA 2QA5A 5LQKA 2E6UX 2ANBA 1XTRA 1ITZA 2L82A 3EEIA 4KQGA 2GD1O 1E1QA 3IQWA 4OFWA 1ZD4A 4QXPA 1EFKA 2R1TB 4IGAA 1MCZA 4YRPA 1T3GA 5A4KA 1I4DD 4LVUA 3E5HA 3UK7A 1UXOA 2CFCA 3Q2KA 3AETB 1GYPA 1LBSA 2WWRA 4EEZA 1CBUA 5DI9A 3ZBUA 2PFKA 4WDRA 2ORIA 4RAOA 1ZVMA 2PKXA 2C4TA 4RVFA 4DTIA 3K5HA 1YZYA 4LXXA 2EKBA 4X8MA 1G1AA 1NUQA 3FNQA 4I36A 4YRRA 3RAJA 4N0MA 2V7BA 1XRQA 3OIDA 4MZDA 1EUYA 1TT5B 2XXAA 3KBBA 4ZVQA 3HDVA 3WMRA 4J1NA 2OGZA 1X1CA 4BO4A 1FYVA 1ULAA 1X7DA 3IQFA 1FP7A 3OE4A 1ZZGA 3CVUA 2N3ZA 5CIQA 4KI0A 5IMBA 1MTOA 4ZOBA 3W4IA 4MS1B 4GPEA 5EJMA 5BVGA 3FNRA 1BD3A 2ZT8A 2P4UA 3VC1A 5L95A 1WCXA 2J09A 1Z39A 2R79A 3FUVA 3L0YA 2F3PA 2ID7A 4Y2GA 4ZVLA 2AK2A 2P30A 1R1DA 3UWDA 3VPAA 2Q6LA 2BI7A 5SYMA 3K32A 4X62B 1WPQA 2FMUA 4UTXA 4MINA 4DBZA 1M8KA 1P2BA 4YPFA 4X3PA 2GPTA 1VA5A 2VH2A 1NXSA 1XD9A 1Z8FA 2ZKLA 4EJ0A 3CURA 4FFDA 4LDQA 1Z16A 4TXMA 2XIQA 4Y2XA 5DN6A 4CT0A 4OL0A 2QU7A 3AL0C 2DFPA 2JD2A 1AXEA 5LA6A 1CJKC 2I2XB 1PWYE 2IWHA 1XJ5A 3TK1A 4MI6A 1TUGA 2CNWA 1JR2A 1JJFA 2UYCA 1HYGA 1JHYA 1TFRA 3TGLA 4JODA 5JXWA 3DSRA 1SBIA 3LDGA 3OM8A 5F3DA 4IHQA 3ZD6A 5JH7B 5B7GA 2G4CA 2V55B 1P5HA 1KEZA 1XQYA 4YK7A 3OQOA 2CDCA 3FZYA 2P9EA 3D4OA 3ZWKA 1FTWA 4LK3A 1YKGA 2WJPA 4KSBA 4M38A 2RSLA 1KVSA 4OUDB 2REOA 4V3BA 2HLHA 4FR5A 1X7HA 4DA6A 2JRCA 3UAGA 2C0CA 5T6BA 3PB3A 1JEOA 2VHWA 1U8EA 1M10A 3L77A 4KU4A 4BV9A 4YY3B 5LIRA 2IE8A 3Q8XB 1N7GA 1Q0UA 3KE8A 2OGUA 4E5YA 4AMUA 2CXXA 2XUDA 3FLMA 3P9NA 4IQGA 4PLGA 2O54A 3LZ6A 4PZ9A 3SBDA 4BX9A 1YB7A 1D7OA 1FDVA 3L5OA 1WMDA 2JCGA 3G49A 1I30A 5JXJA 4JI8B 2G06A 2B8TA 1F2UB 3BMOB 3MSXA 4IJUA 5K2OA 1E7YA 2NO1A 4HAZA 4TL8A 3OKPA 4QYIA 2AR0A 2PZMA 4F4HA 1T2EA 2JCYA 2X3FA 1IQUA 2YWJA 5EIXA 2Z08A 1EGAA 3A0RB 1K5PA 3K30A 3KOOA 3X2SA 2I6QA 4D3DA 4NYIR 3V34A 2ABWA 3LPDA 5IH7A 2Q1WA 2RKBA 4NCNA 4MR7B 5E2BA 4U02A 2P68A 1YRQA 4JBIA 4KIJA 2JJYA 2R4QA 3G9TA 5J40A 5LQJA 1J42A 1NR5A 4N76A 2BY4A 1T6NA 3HN7A 4XQEA 5EZYF 2IXBA 4EM6A 2LNDA 4MUKA 1F0NA 5FAXA 4UNQA 1DG1G 2BEVB 1PGJA 2QU8A 5EXEA 1DCMA 3BMCA 1Y4SA 3T3EA 3KM0A 2I4MA 4BMOB 2RC6A 1E69A 1ZLYA 2K2QB 4E88A 2IOFK 3R44A 4UUNA 2VCYA 3D7RA 4HAXA 4MJ3A 3VZRA 4TZ6A 1M83A 2BRUA 4IS3A 4L4SA 4Z4IA 1QU3A 3QHPA 5FWXA 2DH5A 4JFRA 5K6AA 2IXDA 2FW8A 4JK3A 5EJAA 5K20A 3OCVA 5D1HA 2ZROA 4YQEA 4DARA 3HCRA 2ZIGA 2EWMA 4KLRA 4KQ6A 5DX8A 4Q0MA 5DCUA 4BWVA 2IZ0A 3FYUB 3OLVA 2AI3A 4G5RA 3BJEA 4LVNA 5BQFA 1CUHA 3D4IA 2C9CA 1KZ6A 4G84A 4K3VA 1IQPA 2J5RA 3EARA 1YVEI 1ONBA 4J29A 1PJCA 5BSEA 1ZS9A 3O1LA 3N2IA 4B0OA 4TS4A 5IVDA 4RTNA 3QYAA 4ZVTA 1J97A 1JKMA 1ZOLA 4BFCA 3NAGA 5IARA 1Z0ZA 1VC2A 3AI1A 3LI2A 1TCBA 2IOQA 4BLWA 4B3CA 2J31A 3JQRA 1UWCA 2G9ZA 1QE5A 2VAVA 3E9NA 1IHPA 3E0QA 4M7RA 5EIBC 1U7TA 5GWXA 4DM3A 5EZQA 1L8AA 4CHTA 3FDIA 3ESYA 5JS7A 5DISB 2WD7B 3HCDA 2O5EA 1TMGE 2V45A 2BGWA 2I2WA 4FNAA 4DR5B 4X7BA 3AVQA 1HL7A 4EY7A 3CIOA 5M2QA 5TLSA 3N0WA 1YMUA 4ZOAA 4ZVUA 3SVTA 3GCXA 3K6SA 1P19A 4PYIA 1CZHA 1PJ3A 4TYNA 3C1AA 3ETCA 2ZVPX 3TM4A 1OPXA 4FX5A 4HS4A 4MCHA 1WOMA 3UM9A 4E5DA 3GA0A 2BBOA 3QNWA 1BHO1 1HEUA 1MC8A 2IZOA 2Y1EA 3ITDA 1QIDA 3LBFA 4WK2B 5CW1A 3E7XA 2FFHA 2B78A 2HBRA 2IHBA 3EPRA 1AN9A 2I2CA 5CFZA 3D3QA 1OB5A 1FDUA 1U3VA 2JKVA 4J94A 4PZUA 1SELA 2WW8A 3MWYW 4WH0A 3TKYA 1VTKA 2FN9A 2GCNA 1YK1A 1WG8A 1UBUS 3AEYA 4NCAA 1AMNA 3T8YA 5JAPA 1PYOA 3BQNB 4TVKA 4X92A 5FUXA 3PENA 1UXJA 5JV5A 4LI0A 4XWWA 4N8EA 4UBIA 2OZLA 3TD9A 2BBWA 2BM9A 3VU0A 2Q5EA 4BLOA 4G9BA 5IDYA 4BX0A 3PXCX 4FLFA 4G0YA 4M1TA 4UATA 3NM5A 4PVCA 4ABYA 3EGDA 2VATA 4X94A 1USVA 1GRCA 1LPMA 2NZ8A 4DXDA 1H3EA 1BFUA 1I2CA 2UKDA 3WBFA 4ESOA 3HKDB 1E4EA 3IHTA 5DYTA 2Q4BA 3GFVA 4JOBA 2BMJA 2HXYA 1E2NA 4QDKA 3NVAA 1MVOA 2D2IA 2F55A 4RS4A 1E9DA 3DE7X 4XEUA 2H2DA 2ZXUA 4PC2A 4YRTA 3WLOA 4WY2A 2FPGA 1QX4A 3H1EA 4MX8A 1CJSA 1SOAA 3GBSA 4D3ZA 3SVLA 2FHPA 1W1UA 3H5IA 2B7LA 4TWBA 3FOWA 2BMEA 3NV9A 1RLJA 1CXZA 1W0CA 2IIQA 2JJ8A 2NSJA 3MLEA 4UMEA 2TECE 4MGZR 3FY4A 4YS6A 5TDHA 5K8UA 1W4AA 2W2MA 1B6SA 1GCGA 2HT6A 2OHVA 2MJLA 3SFVA 2QT1A 3ZWCA 1RIFA 2CL7X 3WMEA 3NALA 3NFRA 2VNHA 4M1QA 4C6HA 1QYRA 3MGBA 3QFHA 2C98A 2JGJA 4MNTA 4WINA 5F1OA 3JVVA 4WUVA 3H9UA 3GG2A 1EE1A 1MO5A 2ISSD 1F7UA 5IW8A 1M2FA 3TMYA 4U3JA 1JUDA 1O1YA 1TIBA 2JBWA 3A37A 3JS5A 2RGNA 4BYMA 5FTWA 4AVYA 3G7UA 3RARA 2VRCA 2X0EA 3WGOA 2QE6A 2FEKA 4GW3A 4UOQA 3ESXA 3KSBC 4LHYA 3ZJTA 2YMLA 2XNCA 2ZCUA 3G5LA 3KPJA 3PFFA 2IGTA 3G8BA 4MQFB 2GTIA 3B1FA 4B34A 4RPGA 3M7IA 5JPCA 4L4XA 1ZNWA 1H85A 5DGDA 3B60A 3NAQA 5BVHA 1CHDA 4ZDJA 3RC1A 3LC0A 3TGPA 3PHIA 2VWHA 4ML3A 1SCNE 3TWOA 1N2CB 3SYMA 4KGVA 2ZIUB 1N0VC 3TZBA 5ECWA 2XSZA 1SVWA 3GUUA 4BUCA 5CT5A 1JEDA 4Y2QA 1IUPA 3E18A 3WVNA 3SR4A 2A29A 4PGGA 4UUQA 2ZETA 2NZYA 4CM8B 1H66A 1NQAO 1TDJA 5LYJB 2BFAA 2Q3EA 2C4NA 1IYZA 1LGYA 2ONCA 2WJAA 1YR2A 4HZGA 3W6ZA 3IUPA 3RBVA 1CJVC 4CDGA 3AKEA 3TLXA 4YV7A 1QRAA 1UAYA 3BJZA 1ID8A 3GGCA 1XQXA 3SNHA 4RD1A 3FN4A 1XKLA 4FFPA 4KQMA 4QUIA 5F3WB 2M2IA 2HSZA 1W35A 1I3MA 2EVWX 3AXTA 3FOAA 4LI3X 3QU7A 4ZREA 2PV7A 3G1UA 5E6UA 5L7YA 1E3LA 4DJEC 3QKUA 3WL3A 4QBHA 1WBDA 2C82A 2QAIA 4EYKA 4B3MB 2C83A 2CLHB 3GVXA 3EGXA 3T41A 4OA8A 1YBAA 4IOLA 4LYAA 5T41A 5HRAA 1OLSA 4K40A 3WYEA 2J41A 2J33A 4YDQA 3DTTA 1J2JA 4OP3A 1VFNA 1OX5A 3SKYA 1G8SA 5IT9A 1RLTA 3DQQA 4J0QA 1T9DA 3CLSC 4XM1A 1GPJA 2V6GA 1L5KA 4R71A 3D4PA 1YCDA 1PVVA 3P0RA 4R2HA 4BX3A 5KEIA 2NO9A 3SLGA 4PZCA 4ROTA 2QVXX 2YHBA 3WIBA 1E2FA 1PJTA 4HFMA 2C7QA 1AVTA 4FLMA 1FYXA 4CTKA 1NI5A 2ZM5A 1GN8A 3DMNA 2V6IA 1Y81A 4M6WB 5P21A 4A03A 2BVNA 3OFJA 1Z2OX 1JA0A 2XTAA 3SJCA 1D0SA 2ZYSA 3EGIA 3ZNQA 4E5MA 4ZT4A 4J4TA 1IOWA 1ULBA 2A84A 2BKUA 4QC2A 1R5NA 2EZ8A 2CUKA 2R86A 2QLTA 3ICWA 2FPWA 2RGCA 2RCYA 5FUYA 4FEYA 1YAJA 1CEQA 1OFVA 4HDRA 4UM5A 3DKRA 4ZO9A 2GAFA 1DWOA 1IWPB 2C92A 5L45A 1T5OA 3GFGA 1I3NA 4BAUA 5CDUA 1I7QB 3UKOA 1TI7A 2NZ2A 2PGIA 3BZUA 1JSCA 3D8BA 5D84A 3VZQA 2Y68A 3ESBA 2QM7A 3K2IA 5CYFA 1JEQB 2Z95A 3ZEAA 3ZOKA 4ZO4A 4D3XA 3LY8A 4EZEA 5BSHA 4I19A 2BHNA 2FPOA 3UAZA 1J2TA 2HJRA 1ZHOA 1RCTE 1E4YA 2B4YA 3L0SA 4G4SP 4I6EA 4MO2A 1VCMA 2GAOA 4O5AA 3UT6A 4BP8A 1WQ1R 1F06A 1E9EA 1P7ZA 4KN8A 4FI3F 1FFBA 3WGMA 9LDTA 2NTVA 5FTLA 3ESQA 2HV9A 4G0WA 3AESA 5AM5A 2GO7A 1C4OA 2ZYTX 4L57A 3RDPA 4W5QA 2QBYB 1P91A 1VPLA 1EG7A 3ZE8A 2YJTD 4DILA 4M46A 3DNPA 1A5AB 4FIDA 2R97A 1AGNA 1LW7A 2R6CA 2GJ4A 5KTSA 4AFNA 2ETVA 3ZWNA 3U4CA 3T1VA 1H2WA 4Z4EA 1M6VA 2JJ1A 1CF2O 1AM4D 4Z53A 1S2LA 3F7OA 3FD8A 4IRXA 4BUJA 2P2CA 1IAVA 5J2TA 1QHFA 5K0JA 3CVVA 2I9KA 1ZIYA 4Y9RA 3OTOB 4PXAA 3PL1A 2FSFA 2BFDB 4L9WA 4BUZA 2N42A 3BJRA 2JB9A 2WM8A 3GEPA 4CKWB 1PR9A 1WJGA 3BK2A 3DO6A 5LPNA 3I9JA 3JD0A 1EFPA 1O94C 2JVJA 3CZCA 4G89A 2JLVA 4UJ3A 2HLDD 2IHUA 1KXJA 1VKZA 4HF7A 2JCVA 5JCJA 4DIEA 1AHNA 4DJ5X 3FDFA 3W3AH 2A5JA 2FOIA 2RI6A 1E9AA 2PWAA 3FRHA 3IPAA 2V58A 2ZS9A 3U80A 3H0EA 3MHTA 4D97A 3GYGA 3V8QA 1J90A 4WZAA 1SIOA 2CZQA 1NYQA 3IEIA 4QVKA 4DRZA 621PA 1RI5A 4CEHA 1Z0DA 2QTFA 2JLRA 4JYBA 1D4OA 4RHCA 4QQFA 5EMMA 1UFRA 1AQ6A 4NAVA 3VDXA 2X1MA 4WK6A 4J2HA 4N8SA 5LZ7A 3OZSA 4O3FA 4DUGD 1LK0A 1V9LA 3ZDRA 5K03A 2FZEA 2QUZA 3HA7A 4DHWA 3K9LA 2IS6A 2FQYA 4C87A 2MMGA 3RRJA 2X3UA 2EGHA 5JJ5A 5KSWB 1XDDA 2G1UA 1TK3A 4W9MC 2H51A 3AP1A 5HGJA 1KQOA 1R6TA 1XEWY 3R5KA 1VXOA 4P80A 5SYNA 4TSRA 3FMFA 2P5SA 3QM1A 3IAM6 1D5WA 1PL0A 2CF6A 2VZLA 3GLTA 1KYYA 5ALVA 3G2KA 4U2KA 3D4NA 2WP8J 5BXQC 3VR6D 4QRDA 5LKRA 3V4FA 1EVIA 2JRLA 1PHPA 3CV3A 3TE6A 1QB8A 1ZVKA 2XZPA 3GLFA 3IQHX 4LYFA 1EE9A 4K8OA 4KAJA 3DFMA 1TKAA 1R5BA 2EYUA 3UENA 1X1TA 3KOYA 4D9NA 1W8IA 5BR8B 3IERA 1UWKA 1XQWA 4KR6A 2QSUA 1JXAA 2BMVA 2BW0A 2OMKA 4K5QA 4Y9UA 4A92A 2MDTA 3DE3X 3CBQA 3KQHA 2BMDA 3CKLA 1TVKA 2QIPA 3K1TA 3ROTA 2R96A 3F49S 4DOMA 4BLSA 2QRJA 3DLPX 3LZCA 3EA5A 1SHKA 1KQ3A 2G9UA 3TNJA 5DHAA 3HR4A 4S2UA 4NZMA 4EIWA 2A0YA 2C4UA 2CVQA 2XUPA 1S3FA 3S8MA 2ZJAA 5L3SB 1DCKA 1V25A 4G0MA 4UMDA 5KYVA 4FHFA 5JDCA 4DSOA 1NVXQ 2ONYA 5J5AA 3VC3A 2PUBA 3G6WA 3PUJA 5F98A 2VAXA 2R5FA 1E79D 1K4YA 2FWJA 2YWFA 3IIIA 4HEA1 5DLDA 3UXHA 3C1OA 3WWCA 1RJDA 3PQEA 3UFXA 4TMXA 4JMPA 4GMDA 4WGFA 1U5BB 4KQIA 3O75A 3S6JA 1Z56C 3I6IA 4MTLA 3TTVA 1OAAA 1H23A 4O0LA 4MWSA 4HN4B 1YAHA 2WY2D 1QZXA 3BIOA 4HMOA 5DASA 4QT4A 5BNIA 3JX9A 3MRVA 4BZZA 3F8TA 3C5WP 4BV3A 1GL7A 1GZ3A 3HZOA 4MGYR 4PLYA 1EUQA 1UFOA 3FFBA 1JL3A 3N3AC 4ENWA 2ZIAA 3EVAA 1AQYA 1HE5A 4ON9A 4ZRMA 1AB6A 4GDFA 4A10A 1MGOA 3ZE2B 1ZXXA 4BS9A 1ZITA 2IJGX 3AR5A 4IGEA 3WWDA 3VYRB 3UJ3X 1BX0A 8GPBA 1T9AA 1XJQA 3GLHA 5AVUA 1XELA 1T9KA 4YP6A 3OOSA 1AGXA 2EDAA 1QMPA 4GZ3A 1GDTA 2HB6A 2OZKA 3PYXA 4WHMA 4CIYA 2OV3A 1ZVQA 4UAJA 1E0JA 1T4CA 1QYXA 2V9ZA 2UYGA 1NYLA 5AHWA 1UBGA 4HI0E 4QUBA 5JY6A 2JZNA 4EGFA 1P6QA 4POOA 3EY9A 3SXJA 3T94A 1L5NA 1F48A 1UT8A 3HCCA 2JLBA 3PGXA 3W4KA 5HOEA 1P8AA 4MKHA 3AL2A 4UU1A 3RYFB 3A9VA 3H1PA 4KMSA 5LQAA 2QLJA 1PGPA 5E9JA 3ZWPA 4DRXA 1C9YA 5IJ9B 4E1VA 4IHAA 5IT5A 3EHDA 4NJMA 4D8TA 3LXXA 4FR0A 1YRLA 4B73A 2C5EA 4IOMA 3FPHA 5ABPA 1KJJA 2FR8A 3DZFA 3EDMA 4FFNA 1N9KA 3NT2A 5AW3A 2YMMA 4O4HB 4KDEA 1OYVA 2JPDA 2CK3A 1UPUA 3V1TC 4P83A 3WTCA 3X0DA 1JFVA 1UBMS 2Q6IA 3SXUB 3K70C 3F97A 4MB0A 1I7DA 3SMQA 2JATA 3QK7A 2FQWA 5LOVA 4ZCMA 3COSA 4GMKA 3T35A 4C4XA 4DCSA 3UZUA 1NF8A 4US0R 2ZAOA 3WLAA 1ZD3A 4D0GA 4KBFA 4FHGA 3VU9A 3ID6C 4TT8A 5F7ZA 5FT9A 3BE5A 1O95A 4Z4QA 2BV3A 3J80A 4HFJA 4O2RA 2N75A 5CAEA 3TYXA 1TTHA 4CTMA 3H18A 2BTOA 1V5WA 1IK4A 4DW8A 3PD1A 3QF4A 3YASA 2Y6UA 3DKKA 3DZDA 3RQSA 4ZV9A 3TL6A 5LQDA 3CLUD 5CDFA 5LZ2A 1NRXA 1IZ7A 3BSWA 1TW3A 4HEQA 1M73E 4I2NA 4OI1A 2JFZA 3QVOA 2XKJE 4CLDA 4I4IA 5GOTA 2PA0A 1YASA 2AJBA 1CVLA 4LOHA 2CYBA 2G9NA 5BMVA 5CXQA 2WAMA 4AG6A 1YB5A 2G1JA 3GJ0A 1U81A 2RJ3A 5KOHB 5LP6B 3RH0A 1PG5A 5FI3A 1RYDA 2X42A 3VSCA 4ZV4A 2IK8A 3FPLA 4ZU1X 3TTXA 5AOVA 5HIJA 1VG9B 2DOKA 3LHDA 1GFWA 3PTLA 4R2JA 5AVZA 4YRCA 2ONZA 1TMYA 5EZYB 1IBRA 3J7AC 1V43A 2HK7A 2OYCA 3W2GA 3ZBTA 1KOGA 1MMFB 2C0QA 1LBQA 1NN1A 4GR5A 4UREA 4DLSA 4YDSA 4I5GA 4QQNA 4F06A 4LSGA 2Q3LA 4NEQA 4EECA 3PJGA 1L0BA 2WT8A 1N0UA 4ZAXA 4KLZA 2J9YB 5FNVF 1TJNA 1Q1NA 4V0ME 5L6MB 1L4BA 1MO6A 1U1DA 1A9ZA 1X42A 2BN4A 3D3KA 2BJWA 2BHTA 2OD2A 5ELLA 3EXAA 521PA 2QXTA 5ULLA 5AW8A 1KETA 3VNQA 1AO0A 2ENWA 2P9BA 2BCGY 2C4VA 4XUEA 3RUFA 4NZNA 3AB3A 1CWUA 1DKQA 2OPBA 3IKMB 3E6AA 1JJVA 3HVJA 2A88A 3L7CA 3GPCA 4FMBB 3WRYA 4WADA 4D4IA 1BWRA 4BNTA 1G59A 2WI8A 3FYHA 4R8SA 3KEQA 2PX3A 3K1AA 5F33A 5DJ5A 2VDRB 4LZOA 3DDWA 1YZNA 2H7YA 5E9WA 1CS0A 2HI0A 3PQCA 4YR9A 3PCXA 1R7RA 2ATEA 2PS1A 3AF6A 4K7JA 5KSPA 5C1IA 1FVOA 4RENA 3ORSA 3EVFA 4FYWA 4RZSA 2OV6A 1LPPA 1QV6A 1M1UA 3A4YA 5ARDA 5FA8A 5IBPA 2D3TA 2QUIA 3AM4A 3TBHA 4L72A 1Q7TA 2IEDA 4GRAA 1UODA 1BEZA 3PG5A 3P94A 4HXEB 2GDJA 3QSGA 1DUIA 5AOAA 3IMGA 1IQRA 5IXYA 4OHPA 2MYUA 4V0NA 1N5OX 3AEKB 3N8KA 4LQCA 4EW6A 5LU9A 1PSZA 3W6UA 5D00A 5KIAA 1X7ZB 1UPBA 4E5KA 1GUAA 3SG0A 1D9ZA 4L9AA 4WT7A 1ZM7A 5C81A 1RZRD 2JGLA 1QK5A 2GWRA 1X7XB 4TM8A 2AOVA 1H65A 4IZIA 1SVIA 5IM4A 3TG2A 3HGQA 2DQZA 1R0XA 2R751 1E5DA 1ZA1A 1HX7A 2GBFA 1E3IA 3KYDB 3OWHA 4HVAA 2PMBA 4GL4A 5FUWA 2IYRA 2OG2A 2YHSA 3ZLTA 1JYEA 4RV9A 3CZ5A 1IBSA 3JPYA 1RPZA 1N3BA 3P9SA 1XRPA 3TLCA 3KVRA 2O23A 4EHDA 4YIHA 4BNYA 1MDBA 4PSDA 3WLEA 3TJZA 3PKJA 4BNFA 2FG5A 1VGVA 3KCNA 3FCUB 4FCWA 1EGMB 3H87A 3OZRA 1TPYA 5LQMA 1QF9A 2Y9PB 3NB0A 1BE0A 3CONA 3STHA 3UO8B 1TZMA 3EF3A 4MV9A 5D86A 3UK2A 1NZDA 2KPOA 2PD3A 1KEEA 1Q3TA 4W8GA 4OSEA 3K70D 3NCHA 4KXQA 5H81A 3ZHUA 3L6EA 2PX2A 3G8CA 4Y6SA 3DTVA 3IT3A 2O48X 3ZGOA 5HJ7A 1CR1A 1Q3IA 1UFKA 2IVZA 1CCWA 3R5SA 2C00A 2JLYA 1ECFA 1GQSA 1UBCA 4F4IA 1ADCA 4ZOLF 1YFKA 2JAXA 1KYVA 2LCIA 3EWAA 1LBIA 5LXTA 4FWBA 5AKZA 4AP9A 3LOQA 3IOEA 3ZLUA 2BTEA 2P3QA 5DBOA 2D8MA 1GG2A 3URMA 2ZS8A 1VSBA 4ALKA 2EQAA 1JRLA 1WW2A 3RS8A 3UHFA 5CP8A 1SVSA 4B71A 1HDIA 4C21A 3I42A 2D00A 1P4JA 2XAUA 3HJAA 2DF8A 3HC7A 4NP6A 4PC3A 4OQDA 1ZW1A 4CMEC 3VBCA 4R1LA 1HR0B 5TIIA 1YRYE 1ISMA 1RWBA 3N8NA 4UDYX 1NNEA 2VP5A 4AZTA 2W8ZA 3L7YA 5DBFA 5ALUA 4XM0A 3LX8A 1XA0A 1RBQA 1M33A 4X1KA 3KR2A 5I4IA 5KU1A 1K7CA 2ZT5A 3LX5A 3WP1B 1E3WA 2PE5A 4K1XA 2OZPA 1W73A 2WIAA 4DCJA 2RJOA 2B0JA 1NVVR 3NIBA 1EEHA 1XCPA 3TQHA 5JXHA 2HJVA 4B46A 3RS2A 3IMEA 2CLOB 1XD2A 3OLWA 5KNDD 3UH1A 4ADSG 4BZQA 2X86A 2ZQ5A 4MARA 5LZ9A 4UTRA 1P4SA 2OSBA 1M34A 2VDLB 3EUWA 3L1UA 1WZ2A 4HQ6A 4X60A 1GJRA 1SBTA 3WOHA 3VOBA 1R0BA 1T5TA 3EW9A 3QA3E 3MGGA 4I1IA 3FUCA 3WZLA 5EVCA 2IYFA 2HPHA 4WRRA 2P6PA 4OM8A 5EXXA 3W77A 1NVEA 1HQKA 1QIFA 2CY0A 4M1YA 4Q1VA 4K0KB 4RMNA 4U7DA 1VRWA 4QYXA 4C3VA 2JGEA 4MRVA 4IQ8A 5DNUA 1AUOA 1N6NA 1EH5A 2JKYA 1ZUIA 2MINB 4J76A 1VLQA 3TUJC 5HUJA 5ITVA 3VU3A 3LC2O 4LJRA 2ZRKA 4LZPA 2GD0A 3B89A 3EVBA 3UJDA 1PGNA 2Y1KA 2CE7A 3CX3A 3UGJA 5CFNA 1CJTC 2GAJA 3L4BC 2KLBA 4HEA6 4IH9A 4MQ4A 4QTZA 1BG6A 4HDAA 2FPRA 1HMPA 3FE2A 5BT9A 1J2YA 2WC1A 5TNXA 2REQB 1UZUA 1HC7A 3H3XA 4KDFA 5HS4A 1TD1A 4UU8A 2C2GA 1LRKA 2YWXA 4EL5A 4ZCIA 1MO8A 2JZOA 3COJA 3PZBA 3QW4B 4GMFA 3LS2A 4URHA 4CL0A 7ADHA 4KR7A 2NPOA 3DHWC 2PSFA 5HE8A 3V8RA 4MI1A 1II8B 4D57A 4NULA 1GSAA 4YYZA 1Y33E 3GXOA 2UUAB 2FWAA 2Z83A 2ZSHA 3Q6IA 1XP5A 3JTMA 5TQ0B 4EB0A 2B35A 1IC6A 2Q3DA 3FYTA 4UUAA 3W5VA 3BG5A 5I5GA 3JD3A 1XTUA 5CXSA 1KI6B 3R6DA 1A88A 2FUNB 5D5PA 4E6PA 1DDIA 1RE0A 4CJXA 1STOA 1I3LA 4GMHA 4NMHA 3EEBA 3EXG1 2AR7A 2Q50A 3F6EX 3ZKAA 4RV4A 3AK4A 4H35A 3W5IA 5BYJA 2OECA 1FX1A 4ZYWA 1U0EA 2JD1A 4LWPA 1CYDA 1IY2A 2VWGA 2Y77A 4U2BA 1N5IA 1TO2E 2RAPA 3IV7A 3O4GA 4AJNA 4BU1A 4QICA 2G70A 4RLQA 3ZTYA 2H4XA 1E2DA 3CPJB 9GPBA 2QPLA 3HYTA 5JD4A 1U0LA 2QF7A 4II7A 1AA6A 2ZJ5A 1JMYA 2AS0A 3IUSA 1OHHD 3VNRA 1GWNA 4HV4A 1AHHA 2AOWA 1KO4A 1KC1A 4UUPA 1OB2A 1G0OA 2XMDA 3ZVLA 4TS9A 5EJ7A 4DLXA 2C59A 1AIPA 1G21A 3R5JA 2Y0CA 2LKDA 5E8JA 1RI4A 3KQKA 3CJQA 3ZWAA 3E8SA 4FXPA 1A7JA 3ZS8A 4V0KA 3TLGA 3C39A 1B0ZA 3RYIA 2ZYHA 1T1JA 2C3UA 4ILKA 1XEAA 4P5PA 3FPGA 3IHLA 3X1MA 2BGIA 3D0RA 1YJXA 4AD8A 1OXVA 2UZ4A 1S96A 5BSGA 4MRRA 4O2AB 4DWVA 3LGSA 4EI8A 5LWHA 1NXPA 1E1YA 1Q0TA 1E8NA 1PWZA 2V9PA 4J16A 1OWMA 3KSDO 4J6EA 3DLBA 3KQTA 5PNTA 2AI1A 2HN9A 4YN3A 1GLNA 1ZMBA 2ZB2A 3AVUA 1JZTA 3SP1A 2WAOA 2XUZA 5AD1A 4UAUA 1X8JA 4K9PA 4AZWA 4G9GA 3MJ4A 2XLBA 3TTTA 3LBIA 3QU5A 4QUGA 2BR3A 2B6NA 2IHVA 4FX2A 4Z51A 2CHQA 2XAAA 2DLNA 2XBUA 2Y1GA 2V6JA 2W2LA 3B5JA 3CE6A 4MVJA 2YXEA 3RG8A 1KNXA 3DYVA 4PRYA 3M2TA 4ZI3A 4WNAA 3FI9A 2MIIA 4OBXA 4GYYA 3MTDA 1AX9A 4UVGA 4RTLA 1ZONA 3CNBA 1WEKA 1KP9A 1YQTA 2YQZA 3OCCA 1E96A 4MR9B 2O8DA 2KBFA 1N36B 2JFHA 1BXZA 1JYFA 2D2XA 1NJSA 2OC4A 2ZJ7A 2IV2X 2YFHA 3FX2A 4Z4HA 1C9MA 2LE0A 2ORWA 2W6ID 4G36A 3T1HB 2R84A 2W0MA 3G1TA 3QEMB 5JQWA 5GJBA 2GJ8A 2A0FA 3DOHA 1ENYA 3IP6A 3MUOA 4MV7A 1P80A 3T0IA 2RDMA 2WJ3A 1TA4A 1QOZA 2PAAA 4G86A 2AF4C 3WRWA 4E7OA 1GPAA 1W4ZA 1JQBA 2EFJA 3GJ5A 5B1EA 1C7ZA 3ORQA 3LGXA 3JQ8B 2W2KA 2ZIZA 4ARSA 1Y89A 2WKPA 2X8WA 2AMYA 5ICCA 4A0RA 5FXMA 1YC5A 3A6FA 5EMLA 1AHIA 3KZMA 4IY1A 1WXHA 3GT4A 3LH5A 2WYOA 3NHPA 5HTKA 3I6MA 4X90A 3MAJA 3TQRA 2FPIA 2Y1WA 4JVOA 3RABA 3LVBA 4HGYA 4HRXA 2YVAA 2GA8A 4KPUB 4EW1A 3GGDA 4DUPA 3QQ5A 4GI7A 4OYRA 1BQ3A 2XDQA 5IJWA 1KWGA 5CPBA 3WIVA 4H7HA 1EDDA 3M81A 3EMVA 3ZG6A 2OM6A 2WMYA 2ZANA 3A3KA 3DP7A 3BMQB 5KKAA 1HTBA 1YKSA 3A6EA 2XR1A 3FNIA 1UWVA 3I4FA 4W5OA 1Z28A 1DQPA 1PKEA 4EJ2A 3G0BA 5EJEA 5FD8A 4MYHA 1T5SA 2CLIB 3DTNA 3FVWA 3TRFA 1DAGA 4HH0A 4TSFA 5IVHA 2PH3A 3D8SA 3BB3A 1DJNA 3TSOA 4B40A 1UMKA 3KVYA 4KIUA 2ONJA 3SBEA 3ZNPA 2YV5A 1GZ4A 2J3HA 4HDSA 2JA2A 1G98A 1P2GA 3L7MA 4GXTA 4ZK2A 4JYCA 1LK5A 4E14A 4UCWA 2HIMA 1EFCA 1P0PA 4C7OB 1Y9EA 5JMOA 1DJMA 3IT0A 3DBIA 4ZT7A 2QORA 4MV1A 3PEEA 1XLTA 4PFKA 4LK2A 3U4QB 1BNCA 1DTWB 3LVRE 4RYDA 4DLLA 1UAAA 5KCMA 1G2IA 2PXXA 4IVNA 3AO0B 3GRYA 5AK6A 3KR0A 1WULS 2HWKA 3R0QA 4NNOA 2J0EA 3NYRA 5DI3A 2GEFA 2DSTA 2JFBA 4ILEA 4MJXA 4MDEA 1XHLA 2DHQA 1NSYA 1VMAA 4EFMA 2YY7A 2H16A 3KKEA 1BDHA 4AX8A 5JJIA 4K86A 5HF9A 2PQMA 2AOUA 2HHJA 3BJIC 4MS4B 1LRLA 1X6VA 3ONDA 1ZG3A 2ILTA 1R8YA 4AYTA 3VSEA 3MG9A 2R8PA 4OI2A 1DOHA 2ALJA 4L78A 5CLIA 2ACEA 3D2BA