2YJ6A

Conformational changes in the catalytic domain of the cpx-atpase copb- b upon nucleotide binding
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
251
structure length
248
Chain Sequence
b'ALSLYEKMLHKGMIIKNSNVYEKIKEIDTIIFNKTGTLTYGTPIVTQFIGDSLSLAYAASVEALSSHPIAKAIVKYAKEQGVKILEVKDFKEISGIGVRGKISDKIIEVKKAENNNDIAVYINGEPIASFNISDVPRPNLKDYLEKLKNEGLKIIILSGDKEDKVKELSKELNIQEYYSNLSPEDKVRIIEKLKQNGNKVLMIGDGVNDAAALALADVSVAMGNISKNVADIILVSNDIGTLLGLIKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COPPER-TRANSPORTING ATPASE
publication title Conformational Changes in the Catalytic Domain of the Cpx-ATPase Copb-B Upon Nucleotide Binding
rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 68
structure length 248
sequence length 251
chains with identical sequence B
ec nomenclature ec 3.6.1.36: Transferred entry: 7.2.2.19.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2yj6A01
3.40.1110.10 Alpha Beta 3-Layer(aba) Sandwich Calcium-transporting ATPase, cytoplasmic domain N Calcium-transporting ATPase, cytoplasmic domain N 2yj6A02
1TJ3A 3L8EA 3W5AA 4BBJA 3RF6A 3NUQA 2MU1A 2OM6A 3L8GA 3MN1A 2WF8A 3QNMA 3L8FA 5ALTA 3E84A 2HHLA 2FI1A 4PNHA 5JJBA 2AUTA 3R09A 2I54A 4Y3UA 3EPRA 1F5SA 5E0OA 3QXGA 3ET5A 5AVRA 4B6JA 3FZQA 5ALUA 5AM5A 5IS2A 1IWOA 1WVIA 3AR2A 2PR7A 1YNSA 3N28A 3HLTA 5AKKA 2GFHA 3NALA 2YMLA 4ZEVA 2FPUA 5ALZA 3U7EB 3QLEA 2ODAA 5ALPA 3DAOA 1N8NA 1T5TA 4JDPA 5ALMA 2FDRA 2HX1A 1YJ5A 3CZ4A 3SHQA 3B8EA 2HDOA 2NYVA 5ALOA 4I9FA 5AM1A 3N8GA 2OA0A 1JUDA 1X42A 4BNDA 3PCTA 5AI6A 2W43A 2YFYA 2P9JA 2OBBA 2A29A 1Z4NA 5AVQA 1K1EA 2JAUA 5AKHA 4C4TA 2G80A 2B1QA 4JB3A 5AW2A 3AR6A 1ZJJA 2RBKA 4UASA 4BX3A 5IT4A 3AR5A 4QQFA 3SLRA 2IA5A 2C8LA 1SWVA 4OD0A 2WF7A 2HI0A 4UM7A 3WKBA 1MO8A 4G63A 3AR3A 1YS9A 3QU9A 5AVSA 5AM0A 2R8ZA 5AI4A 4ZEWA 1L6RA 4L6AA 4EELA 5ALWA 4DWOA 4FE3A 5AW5A 2RAVA 1Z4MA 4MWOA 2CN1A 5ALIA 1RMQA 2P27A 2AMYA 4L57A 4L6CA 3WK8A 5ALKA 4KN8A 1RKUA 4GIBA 5IT0A 3QYPA 2HF2A 5AI5A 3N1UA 2RARA 1WZCA 1YDFA 4O8CA 2YMPA 2ZG6A 3U19A 1Z4JA 2X4DA 4UM5A 2YMMA 4H1WA 2FPRA 3E81A 5AVXA 2C9MA 4EX6A 4UATA 2W4MA 1QQ7A 3WGUA 3MPOA 4HGOA 2EATA 3OCVA 4BNDB 3KZXA 4UMEA 4BX2A 2ZBGA 4BEVA 1ZD4A 2Q4RA 5AI8A 4XPZA 4Y2QA 5AK4A 3AR4A 4CF3A 1O08A 2BDUA 2BDEA 2B8JA 2FPWA 3MC1A 4UU0A 1U7PA 1L8LA 5AW8A 3DDHA 1Z4LA 3QU2A 1FEZA 4KYTA 1Y8AA 5ALDA 4EX7A 2RB5A 5ALJA 2KMXA 1NRWA 2O2XA 1U2SA 4YCLA 3ZTWA 1L8OA 4KNVA 3QUTA 4YH1A 1EK1A 1RQLA 4OCZA 3M9LA 3N07A 2HF7A 4NWIA 4CF4A 3L1UA 4FYPA 1RLOA 4YGYA 3ZX5A 1J8DA 3L8HA 4HAIA 3FPBA 4UMDA 3SKXA 3ZW7A 1J97A 5AVZA 1XVIA 4UW9A 2B30A 5AVYA 2HSZA 1RLMA 2ZBFA 4J2TA 1YMQA 3QX7A 3F9RA 2P69A 4XOUA 5AKYA 4BYGA 4G9BA 3PDWA 4KX3A 1LVHA 2GO7A 3WKDA 4AS2A 5AVTA 2HO4A 2B82A 4AS3A 1L7NA 4NFLA 3A1DA 4IFTA 2ARFA 2R8YA 1MH9A 1Z4PX 3QU4A 2ZXEA 4UAUA 1O03A 3OCZA 4UU1A 4HGQA 4BX0A 4GXTA 3ESQA 2R8XA 2W11A 3WK5A 1T9ZA 2PQ0A 3I6BA 5A3RA 3ZU6A 2YMQA 3L5KA 4KX5A 3ED5A 1TA0A 5A3QA 2G1AA 3CNHA 3W5DA 2EAUA 3D6JA 3OCXA 3U7HB 1QQ6A 3SF0A 1Z88A 2A00A 2WF6A 4RETA 1WPGA 1EK2A 5ALGA 2KMVA 4HGPA 5FP0A 3I76A 1TJ5A 3IB6A 3PGLA 1NNLA 4NABA 2B1RA 4UARA 5AKXA 3QU5A 2YN4A 1AQ6A 3GYGA 4RESA 3W5CA 5A3SA 3WKEA 3R4CA 4BKMA 2I34A 5AW9A 3OCUA 3AR7A 3QU7A 1ZD2P 3UMBA 5ALQA 1ZRMA 1RLTA 3OPXA 1U7OA 4HGRA 2VKQA 4I9GA 4XQ0A 3A1EA 4C4SA 4OHFA 3ET4A 5ALNA 1RKQA 4ZEXA 5ALYA 1L7PA 2YJ5A 5ALLA 4EEKA 5AK3A 4EZEA 3WK6A 5AKGA 5AKEA 3DV9A 5AICA 1MO7A 5AW3A 3WKAA 1KYTA 4Y2YA 3BA6A 4DFDA 3ZI4A 1ZS9A 3WK4A 1RRCA 2NO4A 1RC8A 3OCWA 2IOFA 1TE2A 2C8KA 4C4RA 2ZBDA 3ZVNA 4UAVA 1RPZA 4FFDA 4YIHA 1RQNA 3OCYA 1ZOLA 3U13A 3UM9A 1VJRA 1S8OA 3SD7A 5ALFA 3S6JA 5AI0A 3E58A 2IOHA 2P11A 5AW7A 2WF9A 5AK5A 4EENA 4IG4A 3ZUPA 2HCFA 3B9RA 1U7QA 4YCNA 2I55A 2DQSA 1CR6A 3PGVA 4Y2RA 1Z4IA 2GHQA 4UMFA 3WK9A 4Y2VA 2YJ3A 3FPSA 3QUBA 1ZD5A 3ONNA 2G09A 2FPSA 1WR8A 3KDPA 2YJ4A 2O9JA 2IYEA 2G06A 5AIAA 5AW4A 1Q92A 2CFSA 4OFZA 4QJBA 1Z4OA 2JAOA 3I1YA 3L7YA 2CFTA 3UMCA 5AM4A 3J7TA 3QUCA 2WM8A 2AGVA 3FGOA 1VJ5A 2JAWA 2Q5EA 2WHEA 3U7FB 3ZTYA 2MSNA 5AM3A 3FVVA 3NIWA 2BY4A 4HYTA 2I33A 2AH5A 3QGMA 2G08A 2NO5A 3K1ZA 5ALSA 1VFPA 4YIKA 1U2TA 2IOFK 3ESRA 1Z4QA 3EWIA 3W5BA 3HYCA 3MMZA 1NF2A 3ZWKA 1N9KA 1U02A 5ALHA 4BEWA 4DCCA 1Z5UA 2R8EA 3ZWDA 5AHXA 3A1CA 1RDFA 3KBBA 5AW1A 2ZBEA 3L0CA 3ZX4A 4DW8A 5AVVA 5AKIA 1RMTA 1L7OA 3KD3A 3L0BA 3GWIA 5AVUA 1Z5GA 4Y2UA 2HEGA 1XP5A 2FUCA 3R9KA 5AKLA 1PW5A 3NAMA 5ALRA 1ZD3A 3UMGA 5ALXA 1SWWA 3NRJA 2YJ6A 2YY6A 2Q4TA 5AW0A 4E88A 3U7GA 2WF5A 4YCMA 4Y2XA 3QUQA 5AKJA 2GHTA 1RKVA 2YBDA 4Y2SA 2FEAA 2QYHA 3BWVA 2C88A 2QLTA 4Y2JA 4CNQA 3M1YA 2B8EA 3VAYA 1S2OA 4UMVA 5AVWA 2GMWA 2I7DA 3KC2A 1SVJA 3SKYA 4J03A 1QQ5A 4NAVA 4F72A 4MUMA 5AESA 3RFUA 2D2VA 3AR8A 3WKCA 2EARA 4HGNA 3U26A 4CE6A 4CF5A 4KNWA 2I6XA 1Q91A 3OTQA 5ALEA 3A3YA 3AR9A 3DNPA 3L0YA 3WGVA 2CFRA 3P96A 1TJ4A 3IRUA 3TLMA 5ALVA 3L1VA 5AK6A 4F71A 4Y2TA 3B9BA 1QYIA 5AIBA 1RMYA 1QH9A 2JARA 3IJ5A 5T41A 3E8MA 4NV0A 4XE5A 5AM2A 1LTQA 2JGAA 3NANA 3WK7A 1ZRNA 2B0CA 2FUEA 3FM9A 1SU4A 2G0AA 4Y2PA 2PKEA 2G07A 1YV9A 1Q3IA 4AP9A 3KOOA 3ZVMA 3NASA 1L7MA 2C4NA 2OYCA 1Z4KA 2HOQA 3I28A 3SMVA 5AW6A 2ZOSA 5AI9A 1CQZA 5AKZA 3EF0A 3N5KA 1T5SA 3EF1A 2WFAA 2FPXA 1XPJA 3ZVLA
chains in the Genus database with same CATH superfamily
4AMGA 4K9OA 1TAHA 4TWRA 3VSBA 4YRGA 4L3VA 2ZRKA 2Q6OA 2E1PA 3T61A 1L7AA 4EB0A 4K03A 3C97A 5C8YA 1II8A 5U4QA 4WEQA 4CTNA 3H2BA 3CB2A 1U1EA 2R6HA 3QNMA 5FV7A 1J5XA 3E84A 4N40A 1P1IA 4JQYA 1QVRA 3HL0A 1A69A 2XNKA 4MWGA 1F14A 4P31A 1OXXK 1TKCA 1RE0A 4LJ9A 3OOYA 5JCPA 3ZWCA 4KQWA 3F0TA 1P1HA 4CIAA 3QXGA 3V34A 3BEDA 4EHJA 5L7WA 2CC2A 4QIHA 3MT7A 3Q8LA 1T5BA 4QYXA 4CTKA 3MAAC 4OREX 1VPVA 4RSMA 3FSGD 3GO4A 4OQYA 1IOWA 4CTOA 3EA5A 3P26A 10MHA 3A6JA 2XYHA 3JD3A 3ZXYA 1NW7A 3HU5A 1AXGA 1GZ5A 1H1LB 3T8YA 3IBTA 1RHUA 1YB7A 3MGBA 4E13A 1BDBA 2E3JA 1FF9A 2JIRA 3BZUA 3OIVA 5KVCA 4C9BA 4DR5B 3QA9A 16PKA 4IFEA 1KVUA 3U3OA 2OT3B 5LNK6 4RULA 2GYUA 3P0RA 4PYRA 3DAOA 4Y1EA 2WVGA 1R6VA 3RREA 2VJNA 3SNKA 1HQYE 3A4NA 821PA 4KUHA 4URZR 3IMFA 5I3ZA 1HEUA 5E4FA 3UO8B 2VS1A 3K5IA 3BCHA 2FWNA 2N1BA 4EJMA 2HDOA 4OTZA 3RVJA 3VKFA 1CF4A 1WTAA 3QXJA 3CNBA 3K0AA 5ALOA 3ZLUA 3AY6A 4GO1A 5AM1A 5M29A 5HUQA 5BNIA 4B4UA 1SIUA 5JS2A 3DQQA 3GRAA 3PCTA 5CH5A 1UBJS 3PPIA 2EFJA 4BJHB 1R9NA 2A29A 3W8RA 4X94A 3THOA 3N74A 4PLPA 5AKHA 1U3FA 4PO1A 4U2CA 1R0CA 5DGCA 3PQ7A 3LJKA 3SNHA 3VPSA 1OLSA 2G6BA 2BAGA 3FTPA 1ULZA 3ROTA 4RWZA 4IEIA 1W0JA 3JVUA 3AIKA 4H17A 2GARA 3AHFA 5IUKC 1P19A 4YRKA 1QP7A 1TM1E 1DV2A 2ZXUA 3WNVA 2WYOA 4NV1A 2QRMA 2K5UA 2F3PA 2XUKA 4R1LA 3WKBA 5FX2A 3ZDCA 3AR3A 4FDLA 1P9OA 1AUOA 4KKXB 4US0R 4BBPA 3ISVA 4Q7MB 3QJYA 1RCTE 1X86B 1UL1X 5BN5A 3I3OA 3P5BA 2PU7A 1XDBA 2Q5LA 1J07A 1Z28A 1QCDA 3ZHBA 5I7UA 1M6VB 4TXNA 2HF9A 3L43A 5HKLA 2D0OB 4JP2A 5LB4A 3LVRE 4U39A 2UVPA 4IIHA 3QM1A 3A8TA 3TLEA 2JL1A 5K4AA 1E8DA 1JT2A 4BX8A 1CZNA 4DGSA 4RPJA 1Y1QA 1RKUA 4IXMA 1KPIA 1ZUNB 5I5GA 3SYNA 2OFXA 4F92B 3LP6A 2MSCB 3HBFA 5PGMA 1B73A 1NMEA 1PL6A 2OGSA 2P2GA 2HM7A 3KXPA 1L7VC 3W1EA 5IT5A 5DX1A 4AICA 5LBUA 3ZDFA 2I80A 1HE2A 1M6HA 3D1JA 5H59A 1OWOA 5DX8A 3TW4A 3QV2A 1AXRA 4F2HA 2DFDA 2I6GA 1X9HA 3O4RA 4GKBA 5HFAA 4M1KA 3TLAA 2CCKA 5A03A 3KZMA 4TMWA 3F7NA 3LQ1A 3UK1A 3HVIA 4H1WA 2PUDA 3TMAA 2B5OA 721PA 3K30A 2PRSA 3QP9A 1GIAA 1PBTA 2H1SA 2WNSA 1QQ7A 1E3DA 4Q37A 3JVVA 3MOGA 4L76A 5DHFA 2WT9A 4ZCLA 5KTNA 3FPGA 3LQRA 2JRCA 3MZ0A 3E7FA 1WD5A 3GJ5A 4M9RA 3W78A 4BX2A 3L1KA 4M8KA 1NR7A 3FWHA 2YNMA 4EG7A 4NCNA 1Y6QA 2Q4RA 1Z13A 3KCNA 3BMQB 1IIBA 3KT3A 3F67A 2JFZA 4EY4A 1E4OA 3AR4A 4X3OA 3VYRB 3ZV5A 1M34A 2DG2A 3LT2A 1R3UA 4E5KA 4Y6QA 4ZT6A 2G0TA 3ZZUA 3LOUA 2DOKA 3QX8A 1SCNE 4XQEA 4RCYA 1Z63A 2HNAA 3EGDB 3JX9A 1YWGO 3DDHA 5AK0A 5IKEA 2BD0A 3QPWA 4JYBA 2A14A 5FD8A 1XPUA 1RKXA 4MUNA 3IUNA 1WULS 4LDQA 1KNQA 4Z8YA 1PZFA 2OD2A 2Q8NA 3CG0A 4N3GA 1R0RE 1KETA 1KJNA 1W30A 2AYYA 2ZE5A 5KX5A 3L8DA 4JI0B 2OFWA 1PFQA 3PNSA 4RXUA 4B3XA 2P5TB 1R6UA 5DK4A 1DEKA 2GLTA 2AJDA 2GZDA 3H9EO 4KXMA 3JQ7B 2Q3HA 2SCUB 5D85A 1W47A 2VRWA 4Q9HA 4BVAA 1FBTA 4AMBA 4DC1A 4E5DA 2JIZA 1ORTA 1VL6A 2Q4OA 3PB3A 4IRXA 5HGXA 5I9SA 4CIWA 4PVDA 1SBQA 4LRQA 1SG6A 2HA5A 2IY7A 4FYPA 4B0PA 1KVSA 4UOZA 3TDNA 2GJAA 3WYDA 2EFCB 1R7RA 3A4TA 1U04A 2FEWB 2OHVA 1RSZA 4O59O 4RYDA 3CX7A 1MO5A 2F43A 3E70C 1LNQA 3WNDA 3G59A 4EPWA 3KHSA 1Z0IA 3G9XA 2J0UA 4Y8VA 4YCBA 4QWWA 1ID8A 2IOYA 2WLTA 5BSVA 2ZKIA 2AR0A 4OSOA 1BHQ1 2VFAA 3F9RA 4C6TA 3UJNA 1JKIA 1E9BA 2WE8A 4JFAA 1HH4A 1NSFA 2EZ4A 3LHKA 1SOUA 4BKOA 2ZK7A 2FA9A 4MUAA 2QAGA 5FPHA 4HVLA 5AO9A 2WZDA 2ZJOA 4TYQA 1AU9A 2JB9A 1E5TA 1RACA 3A6KA 2CSXA 3VU3A 4RY0A 2C78A 3Q5DA 1XAGA 2YJTD 4XWYA 3B2QA 2WT4A 3CVVA 1X2EA 1WHSA 2I1QA 4UUPA 3SJCA 1P33A 2DY0A 3JWPA 3ZKWB 1Q3KA 4P0PB 3LIIA 1Q20A 2DGDA 1EYZA 1D4FA 5IT9A 1N3LA 2OWDA 1YDWA 3A58B 4ZDIA 1RYYA 2J3EA 4EFKA 1FJHA 4EQ6A 1MJGA 4DA4A 4GD3Q 2UZ4A 2FSPA 4K2HA 1Z39A 3Q3GE 4JQZA 4AZ3A 4F2GA 1JIIA 1I9CA 3EFHA 1N2OA 2ZCUA 4AJEA 1RQPA 3ED5A 1YBAA 2OZVA 2XOKD 3CW9A 3BCSA 4LX8A 4QYWA 5SYNA 4LDPA 5A3QA 3UJBA 3HBAA 3GDGA 3EIOA 1GT6A 1BROA 3SC2B 1O94D 1Y3IA 2ATCA 2FX5A 4JASB 3WBBA 4LFBB 2ZIWB 1B8VA 3MM4A 1ODCA 3RV3A 3VSEA 1I4LD 4IIJB 5B5SA 2XMSA 2XMDA 4IUDS 4UDXX 1KAGA 3E7WA 1C9YA 3IPLA 4Y30A 5FXMA 1CRWG 1OYYA 3LZCA 1KMQA 3G9TA 3IVCA 3WADA 4D57A 2HN9A 4FOSA 1KFBB 3GYGA 4MPPA 1Q7CA 1ZVKA 3CLUD 3MJCA 4OEHA 1NBMD 5A3SA 4O33A 1T6XA 4WK0B 4AMVA 4ALLA 4BKMA 4ESOA 1C7RA 3LQQA 4KZPA 3M3HA 2EGHA 4WUVA 1UQRA 3L4JA 2NQ8A 4B3SB 3FAZA 1N32B 2AZMA 4KH0A 4W8HA 5TQ2B 1NT2A 2E4VA 3EGEA 3EPPA 1TCBA 3QYFA 2VJCA 5FI5A 4F5DA 4Y0AA 2CF5A 2R2AA 3I09A 4NF2A 2KBEA 3A4YA 3O83A 4RZHA 4UUBA 2X0KA 5DTMA 1M72A 1QZTA 3GD5A 1G8GA 2ZAOA 5EYPA 5G41A 2IUYA 1V11A 5LMNB 5LD2C 4KRGA 4WNAA 3HJFA 5IJAA 4QXOA 4L5IA 3ZZ0A 1VJTA 1DC6A 5DASA 2ZBUA 3AVUA 3EVAA 3CO5A 2W6MA 3L6DA 4JIMA 1TOAA 4IX9A 3TQIA 4B3HA 2ERCA 4RVGA 4YP7A 2ZQ5A 2IP1A 3EXEA 4IY1A 3H18A 3NG1A 1L7PA 4O2AA 4QOSA 3CUEF 3I01M 4OMDA 3HUTA 3V8RA 3WK6A 2FETA 5DYTA 4MV1A 1KK0A 3C6QA 3QZUA 2ZM6B 3JYOA 4N76A 4LWQA 4HAXA 1A77A 3F3KA 1PEKE 3L8YA 1CDEA 1SG0A 3SP1A 4DA9A 1L5VA 2PRKA 3TUZC 3RIGA 4XVHA 4GKKB 1PHRA 2PYDA 2VZ9A 4JUIA 4KWEA 4V0QA 1LPAB 1XCLA 2C8KA 4JC5A 1VJDA 5DBEX 3DO8A 1KHTA 3ZVNA 3RVKA 5G1PA 3KYDB 2AOUB 4PSKA 2R1VB 2ZPAA 5JECA 1YUNA 5G0VA 4DDMA 4H1UA 3ZVKA 3GVCA 5K0NA 4GXQA 3OT1B 2QLJA 1XVVA 4KR7A 3HKEB 1AHIA 1WMDA 4CQMB 1M0WA 1TRHA 2CKMA 4A5SA 1I7NA 1G2PA 1FYVA 2HIHA 3OTWA 3AX6A 4DLUA 4R8SA 5D84A 2IWHA 4AU1A 4M2LA 1B0AA 3M4XA 1DGQA 2YZKA 1BTOA 3AEUA 5I9MA 2O8CA 3HJTA 4PGMA 3STHA 4EUKA 1EXVA 4UOQA 1OY1A 1WVMA 4LQCA 2B3DA 4L9WA 3L06A 2ZPUA 4ZREA 1XMPA 1CX9B 4JT9A 1WP4A 2ZRLA 2CLEB 4TGLA 1ESCA 4BO3A 2XQJA 4G1MB 3S28A 2W37A 2A9JA 2W6PA 1UPXA 2YJ3A 2B8WA 2JHFA 3NJ4A 4IEEA 4CTJA 2JK0A 3FPSA 4ZQFA 1OREA 3TNDA 4AJ4A 1SQ0A 2J41A 4RH3A 3ZTTA 2QXTA 3VZCA 4YJ2B 4OUDA 2I2XB 4U0JA 3LKZA 3BMNB 5BRAA 2DVMA 3DHWC 5F21A 2CMDA 4OM7A 1SELA 4S0XA 1CIVA 4QOGA 4MR7A 3IP7A 2H08A 1CNEA 1NE2A 1T1EA 3F6EX 3UOGA 2XZTA 3ROKA 3L6BA 1OI2A 3THSA 3ZJTA 5DLQC 1G5TA 2PSDA 5LYJF 2VSNA 2B8TA 4YJ3F 2I4TA 3FWPA 5ECGC 5FJJA 1ISIA 2VP6A 1KSGA 4PHTA 3FGOA 4HBGA 3FN4A 2IXBA 5HEKA 3QLVA 3VPAA 4XYBA 4O2RA 2PLRA 2REQB 3K16A 3M82A 4D45A 4TKUB 1BEZA 2O6LA 5I8PA 3C3YA 3TQQA 1POWA 4D9KA 1CF2O 1E6CA 3MWEB 1G0OA 1HK7A 3RSQA 2AH5A 1QGUB 2JCBA 2VXBA 4YB8A 4B34A 1GYPA 4R68A 4I3GA 3G1UA 1HSZA 3A1FA 5KCMA 1BXKA 1MIHA 1U02A 3A70A 3GRCA 3O4JA 5EKXA 1DAMA 1EWRA 4A8JC 4ACAA 4ZTUB 1XZCA 4FWTA 3LI2A 2DJIA 4QASA 1A7AA 2QZSA 5CFZA 3DDWA 3HCBA 2WJGA 2AR9A 4MAAA 3MWJA 1QGAA 3BGVA 3DOUA 4PQYA 7MHTA 4J0QA 4C0SA 1YCGA 2ZSHA 4YQFA 4DA7A 5AVVA 4U7HA 4JI5B 1NJFA 1V8DA 2P4EA 4DMCA 3B9QA 4IOLA 2J0QA 2Y1EA 4ZOAA 4EGSA 3S8YA 1Z5GA 3DOIA 5CT5A 3F7OA 1P18A 1SVOA 1ORVA 5JSKA 5IH7A 2V6IA 1R12A 4JI1B 1T36B 1TFRA 1VE5A 2B1IA 5I51A 2MYPA 3OLCX 3T9CA 2V5VA 5DPMA 1NA5A 1C50A 2GPTA 4I4NA 3U1VA 4DIBA 5BR4A 2R5NA 1U8FO 3MTBA 1WIWA 2H16A 3WBJA 3GYBA 2GCEA 2JH9A 2G8LA 1PT8A 4I1UA 1LPMA 3ILSA 4IJKA 4KIUA 2JFQA 5BY2A 2R8OA 4ER7A 1BZYA 1DBQA 4YCMA 2G70A 9GPBA 1ICIA 3OIDA 4DQKA 5I4KA 4CEIA 1PJRA 1Q7GA 4HDMA 4MHSA 3ADBA 1TZBA 1UBMS 5IVPA 4BFWA 1S2OA 3GCDA 4XTRA 1XALA 5LCXA 4KR3A 1EGHA 1CZRA 1N1GA 4QT0A 3ZHSA 2NU6A 1JQ5A 3C3PA 4B44A 3AR8A 2GDJA 1E64A 3ROEA 1T4CA 4ZFNA 3OTOB 1IY2A 4DLRA 3SXUB 4C88A 3K9FC 5GQSA 1UXJA 3VPHA 3PQEA 2WD8A 2Q5JA 4NYJQ 4C2AA 1T8YA 2IZ5A 2M6LA 2PE5A 2C9DA 3H1PA 4R1MA 3D8BA 1XB2A 3D3KA 3KVNA 1E69A 4UE3S 5CLQA 2V8OA 1VBNA 2AN4A 1XQVA 4QUIA 2JVIA 3RYIB 4ZGWA 2G1PA 3IPRA 2PMBA 3TB6A 1IPHA 2YV4A 3I92A 3KSDO 4GUAA 4IYRA 4RUKA 1VL0A 3EUAA 4QM6A 5ALVA 1KAQA 4TTAA 1HE5A 1TFUA 2FMFA 5JC8A 1BCSA 2ZQZA 1N3YA 1QH1A 2BV3A 1T0BA 4K9LA 2FZWA 3K7EA 4KPEC 3M7IA 5AIBA 3F73A 5KJ6A 1WQ1R 2XCSB 3X1XA 2Q46A 4M6WB 4WPGA 3G82C 3RODA 1X3SA 4JS0A 5JOQA 3DE2X 2Q4DA 1CQPA 2QWXA 3H9CA 2JGAA 1XNHA 5IH3A 4CODB 1I5RA 3CVUA 1D03A 3EIXA 3LRTA 4MRSA 4YJDA 4DA6A 2VI5A 5D1HA 4LA4A 4YX9A 1Z0JA 4BKQA 3U2QA 1WZIA 3LY7A 1KTIA 1BWQA 5EMHA 1FYDA 3G8BA 3DZFA 4U1RA 4WLUA 1IN4A 5LQCA 1YQEA 1Q3IA 4WERA 4BWVA 4E94A 4NENA 4DIMA 1Z4KA 2XXBA 1FYEA 1WRBA 2AC2A 4FYIA 1ISFA 3SMVA 3GFRA 3ORFA 5F4BA 2ZAYA 4X90A 4M4SA 4XX0B 4GX2A 3EF1A 2PFSA 1T9CA 1O9BA 1Z38A 4PU0A 5GJCA 3R6LA 2IYQA 2EW2A 2XTAA 4FZ5A 3JQPA 4HRXA 4RPHA 4EMSA 2B3TA 5BN4A 3DXFA 3F5FA 3QV1A 1EK0A 4GRIA 2B4KA 1XD9A 3LQ4A 1N9ZA 3GLFA 1BW9B 3W5JA 4Z1OA 3CUUA 4HDAA 4JOSA 1OH5A 2BGJA 4HRAA 3EHDA 2YV1A 5DSXA 1YC2A 3QH4A 3G1WA 2J6IA 1J0DA 5M5BA 2BZGA 1R4ZA 1SB8A 1JGTA 3AB8A 4JEHA 4O0LA 4C6SA 4DLPA 4G3XA 2I1VB 3CUVA 3H9UA 1LEHA 2IITA 2DE0X 1PJQA 3DLAA 1XK6A 2AG1A 1MB4A 3P52A 2DH6A 4G84A 3U44A 1Y9JA 1OHHA 3O3NB 3D3WA 4GL4A 2JJ2D 3CH7A 4RANA 2VTBA 5A0TA 2ZUEA 1DAEA 5FOTA 2EX4A 1UBSB 2ZI9A 4I4TB 5HKAA 1M73E 5KI6A 4DQVA 1LDEA 2RHJA 5HMMA 2V54A 2X4GA 2OMKA 3T9DA 1UMBB 2CE7A 3I6YA 3IVRA 3VHXA 2QTAA 3B1WA 1DHTA 1MRSA 1RWWA 4L5AA 4MW5A 4BNLA 4KDRA 4O02B 1G5FA 2IIVA 4PHCA 3CVOA 4F4UA 1KEPA 3K15A 4MI6A 3WLPA 4FGZA 4F6RB 2ERXA 3EH1A 3NC1C 5EP1A 1UBFA 1NULA 1SBTA 4DM7A 5IX8A 5E6RA 4BE4A 3O4HA 3U48A 3MGGA 3HQ4O 3WRXC 1X7GA 2XZPA 1AX9A 4LYHA 2W7TA 1L5SA 4M87A 5ARDA 3SJBA 2L0XA 4JJFA 5EN4A 3UN1A 6ABPA 3TXYA 2GYVA 2NYVA 1E9SA 2B35A 4Q1BA 1K5PA 1UMDA 3OJFA 1AB5A 5LYYA 4QTXA 3HKDB 4NIMA 4LI0A 3TW6A 1FUYB 3OX4A 1LA2A 2Y1XA 4A2PA 3DHYA 1HL3A 3ZHQA 4BTEA 1QRUA 4D9JA 3IXMA 4G65A 3UF0A 1JKJB 4XB2A 1X80B 2OBBA 1SVIA 2WB4A 3PC8C 4JKYA 3UK0A 1YB5A 3AGPA 1D2CA 3UUGA 4HJRA 3IV9A 1EJ0A 4GVXA 2HSGA 5LN1A 1XRRA 4M9ZA 2GRJA 3JYNA 3S99A 1HURA 2AX4A 4M1TA 4RGQA 1KO7A 3HVKA 1N6PA 2PGXA 5D3ZA 2V7WA 4HFJA 1Y6FA 3ES9A 1ISMA 4KDCA 2KB0A 1JXQA 3LRXA 3WL8A 5JDIA 2AD1A 4JVSB 4UXIA 2C2HA 5ES4B 3UAYA 4JQSA 2DQKA 1U5BB 2O8FA 2AMVA 4EMUA 1U4SA 4G63A 4DCGA 5JJ5A 2YS6A 3DL0A 4Q00A 2VTDA 4X00A 2IUSA 2PSFA 3WSVA 3A1TA 1IATA 2AKYA 5JZOA 3MT8A 1Y3HA 2GNPA 4I55B 4NZOA 5E3JA 4ZEWA 1K7FB 1XTPA 2NV6A 4HVAA 3P20A 2OQVA 5CVTA 5GINE 4IFBA 4IG9A 3UAVA 4C01A 5BSRA 4LTNA 3W7VA 4N0DA 1FRNA 1D0VA 3GUVA 2OO5A 1JZQA 1ODKA 2W6JD 3BIWA 5HF8A 3RRZA 4AL4A 1PS9A 2BHLA 2BSAA 1NBIA 1EI9A 5IKXA 1MKYA 4A6EA 5CNIA 1HDYA 4K6OA 1AQUA 3OQOA 3GDHA 2QR2A 4QYIA 5EERA 1T0HB 1NUUA 1YCHA 2GEFA 2QTRA 1D4AA 3EOZA 3I5AA 3IV6A 3JAKA 3MPUA 3GBVA 4HLCA 4W5WA 2Q5QA 1K0FA 1KE2A 4C4PA 4EZBA 1Z4JA 4JSYA 3OQNA 2BFAA 3ZWAA 4RH1A 4DGQA 3OU6A 1VIDA 1BD3A 2O1WA 3LYUA 1VL8A 1QYVA 4W5HA 4PGGA 4HDSA 4EPTA 1JR6A 1YRQA 1FSFA 4LOAA 4QNRA 5K7SA 3CBGA 5TJHA 3KBOA 2EATA 3IR5A 1W49A 3GMTA 4Y6LA 1L5LA 1XQYA 2XBLA 3FMIA 3TTTA 3VX3A 3PL1A 4C76A 1IBCA 2FWIA 5BURA 4B6FA 2AW3A 1NLZA 2C5GA 4HRVA 5AI8A 5AK4A 1Z36A 4QXAA 4GDMA 5CDGA 2JF0A 2P9BA 2XI4A 4KRXA 4YRMA 1IHDA 2NZJA 3SBDA 5FLXA 2PZEA 2DJ5A 3LZ6A 2F8TA 3N8DA 3NPAA 1RPTA 4D6XA 4W7SA 3UCFA 1EWYA 4Z9BA 4ENQA 2DWCA 3BK2A 3I9V1 2HXYA 4XLZA 2C5SA 2CXTA 1JA1A 1IG3A 4A15A 2GK7A 2B1JA 3OKPA 4RQUA 1QK5A 2MMCA 2WV9A 3RGWS 5H4GA 4KREA 1KQGA 2FR8C 1LDNA 3IOYA 3KEFA 2JGDB 4LNHA 4Q01A 4HNVA 5JYDA 4R01A 5I7OA 4AS1A 4NZYA 1NRWA 1E2MA 4FDTA 4PZ0A 2OFFA 4RHUA 4BATA 5KOYA 3RS8A 4ZT4A 4A5OA 4ZYUA 1DX4A 2JFBA 3K8ZA 3P27A 4G67A 2GVDC 4KNVA 2LKDA 5EI5A 2BHNA 5BR1A 1Y3DE 5TNXA 3EPLA 2QE6A 3F8TA 3C5CA 1KJWA 3F71A 2RH4A 1MX9A 2HF7A 1NTRA 1YZHA 2ATEA 1H6AA 2HFJA 3GCXA 4TZKA 4Q39A 3JYHA 1N2SA 2GERA 2P91A 1F4PA 1HV8A 1JR4A 1SBHA 2FG5A 3G7UA 3FPBA 3JWEA 3LDHA 4XM0A 3O4FA 1MT0A 4AKIA 1N2CB 1SOAA 2YVAA 4FT4A 2HA0A 2O2GA 4RK1A 4XPIB 3VAAA 2JHAA 2PMKA 1MW9X 5BMOA 1QDUA 1ZIPA 1Z2NX 4O4HF 3FY4A 1L7DA 2QY9A 3I34X 1OX5A 5JO9A 2C3YA 1L5OA 2VVTA 1Z8FA 2G8NA 3O2SB 1JLLB 1WEKA 4BNIA 3BOSA 2G63A 4RA6A 1V8BA 1I7DA 4RZ3A 4XWTA 3RK1A 2FN4A 3SC3A 5BN1A 1U2GC 2GTHA 4L50A 3GJ4A 3CLKA 3EIEA 4PRYA 3KDAA 1EFCA 5FA5A 2H1RA 2GO7A 4YP5A 5DFAA 4RJIA 2XR1A 4IHJF 4R69A 3E15A 1P3DA 4YRRA 2I3BA 3M70A 4ZCSA 2X8JA 2X7HA 4FMCF 4FB4A 2DYKA 3FYUC 2IPOA 1E32A 1ZJ5A 2BFBA 2IEDA 4BC0A 2OAEA 5D87A 3DE7X 1VHJA 3N2EA 5EJMA 3SSOA 3UG7A 2VQEB 4W5OA 4KSBA 2ADFA 3KHTA 4NJMA 3KU4A 5FTJA 3SLKA 1YR3A 2O57A 2WJ4A 3K8YA 9LDBA 5CIWA 2D59A 2XE7A 2OXEA 3CLRC 4O63O 1CEYA 1AHPA 2YRFA 2W93A 1H3NA 5NULA 2IL1A 5LP1A 2WTEA 3FJYA 2WA2A 1DXYA 2GD2A 1YRBA 4UJ3A 3TL3A 4DXDA 1F48A 2MJLA 2R8BA 1Q83A 5GGYA 5THXA 4BVGA 2GBLA 5A3RA 4NJEB 3VJRA 3URMA 1N34B 3O0DA 4LDZA 2YY5A 3SS7X 2G1AA 1F0YA 5F3WB 3JQGB 1QUFA 3ORSA 5H3CA 4E5VA 1NLUA 3AJEA 2WF6A 3MWDA 4HQFA 1C14A 4QLBA 5BW4A 5IHPA 2VJOA 3OWHA 3DFIA 2FPGA 2GZSA 1KZ6A 3EGXA 2D7DA 3F90A 1ZJ6A 2JGFA 4INJA 3B3QA 5BO5A 3KR0A 3L7OA 3WYBA 1M10A 2C04A 4TYYA 3B89A 3T52A 3U4HA 5CCXA 3X2EA 2WABA 2VT7A 4URYR 4LN1A 1UZUA 1SC9A 4MWCA 3W04A 2O52A 2A1TS 1JIJA 3CNLA 4QC2A 1HI9A 1Y8CA 1U7UA 3AVQA 4C4YA 2XT9A 5KMGA 2C7RA 4NZZA 5ENVA 3BB3A 4U9UA 3MHTA 1GA1A 5JQGA 4CFYA 4MGZR 2PD4A 1IK6A 2R85A 2DLDA 3I4FA 4K6KA 1GPH1 1ZVQA 2ASEA 3GJ0A 1JYFA 4IF4A 4Y18A 2IWRA 4AYWA 3SVTA 2I03A 1SKAA 2Z8YA 4FUTA 3DE3X 1H93A 4V2IA 2JFUA 1V48A 2GX6A 5B58T 1Z6XA 2EQBA 4EG4A 2PGAA 2RHHA 4G0VA 4JYZA 3ORYA 1BDMA 1RYFA 2VUIB 1A71A 4QU5A 4TUYA 4ZEXA 3RNOA 2IS4A 1WL8A 4LW8A 3ZWQA 3ENKA 3HWWA 1HE8B 4F38A 1Y37A 2WU4A 2L17A 4UTPA 3ETGA 5L4NA 3FTDA 4BO8A 3NWOA 1H2HA 3JWJA 4UQOA 2IFTA 5AT1A 1OWLA 2PH7A 5FPTA 4A16A 4EW1A 1K06A 1Z47A 2Z8ZA 5D01A 1SOVA 4Y2YA 4CV1A 2XVZA 3ESDA 1SCJA 2AMLA 4HFRA 4M7WA 2C29D 4P7GA 2NO4A 1V6CA 4WWHA 3THYB 2O48X 4JLBA 1O97D 3AETB 3P0EA 1NF3A 4OQ4A 4R51A 3FHJA 4DIDA 1BO6A 5L3QA 1AY0A 3VTFA 1GZ6A 2PVSA 1XDSA 3OZAA 4G4SO 1VRVA 3F46A 3NS7A 4K9KA 2VDVE 4ZRNA 5EWLA 1FTGA 4FFDA 3E3AA 1W4RA 3TD9A 3MMNA 4BWGA 1PVDA 1Z06A 5A4FS 3NIDB 1QORA 1H2BA 4NCIA 3SFZA 1PVOA 1OAOC 3OD1A 5ALFA 4RGBA 2HGZA 5GV8A 1N6IA 1V4BA 3QXSA 4MI9A 4O4IB 4XCXA 4U9IS 5TS2A 4GBMA 3V4SA 3V6MA 4CQLB 1PWZA 4DM4A 1VCNA 1U7QA 3WG9A 1E9VA 4HWKA 3V1NA 2CYCA 2FPLA 2HBZA 4MUFA 2GEDA 2Z6QA 4B8ZA 4OK6A 3VYSB 2V74B 2XCUA 2WD7A 1IN1A 3WQRA 1ZY2A 3NBYC 2J4FA 2NN3C 3GJSA 3KL4A 5GGXA 1PJSA 5IDYA 3IKVA 1X7WB 2ZZMA 3EZ2A 4OAPA 4UAJA 3RH0A 4U7TB 1CS4C 3MCUA 4CLOB 3K70B 2I4RA 2VYVD 1GV0A 1T5LA 5HOQA 2R25B 1P4SA 2YL2A 3QF4A 3QK7A 4Y2GA 3WHKA 1MHTA 3C8DA 3AUKA 3CRQA 4LZAA 4RZSA 2CFSA 3E5HA 4FHFA 1J0CA 3PFGA 1E7SA 3R8XA 1T8UA 4YRPA 3S2UA 4YWJA 2Z2IA 1M3SA 1ISRA 4OQEA 1G2IA 3G2JA 3WB1A 3CH5A 1QLHA 1QNLA 4WZAB 3V3KA 1VIYA 1TM2A 3ZTYA 1Z6YA 1DMSA 1KYXA 5LZ4A 2QGFA 1Q3TA 1RVDA 3NOXA 4UNQA 3FVVA 2BCJQ 1QO9A 1JH8A 2YIVX 1RXSA 4HYTA 4NOJA 1K6MA 2IZZA 2W2MA 3QOWA 2FWAA 4LC0A 4Y9UA 1STOA 2OAP1 4J0GA 2ZM5A 4FKMA 5BVHB 2W83A 2OZEA 3ABRB 3TRDA 2NM0A 3U56A 2ASVA 1CUIA 2CCJA 3LY8A 2WG1A 2AFHE 1PYGA 4B3TB 2WIAA 2YYYA 3D64A 1H8HD 1NBEA 4C5AA 1HZZC 1C9EA 1XI2A 5AW1A 2FFJA 4JR2A 1AZWA 1YJBA 5KVSA 4HTFB 3B3GA 1QRRA 3GAZA 1LLUA 1XTIA 5MN4A 1JPNA 1V1RB 4MQFA 1XR3A 4E3WA 1OB5A 2O8EA 2FDXA 1PW5A 4KZKA 1GHTA 1OR8A 2BKXA 2E0IA 2GVNA 2J5BA 3BIXA 3SEQA 3TUJC 1SZDA 3TKYA 1FLDA 3BXFA 2NX2A 4HAVA 3RLFA 4AO6A 4HV4A 1KI6A 1N5MA 2PK3A 1HGXA 3G88A 4GMFA 4ZOLF 2YV2A 1QTIA 4KVFA 3U7GA 2ZUBA 2Q9AA 4KLCA 5KJ1A 4EG1A 2JGEA 4DV2B 2HRCA 5B1DA 3RRBA 3RIEA 4WEOA 4RHXA 4B3MB 4Y2JA 3UWSA 1L9XA 3LUJA 121PA 2HLDA 3DV0A 4XYLA 1KRXA 1DRJA 2XA2A 3MLAA 4LBWA 5EE3A 4C4AA 4S05A 1ABEA 2R2GA 3KC2A 3QMMA 2IODA 3HZZA 3EN0A 3JR3A 2XWJI 4RIEA 5FUXA 5LQSA 4NAVA 4F72A 1ZEMA 2V7EA 1U0SY 1QV9A 4WL0A 2H0QA 3L8CA 2PXCA 5CU7A 1YS2X 4IQ8A 2NLOA 3IODA 2BKLA 4WI1A 5ISMA 2DH5A 2RMKA 3GQBB 1O9GA 1FMJA 3UJHA 4ZVLA 3VFDA 5K09A 2I6XA 4GGOA 2OY0A 1H4VB 2Z5LA 3LT5A 4US2R 3IJEB 3E82A 4XWOA 1X7XA 2WPDD 4W6QA 4YT8A 4E5NA 3WV4A 3NI2A 1THMA 3L0YA 5EWMB 4HQRA 5F1PA 3V8NA 1HUQA 3CWQA 5B55A 2DPMA 1HFKA 2VF2A 4JMPA 3TLMA 3A9TA 4PAQA 5TV2A 2I2DA 3DR5A 4OGGA 2ZUWA 1E0KA 3EQ7A 1FSPA 1CE8A 2F7SA 2A8YA 4Y2TA 1SHTX 3L1HA 4CLRA 4MQMA 1NTOA 1WPXA 3K9LA 3K0EA 5EPUA 1P61B 4R9RA 1FSGA 1NVWQ 3PNVA 2FW0A 1GKKA 3AZOA 2VJMA 1KRHA 3IILA 3MWKA 4NS1A 4OQPA 3EPHA 3I6IA 3COYA 2ZWAA 4FFRA 5E6UB 3HN6A 5L3SB 2C96A 1O5TA 2E7ZA 1D2GA 4CKEB 1SQSA 1B15A 5BR8B 3IE1A 1GAXA 2E6KA 4QOEA 3TKLA 1LKZA 3VR3A 3EBLA 3ZVMA 2PFKA 4I4CA 5FPKA 5IYZA 5CA0F 1CSEE 1JQBA 4LGVA 4MULA 1U4OA 1U98A 1FP2A 2CWWA 3I52A 4QU0A 4BV8A 5AW6A 4DUYB 2UDPA 4WFQA 3MS2A 1SHZA 3QBDA 1P0FA 3L7NA 1KIMA 1XTBA 1QC5A 5GADl 1XPJA 1EZZA 2QRQA 3DPSA 3FCCA 4B47A 3KQUA 1EX6A 2EC5A 3KM0A 2GYYA 3OFND 4Q16A 3WLJA 4F8EA 3IQFA 3WIDA 5JWOA 3ITDA 1IU9A 2GM5A 2QDXA 3GC6A 3PUJA 2YX1A 1SXGA 1VLLA 2YWRA 3ENQA 3AU8A 1BG6A 3I04A 2CXSA 1ZBDA 2C7GA 1QF7A 4K46A 1BIFA 1EX1A 3RYFB 3JQ8A 1AM4D 1XTUA 2GNOA 2QRHA 1AA9A 1HZJA 1U1CA 3FSGA 1AO3A 2V6MA 1G5QA 3NDRA 1TM3E 2OG2A 1XJ5A 2RCYA 3OG9A 4GC5A 1VA5A 2AVNA 1Z3IX 2P78A 2SICE 3AGQA 4IDEA 4QDTA 1K9SA 1M5RA 1T3HA 1U3TA 2FPIB 4RXTA 4YYEA 2FZLA 2WTUA 1NGSA 4TV9F 2FPMA 3M6IA 4XM1A 2A0XA 3E1GA 4TWZA 4TLMB 2XUJA 4D99A 1V5WA 2I5PO 3HLTA 4FLMA 4MO2A 1Z5PA 1B1CA 1V45E 4X1OA 1K88A 1UJ5A 1XMJA 3BSSA 2YVLA 2XH8A 3RUPA 1JQLB 3GEDA 4BFZA 2KS6A 1ELOA 1EVLA 5EVCA 5CPFA 4ER5A 2CSUA 2O0LA 1SEVA 4MP8A 1JYEA 1T5TA 1ZM2A 1G41A 2H1CA 2HX1A 1M1YE 1QKKA 3H97A 1QHEA 1E60A 1PNQA 1SPXA 4XYGA 3GGSA 3MCWA 5FJIA 3SQNA 3QNUA 4KTTE 5CM2Z 5IG2A 4WJLA 4X1KA 3LE8A 1WUJS 2BR3A 3CRVA 3MJRA 2PQ6A 4L5YA 5LXTA 3UGTA 3N8GA 2OA0A 1WUTA 4OXKA 2VDWA 1N6RA 2FQXA 2HIMA 2BRUA 1RWPA 3RF7A 5DOVA 1CZLA 3G2HA 1KQNA 1FCJA 1EDBA 1Y82A 2REBA 3DWFA 5TPWB 3OOSA 2Q0XA 5AVQA 1KZHA 4AKTA 2VP2A 1E1QD 3D0QA 3D6UA 3H2ZA 3PXEA 2F3RA 4AZ0B 3S2SA 4ZI7B 1B4DA 5EZYF 2Z43A 1EGQA 1E2LA 1K27A 3GFBA 3FDZA 3MIIA 4ZV9A 2OGTA 1V6AA 3AV0B 3KKOA 1GCIA 3GLHA 3MXOA 5IT4A 5D8DA 4EA9A 3AR5A 4H7DA 1GG5A 1S8NA 2Y76A 1IHUA 1L5RA 1NU8A 2DPGA 1DO2A 2XV1A 3NXKA 4B7UA 3VVMA 4HDRB 2R84A 5FPSA 5I7HA 1XL0A 2IOQA 1XTKA 4Z9XA 1U2ZA 1Z0FA 1NVDA 3EOAI 3OF3A 2HPAA 1ZAKA 2Q2WA 2QN9A 1YS9A 5AVSA 5C46F 4LGYA 3KTAB 1QZXA 1SUPA 4Q7KA 4L0QA 4HYQA 1KAMA 1TM4E 2W2NA 1QLJA 5JZBA 2H2WA 1XZJA 1L6RA 3SWWA 3QVLA 2Z04A 2Q5OA 5ALWA 2PSEA 4UKDA 4Q7QA 4LFAB 1YQWA 3OOWA 3LVQE 1F1BA 3QFCA 2YICA 5F5LA 3REFA 4EYGA 2JGIA 4XGIA 1BXGB 4JBIA 3SM3A 2YC2C 2YXEA 1SU7A 4NVRA 4E33A 1ZFNA 4EIWA 2JCVA 2GN6A 1JRLA 8AT1A 2OFPA 4NCAA 3H5AA 2I91A 1M6NA 2A5FA 2QLLA 3GROA 3IEIA 4PZ9A 2C57A 5A5FA 4OF4A 3KJEA 4B2IA 2A94A 2EWVA 1OI3A 3IJRA 2WQZA 1L5WA 1T2FA 2FP4A 3FPFA 1X94A 1EHYA 1K63A 3UB2A 1WKVA 2NMVA 1JSLA 4RPKA 1KI7A 1UWLA 2N3ZA 1TAQA 4M9UA 1TM5E 4ZCTA 2BGNA 1H3EA 1M2OB 1WW8A 1IZ7A 2ZTVA 3WYGA 1X39A 1P75A 4R0NA 1KZ1A 8ABPA 4CMBA 2IH5A 2E55A 3R76A 2OQ2A 3LHSA 4FX2A 3UAXA 4ZVQA 4DLZA 2CCGA 3LRPA 5L45A 1US8A 4HGOA 4F2WA 1BJTA 5LZ8A 4EPVA 3BAFA 5LZ9A 1I94B 1TC1A 1BMDA 1T6BY 2VHTA 4C43A 2R66A 3DLIA 2V4UA 3AUXA 4LVOA 2RGRA 1OZFA 1F0KA 3SZRA 1ZD4A 2H2FA 3EMBA 1FBNA 4E2FA 3L5OA 4UUQA 1Y1PA 3HRHA 3ZY2A 4DCJA 3VAZA 2AN5A 4AJJA 3I2IA 4DR3B 1ODJA 5TC4A 2P9GA 2WUVA 3DLTA 3F6YA 2FZCA 4IFIA 4GECA 5A04A 3A2KA 5GONA 3CYFA 3R3XA 3WQSB 4QO8A 1L8LA 4FR0A 4XGQA 1LDMA 2A7XA 4DTCA 3DR3A 1L5MA 2WYHA 3PA6A 3PQ6A 3Q3VA 3UXHA 1QYCA 4GMKA 4C3UA 1EGMB 2OPBA 2ILVA 3PDJA 5CLGA 2CVQA 1KYYA 3A1NA 4LDRA 2IU4A 4ZU1X 5B7GA 3GA7A 1GUFA 3IQIX 2H18A 2CLOB 2O2ZA 1MD9A 3O8LA 4Q7JB 1O5IA 1T13A 3C5EA 1QG0A 4DLTA 2CV1A 1YDEA 4NAHA 5CB4F 2QAIA 4MO9A 2ZUUA 3BH6A 3JYPA 3M9LA 4GWLA 3GJ6A 4MKXA 4DABA 3PEYA 3L1UA 3ZWVA 3HU3A 2Q2NA 1Z2EA 4QDOA 3ZW7A 4ZV4A 1J33A 3WNBA 1XKLA 1TMKA 3KFVA 4KI7A 4BOYA 4X1IB 3Q2OA 1R6DA 5D2CA 5GVRA 3WMRA 2O14A 3EC1A 3ETHA 2AI3A 3PHIA 3W77A 1IYZA 2B1GA 4AK9A 1YMQA 4AIRA 5BN3B 1RRMA 2QNBA 4JJ6A 1JHQA 4BMNA 1M8PA 2XUAA 4MPRA 4P4TA 1PGJA 5FHRA 2NU8B 3ZBPA 4CEJB 2WJVA 3RGGA 2UU9B 1UJBA 1ONSA 3HJBA 4LZPA 1J8QA 4BMYA 1DP4A 1LVHA 2X42A 3I9OA 1KMHB 1WXXA 2IX9A 2GM9A 4QLOA 5JARA 1MB3A 2H3EA 5EP4A 5DP1A 3N2GB 5K05A 5HUJA 1BA3A 1KQFA 1YFJA 1MZPA 2GRAA 3WGNA 5AQEA 3CV3A 5AYVA 2PV0A 2RH9B 3GWZA 3M6UA 1IWBB 4UAUA 5C4GB 2O3TA 3B5EA 1J0XO 3CF2A 3AERA 3FB4A 1IY8A 1MX3A 2G1UA 3F74A 3JASA 3KD2A 2PM8A 3OCZA 1ID1A 2WFLA 3HJCA 4I19A 3U0BA 4BWYA 4PN3A 2XOKA 4G81A 5I9LA 4ZP1A 1O77A 5D00A 4KBFA 1S3FA 4V0LA 1O94A 1XVAA 4YMUA 2AUMA 2J30A 3L77A 3REQB 2DULA 1DAFA 1PJCA 2R60A 4TKVA 1DJQA 3R0ZA 3WGZA 1SKUA 1H6CA 3A6DA 3WOVA 4EHKA 4PLYA 1G64A 1TCAA 1BJRE 1OV6A 1ZH0A 5CW1A 1NBMA 5ALGA 4P4UA 1EK2A 4MIYA 5AJWA 1NXTA 3EIWA 1SXJB 4Z3DA 1MAHA 3ZU3A 5GV7A 5J43A 4E2ZA 4F9EA 4CQMD 2VTVA 3LWZA 4H6VA 3K2QA 4BVJA 3JPYA 1QCZA 3FIUA 1XEWX 4X7MA 3KQKA 1MBZA 1N25A 2ZFUA 4ZAVA 3I0MA 4JXZA 2ZETA 2A0YA 4GYWA 1KSJA 1S7CA 2ZZNA 2YHIA 2EL7A 3AUSA 1KDYA 1FJ2A 2YWDA 3C7TA 1F20A 2JVJA 4CM6A 4EHLA 3JZFA 3EDYA 5ALQA 3KALA 3OPXA 1D2NA 1YDGA 2JLQA 5LIPA 3I0ZA 2FHPA 1PNTA 3ZGOA 2QPTA 5JAQA 2ISCA 1K7SN 2VDOB 4FFMA 2CGEA 3SDZA 1E18A 5LYJA 1ODTC 2ZTHA 4FINA 4M0DA 5K0BA 3U5ZB 1GNPA 3M5CA 3PI7A 4HAYA 2PXAA 4X8MA 1GTRA 1Y7IA 4TYWA 4RA9A 4UNNA 1RTKA 2HJWA 3L93A 3SR3A 2C3MA 3Q9NA 4GICA 2C99A 3DZDA 1OT3A 3T7DA 2BEUA 4UHHA 5C4IA 5KQRA 4JI8B 1S96A 2RKBA 1YR8A 3K4QA 4PLZA 4DFDA 5I48A 1GTL1 2GJ8A 1MIOB 1TK2A 3D7RA 1Q12A 1N9GB 3FDIA 3L02A 5P21A 2IU0A 1HFEL 1ORHA 3HLYA 4QPCA 2B5VA 3ZWBA 1CZKA 1VDZA 3VISA 2PX5A 1C3JA 3K0SA 3BZWA 2ZBDA 3K32A 4YNBA 5J3JA 4J8PA 5A7GA 5L9AA 4FHGA 4B32A 2X5KO 2FUNB 1IM5A 4M53A 4Q4LA 2REOA 1XAJA 4KLZA 1JIKA 2OPHA 3R3WA 3RU9A 1HT3A 4OYHA 4QATA 1GO2A 4S1PA 4MZDA 4UAGA 3RW9A 4V02A 5CK4A 4I4LA 3HSKA 1EJ6A 1FIUA 2J9ZB 3IX7A 3NDIA 1IFXA 2CXRA 3HJAA 4EQZA 1WPRA 2VUTA 4LIPD 1N36B 1AF7A 5FBRB 4AECA 4EA8A 1U28A 3NBUA 5ILQA 4TYPA 4TTQA 3UJ7A 2I55A 3VXKA 2BFFA 5BQ5A 1U3GA 1UFOA 2V7QD 5BW8A 4P3XA 2WWYA 4DBZA 2WINI 3AOEA 2G7MC 4PYQA 2PA3A 4KXFB 2OBYA 4LX0A 2H4FA 1XZAA 1MA3A 3K2IA 2Y3IA 2B4RO 6ADHA 1DKOA 1RVV1 5LA6A 3EMKA 2HQSA 2O9JA 3AJDA 2G9RA 1RRKA 2J3HA 3WLQA 5B3LA 4AMYA 2ZAIA 5KINB 5IAGA 2CKDA 3LGSA 2UVDA 1Q92A 2WY2D 1X1RA 3K2BA 1RW4A 2CFTA 3AVOA 4IX1A 1BRTA 2ODNA 3BG5A 2WAMA 3WLNA 3L7KA 4E5UA 4F5YA 2H00A 3U0VA 3ZDDA 3GFPA 5FHQA 3ZE0B 4NLLA 1ZW1A 2CT8A 2CFCA 3LECA 3D0OA 2BJWA 1TKRA 4HPJB 3B3AA 2ZTSA 4NFSA 5HG0A 4G0NA 4GP9A 5A4AA 3SQMA 2FZGA 2B36A 1DXQA 1WCXA 5EIBC 3ZG6A 5BVGA 5HBGA 3S8MA 4DV4B 1H69A 2NXJA 1J7JA 2IQIA 2O1SA 1C80A 3B5IA 2FWMX 3DP7A 3I9NA 3IOMA 1UBGA 1GRCA 5FUWA 4DJAA 1RRVA 1Z5NA 4RTOA 3ESRA 1Z4QA 4E08A 2VR1A 3RUDA 3FBTA 3MMZA 1C5KA 2VSQA 4BKRA 1HA3A 1NOIA 1X70A 2CYBA 4CHTA 5HKOA 4RC9A 3DBVO 2O2DA 3OETA 2Y1DA 4BNFA 2VJQA 3BF8A 3NHMA 5ESWA 2PUEA 1SAYA 5CIQA 4YONB 2QU8A 1GNLA 1RQ7A 4KFRA 4OPMA 3NC0C 2GZAA 1XWWA 2IGTA 2HYDA 1QOPB 2DFVA 3LCVB 1E79D 1Y48E 3BTOA 1J20A 1USIA 3GT4A 4ND4A 4TX1A 1L7OA 3GWIA 2C5AA 5DTIA 3P94A 5FTKA 1TD1A 4CLEA 4P4GA 4EA7A 3SX4A 5KTRA 4Y7CA 5TARA 5HQ3A 4RQBA 3CCBA 2ZB8A 3P2OA 3NAMA 1WB5A 4IVPA 2YIMA 1NIPA 1YCDA 1ZD3A 2G9ZA 3N2KA 1FP1D 4MUYA 1RXVA 2OECA 2QD2A 3GGJA 4YC7A 5K3DA 5BQPA 4AG3A 3HXPA 4GGMX 3DMTC 4C7VA 3S55A 4LYFA 1I01A 4AYXA 1Y4DE 2XD4A 3E3MA 3HDQA 4F7WA 1RHRA 1C81A 5LQJA 4A27A 1H2YA 3GHYA 1KNXA 1KY3A 3NGXA 2C2ZA 1CUGA 3C8HA 4FFVA 4R2JA 4E6EA 2JI7A 2QPAA 4KXQA 4NH0A 5DV9A 4IUBS 4ZHSA 5LFAA 4JKOA 3L4BA 2YXNA 3EFOB 5LQRA 2EKQA 3K1AB 4J03A 4UDNA 4WY8A 5EC8A 5K0TA 4Z7OB 2I1LA 5TJ9A 1KJYA 1KY2A 1S2MA 2J9FA 4H60A 2XA9A 4MAMA 4MV9A 1ZEJA 5MGNA 2CHUA 4MUIA 2QZJA 2ZI4A 2AVDA 3W3ZB 1N6LA 1T2NA 5JPDA 3L05A 1WCIA 5LLDA 1FB5A 3IV7A 2V0GA 1J06A 1EGVB 4JLNA 4Y6RA 4LF6B 5I47A 5AP9A 1WLSA 4AP6A 5KDOA 4Q4JB 5GZ6A 1Q91A 2CNBA 1UAAA 1NUAA 1MJNA 1YVUA 521PA 4HUTA 4E15A 5HS6A 1BE1A 2JBWA 2W2KB 3ESYA 3IHKA 5JDCC 3DMFA 4A2WA 5JFOA 4TL7A 1I6LA 2CFRA 3AFGA 3U4GA 3Q7QA 3UG6A 2BMEA 1H4TA 1O89A 2IU6A 2OR3A 1JHDA 3T7CA 4K3UA 3SC4A 4W1PA 3L1VA 1IBLB 4N0MA 1V39A 1I5OA 3RYHA 1E3SA 1TT5A 2CNDA 3DBHB 3R5XA 4QUGA 3AVTA 3BL6A 4CU5A 4FMPA 4YP0A 4W8GA 4HWPA 1J90A 1KBZA 2C7VA 4WK6A 5CVUA 5T41A 1L4LA 3C1OA 3QLUC 4DMUB 1A2BA 3QG1A 3IMCA 4X8HA 1W4ZA 1YI8A 2FUEA 4YXWD 1QMPA 2VN8A 3DNFA 3NPMA 3HYSA 4P54A 1AV6A 1D7OA 1JDPA 1WM1A 2EJCA 3AKEA 1ZZGA 4YQZA 2XD9A 4C78A 4N8EA 4BB6A 3ASZA 1KVTA 2XDAA 2OXCA 5CFPA 1L5HB 4AIIA 1DRKA 2HOQA 3ASUA 1H2RS 2GAAA 2RJOA 2X1VA 4UZSA 5EIOA 2WDPA 1OLSB 4S04A 1WJGA 3L7MA 3ZC3A 3VPDA 5B6JA 5MGBA 3EZYA 5G3YA 1Y5IA 4AVYA 4K1XA 3CXUA 1QANA 1XELA 3AUJB 4GOMD 3D8RA 1K4KA 1M83A 3NTUA 1LB1B 1HT0A 3OPQA 2LUOA 1P1BA 5T4EA 4I50B 3WNQA 1B7GO 3F6BX 1YHYA 1ZM7A 3NTLA 4IMRA 2PKRA 3NM4A 4UFNA 1QP8A 4NESA 3ZLBA 4RS4A 1LW6E 4ISCA 5B57C 4KN5A 2YYAA 3UBTA 4IINA 3E9ZA 2H5JA 4PNHA 2W8ZA 4M1SA 4KJZA 4KITB 4RVOA 4WOBA 2FLVA 1P7PA 1RYBA 4R98A 1Z6QA 1R37A 4UM9D 4WXEA 1H66A 1N6KA 2O2CA 3LHFA 3PYXA 1ZX1A 4CUZA 3NYRA 3S5UA 4L3WA 4EHFA 2VAXA 3DBRB 4X44A 2B94A 4S1WA 4DEYA 1IBMB 1UFRA 3MWGA 4Y9TA 1UK7A 3F6PA 2JBAA 4N48A 4QBIA 4XIFA 3V1YA 5DNCA 2O2EA 2X6TA 1NURA 4YA6A 3RTEA 1GDTA 5U1PA 4MQEA 3HCEA 4TYMA 1E9FA 4NYJR 1QZ3A 3VPCA 1Y42X 3DMHA 4HQOA 4QO7A 1O6GA 3QLEA 2VCHA 2D1TA 5ALPA 3L84A 5TS3A 1XHFA 3Q1KA 5K3BA 4UHBA 3UV3A 2V59A 4HZGA 1THTA 3EQ9A 3F9IA 4MINA 2ORED 5DRYA 5KUTA 4WT7A 3FTQA 4WTOA 5ES3A 3UK2A 3R7SA 2F3TA 1T0IA 2PKWA 2XNHA 3E22A 3KKZA 3RTGA 4ND1A 4MR9A 3AG6A 1ZUWA 1M6WA 2OQIA 3B8HA 3FFBA 1W581 2HMAA 3HCPA 3PR3A 1OLOA 4KQHA 4BNDA 4DMLA 3UATA 2IPXA 5CBPA 2E85A 2GPSA 1E2JA 5CNMA 1M34B 2GTPA 3HO1A 4NQRA 4YJFA 3CZRA 2QG9A 1PUJA 2VNIA 2CXQA 3H9JA 3G0OA 1OGYA 5ECYA 2VK1A 1HNXB 1VZ3A 1U2DA 2H06A 3RVSA 1OYWA 1CR0A 2WTXA 4DNFA 4AWXA 2J0SA 1GDDA 1NJ6A 4K81B 3I62A 1P91A 1ZK0A 3IE0A 1QGED 1TO6A 3GEEA 1GCOA 3BMXA 1DZ3A 4RDHA 4C7BA 3PQ8A 4PPQA 1CB0A 3ICEA 4RJTA 4QJ3A 1VE6A 1EX7A 3T3HA 4D0GA 1MO8A 1QCYA 3V00A 2Q3JA 1T1SA 3O90A 3UK6A 2VZLA 2W6JA 3LK6A 3GNLA 3I58A 2I78A 2YHUA 1SKYB 3ZEAA 3X1ZA 2WZCA 1VRWA 4QUKA 1UDBA 2JD1A 4RV5A 4IJWA 4Z51A 2H8KA 1KO4A 1Z4MA 1PR9A 1U8UA 5JWRA 1E0AA 4FM9A 2ZJ0A 4ZVOA 1MT3A 4I3HA 1N0WA 2BUBA 5G4KA 3UFXA 5KYNA 1DQZA 4LPKA 3N0XA 1A1VA 4HC4A 2DR2A 3N0WA 4YRBA 1NMZA 2AW5A 2IDMA 2AZTA 3AVYA 3M4JA 4DHEA 1H2WA 1RAEA 2ACKA 2PHZA 2UZ1A 3OPYB 2HLPA 3IVMA 2FCRA 1D9XA 3OTHA 2YMPA 5YASA 2JJYA 4C7OA 3L4KA 4GKJB 4HT3B 1IM8A 4ZHQF 3WRYA 2HREA 3BH0A 3IIEA 2BFEA 4MWBA 4RZQA 4GSYA 3T9EA 4ETMA 1EXWA 3O26A 5ICEA 1S1MA 1CY7A 1SBZA 4M37A 5LSAA 3O2NA 1U4NA 1JJAA 1XZKA 4GLOA 4P9NA 5AD1A 3CTPA 3HA7A 2C2WA 2W4MA 3HO8A 4QPDA 3DAPA 3I9LA 5F1KA 4ZKDA 1G16A 3O1IC 3AVXA 2EWWA 1Q0RA 5ARBA 5CLIA 1GRNA 4X6YA 1T9GR 1Q95A 1KAOA 4UEKA 4HUQB 4YALA 1WDWB 4YQEA 4DDTA 2QRGA 4UVIA 1XQ9A 1LK7A 1UJ4A 4PV7A 4LXHA 4Q7LA 2ESRA 3CH6A 1UJMA 1RP7A 3SBXA 1G8AA 4DR1B 5L7YA 2D8MA 2VJYA 5AVOA 4JVLA 5CXUA 1XEAA 1LVGA 2V55B 3H9GA 1UDAA 4RF5A 2IEBA 1JTVA 4CMGA 5K8UA 4S24A 3B1JA 2PO7A 4ENPA 2NYRA 2HHCA 2IHKA 4LZJA 5FBLB 3IBYA 1YS6A 3N6VA 1KDZA 3LWDA 2JLSA 1EGAA 3JY6A 3Q98A 2H4HA 3NBFA 1DKUA 5CAEA 1SUFA 3PEWA 1XJQA 1MHPA 1CUJA 2FFRA 1LDYA 1GCUA 2YN2A 3AF4A 2EJTA 4HAWA 3SX0A 1PE0A 3EFEA 4LOLA 1VLJA 2V9CA 1UMCB 1MU0A 2Y93A 4JJAA 1XTVA 4G6ZA 2CDBA 4J94A 1RR6A 4G1VA 3K71B 3KQYA 5LNK1 1KERA 2J0VA 4RZUA 1YZTA 1G5HA 3IT2A 1QIJA 3OJOA 4Q18A 4RZXA 2VHEA 3BL5A 2VNAA 1E2BA 2L69A 2QRNA 5BWBA 4CDMA 4D2IA 4FS3A 2ZSUA 5JEDA 2ODWA 3JZAA 1V11B 2IV2X 1AJEA 4WNAB 1XNJA 1CDDA 2C07A 3HFGA 1W4AA 2PSHA 3DMRA 1NW8A 1ECJA 3EVBA 4JNCA 5AJTA 5FT9A 3VH1A 4DB4A 2XUZA 4GVLA 3OECA 4FFBA 2F1HA 3KJNA 1MC4A 4QL3A 5B1IA 3RFCA 1V9CA 5EJ6A 4Q4AA 2EXXA 4O2AB 1L5ZA 3TM5A 5P8WA 2QGZA 4EJ0A 2CVHA 3UKJA 1XU4A 4L3OA 4TTRA 4JBYA 5FOXA 4V1CB 4B7ZA 3BMOA 1A5ZA 4TTPA 3JCZA 2YZMA 1L7NA 1O96A 2GXSA 1COWD 1JJ7A 4IDBA 1VGVA 4N4AA 1F8FA 3K5PA 1HTBA 5TQVA 3WDMA 4P5PA 2PSJA 3QELB 3CVJA 4HDKB 1IONA 1UEJA 5FBHA 5JVDB 4YECA 2WYVA 1M7GA 4NC9A 3TOVA 3FSJX 3DL4A 4GDFA 1H94A 3MD0A 4EHBA 1A98A 2GPJA 3WK5A 1T9ZA 3LDUA 2IUUA 1OLUB 1QVVA 4MS3A 2PQ0A 1IQRA 2QTVA 4BO0A 5DNDA 1E4EA 4PFQA 3RC9A 1GVHA 2VP0A 1AUVA 4X91A 4RK0A 4XLTA 4Z5XA 2MWMA 1YS1X 2PG3A 2KQUA 5FBZA 2P4UA 3AEUB 2B7BA 4Q1AA 5AR1A 1VE1A 1E3LA 5DXAA 5MF6A 3CS3A 1R6XA 2R6JA 4CMCA 3QWAA 1GAQA 3EGVA 4L73A 2A9VA 2IUTA 4DG8A 2ILTA 5JG7A 3DT6A 1TJ5A 4B0OA 4QG7A 3P0IA 5KSPA 1P31A 3H8VA 1Z6TA 4RPCA 4U5XA 4Q6WA 2ZUSA 3U4QB 4JX9A 1NYLA 4GMGA 5M3BA 4D25A 3JQ6A 3P9IA 3R4CA 4KWIA 3NBAA 4OUDB 3IOCA 5CDSA 1M1UA 2Z3WA 1YB2A 3QFHA 4E07A 4BAUA 1Q1AA 4L85A 4RV4A 4WLVA 1D6NA 1VMAA 2A3RA 3AFIA 3FGZA 3G79A 4MR8B 4AURA 4MW1A 3KZVA 3QTTA 3IEMA 4HNAB 2POQX 4GP7A 3NYWA 4C4SA 2C94A 3T0FA 2I7CA 3C6ZA 5JD5A 2FMTA 3BICA 3UV7A 4QUEA 4EPRA 1ODFA 4LF7B 2JFPA 3IIJA 1N2BA 4L74A 3NHJA 2IYUA 4OHZA 2WD9A 3NT2A 3PVZA 4CV2A 1XDDA 1HLFA 1N57A 3Q5GA 1A82A 3PJGA 2GZMA 3GV0A 4WMLA 1QG2A 1IOZA 1UOPA 2QQFA 2VCYA 4JLJA 1WD7A 3D02A 3BGOS 2UYOA 5ELLA 2P3OA 1W5EA 4IIGA 2B20A 2P35A 1MVLA 2DXIA 4A8PA 4KI0A 1JNXX 2GETA 4C0BA 4XJXA 3VR1A 5E9AA 7YASA 4TLEA 4TMKA 1NDQA 5I6DA 1ECPA 2HA2A 5KSZA 5SY6A 4EJ6A 2CDRA 3EAGA 5K0FA 4P53A 1J39A 2NVBA 2QZZA 4WFIA 3OCYA 1ZOLA 2FV8A 2W4QA 4PGHA 4UUNA 4MV0A 1OZHA 4CKCA 3WGIA 2QTLA 1W19A 2V9ZA 1EH5A 3KPYA 4L22A 1FDVA 5E95A 4EPXA 5KTMA 2VP4A 3ICOA 4A82A 1XCOA 1CUDA 4GR9A 3LQ2A 4ACBA 3PQ5A 1A9SA 4CRWB 4EI2A 1V9LA 2VYVA 1NQOA 2FEMA 4RMIA 3WK9A 1CC1S 3IDFA 4KIWA 4E30A 3ELUA 1HLGA 2P9EA 2JIBA 4DPKA 3SIRA 1Z9BA 3RRMA 5A4IS 3D3JA 3OBIA 5KC9A 4NRDA 1Q0TA 3VKHA 4PRKA 2ZJ8A 3HVJA 1NJGA 2V0NA 5BT8A 1ZD5A 2RK4A 2B34A 3E05A 4HWRA 4B9EA 1X7YB 2FPSA 3WFIA 4B75A 1C9NA 2ZBVA 5DNUA 2WZQA 1DCMA 1FVHA 4HLUC 4HLNA 4R2XA 2VHQA 4LHXA 1XV5A 3O9MA 4GX0A 2IYEA 3HBMA 3VPGA 4DG9A 5F3RA 1QU3A 3P9YA 4LMRA 3BFKA 1V9SA 4QJBA 1RIFA 2F1KA 3HYRA 2EZ9A 5CD9A 2HMSA 3WNZA 3W9BA 4GP6A 4QTUB 5IK2D 1ES9A 3PJFA 3PQ3A 4QULA 2B0JA 3QUCA 4ZEMA 1YZFA 1A9PA 4FHZA 3C3CA 2QENA 2IEYA 3FHTA 3OQHA 2ZI5A 3OP1A 4PIMA 4A8TA 4PHGA 4FEYA 2CLFB 2FX2A 3BRWD 3FHCB 3OJEA 2NU7A 2IHTA 2ZE8A 4QICA 3EX7C 2X8AA 1MN6A 4M0FA 3ESBA 4ZYTA 1FP7A 2ZYTX 1PV2A 3I2YX 4BDSA 1B42A 1H8HA 3OPMA 4NOKA 5A1JA 3ICPA 1PR0A 3O1JC 4YFYA 4E7PA 2W9XA 1P7CA 1RJ9B 4Q9IA 2BFDB 1PSZA 3HI4A 3Q12A 1M5TA 1IHPA 4EJ2A 1DX6A 2GF0A 4YN3A 5GMOA 1P0MA 2IZ0A 4G25A 4D4IA 4U5QA 1CXZA 1E3TA 3A3OA 3ECSA 3DVAB 1QUEA 2ZRJA 2OXFA 1IEVA 4ZMBA 1JTEA 1XD8A 2BFNA 3WLKX 4ZPXA 5EIWA 4NXMB 3PU6A 4QDZA 2GZ3A 3GZNB 1JVBA 4Y2UA 1Y89A 1RAHA 1NVKA 2FUCA 4RABA 1NT4A 3R9KA 5KNDD 2JAPA 4D02A 4DV5B 5TMEA 1U81A 1Y8RB 3GP8A 3JR7A 5LOVA 3ZD7A 2BZ1A 2YZ7A 3WLLA 5C8ZA 4RJJA 5JJIA 5C1IA 1Q7EA 1G7RA 2QP3A 1FX0A 3A6HA 2Z9CA 3NCHA 5ALXA 4C0XA 3MTJA 4OFBA 2NVWA 1NPYA 4W7IA 5BN4B 5REQB 2CD7A 1TT7A 1KZ9A 1VDMA 2J4CA 3CN9A 4JP3A 4Y2XA 2WMYA 5TGDA 3WHLA 1LBSA 4Y2SA 3DMDA 3VYWA 3BWVA 1Z0DA 3ELDA 2C88A 1BWRA 3OMXA 2GJ9A 3Q7PA 5F2NA 5HKBA 3L9WA 2HA3A 1Z5VA 2ZWVA 2QJFA 1JEYA 2EYUA 2G17A 1J9GA 2JNWA 3PUIA 3S7TA 3AONB 4XTCS 3IPYA 1LGYA 3U44B 2WPDA 3DAYA 3K70C 3PXAA 3VOBA 3G5UA 3RANA 1N0UA 3VTAA 2HK9A 3N2ZB 1FVFA 3TH5A 5EJAA 2PKXA 4C6HA 4UC0A 3QI7A 3SN6A 3L3BA 4E0BA 4KIFA 4MUEA 3AW9A 5LMZA 5EFZA 4M38A 1YAJA 3S1LA 1PEAA 1U9YA 5ALEA 4E09A 4OGFA 3WJ7A 3RIHA 2HNBA 4R1NA 3VHXB 1W1UA 3SQOA 1OBFO 4TV9A 2HGSA 3QE9Y 1JDSA 4EKEA 2VPYA 1WDKA 2OHOA 1PGOA 3QE0A 2CXXA 4L2IB 3KO8A 3MBOA 4TT3D 1W52X 4EG3A 3RC2A 3V6LA 3MJSA 2YVQA 3KQQA 1ZWKA 2ZGVA 5JSHA 2O8DB 3AT1A 4U63A 5JNLA 4B6SA 1APBA 3OEHA 3LK7A 1OFHA 3CR7A 3NYQA 4BMPB 3DKIA 3UJ8A 1R8QA 4GLLA 1JYSA 4OK3A 2B0CA 2FG6C 1PQWA 3LPDA 1NVTA 2VK4A 4L0DA 3UJPA 1PYDA 2G07A 2VDJA 5G3ZA 5I9NA 1OXBB 5T4BA 1K68A 3DZKA 2C9YA 3KOOA 3NASA 1DARA 1ZA2A 3NW9A 2C4NA 3OSUA 2EP5A 4HATA 4NYMQ 2OYCA 1C0LA 1RC1A 2NADA 2NQTA 1M2FA 3EWSA 1SFRA 5AI9A 1B0PA 2XBUA 2Q6VA 1XJ0A 2GCGA 1BS1A 4WBNB 4DSAA 3N70A 2XRMA 1TD9A 1EVZA 3BEOA 2AQHA 2HJVA 1EUDA 1WE2A 4IUYA 4YT2A 2O8FB 4C7JA 2MU1A 2OM6A 3CN7A 1KBOA 5LLSA 1C7JA 3CPSA 3SC2A 3QKRA 1M2VB 3V1UA 2CNOA 2HMTA 4MDHA 4S2EA 4PPYA 1PV4A 2GA8A 4EO7A 2AXPA 1DTWB 1V35A 4YUYA 2EV9A 4TLLB 2ZYIA 3TRIA 4P0TA 2RIRA 1NY5A 2NZ8A 2QL9A 2ZT5A 3DGEC 3UOAB 3WL5A 2QMEA 2A0UA 1A8QA 1M6VA 1ZM3A 2JLXA 5I9TA 1NOJA 3EGCA 3FSRA 4DSNA 1VE7A 1V0JA 3N53A 3B85A 1BCRB 1LU9A 3IAFA 2CEAA 1CBUA 3FPLA 4JA2A 2IV7A 5JBIA 2HD4A 4IDGA 1QQAA 1GSAA 1O0SA 3NWEA 5BSEA 1OW3B 3ANLA 3VDQA 5FYDA 2Y27A 4XARA 1ZUNA 2YC4C 3ANYB 4PM4A 4Z4CA 1WX1A 2VAPA 3RS7A 2PCLA 4D7AA 3N6RA 1QYRA 2BHSA 3DDZX 4JLDA 5EKTA 4A03A 3FX2A 3U16A 4MAFA 2HB6A 2YMLA 1U63A 3PNPA 3CZ5A 1NFFA 2FPUA 3K9GA 5ALZA 2WE7A 1PK8A 2CBGA 1CJVC 2FPOA 2ECKA 2H2IA 4M8NE 4CKBB 3BGSA 2B2CA 3W2HA 2QUAA 2WU3A 3IHLA 3IP3A 3FPJA 3NEPX 2AQKA 2J3IA 3GFVA 5C31A 3DD1A 3WY9A 1S7GA 3SYRA 1KJQA 2W6QA 1Q7TA 4AY2A 4P34A 3RUEA 1E1QA 4EUSA 1HNZB 1WXHA 1LI4A 3C7CB 3FYTA 4O08A 3UWPA 2Z6AA 1C8BA 1Y80A 2C7BA 1EB8A 4B3RB 4L8YA 4MVJD 1DJLA 4TV8F 4BNHA 4LQDA 2XNDD 1EE1A 3PUKA 3WWDA 1V3UA 3WZ2A 1ZH6A 2CD9A 3IMEA 3EPJA 2C8VA 2DTDA 3GRUA 3W5VA 5JSFA 5DXJA 2C0CA 4X3CA 3ZHOA 4H7IA 5CIYA 4WXYB 2HZBA 3G49A 3W5UA 3RAPR 3GBPA 4UASA 4C0WA 1P8AA 4XJSA 1GKUB 2C2MA 2IBSA 1C30B 1MQAA 5LZ5A 4KACA 1M6YA 1VPEA 3EGDA 5BNFA 3TPCA 1ACLA 3I23A 2XYQA 4MUJA 3WLEA 2DKNA 1JLHA 5AHKA 2WWVD 5K0CA 2I8CA 3GFFA 4LMPA 3KJFA 2BGKA 3VH3A 4KOAA 2GPWA 1Z29A 1QIMA 3H4VA 4BV2A 2R6ZA 2X8BA 3Q9LA 3PE6A 1H5UA 3CINA 7REQB 1LBHA 2D00A 1IY0A 4Y1RB 3ESCA 3DLPX 1TCCA 1IZ0A 1R66A 4DWOA 4LVUA 1R5JA 3JQ7A 1B8UA 4JVOA 2SCUA 5KJEA 3R7NA 4C6RA 1YDHA 2PRIA 2XECA 3N86A 4L57A 3KQWA 4O4JF 2A9FA 3V8QA 2JASA 3A0UA 4BMCA 3CCFA 3YASA 1BS2A 4LEIA 4LDNA 4YRTA 1F9EA 3RD5A 2KPOA 5IEJA 1HORA 1YF3A 4A10A 2QOEA 1SCUB 4I81A 3PJRA 1QQTA 3LP8A 4RA6B 5C1BA 3MT9A 5J4HA 1VCMA 1YRLA 5HM8A 3IT0A 2TMKA 1QRTA 2Z30A 3NTQA 3DOCA 3HJGA 1A50B 4AF7A 3ESXA 4BLWA 4QQ8A 3WXBA 3OZXA 1DTSA 2CB0A 2YW9A 1ZIYA 2VTEA 1PJTA 2DUMA 1GOTA 3B2NA 5BRNA 2X8JB 3H3JA 3L82B 5DE3A 3CWCA 5EQDA 1BAPA 1K7YA 2AMFA 3RFXA 1Y3FE 4UHKA 2GJSA 5SZKB 3W6OA 3PZRA 2RGNA 4ZYWA 3B6MA 2UYCA 3KZXA 5TB5A 1MABA 2ZZKA 2QSZA 2QX9A 1J70A 3G2QA 3BD8A 4YR9A 5J4KA 3ZKWA 3Q72A 4BZQA 1IN6A 1G21E 2F48A 4P36A 3LA8A 3VNBA 3EZ9A 3ZV3A 4PX5A 4FOLA 4D8VA 2AC4A 2UYQA 4GZLA 4M0UA 1PD0A 4IHKA 1EIZA 1QFXA 1CHNA 5IM4A 1V95A 5BSKA 2JJ8A 1NF9A 2HMWA 4BNTA 1BN6A 1HC7A 1DX9A 5B6IA 4EOGA 4LECA 3VNAA 5F2OA 5BUCA 1VIVA 2MCFA 3E0XA 2P6UA 4AJIA 1Z7EA 4EM6A 1GM5A 3N7UA 1Q6ZA 3T5PA 5ARCA 4UULA 3BD6A 4Z4IA 4B2PA 2KMXA 4JLUA 5F76A 4GM4A 2UKDA 3QSGA 5JH7F 1YB4A 4DY6A 5ILGA 4IIJA 4RZIA 1CQJB 3QUTA 1FMCA 5EZ6B 4LSMA 5FEUA 3O74A 3M6XA 1GZSA 4DMMA 2IF2A 5FFMA 1DEAA 1GSHA 2HTFA 3PKIA 2VJAA 5I4IA 3LBIA 1NP7A 2B4YA 1ENZA 4YCDA 1FLNA 3M9XA 1W29A 1SXJD 2ALJA 3HJNA 3INNA 4HS4A 2BJVA 2VUHB 1P17A 2EG5A 2ACEA 3MOSA 3UJAA 4MV3A 1E7RA 1HEYA 3GZTB 4D4LA 1PTKA 3ILHA 4QVGA 4EHAA 3DT9A 2INGX 3LY5A 1QZZA 4H0FA 1NFQA 4OMUA 4TUYB 3W90A 4Y6OA 2FN7A 3VU0A 5CRIA 2XVMA 3C8ZA 3BJZA 3FLMA 1N8SA 3JQEA 3PFNA 3QVUA 4IGEA 1LPNA 1IL0A 4LVNA 4MJXA 1NZDA 1MAWA 2QY6A 2ZSDA 1GPAA 3CEHA 3M5PA 2RG1A 4HCJA 4M54A 3THWB 3ADPA 1W5SA 3FZEA 4UPVA 5E9JA 3ICQB 4EYQA 5FI3A 1I7QB 5G1OA 4V1CI 1KO1A 1YBVA 4F4IA 1RHMA 1VE9A 1MH9A 3HB9A 3L6EA 4L75A 1Z07A 2P2SA 1LUAA 2A4KA 4G4SP 3JD0A 1JFSA 3HG7A 4HLDA 1FUIA 1HL7A 2QPOA 2GWRA 3NOVA 1T0UA 1T2AA 5EUMA 1QK3A 2O2YA 2R8XA 4P93A 2ZUFA 3E61A 1ZK2A 5A4JA 3TLGB 2AOUA 1C7QA 2R1VA 3OE7D 3FVQA 3IVXA 4ZC8A 3T7SA 4XB1A 3K0KA 4EW2A 1UKAA 3KKMA 2NO9A 3OT1A 4NMMA 3UVEA 4ETNA 1WDMA 5DNEA 6GPBA 1ADCA 3HKEA 4UCWA 4K6GA 4CQMA 1EDZA 3HDVA 4TMFA 4EY3A 5AJHA 3SHTA 5KVAA 3D6JA 1MTZA 1VI5A 3U7HB 4YRJA 1G6HA 3IVGA 1T4MA 4ZK6A 4D9EA 5CPBA 4HWTA 2B1RA 2C00A 3TAXA 3DEJA 1KEZA 4ID3A 1AS0A 4OOFA 3SYTA 3WGQA 1R64A 3FBGA 3VC2A 1M54A 2O0MA 2V9PA 1NBOA 4IGKA 3RUHA 3W5CA 3PXBA 1KSFX 4OHCA 1P9RA 1QAQA 2XIQA 2Y67A 3CMCO 3LC7O 3QF4B 2I34A 4LRWA 4O4LB 2BEVB 3GJTA 1DFIA 2PYZA 3HA3A 4YJ2A 3NTOA 1DL5A 2FSIA 1J25A 3BMNA 3G9ZA 4RH0A 4EZIA 3BIJA 5L51A 3BFPA 3AL0C 2NYAA 2UYGA 2RG7A 1ODLA 2D5LA 2VHWA 3PJDA 1E9EA 1ONBA 5ALNA 2BC9A 2JZNA 2X58A 2WZBA 1YHNA 4EGJA 1TVMA 4YY3B 1O57A 5DI3B 2YDYA 1ZICA 2X77A 3DUFB 4UREA 3C6MA 3SJUA 1R74A 3GB9A 3MUNA 4N5HX 5DWQA 2YJ5A 3S68A 4B76A 1Q3HA 2QLMA 3OH8A 3K4HA 5FOQA 1RM5A 2VHUA 1AIPA 1UP7A 2REQA 2WHYA 3H5NA 3OOJA 5AKEA 2H4XA 2ODPA 1E1NA 3H17A 4BLQA 4F1WA 1TMYA 4JOCA 2LW7A 2QX8A 4G23A 4YP6A 1ACMA 4YV0A 2RHRA 3WWZA 3DJFA 4JODA 2W71A 3FUTA 1QGUA 2CUKA 5GZ3A 2XTJA 1Z0UA 3PXUA 4TS1A 4IL5A 3DAFA 3ZBTA 2YJGA 4JQCA 4P82A 3V4FA 1TUIA 3N0VA 4V3CA 4CV3A 3O1HB 3KSMA 5BV7A 4HHEA 1K92A 1VLZA 4NKRA 2O54A 5BT9A 2XGSA 1GJRA 1R00A 3B5JA 3M49A 4Q1DA 4OQFA 1ZJYA 5AMXA 3SD7A 2NVUA 2V7QA 4FGKA 3B1XA 4QNNA 5AJYA 2NV0A 5DT9A 5EMJA 5ELMA 1F8GA 3ZGVA 5EKDA 1FNBA 1DSSG 4IG4A 4MQFB 4ZIRB 3ELWA 3PFKA 3VH2A 5JZ9A 1KEUA 4BFYA 2Y1GA 4KUEA 1XRQA 4DSOA 2OQRA 3ASVA 4WCVA 2GN8A 1GL6A 2QM3A 4ZVSA 2QBYA 4LXIA 4MCIA 2HL6A 4PSAA 1PDOA 2WVHA 2EGGA 3JD2A 4AJLA 2DWPA 2ECPA 5F52A 1CIPA 3OJLA 4CL2A 3GVIA 4IDDA 4FCVA 1UPBA 4EKYA 2EERA 2I7TA 4WW0A 5BYBA 1NR5A 3WMEA 1D2HA 3AH8A 3HXTA 3JTMA 4Z99A 5HJ5A 3K6JA 2G06A 1JALA 4LS3A 1C7IA 2KLBA 2NO1A 2OHHA 2XF2A 3V4LA 4BNGA 1J2RA 1MPXA 2R1TB 5AUQA 8LDHA 1FU7A 5JQWA 2CXHA 3O75A 2VUUA 3TLCA 2IC5A 2WM2A 2QTZA 2AEMA 4L4XA 4F6CA 1SKBA 2XE8A 3IFSA 4P1ZA 3PSHA 1N5KA 2YWJA 2IYLD 3H6GA 1Y3CE 1NPTO 5COBA 4ZDJA 3A6GA 4I66A 5LLTA 4FGUA 3SXUA