2YJ6A

Conformational changes in the catalytic domain of the cpx-atpase copb- b upon nucleotide binding
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
251
structure length
248
Chain Sequence
ALSLYEKMLHKGMIIKNSNVYEKIKEIDTIIFNKTGTLTYGTPIVTQFIGDSLSLAYAASVEALSSHPIAKAIVKYAKEQGVKILEVKDFKEISGIGVRGKISDKIIEVKKAENNNDIAVYINGEPIASFNISDVPRPNLKDYLEKLKNEGLKIIILSGDKEDKVKELSKELNIQEYYSNLSPEDKVRIIEKLKQNGNKVLMIGDGVNDAAALALADVSVAMGNISKNVADIILVSNDIGTLLGLIKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conformational Changes in the Catalytic Domain of the Cpx-ATPase Copb-B Upon Nucleotide Binding
rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
molecule keywords COPPER-TRANSPORTING ATPASE
total genus 68
structure length 248
sequence length 251
chains with identical sequence B
ec nomenclature ec 3.6.1.36: Transferred entry: 7.2.2.19.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2yj6A01
3.40.1110.10 Alpha Beta 3-Layer(aba) Sandwich Calcium-transporting ATPase, cytoplasmic domain N Calcium-transporting ATPase, cytoplasmic domain N 2yj6A02
3ONNA 1U7OA 3B8EA 1U2TA 4L6CA 4DW8A 3W5DA 1TJ4A 4UATA 5ALZA 3NUQA 5AKXA 2OM6A 3ZX4A 3ZVNA 4QJBA 3WKCA 5FP0A 4HAIA 2ARFA 2I7DA 2B1RA 4XQ0A 2AGVA 2P11A 2YMLA 1XVIA 4Y2SA 3MMZA 3N28A 4Y2QA 1Q91A 3UMGA 4AS3A 1YDFA 2B8EA 5AVRA 3FVVA 1QQ5A 5AW9A 4BBJA 2EARA 2MU1A 3QUTA 4G9BA 2G07A 3AR5A 4GXTA 3ET5A 4F71A 4BEWA 4Y2VA 3U19A 1ZD2P 3PGVA 1WZCA 3B9BA 2AH5A 2WF8A 3ED5A 3D6JA 1QQ6A 1ZRMA 2JGAA 1Z4KA 2FPUA 1Q3IA 2GHTA 1J97A 3S6JA 3L8HA 4UASA 5AKHA 2DQSA 4KNVA 1PW5A 4EENA 3AR2A 2BDUA 2I55A 2ZG6A 1TE2A 2YBDA 1VJRA 1X42A 3SD7A 1O08A 5IT4A 5AVXA 3R9KA 1Z5GA 2OBBA 3U7FB 3E8MA 5AVTA 4NABA 4C4TA 2ZBEA 5AW2A 1TJ5A 2CFSA 2FDRA 1LTQA 2JAUA 3I76A 1MH9A 2ZBFA 4EELA 2KMVA 4UMDA 3MPOA 2YY6A 2YJ3A 4FE3A 5AM5A 3WK7A 2YN4A 3UMCA 3CNHA 1RRCA 4UAVA 4JB3A 2YJ4A 5AM1A 4CF3A 3ZUPA 1K1EA 2P9JA 5AM4A 1ZOLA 3NAMA 1Z5UA 5AVSA 2ZBDA 1ZJJA 4EEKA 4BYGA 1ZRNA 5AICA 3L1UA 5AK6A 5AM2A 3NANA 3SF0A 5ALXA 2A29A 3SMVA 4AS2A 2QLTA 1NNLA 4FYPA 4DFDA 2BY4A 4YCNA 1NF2A 3FM9A 2YMQA 2IA5A 2X4DA 4BNDB 2C4NA 2IOHA 1N9KA 5ALMA 5E0OA 1EK2A 3A1EA 2ODAA 3N1UA 4F72A 1T9ZA 1ZD4A 1MO7A 1SVJA 2HO4A 1RDFA 3QU9A 3WK5A 2WHEA 4DCCA 2YMPA 5AESA 1S8OA 2YJ6A 5AK5A 1AQ6A 3IJ5A 4BX2A 2GO7A 4Y2PA 5A3RA 3AR3A 4HGOA 3ZW7A 5ALOA 5JJBA 4E88A 1RLOA 2HHLA 3I6BA 4HGQA 3AR7A 3IB6A 1RKVA 4UW9A 4UMEA 5ALIA 2C88A 4RETA 3ZWDA 5AVQA 4UMVA 3ESRA 4EZEA 3I28A 1Z4JA 2GFHA 3ZTYA 1TA0A 3FGOA 2G09A 5AKLA 1Z4QA 2HOQA 2Q4RA 3EPRA 1J8DA 3OCUA 5AI4A 3K1ZA 5AI5A 1Y8AA 1SU4A 1YMQA 2FI1A 2HF2A 1U7QA 3WGUA 2PR7A 2RAVA 3B9RA 3QX7A 1WPGA 1ZD5A 1L7OA 3AR6A 2NO5A 5ALFA 4HGRA 4Y2TA 1RMQA 3QLEA 3QU7A 1Z4OA 2O9JA 2QYHA 4MUMA 3U7GA 3MC1A 5AW5A 3IRUA 3P96A 3KD3A 4EX7A 5AW1A 5ALRA 4EX6A 1YV9A 2PKEA 4NWIA 1RQNA 2I34A 5AI9A 1U7PA 4BX0A 4AP9A 3PDWA 3RFUA 5ALDA 1IWOA 3QU2A 1U02A 3L1VA 1U2SA 1L7PA 3U7HB 2YJ5A 3U26A 1YS9A 3OCWA 3ZVLA 4UM5A 1L8OA 5ALHA 1XPJA 5AM0A 5AVVA 2FPSA 5AI6A 3UM9A 2P27A 3ZWKA 2B30A 2G1AA 3WGVA 5AHXA 2NO4A 4BEVA 2CFTA 3WK4A 1RC8A 2RBKA 1VJ5A 3U7EB 4YIHA 3ESQA 4FFDA 2FUEA 3FPSA 1SWWA 2B1QA 2G0AA 5AW8A 1QQ7A 4KYTA 2IOFK 2WF7A 4ZEVA 2ZXEA 2B82A 3L0CA 2GHQA 1L7MA 5AKZA 1WVIA 3KC2A 3N5KA 1L7NA 2W11A 2IYEA 2PQ0A 2YFYA 2Q4TA 3ZVMA 2B8JA 5AKEA 2HSZA 1KYTA 2BDEA 2G06A 3EWIA 4KN8A 1RKQA 3DV9A 5ALSA 2R8ZA 5ALLA 5ALEA 1RPZA 2FPRA 4J2TA 5ALPA 3HYCA 2Q5EA 1VFPA 3OCVA 5AW6A 4DWOA 4UMFA 1Z4LA 3AR4A 2HEGA 3GYGA 3U13A 4MWOA 3DAOA 3DDHA 1YJ5A 4KNWA 3FPBA 3WK9A 5AIBA 1Z4MA 2O2XA 2FPXA 4ZEWA 4NFLA 3HLTA 1Q92A 3OCZA 4G63A 5A3QA 4Y2JA 3WKBA 3I1YA 1Z4NA 4ZEXA 3OCYA 3L0BA 4UM7A 4C4SA 2D2VA 4Y3UA 1YNSA 2HCFA 5AKKA 1L8LA 1ZS9A 3GWIA 2HX1A 4OFZA 3N8GA 3A1CA 4OCZA 1RLTA 4YCLA 3QUBA 4OHFA 4YIKA 1N8NA 3KDPA 1RLMA 3A3YA 3E84A 3AR8A 5AIAA 2HI0A 3QU5A 3QNMA 4BX3A 3M1YA 1SWVA 1S2OA 1NRWA 4CE6A 3ZU6A 2HDOA 2G08A 3MN1A 3WKAA 5IT0A 4I9FA 2YMMA 1F5SA 2KMXA 5AW3A 3QGMA 5AVYA 3PGLA 5AI8A 5AK3A 4QQFA 5AVUA 2CFRA 1RKUA 2EATA 4JDPA 2EAUA 2W4MA 4HGPA 3M9LA 2IOFA 4J03A 5AKGA 3ZX5A 2NYVA 3CZ4A 5AM3A 3BA6A 2AMYA 3QUCA 5ALUA 2W43A 2R8XA 2WM8A 2P69A 2JAOA 2RB5A 3W5AA 1XP5A 2ZBGA 3ZTWA 4UARA 3L7YA 3L8EA 3SKYA 3TLMA 4B6JA 1LVHA 4Y2UA 1CR6A 3NALA 5AW7A 3OPXA 5AW4A 3QYPA 3L8FA 5ALNA 3J7TA 3KZXA 2CN1A 3SLRA 5ALWA 2G80A 5ALYA 2A00A 3SHQA 5AW0A 3E81A 5AK4A 5ALJA 2C9MA 3SKXA 3EF1A 1T5SA 4C4RA 3KBBA 1JUDA 3FZQA 2VKQA 2WF5A 2AUTA 4CF5A 4Y2YA 3WK8A 1RMTA 2FPWA 4H1WA 3AR9A 2OYCA 2FUCA 2I33A 2I6XA 2FEAA 1L6RA 1QH9A 3RF6A 4RESA 5A3SA 4IFTA 4GIBA 3A1DA 1CQZA 5AI0A 2WF9A 4XPZA 1RQLA 4I9GA 3L8GA 4XE5A 2JAWA 4PNHA 1Z4PX 2WFAA 1TJ3A 3PCTA 4KX5A 5AKYA 5T41A 5ALTA 5ALKA 3EF0A 4IG4A 1RMYA 2RARA 3WK6A 1ZD3A 4CF4A 1FEZA 3QU4A 5ALGA 3L5KA 3VAYA 1QYIA 5ALVA 4CNQA 4L6AA 4Y2RA 2GMWA 2ZOSA 3N07A 4KX3A 4L57A 1EK1A 5AVWA 3BWVA 3NRJA 4HYTA 4NV0A 3KOOA 2HF7A 5ALQA 3QUQA 3OTQA 3QXGA 2OA0A 3UMBA 4BKMA 3NASA 5AKIA 3WKEA 3WKDA 4YCMA 2WF6A 3OCXA 4O8CA 4UU0A 4BNDA 2R8YA 2MSNA 2I54A 3E58A 4Y2XA 1MO8A 4XOUA 2B0CA 3ET4A 3F9RA 3NIWA 5IS2A 4OD0A 4YGYA 3ZI4A 4UAUA 1O03A 1Z88A 4HGNA 3R4CA 3L0YA 4UU1A 5AVZA 3W5BA 2JARA 1T5TA 1WR8A 2C8KA 1Z4IA 3W5CA 2C8LA 4NAVA 4YH1A 5AKJA 3R09A 2R8EA 3DNPA
chains in the Genus database with same CATH superfamily
2QIOA 1YH3A 3ONNA 2A9VA 3W5VA 4C6SA 4JJ7A 3TQCA 4YJ2B 4GOJA 5FHRA 1WB4A 1ZMXA 2QE6A 1HRDA 1NYLA 2R11A 2Q46A 1X2EA 3IP9A 2AEMA 3WGZA 3ZHXA 5JAPA 3IIMA 3HMKA 3O4RA 4KXNA 3LX8A 1LLUA 1LBQA 3OM8A 4AJOA 1I5RA 4G26A 3WRXC 4B71A 4MWCA 3KJNA 3GJTA 3ZVNA 1P3JA 4BXOB 1G291 3D6UA 1A9XA 5H80A 5BQOA 1DMRA 3QF7A 4C07A 3A70A 4CF6A 4CKXA 3U4HA 1IEXA 3FIJA 1NBHA 2A4KA 4MVJA 1UWLA 2B35A 4C4OA 2Q3FA 5GIPE 1MTZA 1N2HA 2QZ9A 3WDMA 4LXYA 5K3SA 3FCCA 3LW8A 3NVKI 3KQNA 4A16A 4MCIA 3W9SA 4HWRA 5FEUA 1DO2A 1RRFA 3O4IA 1DT5A 3UMGA 1RWVA 2B8EA 4D9JA 4EKNB 5BQXA 4PAGA 5LDDC 2H06A 3HVHA 1I3MA 4OI2A 4QHYA 3IB3A 4QGBA 5EWJA 1Y63A 1OLOA 1UPUA 2QMYA 4NG5A 4F8EA 1QWOA 1YI1A 4OI4A 5FLKA 2OXTA 2PYZA 3GB9A 1GPYA 4UVGA 2C94A 4GXTA 1F8YA 1HL3A 2HA4A 4CM8B 4ZKEA 1QIIA 4TXLA 2IYSA 3WA6A 3RRYA 4OP2A 3EUEA 1RWXA 2FPOA 2QROA 2ZRAA 3C6MA 3W5UA 5TQ0A 2FSHA 3G8AA 2D7CA 4IEFB 1KDZA 5FTLA 2N0SA 4Q21A 3WMEA 1W5EA 1GVHA 3BJEA 1IHPA 4ZT2A 4R05A 4ZA2A 3BDVA 4TT3A 2C5BA 1Q3HA 2JGFA 2EWWA 2VBFA 3LPDA 4LHWA 1JQLB 3F5MA 2ZYAA 4ND8A 5JZBA 4UASA 2P9ZA 3A1SA 1UOEA 2G25A 3G6KA 2DQSA 1P8AA 1VE7A 1MR3F 1Z0JA 1XTPA 3D8BA 2FMXA 3K1AB 4BUCA 4QOHA 3X44A 1Z9BA 5CIQA 2BGTA 5AXCA 1CUSA 2GI4A 4A03A 1F0NA 4CLRA 3I45A 4LF8B 2O1EA 5A5FA 4J9VA 2PS3A 4FZRA 4B0PA 3LSTA 3LG2A 5IAGA 1TO6A 4NICA 5CIWA 1ABFA 4R8LA 1BS9A 2CFSA 2H5IA 4CMBA 3A3PA 2PRZA 2L69A 2YWGA 4EHDA 1NFRA 4WBNB 1JWBB 3OVMA 1EAYA 1FBTA 2JEOA 1U8UA 3HJRA 3P2JA 3HFGA 2JAHA 4JB3A 1G2IA 1TX4B 1M2JA 3HA7A 1OV4A 4IF6A 2V9PA 3DEIA 1NVUQ 4MS4A 5CFRA 1NASA 1Q21A 3UEOA 3LDUA 3PL5A 3KV3O 4RZUA 1JJIA 2Q99A 1G0NA 4N0QA 4J4TA 3OHPA 3GLGA 5FV7A 4F96A 1XPRA 1W0CA 4G36A 3TRIA 3I39X 4V0NA 2IDJA 4NCNA 3PVCA 4YYEA 4IOMA 1AZTA 5L8VA 1S8NA 2HUPA 3KSZO 1FSFA 2QTGA 3I6YA 1VE5A 1K0FA 3WHIA 2XB9A 1E7SA 4D41A 2P4EA 3FW1A 3D2CA 2II6A 1IOLA 4Q1BA 5B3AA 3FDIA 3Q9LA 4PZ0A 5IJXA 3VZDA 4X45A 2QLTA 3R8CA 1NNLA 3UJ7A 3ELBA 3V4LA 1I32A 2CSXA 1YRAA 4OQQA 1D8TA 4TV8F 1HG0A 4RIGA 3DVRX 2KE5A 2COUA 4ZI7A 1WQ4A 1FRZA 4ZALA 1OAKA 1FYEA 3UHPA 4BNDB 4EBBA 5KO2A 4IP0A 4MKFA 4DOMA 5FH9A 3CR7A 4HC4A 5DHAA 5H83A 4JT2A 1SURA 3FH0A 3N0WA 3C4VA 1XDGA 4RM2A 5KOYA 2JEYA 5G02A 3LGXA 1T9ZA 1UODA 1CWUA 1RDFA 3RU3A 3EK2A 1S8AA 4N03A 4PFQA 3VR2A 3WK5A 2OQVA 1I6LA 2IGTA 3NBMA 4EVIA 2B78A 2BEWB 2H48A 3C1AA 3IJ5A 2CNWA 2G7ZA 1SA0A 1Y1KE 1GG2A 2CLLB 1UIRA 1DOAA 1E69A 2J3JA 1XDWA 3C7CB 2PKRA 3WGYA 1EUQA 5ALOA 4NESA 5ANRB 2IV7A 5AHOA 2GD2A 3RVBA 3U9TA 5J2UA 4DQVA 3JVVA 1LBSA 2FR8C 3GVHA 3KJEA 4FDAA 3A9TA 1II8A 2WPDA 3WL8A 3FFXA 3HYTA 2VO1A 2BN4A 1E1YA 3DHEA 1PKEA 2FWMX 1BH2A 1QZUA 2G04A 1VSTA 2PS0A 3ESRA 3THWA 1IDOA 2GZDA 4ZP1A 2R6AA 4M98A 4PIMA 2QSYA 3OU2A 5CDSA 1AOXA 1PO7A 5DOZA 3JYPA 2Z9CA 4TSKA 2F9MA 1EVEA 1SEPA 1W0JD 4JR1A 1SU8A 4RM3A 4N5LA 4C0HA 4J0IA 2P30A 3ERCA 2CXNA 3D81A 3EASA 3M49A 4HUTA 4FGKA 1U8TA 3TTYA 4PXAA 2ZDGA 1GTVA 4KAXA 4L8WB 4Q12A 3KT0A 3ENVA 3W1VA 1YMUA 3CZCA 1J8VA 3ZD8A 1MRSA 4MW0A 4BEBA 2PR7A 1IHUA 3K4HA 4PLZA 1ZCBA 3B9RA 4HNTA 1ULBA 2P0EA 3B82A 1VBKA 3ZQUA 4MQEA 4R6WA 3R0VA 3UZUA 2XEDA 1YMVA 2HNAA 2MYTA 1H23A 4KQ2A 3VKVA 1OR8A 1VB5A 4B32A 5CH3A 1KKLA 1KMHB 3LYAA 4N65A 1YO6A 1WRBA 2OSVA 4B6GA 1QFXA 4MDYA 4NOJA 3GNTA 3Q8XB 5ALRA 1UZAA 4R1MA 5K3DA 1OZFA 1ZW1A 3FCUB 1KYVA 5BUCA 3F2IA 3SFZA 5FQNA 4EF6A 4F4JA 5EJAA 4KOAA 1UP4A 4RTOA 3TMYA 2ZRJA 3W34A 2VZEA 2YWJA 5ERGB 2WWXA 2V3CC 1A5ZA 4D3FA 3ZY4A 4FOPA 1P2TA 4MQLA 3ZZUA 2IFTA 4F97A 4HNHA 1FTSA 4L5IA 4IPTA 1TAQA 1ES9A 1E3EA 4ND3A 2J30A 3COZA 1MQAA 4FB5A 4YJGA 1DC7A 2D0DA 1H42A 1Z29A 4RGVA 1V8FA 4KAJA 2FP4A 2XMGA 4BO8A 3BXFA 1Y3DE 1ECPA 2G1AA 2JD1A 4MRNA 3WGVA 1FMFA 2NO4A 3OURA 3U4MA 1M1YB 2X0RA 3OZUA 2X86A 2PGNA 4D3DA 1JDZA 1XMXA 1NW9B 1M1YA 2EFHB 1NW8A 1HYEA 5KC9A 2ZWOA 2QT9A 3KSBC 1EIZA 4B44A 2IWRA 4A2WA 3COSA 1TW2A 2B4KA 4QYWA 3S2ZA 5D7NA 3EQ9A 2YYSA 4XJTA 4YIHA 1KTIA 1G42A 2VSOA 3V7FA 3GRPA 1Q20A 2O8FB 5HJEA 1HDCA 5CVUA 4BQEA 1QHEA 1U4SA 3LCVB 3EUAA 5IJZA 1QP7A 2VQDA 4J1TA 5EP1A 3LDHA 4G5SA 2IOFK 4RXMA 3SMQA 1UFRA 1UAGA 4TZKA 3VMMA 4N0MA 5DN6D 1Y8QA 2EP5A 3WLPA 4TN5A 4DSTA 2WLSA 5AKZA 4DXDA 1UZUA 5KSOA 5I4BA 2Z58A 1SPXA 2IYEA 1VCHA 3S5JA 1XHLA 4YCCA 2PCJA 4PRKA 2IZ1A 3EVNA 2JZNA 1VP9A 1XDSA 2ZIVB 5TF4A 1W49A 1B3RA 4LNAA 3BMNB 4ASUA 2B8TA 3C3JA 4CQMA 4ND2A 4YV2A 2OO5A 3WGQA 4M1MA 2AR9A 3SC2A 3V1MA 1M1NA 1S8FA 4NG4A 3EAFA 3QFCA 4NK4A 1OYWA 1VPWA 1D5WA 4HLCA 2FV8A 2Q5EA 3ILXA 5B1IA 3GNSA 3OH8A 3FYUB 1H5UA 5TLSA 1AY0A 3GMSA 4FGZA 3T3OA 3S68A 3MIIA 3EFOB 2UZ1B 3GYGA 2C7VA 2BFEB 4TKMA 1KWGA 2EL7A 3B1XA 3LGSA 4URWR 5HWSA 4ZCPA 1I7PA 1G38A 4CR6A 5C0OE 1B6RA 2ZSIA 4C3ZA 2O2XA 4OLJA 3NFRA 2YQ5A 3OD5A 1D8AA 4BLQA 4G4GA 5GJWC 1NIJA 5EXEA 2CL6X 3O2NA 3A4TA 4OYLA 4PYKA 3OCZA 4J1QA 1XHFA 3LUHA 4M0MA 4EW3A 2BYTA 1SXGA 4R1OA 5ADVA 3CONA 3L07A 2MT9A 2NSJA 3SBOA 3A9CA 1QQBA 1ZEMA 5IKPA 1KJQA 2IELA 2CHGA 4O2AF 5REQB 4DUYB 1U2ZA 1YGPA 4RNCA 1D7AA 3KWMA 3TPFA 2XTJA 3RS7A 2QX7A 4OA8A 2W2LA 2Y1KA 2YWHA 1DE0A 1QYVA 4Y2HA 1UJ4A 1LUAA 1TYEB 5EEHA 1G20A 4ZAXA 3TQRA 5JJ5A 1SRQA 3B78A 1QCZA 4TQAA 2EFGA 1XZIA 3N8IA 3PXUA 4HGYA 2AVNA 2F8TA 4MULA 1WNTA 3PPWA 4JX9A 5P21A 9LDTA 5KWSA 5AP9A 2HRCA 2JCXA 2Y1EA 5KVQA 4E2YA 4MUKA 3M1YA 4BMPB 3UPDA 3E70C 3I09A 4W5RA 1CUIA 4XYGA 3ZWNA 2G08A 1L4EA 1Z6XA 2PRIA 3GZNA 1NBIA 3GCDA 3OPYA 2R84A 2ZJAA 3M6IA 4X85A 3Q7SA 2W6PA 2MYPA 4DTIA 2R1TA 1GQRA 3AYXB 3DOHA 1T3HA 1T3SA 3G82C 1ULAA 4URHA 1N2IA 1JIXA 1F0KA 3EBPA 3IUQA 3A14A 3D5TA 3O3OB 5J63A 1AH2A 1PR2A 1STOA 3N2LA 3ME5A 4RPGA 2IY8A 5ELXA 2FP3A 4EW1A 3P9SA 2UUBB 1C9NA 4MV8A 1NVKA 1KIAA 3IT0A 2AN4A 2Z2KA 4UTVA 4ZZ3A 2JCSA 3CZRA 2ZBRA 4HWTA 3D4LA 4NLLA 4HGPA 2OCBA 3ABQB 4JJ8A 1KMQA 5ECDA 4K40A 1IB6A 3AF2A 4JV5B 2OLKA 5AOVA 2VWQA 4OJYA 3D5EA 4P81A 2R8XA 3VR6H 2CZGA 3NG1A 4DF3A 2G82A 1LDYA 1E3WA 4MROA 2OCDA 3R1IA 5ESXA 4W5OA 4WNAB 2JW5A 1V1MA 3NBKA 2Z2ZA 4KGZA 4MHSA 5E3HA 4W9MC 3OLVA 3R3HA 4R81A 3IE1A 4L3OA 4P2GA 3GFTA 1I3CA 2ZYVX 1OYVA 4HDRA 5BR4A 2ADMA 2YFKA 3K2QA 2V98A 1O97C 1Y3AA 5JG7A 2FK7A 5BY2A 4ZYYA 4F8JA 5C46F 2AI3A 4YUYA 4AY3A 3R0JA 4X8OA 2HXYA 4AN4A 4JKIA 2QNRA 1CR2A 1QYRA 1G8KA 1I2MA 1WQ1R 2QRNA 3GDHA 4M37A 2IYRA 1DIAA 3RWBA 2OL4A 5HDQA 2I22A 5JDCC 3UJAA 3TMKA 1YDEA 4ENUA 3H0KA 4AY6A 4B46A 2HREA 2J59A 1JRLA 2VKQA 2WU1A 2EKLA 4H1HA 4UDNA 4CKBB 1OBCA 1EWKA 2WY2D 4B17A 3X1JA 1VGRA 5KQSA 2OC9A 4JT4A 1IJEA 1KS9A 3MLEA 2H17A 2IF2A 1K68A 3TOVA 3W78A 4AF6A 1T25A 1QVWA 5GOZA 2VHVA 3VM6A 1EH5A 3RUPA 3ZDCA 1O94A 1XDDA 8ABPA 1DZ3A 1KAOA 1Y7TA 4BY9E 3E3NA 2B8WA 1N7IA 3KKKA 3D4NA 5F2EA 4KK4A 3VTZA 2W98A 3ZKWB 4FHGA 1I51A 2K5UA 1UXGA 2QUHA 3OP1A 4G1BA 4GVXA 3VR1A 3W6PA 5AKYA 2CFOA 4F2WA 5GADl 3AG5A 4OSOA 4CHTA 5ALKA 1M76A 4EHAA 2V54A 2WAAA 5A6SA 3JQFC 3TTWA 2OP1A 4TYQA 2P9YA 4ITRC 5TQ0B 3FYDA 4XQCA 4Z4FA 3JVIA 4R9UC 4ZYWA 4W82A 4LHXA 1SIWA 3GUYA 1WSAA 4IXDA 4DA0A 4ZJZA 3O1LA 3UJ8A 5KNCD 3TW6A 2YHIB 4OIFA 2QA5A 1E0JA 4QXRA 4RHCA 5BSEA 2VK2A 3IO5A 1OFUA 1Z2DA 3ROPA 2IC5A 1DAMA 4CI0B 3CLRD 1IXKA 3BBPA 1FSSA 3F1KA 2VJLA 1SK9A 5FWAA 5ICEA 3IDZA 4YJKA 3GT4A 3RRNA 3K53A 4IM7A 3TZHA 1TDJA 4S2UA 4BV2A 1FDIA 1F3OA 1AQIA 2BFDA 4BBPA 2R00A 3RWOA 1FDRA 1HGXA 1V2GA 2PL9A 1OQAA 2MSNA 3OOEA 4BKUA 5HMMA 1JTFA 2D0OB 4KACA 2QORA 4YRLA 2CLDX 3AYZB 3KP1A 3UV6A 4PQGA 1NXPA 3ND8A 3QVTA 4L8YA 2QAJA 4PQYA 3R4CA 4TTTS 2QD1A 2V7GA 5F4ZA 1ZUD1 3CEPB 1UBHS 2A7QA 3A9VA 3BWDD 1RQ2A 4J6EA 2I76A 4X6XA 2H5EA 2IU4A 4Q3NA 1KFBB 4ENPA 2V7VA 2LNDA 2OGTA 3G7SA 3R09A 5IWCA 1YHNA 2BEJA 2F4NA 3PX2A 4TYNA 2VS1A 1Z5ZA 1JU4A 3CPSA 1UWKA 1XZBA 3FBTA 5E6SB 3ZJ4A 1U31A 5GM1A 5D00A 3NDPA 5ULLA 3UWSA 1U7OA 1T5OA 2WNSA 4KR7A 3K92A 3DE3X 3WWZA 1IBMB 4Q4CA 1WMFA 4YWHA 4B3GA 3B2EA 4Q4AB 4FDLA 5T6MA 1CK4A 3AB3A 1AV7A 5THXA 1ZU4A 1DUIA 2XTNA 3FPFA 5AFSA 1NN5A 1MENA 4BQQA 2V96A 4UVDA 3X2EA 4QOEA 4RK0A 3L7NA 5BSRA 2HMYB 3RYHA 1SXJE 2I7DA 4JUFA 4CCAA 1RWWA 5DISB 3PDUA 4EECA 2DT8A 3C3YA 1XU4A 4IKPA 5KWIA 3N28A 1ONBA 5TQ2B 2G9RA 4BC0A 3F96A 5J5AA 4RA9A 4QWWA 5CTJA 3O1JC 3EFBA 4L4UA 2DB3A 1RPJA 2ZIZA 1CRLA 1LSSA 2R79A 5JLAA 3CUUA 3MMSA 3RBXA 4BP9A 3HWRA 3MBOA 3U4IA 3ZE2B 1L0BA 3OLYA 3GLHA 2PLWA 3I0MA 1Q5PA 2ZROA 1L5GB 2YHSA 4AJPA 4PX5A 3U60B 3CPJB 5C8VA 5KOHA 2QLMA 5BN4B 3FKJA 1ZJ5A 4OHCA 3WSTA 4YDQA 4G01B 2GUWA 1XIVA 5CGQB 3LVBA 4OQPA 2R0QC 5FA5A 5JNVA 4JEHA 1MEJA 2AFHA 5DGDA 4DPKA 2QTWB 5AWFC 3OE7A 5BYAA 4MKGA 1K8XB 1V4VA 1V7QA 1PFWA 2X8BA 3GLUA 4KO1S 3ZY6A 1IIBA 1KORA 1MO2A 5FOUA 1JH9A 5FYDA 2IUYA 3EXG1 3SNKA 5FBZA 3H7AA 3MJHA 4KNVA 1JKFA 2O57A 1D2HA 3DS8A 4IRXA 1L7DA 2XD4A 2HIMA 4LYYA 3CH5A 4QJ4A 2XGGA 3I9NA 4XVRA 4J7AA 3ZQ6A 2GBFA 2CXSA 1HC7A 1VDMA 3N2NA 5DX0A 4XUEA 2QZJA 5HRCA 1FS5A 3RHSA 4TZ0A 1Y5NA 3PJEA 2BONA 1PZHA 1DKLA 3L6EA 3E8MA 4HD8A 4MUEA 3ZQJA 1RC1A 2E9SA 2X23A 2EERA 3F6PA 1UBGA 4N7MA 1M5TA 4BNFA 1F60A 1SNYA 1BMQA 2X3FA 3G2LA 1MH9A 1DNPA 2WJYA 3IV7A 2GN2A 1WMSA 2ID4A 4KN6A 2WSSD 3KAKA 1PV1A 3ABIA 4UUNA 5D86A 3T9AA 1DKRA 2PLAA 4MUXA 3VNVA 2QP4A 3WGNA 3EZYA 4LXUA 5MFZA 4C1BA 2HK9A 2QPLA 2CLHB 5WRFA 4GXRA 2G3YA 4G0PA 5IN5A 1V9LA 4EQ6A 5ITSA 1D1QA 4FOSA 5BSUA 1ZD9A 1X7XA 5EGNA 3NCTA 3O9MA 1C3EA 2JCYA 2PZ8A 3E1KA 3FETA 3INGA 6LDHA 5CLFA 2ACEA 1XL0A 3C3BA 3OFND 1DGQA 3T8YA 5AICA 4PGHA 4MR7B 4V0ME 4MVJM 4EP1A 4INJA 5EIBD 1IY9A 5LQDA 4IV8A 2A29A 1W35A 4W9NA 5B6PA 1VHDA 3RTAA 3LH5A 3Q1KA 4OKSA 1NF2A 4TXHA 3VYRB 4N7RA 3V9PA 5FPKA 3B1ZA 4I5DA 4RD4A 2IPOA 5DVZA 3V3TA 3WOVA 4DR5B 1YJQA 5E0OA 2PWAA 1N1EA 4HKTA 4TVBA 4LJ7A 3W0LB 1KK3A 2ES4A 4KB5A 5FL7A 3CW8X 3EPJA 4FSDA 1MC5A 1NC1A 1XROA 2A57A 2ISSD 3HKCB 3HU2A 3OT1A 2ZI6A 3QTTA 5LR6A 1BDHA 3OESA 2RGGA 4EJ6A 4K3UA 1AA6A 2ZJBA 1NLYA 3NYIA 2C00A 4JLAA 3D4PA 3DAHA 3E3OA 4Y6QA 4Q19A 4EMSA 4WBNF 1EPUA 4KZKA 1M0WA 4QUHA 3GLIA 1R37A 3DVAA 3PGMA 1YDMA 4O0MA 3UJ6A 4UW9A 4Z9BA 3MQFA 3WBBA 5JNLA 5DM0A 1DOZA 1E1NA 3NUGA 4D92A 1WB9A 3K30A 5A6SB 3PF9A 4JP8A 4XVUA 3HKEB 1G7RA 1F2UB 4QVIA 3STUA 4AZWA 5FIUA 3K6SB 1KH2A 3GJ3A 2EFEB 4G5FA 2M2IA 4NECA 5B58T 1FP2A 2GA8A 1VRVA 1W87A 4HBGA 1FP7A 2TMGA 4ALIA 4NZYA 2O2DA 3EWAA 1B0UA 2CNKA 3M6VA 4S04A 1KVQA 1JEDA 4DS3A 4IRUB 5F3DA 1YZ3A 3ORSA 5IC6A 1US8B 4JYMA 4ROTA 4PYMA 2FVXA 4AICA 2JLWA 2YZ7A 4UBJA 2HF2A 1K06A 2C4UA 2FN4A 3FRHA 4FKBA 4HWOA 4TV8A 4CG3A 4D74A 2PKCA 3QE9Y 1TVMA 2B2XA 5G4LA 4B4KA 2PSSA 1I2CA 1EK0A 3PUZA 5EKUA 4ADSG 3TTXA 1AXRA 1RSZA 3QELA 4X97A 4Z51A 1ENYA 1P73A 4PYQA 4UEJA 4A5OA 4P53A 4CLHA 1U80A 3D1JA 1N5JA 3DUWA 4M1QA 4GWGA 2C1EA 4R9NA 3CX8A 4UJ5A 2BP7B 3O8BA 4LQ4A 3IRUA 3D9QX 4TS1A 1HSOA 3TXYA 1ZP6A 3UW3A 4ZI3A 3AJ9A 3CG4A 4YAFA 3H1BA 5AW1A 5K8CA 3JTMA 4CTOA 3WFIA 3L82B 1Y3CE 4PF1A 5JTUA 4TV9F 3ZNPA 3L1HA 3EXIB 3P27A 2I7VA 3R0ZA 5JSFA 5H3CA 2WFZA 2ZUSA 1T2AA 1RCUA 3BB1A 5J2UF 1TMOA 3WI7A 2W90A 3RWMB 1RM5A 2QTNA 2FE4A 5IPFA 1UKCA 3UMYA 4YQFA 5HILA 4PAWA 1OLSB 1ECJA 2E87A 5K3FA 1ZXLA 3V6LA 2R00C 3IDQA 4IDPA 1YS9A 4RVUA 5FUQA 4ZK2A 5JD5A 3V33A 1TM3E 4FLEA 2QDXA 4MW6A 2NX2A 1C9KA 3MCAA 5GVRA 2Q4EA 2OFFA 4KOEC 1LK0A 4MOWA 4YDSA 2VXYA 3O4VA 1G3UA 4ENTA 2OYSA 2PGIA 4AN0A 1M1XB 2YJGA 1P61B 1R50A 4AG3A 3ZV4A 3H13A 4V39A 5L4NA 1FUUA 1ORHA 1WUIS 4YFVA 1MC1A 2YOFA 1BWSA 4YRQA 1AMOA 3Q3EA 3OIWA 3RSHA 3N86A 4HDSB 3RSZA 5FWDA 1D9ZA 2A9FA 2X3YA 2UZAA 3TLCA 1QG2A 1X74A 3FFBA 3U7EB 2YXBA 3N5CA 3VGPA 4DRXA 1N9ZA 1YOVB 2ZYHA 4C30A 2D3WA 1XN1A 4INAA 1PG5A 1PGOA 4PGGA 1IRIA 5D5PA 3DMRA 5H59A 1HE3A 5LMZA 4EGCB 3IXQA 4ZQFA 5K0JA 4NNJA 4BNTA 2QPTA 4GOND 3FHJA 3P4UA 4A5SA 3K9NA 2MYNA 5KQRA 3G85A 1WVIA 1KYIA 3JQAA 1YRBA 3OTGA 4F3YA 4KG7A 2UUAB 2JFNA 3B3QA 3H65A 2JIZA 2IYOA 3CE6A 4HQOA 3T0FA 3TSWA 4C6HA 3M6AA 4C0BA 1WCWA 1KYTA 1GZ5A 4Y1RA 3TJMA 4IHAA 3KSMA 3I9JA 4JBGA 4MLDA 4I19A 1QAQA 5ALEA 4FB4A 2HLPA 4UUOA 1JDNA 2HJ9A 3Q7EA 3TFOA 1TJNA 2OFWA 1WPQA 2P7HA 1UC8A 2Y8EA 4NCJA 2HU7A 1TUGA 4B80A 3GJ4A 4CM7A 3NCHA 3LCCA 4MB6A 1VCOA 3PQ8A 3AKDA 3T41A 1O95C 3L93A 5EUBA 2GXQA 4ZXPA 4LISA 1E2MA 3AV0B 1Z4MA 4QTYA 1GKKA 4G8JA 2NTJA 2NSLA 2XMCA 4ZEWA 4ECEA 3UHFA 3HL4A 1A8QA 3IOYA 1BW9A 1UQTA 1YSCA 5K3OA 1ZAKA 4BZPA 4TKUB 5JXHA 5LFAA 4C0JA 2BZGA 1Y1LA 2CKMA 1O6CA 4OJNA 4U0JA 3RFVA 3V8MA 1UADA 3B5EA 3EB9A 3CVJA 4ZEXA 4CMKA 3L0BA 3DDSA 5EHGA 3A0RB 3PKZA 5J59A 3SJZA 2EFJA 3K1AA 3L79A 4C4SA 1I30A 2XF2A 4INPA 2YW2A 3EXHA 5F9MA 3LQ2A 1X38A 2G6TA 5JY6A 5FUBA 2AV6A 2RAUA 4DLLA 4LE2A 1W76A 3FFTA 1NVGA 1KP2A 3AHCA 3QFFA 3QVWA 1MKYA 1UKEA 3A1CA 4UNPA 1MQ8B 3QUBA 2VP3A 4DJTA 4QICA 4EFLA 5BP7A 1FP6A 1RLMA 1NG9A 3TUIC 2IBSA 4IH1A 4XYBA 3BE4A 5HCNA 3E84A 1V37A 1ZBQA 1I10A 1M9NA 3GUZA 5AIAA 4AFNA 2NP6A 2D13A 2OY0A 3QU5A 4NYIR 3UCEA 4B3JA 2ZSAA 4E2ZA 1GZ7A 2I7XA 4QLBA 1LSUA 4M9RA 1FNSA 1VKJA 1YC2A 3H5VA 2J7KA 1I24A 1Z3CA 1OFHA 1N6RA 3QG1A 3O8QB 4NX2A 4QUAA 4N76A 4ZAVA 3S2FA 3OQ1A 2H1IA 1T43A 1LVUA 1J25A 1QVAA 5T6BA 1VLMA 4HAYA 4KWCA 2FSFA 4I36A 5JSUA 3IHLA 1JTEA 1ZC3A 2I6FA 2FWBA 4KN5A 1AV6A 2FUG1 2ZSEA 3FF1A 1ZI6A 1BVRA 3GXOA 3HCCA 3ZHQA 3P2OA 2AJLI 4MITA 5ESRA 4X94A 2ZBQA 1G8JA 1BCRB 1CSEE 1FS4A 2GN9A 2AX3A 5G41A 3S70A 1E2IA 3GAMA 5F52A 2WDPA 2EAUA 1BJRE 1POXA 4HX5A 3ENNA 3VQTA 2G40A 3CF4G 3BA6A 2QJOA 3DQZA 3JCZA 4JKOA 2WM8A 2H1VA 3W1WA 3TTTA 4YJ2A 1NBOA 3W06A 3E9NA 3SE7A 1TMGE 4Q15A 4L74A 4KWTA 4DA8A 4O33A 4BGEA 1XTQA 4RX1A 4V0OA 2XKBA 3RJTA 1M2VB 1SGWA 1JVSA 2DBQA 3G5AA 4Y2UA 3QWAA 4YAWA 5DI3A 4YN3A 1JG4A 2ONCA 1XKLA 4GLJA 2GN0A 2P6UA 3ANTA 4UUBA 1T3ZA 3H97A 4TVKA 4BRZA 4RS3A 3OOWA 4TZTA 2JLUA 1QIHA 1DL5A 2W6NA 1T4GA 5LQKA 3T1VA 3G23A 1EX1A 4CTNA 3A2KA 4COKA 2W5UA 2OCGA 3EC1A 4JOQA 4UDYX 1JEJA 1Y48E 1YZUA 3SLRA 4FP9A 3ZU3A 2IF0A 4F38A 4LVUA 4CIAA 2A00A 3U3OA 2OKGA 5G0TA 4IL5A 1JKIA 4UCFA 1MJNA 2CE2X 2QAGB 2V6JA 4L0MA 4M9UA 1E60A 2UZ3A 3KZOA 3LYLA 3P94A 5HHTA 4FDVA 3S44A 4XFDA 2I33A 3L0SA 4P4SB 5GZ6A 1I0ZA 1NMZA 3SR4A 4Q24A 2F3QA 1DO8A 3IDFA 2XADA 3F47A 4V0LA 3TKLA 4F1WA 3EFEA 1Z6PA 3O21A 5TVGA 4ED9A 2NSHA 3FNFA 1X80A 1A27A 1ATZA 4MGKR 1E5QA 4Y6PA 3TOCA 3LIIA 2X6QA 3CW9A 4JGGA 1U0TA 3PDIB 2FDCA 1HNWB 4DADA 1USGA 4W99A 3K5IA 1RYDA 4RSHA 4DKXA 3QFHA 3H7IA 2VPQA 1GTG1 2CF5A 3GLFE 5JJLA 3KR1A 4MPTA 3OFJA 5KMGA 1MB9A 3DEHA 1P7VA 2QM3A 3CH4B 4H08A 2BHLA 2TRSB 4JR0A 1IZ0A 4YT8A 4HK4A 2AFHB 2GJ4A 2XIJA 3T9DA 1RMYA 2EJTA 3FR8A 1N9GB 1SBNE 4RK7A 1ZD3A 4U7JA 2FP4B 1XAGA 1K6MA 1H5NA 3M82A 2FPKA 4RKWA 3HDJA 2AF4C 1B1AA 4LOAA 4MKHA 1TRKA 4U2KA 3BOSA 1B74A 3I1JA 1PJQA 3L40A 4FYWA 2HHHB 1WULS 3DYVA 3BEDA 3HK2A 2CB0A 3I9OA 5DDIP 1HYHA 4CLOA 1BDBA 4YB8A 1J2YA 4FFLA 3NHYA 3ELWA 3L84A 4R51A 4P7JA 4DMFA 2MSDB 2V5VA 1EK1A 3GELA 3HEAA 1NKTA 2CYCA 3OJEA 3U7IA 1SVOA 3ULKA 3V2GA 2RI1A 3EDMA 5K4AA 3UV7A 4HNQA 3H2SA 2OAP1 5L4SA 1JDJA 3ANYB 5JSZA 3CVWA 2CUTA 3MXTA 2CXUA 1EFPB 4UFOA 4KRFA 3NASA 2CJXA 1UBFA 2PRKA 3O91A 4YAOA 4LDPA 2IEDA 1VQ1A 1FUIA 5K3EA 2HMUA 2LCIA 3LQYA 3K9HA 1F2UA 4ZQGA 5GIOE 2VT3A 1TKRA 3BVPA 4LDQA 3E5NA 4NJOA 4EMTA 1YDHA 1E2UA 2AZMA 4G8BA 5HBGA 3D7RA 1QIEA 2B37A 2ERXA 3PTLA 3PTZA 1NN3A 4HCJA 5D3MB 3PD0A 4NYJR 3BJRA 1F6BA 1QRDA 4G0YA 2OZPA 2QYTA 4K6OA 4N49A 5I4IA 1JG2A 5F2OA 1V3UA 3PJFA 4NAVA 1S6YA 1VHQA 3TLGA 3LC0A 3TBFA 4WCDA 1HSZA 3EVCA 3WAJA 1L3IA 1JG1A 1ORDA 1Q16A 2W37A 1B2RA 2DHCA 1UBTS 3NHUA 2JH3A 2XB4A 3PCXA 2G71A 3QKTA 4NYMQ 4QFBA 1NXOA 3FYSA 2NPOA 2A1IA 4EA7A 1NF8A 4OB6A 1O95A 1AGRA 4IEEA 4DW8A 1AF4A 5GZ1A 1GUFA 4PNEA 4DV4B 3HY3A 2JG3A 2ORIA 2OM6A 4WBNA 5J1SB 3GJYA 1USWA 2H3EA 3OETA 1OYYA 3KVRA 4BB5A 3ABOB 1TCUA 1KZGB 1HQKA 1QTQA 1AS2A 1LSOA 2FOLA 3IVGA 5I7VA 4JJGA 3GUHA 1OU0A 1QHIA 4FHCA 5I9SA 1LDMA 2IW3A 3G2QA 5EE1A 1G18A 3MMZA 3I2HA 5B55A 2H85A 3RPEA 2FUNB 1ZK0A 4UD2A 3CSSA 4Y2QA 1N5KA 3VOSA 4DUPA 3C8DA 1CERA 4GR9A 5JBNA 5A5VA 5LP6F 3DAPA 5A7GA 4HB0A 1QQ5A 5A06A 1V2HE 3S55A 2W2QA 4G5XA 3IX7A 4P98A 2JAPA 4CR7A 1Z0ZA 5DTQA 5KYUB 1R64A 4PSKA 4ZV7A 3HLYA 1EWRA 3H99A 4P83A 4DYHA 3I53A 5I6DA 2WIGA 5LZ7A 1GCOA 5G2OA 3N6VA 4Y2VA 4LN1A 1XMIA 4OL0A 1WY5A 2P3LA 2QUAA 2WUVA 5DBFA 4MZXA 3F6CA 2J0UB 4A0FA 2O54A 2DBVO 2PNJA 2JBAB 2AH5A 3BDAA 1NQAO 1H3NA 1J0DA 1QQ6A 2Z83A 3D6JA 4F6LA 1AN0A 4AULA 2H4HA 2CJYA 2QU7A 4QGGA 2PLRA 2XMQA 4A2QA 3LX6A 5C3MA 1VECA 5JNUA 4D9HA 3RU2A 4DDTA 3K70B 2WZQA 4ZI7F 1EG7A 2FY8A 2FZCA 3W3AA 4LRYA 3ZXXA 5HW0A 2DR2A 2ETVA 5DCWA 2IP1A 2IEIA 3NHJA 2YHBA 3R3UA 2GD6A 3R7SA 4EA8A 4LK3A 1CLEA 2H7YA 3BB3A 4DUZB 2WPDD 3H4VA 4UEKA 3GDWA 4FOLA 4EJ0A 3R9KA 4GLFA 5F35A 1QM5A 3SZOA 5DHQA 4Z1MD 3U7FB 4N9QA 3VPXA 4JCOA 1PYDA 2SICE 4NABA 4UQPA 1IG3A 5E7QA 4V0SA 5JI3E 1BMFA 3CN9A 4UNQA 4EEXA 1JA0A 1VE6A 4BX9A 1I1QB 1V26A 2DQKA 3CPHA 3ZCTA 4A0QA 2C2GA 5FLXA 1OAOC 2BFCA 2O7VA 1R0WA 5ERYA 1DHTA 1IN6A 3TLAA 3HXLA 3VR2D 5CA1B 2Q0HA 4URUR 1RRCA 2CV1A 3CZQA 4Z8XA 3QPVA 3AUFA 2MIIA 4GYKA 1B6TA 1T2CA 2GYYA 3DDCA 5EXPA 4YMLA 2CK3A 2AFRA 3R3YA 3AONB 3GZJA 1QNLA 1NQTA 1R9GA 1SCAA 3PNYA 3AGQA 3GJ5A 4PN3A 1ZA2A 3HMQA 4DDUA 4B4VA 1Z2PX 4F7DA 1VA4A 2X5OA 1FQWA 1Z73A 4FFPA 4DMLA 1KS2A 4OX9Y 2FPPA 3GLRA 3ETCA 3BGWA 4X92A 2FXVA 2D62A 3K8YA 4H0CA 1ZVQA 3CR3C 4M9XA 1P9NA 5BWNA 8OHMA 1CZRA 4FYPA 2H52A 5MFPA 3NHKA 2VDJA 1U8ZA 2QS9A 3E22B 2RI6A 3OO0A 2AR0A 2WU4A 3F5SA 2WICA 4FZ3A 4HDNA 4FHEA 2LD4A 4M76B 4YPVA 4WAUA 3IYLW 4EG7A 1RI3A 4KYVA 5LZ2A 2AT1A 5HNKA 4U7PB 4FQ8A 3WWDA 5JBIA 4Q1DA 3K35A 2CL5A 3AILA 3BFKA 1QH8A 1WSBA 3MQ2A 5I51A 3FB4A 1KQPA 1RI2A 4OM7A 3N1UA 5K8LA 2XUGA 3AP3A 1KJJA 4MRSA 4CM8A 1WXEA 2O4UX 2VN8A 2WKWA 3EA0A 3G3EA 3U2QA 1PNRA 3EMBA 1YWGO 1UM9A 1XHEA 3HADA 3JSAA 3SC6A 5IZCC 1HNNA 5AESA 1S8OA 2IU6A 2MSWA 3NTUA 4I6JA 4JZYA 4MWTA 5EXXA 1GKYA 1YZQA 3CJTA 5H16A 5A3RA 1OPRA 3OIUA 5ADHA 3FR7A 4J75A 4AO7A 2Z6AA 4N5NA 4UREA 1BQEA 5CUQA 4JVLA 5FOSA 1RLOA 3HACA 3U3RA 3FSGD 1O9HA 3S99A 2H00A 1V25A 1NXQA 2ZRDA 3EN0A 4UMEA 3O95A 1CEXA 1G7CA 3GN2A 3DXYA 3T34A 5J58A 4AK9A 5TS2A 1D04A 1ZNZA 3NAQA 1JDUA 3AEXA 1N0VC 1Z12A 2BVNA 2WMYA 5B36A 2WQ6A 1UINA 4OQNA 1RBMA 4BV9A 1JXMA 1WSDA 4LECA 4EB0A 5AMXA 2YJTD 4NDZA 2QKYA 5C2JB 1KFEB 3OPMA 1JIIA 1A1VA 3I6ZA 3EUWA 1XMVA 3OX4A 3BXZA 4TT3D 2I6QA 2ENUA 2PXCA 4RHYA 3OJLA 4K81B 2YDXA 2X1LA 5JV5A 2PU5A 3HNPA 2HR1A 2Z4RA 3SM9A 3HG7A 1L5RA 2GAOA 3MS2A 3ELYA 1I8TA 4M9CA 1ML3A 1QIMA 1CQJB 1X7YB 3QX7A 3RRBA 2DBYA 3ZCRA 2FW6A 1MC8A 2V7TA 3Q15C 3OEED 1ZVJA 2XE7A 1V7ZA 2GBGA 1DWUA 2D3TA 5DHTA 1T1RA 2QYHA 2VHUA 1JLHA 3H4MA 2BFNA 1A82A 3MC1A 3QQ5A 5BOSA 2NO9A 3KD3A 4L9RA 1VPVA 3MM4A 3C5WP 1A72A 3EFOA 4D9NA 4D4GA 2WJJA 1RQNA 2I34A 4AQDA 4MVJD 2X13A 2ZVDA 3G8CA 4RJLA 5AI9A 3RKSA 2Z6VA 3TXAA 3W8EA 3OQJA 1ND6A 1JR3A 2HGSA 2O52A 2VF2A 3RFUA 2PD4A 2PX3A 3QPUA 5KTOA 1W85B 5BWBA 4FT4A 4B31A 4P5PA 4CQMB 1BE8A 2VPPA 3JAWB 4QQ8A 1YGYA 2G4LA 4PC2A 1UBLS 1LLFA 3RARA 5TJHA 4CQJA 4RELA 4X1KA 1Z8FA 1ODTC 1QP8A 1DIBA 1LRKA 2VJPA 3JQCA 1XTVA 2H59A 1PD0A 3OI7A 1W73A 2OZEA 1IC6A 4JC4A 4UVEA 3UTDA 4U2EA 4QC2A 3IESA 1QHHA 1W5BA 2HJWA 4KSYA 4PANA 4QRDA 1C2YA 1CP2A 1OIXA 2P27A 2V45A 3KKNA 3N9IA 3HYLA 3L8MA 1ZK3A 4O4LB 1HYQA 5FJJA 3OQOA 1N8TA 5TR9A 1WA5A 3IJRA 4IOKA 4E2XA 1AZLA 1NX9A 3ZZMA 2BRUA 5HBRA 4GPZA 4OHBA 5KMGB 5KOHB 1CY7A 1FDUA 3GA0A 4R5MA 1IJFA 1OUMA 1W25A 2OUIA 2ZWPA 4N4AA 1VL8A 4BJ5A 3SF8B 3SQXA 1B16A 2HT6A 2VJAA 5D87A 4ZVUA 3T3MB 1XA4A 4KPGA 3ZHUA 5K0BA 4ZEVA 1MVLA 1ADFA 1NJ2A 3V1NA 2IPXA 2VOEA 3JPYA 5LVAA 1FJHA 2QVXX 4G8DA 4I3HA 3PFGA 2HPVA 3DMGA 3LMKA 3ISTA 4MRMB 2WAXA 4QDZA 4E3WA 1O5OA 2UXDB 2AMVA 4KIFA 2Q4OA 2WNHA 2YFYA 5KYKA 4PPGA 1QQAA 1TAUA 5I5EA 4Y6GB 3N0XA 2JAQA 1Z08A 3OC0A 4HS9A 2R8ZA 4CVNA 2O19A 3Q8WA 3F6EX 5KYTA 2YV2A 3AX6A 1EUCA 1PWYE 4I2NA 5IZCA 2REXB 3AEYA 2IT1A 4YRFA 3QJGA 4R2WA 1FLDA 1FXSA 3B60A 3G9UA 4IZIA 4MKIA 5ELLA 4ARIA 2OK7A 2XCRB 2IBMA 1Z4LA 5ITVA 1PGJA 3DAOA 1XXHA 1B3BA 1XD9A 1CUWA 1KC3A 1SKYB 3Q9SA 3QVMA 4JVMA 3OLXA 1YCGA 1GUYA 4P93A 2G9ZA 4J91A 3RIMA 2ZPUA 5F76A 1D2CA 2WRZA 3A4YA 3PJGA 3IVAA 3L4JA 2ESRA 2CK3D 1H2EA 2QTRA 3IUEA 3NHPA 1ZNXA 1DJOA 2ASVA 5ITWA 5H8WA 2BPOA 5CLJA 3EIOA 2RGWA 3I1YA 1C5KA 3H4TA 4WWHA 1F17A 1LDNA 2W2OA 3JD4A 5DBHX 4NSNA 2FLKA 2WINI 5A4DA 2IYWA 4JLUA 1L1EA 4GGMX 4JEMA 3PUYA 1QGUA 3T9CA 4X65B 2FGJA 2PR2A 2UYOA 3KEOA 1ULHA 4HDOB 3RUIA 3EEOA 3KT8A 4EI9A 4L4ZA 2E4WA 3K9CA 2L0XA 2VG8A 1YZNA 2H31A 5IAKA 2HX1A 1FRQA 5D2CA 4RTRA 1N77A 4F5ZA 2QD4A 4AJNA 2JGKA 2ORVA 1G63A 4MUNA 4YJ3B 3TVYA 4IFEA 3SX0A 3WBJA 3URMA 1OJLA 1VGQA 4D6XA 1UBMS 2I7TA 4G6ZA 1Q7CA 1SG6A 3U4GA 1YS7A 5TMPA 1KI6B 3P5SA 3AUUA 3EW9A 2C4VA 1L7VC 1DDIA 3Q0EA 4P82A 2HJSA 3OSUA 4IHKA 4PY2A 4NU8X 4CE6A 4WCVA 1PW7A 3FGZA 1O0SA 1L9XA 4TVSA 4CV1A 1KAGA 5IDYA 2Z1NA 1BA3A 1JZTA 4RLFA 3EH1A 3I8OA 4TLLB 4DV7B 2B94A 2BFEA 3LBAA 1TRHA 3PE6A 4KVGA 4R3UC 1Q50A 3V7WA 4RJKA 3ZWYA 1SKBA 2W2XA 3NBZC 1JJAA 5K4GA 4G81A 5HGXA 1ADYA 1NVVQ 3TD9A 3MWFA 3AIKA 4MW4A 4DJ5X 1NW3A 4FC6A 4WKNA 1JPUA 1O4WA 3HP1A 4JI3B 4TL7A 3K4QA 2H1OA 1R4ZA 3SBEA 1RKUA 2JFQA 2BTOA 2EATA 4YAUA 1U9IA 3I1IA 4TLEA 1Y9EA 3RRXA 4COOA 3LZDA 2HA5A 1MAWA 2WHYA 3DFFA 4HN9A 4CCSA 1KEVA 1M8GA 2Z3ZA 4PZYA 5IDVA 1Y7LA 4N0DA 1O94C 1RYEA 3KKMA 4WK0B 4GMFA 1JLSA 3A9UA 5LLSA 1BW9B 3L6RA 3WZMA 3DVAB 3KKOA 5IHPA 5DCUA 3B52X 4JP3A 4TKUA 4F5WA 3EOZA 3CT6A 5INTA 2FW1A 3D3WA 4K03A 2VYND 2PUBA 2NNLD 3H5NA 3KUDA 4V3BA 1WMBA 2W58A 3OQVA 2ON6A 4X66B 3ZCPA 3AZOA 1ODSA 2JEZA 1ZUHA 2ZJ6A 2R7LA 1A4XA 4GZ3A 4GE3A 3SQOA 2VBGA 1ZH2A 2WSBA 3UK7A 3UT0A 4W7SA 4JJZA 1E6EA 3NT4A 3KHTA 3I61A 2YWRA 1QONA 5EYPB 2HWWA 4AX8A 2C4TA 4WUTA 2A67A 2X4IA 5JH7F 3M70A 2FMFA 2D1SA 1EVYA 1TK2A 1U4OA 1GPMA 3HI6A 3FDXA 4RJIA 2BCEA 3SBXA 3MT0A 1FS6A 3H9UA 5HFJA 3SKXA 2JH8A 4LBZA 2NZ2A 1E5VA 1VLZA 1H93A 4PLWA 5DNVA 4UPEA 1L5MA 1RZ3A 1UOPA 1I80A 3HBLA 1WKCA 2OYCA 3HN2A 1JXAA 3GZ4A 2IYYA 1PT6A 1L6RA 5B1YA 4P9NA 3RF6A 3BD6A 1XQWA 1OC4A 5KYXB 3O9ZA 4P4LA 2YXLA 1O6ZA 4KMRA 2D2IA 4L8LA 5FI1B 1XZGA 5EWMA 4NARA 3TTUA 4ESOA 1H2BA 1T5BA 2A58A 3Q41A 4A82A 4TZ6A 3VI4B 2PO7A 2YTZA 1GR0A 3C74A 1C0PA 1RAIA 4KE7A 3HUDA 4KQKA 3H1TA 3PYXA 3UJBA 1YQXA 4ZOLA 2ODPA 3RTGA 3LQRA 2BKXA 3HVKA 4RTPA 1INLA 5EN4A 1YUNA 2P2ZA 2P5TB 2I4MA 2JFUA 3E4CA 3GVIA 3PEWA 2DE0X 3ZE1B 2F55A 3K0BA 4MW5A 1E6LA 1SZJG 3JALB 3EF0A 1XQ6A 3M6FA 5F7ZA 3VHXA 4BE7B 2AEFA 3KVYA 5K1ZA 2VJKA 3IBFA 4URYR 4LNUA 4MTLA 3ZYZA 4R1QA 1OWNA 3F6SA 4E5NA 5CVEA 1II9A 1QAMA 1DJNA 3IV6A 3MRXA 1RJGA 4TMVA 4O0LA 2XRMA 1YJBA 4A3SA 2O8DB 4U8HA 1G8PA 3E03A 2C5HA 4AYTA 2OEPA 3RC8A 2OK8A 4LZAA 1GCAA 1TQDA 2ZR7A 4KFUA 1FYXA 4YUAA 3Q8LA 2BMDA 5FQOA 2WU8A 4LRSB 1MOZA 5CFZA 5B4VA 1QP0A 2H8KA 2P9BA 1OA1A 5C1IA 3BS4A 3E9ZA 3NHAA 4LXXA 4KLZA 1HMYA 1RIIA 3SX4A 5U9CA 4Y2XA 1MO8A 3L4BC 2KJQA 3OICA 1C7RA 2GAJA 2Z43A 1F0PA 3AF0A 1RAHA 3E5RA 4WMLA 4YHBA 5IAEA 2V0CA 4HH3C 1IQPA 4F4FA 1KO4A 3ZI4A 4U6QA 5KSWB 1KVUA 2Q9AA 4DUGD 4MI6A 1VJTA 5THQA 5AVZA 3FFAA 2JFFA 4LKOA 3FZNA 4MA5A 4XOIA 3DPIA 5AR1A 4KGDA 4D44A 1Z2NX 5K0EA 4X8LA 4MKZA 2BKLA 3BEOA 3CLTD 1R5NA 3SDBA 4XEHA 2C7OA 1H4SA 5IX8A 3IHTA 5KNDH 2H7CA 2G36A 4I50B 4Z9FA 1GA6A 4DBLE 4NIMA 3IUMA 3PL1A 2GBPA 4CBVA 3MIZA 3DL7A 4RAQA 2ILTA 4Q1AA 3NJ4A 3VR5A 2Z8YM 1TJ4A 3RK0A 4YRGA 2WJ4A 1JA1A 2IS6A 2A5FA 2WA2A 4WLOA 3WGLA 2VNSA 3TRFA 3AHIA 4ZVQA 5G3ZA 2XMDA 3WB0A 2V6IA 2X7JA 3KS9A 2I71A 4NAUA 2XOKD 1UKZA 4D45A 1F4PA 1JQDA 2P5UA 2PEYA 3Q0TA 4Z49A 2X19A 1TM5E 2B4YA 4XVQA 1DUVG 2GN8A 5JWHA 4GP6A 2WWHA 4XTRA 2ZB7A 3K05A 5E9AA 2X9QA 4Z6KA 2OO3A 1D5CA 4W5JA 5D51S 5JS8A 4Q6BA 1U2PA 2EKZA 5IUJC 2R25B 4MDHA 1OIWA 1RWMA 3FVVA 1SIBE 3F8SA 3FMGA 4KR0A 4NMMA 1O58A 1WBJB 3CLUC 3F5QA 3VR5D 3NBAA 2XSZD 2O8FA 1E94E 2ICAA 1PZNA 3C7KA 4KEAA 5I45A 4OK3A 3IUYA 5JVDA 3TBKA 1S2LA 1QG0A 3TRKA 3VC1A 4NBTA 3U56A 5TF0A 3RUDA 3I64A 2CZCA 6GPBA 4B3RB 1PI3A 4RHTA 1GLVA 1CQPA 1X7HA 4WGFA 4YCJA 4EHNA 4KLRA 1WL8A 3K15A 1Z18A 4E5DA 4GSLA 1NVAA 1YKSA 3W7BA 1QHSA 1D4ZA 1NUPA 4IS2A 3GMDA 1VI5A 1I4EB 1ECFA 1JLRA 3KAPA 3PGKA 1HR0B 2PANA 2FVYA 5G4KB 1G4UR 2ZG6A 3RAPR 1TE2A 1XZCA 5CH8A 2V7EA 5J43A 4G0XA 5A9RA 1X42A 3FJOA 1OKKA 3WMGA 1MX5A 3CISA 4C7MA 1L4YA 2OT3B 4E08A 2GM3A 4DQXA 3CVYA 1LPPA 1Z5WA 5SYNA 4B47A 1LF0A 2VP0A 4BB9A 3CF6R 2VJCA 2ZBEA 1H2YA 4PRZA 5AVTA 1N36B 2DERA 1YTLA 1NT4A 4IHJB 1PAUA 1B0PA 1UJNA 2JD2A 2Z56A 2XOXA 3OEHA 1DC5A 4Q16A 4HJXA 3ELDA 2VPWA 4M8IA 4WACA 3RVNA 3U3XA 3OTOB 3M5DA 2W93A 1KYZA 1XNJA 4ZVOA 3VXKA 5FUMA 4Q1FA 1GZHB 4H59A 5JU6A 3MWYW 1KDRA 2VOJA 2WYIA 4ENRA 3WQRA 3ZIDA 1EWQA 3PF8A 4PLGA 1E6WA 1V11A 2GASA 4RVOA 4DBZA 3UGJA 1OB5A 1WIWA 1V71A 2FW0A 1H2AS 1EGAA 2OVBA 5C4GB 4MZDA 3RS8A 4F6CA 4DCNA 3W2IA 1Y9JA 3G2HA 4F60A 1AHIA 2O3JA 3FCSB 5UKDA 4M53A 1ZIYA 3EZXA 1BCSA 1PRYA 4P84A 3LLMA 1BJKA 1KDPA 1OXSC 4B45A 1R0LA 5ICCA 2PIDA 2ZDQA 1YRWA 1O9GA 1ILWA 4GBJA 1OGIA 1JB9A 3L7BA 1Y6QA 1OGYA 1RAFA 2IXBA 3AM3A 5EJEA 4RA6B 3DZBA 3MWEB 1TXGA 1UDXA 1E77A 1RFGE 1IN7A 1ZJ4A 4HTAA 4MUYA 5CLGA 4D7AA 1BA2A 5T4HA 4TWIA 1SVMA 3EXEB 4FS8A 4ABYA 4I4LA 4DQDA 1UMBA 3RASA 3KJXA 2WHEA 1GQSA 1Q3KA 4DMHA 2I66A 1JAHA 3TX6A 1AQ6A 4HNAB 1W2HA 3ZWPA 2BGIA 4HQFA 1HFEL 2D54A 3E8XA 4UTOA 4AP6A 1HE2A 2ZBVA 2B6HA 4K5QA 4XM2A 1OX4A 3RABA 1T29A 2CHUA 5BRJA 3TZ6A 5BXQC 2X14A 2Q7XA 5HQTA 3ZDAA 3C7TA 4BVHA 1EDEA 2NIPA 1XXHB 4LYDA 4DLBA 4F2HA 1P80A 3IGFA 2W2TA 3GIWA 3KL4A 3GLFA 4M1KA 3GH1A 3P2KA 4UMVA 1DBSA 1Y98A 2QIPA 3KDAA 2WJ6A 4IIVA 4AMGA 1EUCB 1Z4JA 2PDAA 4EHKA 2GAAA 5FFMA 2FYTA 1BOFA 3BWMA 4Q4AA 3ZTYA 3DZJA 4W5TA 4LC9A 4ND1A 3SAJA 1NU8A 2EP8A 4M0FA 1U7UA 1Z4QA 1WZUA 4ER0A 3TIGA 4BKPA 5CD1A 4A8JB 3HCEA 1QTRA 1RZUA 2N47A 1N78A 2PZKA 4EUSA 4MRMA 1OCEA 1TLFA 1UWCA 4KO4S 1O8BA 3FYCA 3GX1A 1X3LA 1N6IA 3BRCA 3R3XA 4DM7A 1BAPA 4NU0A 1VB3A 1XZAA 5G1NA 3JWEA 1J7KA 4EPTA 4BNYA 4YR9A 2JIZD 5K7SA 1DDOA 1XKXA 1BH6A 2C99A 1CRQA 2XUJA 3LYHA 5IVIA 1FSPA 3TNFA 4DR7B 3PXCX 4DDWA 3QJYA 4BMDA 1XJQA 2VQSA 4HSGA 3IR5A 3DCIA 4HN2A 4Y30A 3UG6A 4EKEA 2HBRA 4UTXA 5EZ5A 1U1EA 2BEKA 3P96A 3G17A 4G89A 1SCNE 5FA8A 3VPGA 2JRCA 4OBXA 2P8SA 3IMCA 1BC5A 2WZDA 3O3MB 3Q7TA 3QXSA 2WHPA 3GRVA 1AF7A 4KTTE 2ZI9A 1TB4A 3FNGA 4QBIA 4AJKA 5K0TA 3ER8A 1UT5A 3KKZA 4MGEA 1UEJA 2BAGA 4FFRA 4W63A 3SP1A 4PZUA 4DLZA 4EZBA 5B64A 4TYYA 3P2EA 1WAMA 4RMGA 4E1AA 3ZDDA 4F4IA 3U7HB 1G21B 1VJ1A 3GVXA 3L7OA 2OMKA 4DSUA 4QX6A 4FN4A 1B26A 1J07A 3H0EA 4MVJP 4CLDA 4PXSA 3IQEA 1YZHA 4ZVMA 1HM5A 2OBYA 5KS2A 2M1XA 2XQKA 3X2FA 4NXMB 1T1IA 2YJNA 5ESDA 4X3OA 4MWSA 1WCV1 3HGTA 2ZWIA 2CZQA 2QJTA 3FBGA 4I46A 5EWLB 4FNOA 5FPHA 4EW2A 3R7LA 3ENWA 5IXJA 3ADCA 1NPTO 4LY0A 4RFSA 5CYGA 5JAMA 3ZJUA 4BPBA 2CBZA 3CC8A 3WIEA 5C3UA 2AKYA 2XYGA 3KOMA 3WK4A 3GNQA 3PEYA 4X1IA 3ZDBA 1KRWA 1N7JA 3BH0A 3BYZA 3FPKA 1RM4A 1A04A 3EBOA 3FWPA 4N39A 5J4HA 5EXSA 3VR4A 4EY4A 1ZOOA 5F64A 1J8YF 1TYBE 4R68A 1JFRA 1QRRA 1XCMA 2ZJZA 2NAPA 4PAOA 1KXJA 2YYYA 3EUFA 4UM8B 3TMAA 3GJ6A 2F9FA 2XQJA 4JXXA 1Z16A 1DQRA 2C3OA 1JPVA 1ZGJA 2R6GA 3A04A 1XNGA 3MXOA 3KXIA 2MJLA 5L3VA 3OUZA 3RHFA 5CM8B 1QHGA 1HFJA 2Q4TA 3N53A 3PQ2A 4O2BA 2F48A 3IQZA 1JBQA 2B8JA 4MIYA 4V0MA 2B61A 1E9SA 1S89A 2BDEA 3UICA 3OEYA 2UVPB 5EE5B 4D3XA 3T1HB 2X4GA 4U7FA 1WOYA 3DH0A 4J2TA 4LE1A 3K9GA 4Q02A 3AVXA 5B37A 1SELA 1VPTA 5CAEB 3SU8A 1E98A 3F4KA 3PB3A 4BAZA 2OENG 1X70A 1EXVA 1K5GA 2Q2VA 3FOBA 1Z0DA 2VF4X 3QMVA 5AW6A 4ZHQF 1VXOA 3WGIA 1ZJYA 4AZ0A 2QN2A 4JUIA 3FPBA 4L16A 4N40A 3NGLA 2F3TA 4PYJA 2G9VA 1LPOA 3SIWA 1HTWA 1PKXA 1W75A 2FPXA 2GEFA 2OUKA 3DNFA 4MR9A 3HYNA 2VDMB 1A2KC 5DO9A 1APBA 1E3WB 3MTGA 4ZANA 5L7YA 3C0KA 3RYCB 5FT9A 1DKQA 4KDEA 4JBYA 1QTIA 3D0QA 5KU7A 1N2ZA 3RR2A 1ZSYA 3P5BA 4A26A 2I4NA 3NHWA 4UBLA 4D5GA 3RAFC 1FFXA 1KQOA 1J90A 3GUVA 1KYQA 2A59A 4JH0A 1Z7WA 3MWLA 4CIWA 1OWOA 2F1IA 3LGAA 1L4KA 1I6KA 3GRZA 1VL6A 3H6GA 1SVNA 3NHFA 1EQAA 4M8NE 4X0EA 3SHFA 2DPHA 3NHZA 2PPLA 2IJGX 1CY1A 1L8LA 1KI9A 3HUFA 4M6WA 4NF2A 3QVVA 4RD3A 1QFZA 1PS0A 4N3NA 4OFZA 4XYEA 1RJEA 2V8BA 4QHSA 4YCLA 2C7PA 1H66A 3DLHA 2KBEA 1ZU5A 3DEZA 5KVSA 3C2QA 4IQGA 4XIYA 3KEMA 3T7EA 2X22A 3ZDRA 1PJRA 3H5TA 1TEXA 3MHPA 3VX4A 3ZWBA 4CLEA 4NCAA 1ORIA 3IPCA 3EHDA 2E48A 2RFLA 3QNMA 3R8XA 1RZRA 1WDWB 3DM9B 1KRXA 1NRWA 2R8BA 3MS4A 5B53A 1XVTA 3SQLA 5JI2E 1NQ5A 2NO1A 2JHGA 3AFIA 4WDRA 2C03A 5EIEA 1WXGA 1EFAA 2B7LA 2QVCA 3DOIA 5I8PA 4XPIA 3F2VA 1D0VA 3MD0A 4DV5B 3Q8KA 3EPPA 1OC2A 1RADA 3MB5A 1FU4A 2I7CA 3PC8C 3QKRA 5AO9A 3AY7A 1SVUA 3OAAD 4QGHA 3SXUB 1RE1A 2W0MA 4ZO8A 3VNRA 1C9MA 2Q1XA 2WVHA 4DIMA 1W36C 2KMXA 5NLLA 3F3SA 2SKCA 4TQUS 3DW1X 4ZQCB 3WGTA 4MHTA 1JIJA 3K09A 2OZLB 3NORA 2C5EA 4NZPA 3ZWVA 2ZRFA 2Q2WA 3PLNA 1NUSA 3TM5A 3BTUA 3R6LA 2WDZA 1M2OA 4NNPA 3H6HA 2A2ZA 3JWJA 2D2EA 4P8RA 4AKSA 2NYVA 4X20B 4ZMRA 3OKCA 4PZLA 4CMEA 4PSVA 2Q4DA 3ZWXA 1Y3FE 1AQUA 4ALMA 2HMVA 2QL9A 4B6EA 4ETWA 1KH1A 5CHYA 1EUDA 3HHPA 2ZTVA 3W04A 2ZB4A 2YHIA 1QE0A 1AKYA 2MWMA 1NOKA 3R40A 1NBAA 3FYUC 1Q2UA 3FMVA 4KSCA 1PV4A 2A0YA 4M49A 4IGIA 1KJ8A 1ZCJA 4IOLA 4QL3A 3C14C 1VJDA 3TZCA 2QBYA 2TMDA 5J5VA 4XD2A 4EVQA 1E7YA 3ESYA 1OBOA 1L1QA 4BO4A 2AMFA 4D3ZA 2QOEA 1IBLB 3KZXA 1JBEA 1TMYA 5DMXA 4D80A 1ZUNA 4HTFB 5I9IA 1JQ3A 2W2NA 4IWNA 1VG0B 3BSFA 2Q07A 4K6FA 3M6WA 3SC2B 2SHKA 3GP3A 1DO0A 1GXSB 3GRCA 4K2AA 4OGWA 3X1DA 2ISCA 4BLTA 4BPRA 3P0FA 3WLTA 4MQ4A 1DCKA 2O4CA 5H82A 3BMNA 1Z6GA 4BVAA 5DM60 2WJ3A 4F21A 2DFNA 3EDQA 2X77A 3HB7A 2OCIA 3N05A 4DR2B 3TOZA 2ATIA 4KR2A 1N32B 2RHOA 2JGIA 4MINA 5C1PA 1ZNQO 1EP3B 1HLPA 1MB0A 2C2WA 4RPHA 3WL5A 5DWVA 4E12A 4MS1A 3P8ZA 2QX9A 3X1MA 2VDOB 3R9IA 1RQLA 3NGMA 4ZO9A 4F1JA 3QEKA 2UYCA 4DWJA 3A2MA 4G0VA 1QTNA 2TYSB 4PNHA 2FJPA 4IZHA 3OUTA 4LOJA 3NBXX 4FTWA 2P0AA 5ALTA 2XTMA 4AKTA 2HY7A 4F3KA 2BGJA 3OU6A 2L2QA 2XMRA 1MG0A 3R5SA 2XMZA 8GPBA 1G8HA 3GRAA 4KO3S 2UZ4A 4F4DA 1HDGO 1T2DA 4M88A 2HMTA 4RGYA 1UAAA 1FDVA 2QPAA 5GMOA 4BJ6A 1CJSA 3SYTA 3FTDA 3VAYA 4CNQA 1Q0PA 4CKCB 1AO0A 3FTFA 4L6AA 1ISHA 2UXCB 2C54A 3KO8A 3ZTTA 2WJIA 1Y82A 1FBNA 3BE6A 3K2IA 1DBVO 1FE8A 3ILHA 1QGOA 2HADA 2ZJFA 4LYHA 4ZV9A 3RS0A 3SQMA 2G4VA 4D02A 2EHDA 3TQFA 1R8XA 2HDWA 4HYTA 4NV0A 5IN4A 4LF4B 1CPYA 3ITEA 1D2AA 2DRIA 1UBKS 4FCCA 2CNDA 5EESA 2A88A 3WKEA 3IPYA 3FVWA 4UBOA 5FOTA 3C6QA 5DKFA 2W2VA 4MUFA 3VNSA 4GLBA 1NE2A 3P2MA 3TOXA 3Q2IA 3SVTA 4O08A 3DNMA 4R3WA 2HBYA 4NMWA 4C4PA 4UNRA 4QNMA 2F8SA 1T34A 2OXFA 2OHHA 1CBUA 2IV2X 1EXWA 3SFVA 1K2VN 4RQUA 2BR3A 1SUEA 3W8RA 1DCTA 4C4YA 4PZAA 3WJ1A 2YINC 2I2WA 2GPSA 3UMRA 5DW0A 1F20A 4PSAA 4RWZA 4BVKA 1UDAA 1XRLA 3RKUA 1TTTA 2C8LA 2IYAA 3RFXA 3ZK9A 4BFWA 4D81A 3O0TA 1T0HB 3L02A 2GO1A 3QW2A 2IEGA 3TQHA 4H7IA 5CPFA 5IKXA 2P6NA 2XXAA 1ZISA 1AUPA 4OFXA 1GAWA 2QMQA 4EH1A 2E85A 1XA3A 2VUSA 2BHSA 3ABZA 4N12A 2IS1A 1ZYUA 1G6Q1 3ETHA 2O1XA 4JMLA 4XRGA 4TXNA 3KFXA 1IBKB 1SCUB 4PLVA 3PQFA 1FOEB 4KXYA 1WUHS 4QAJA 3RSOA 4CG2A 1GHTA 4AKHA 4DDHA 5CXXA 3STWA 3D54D 2HJVA 3OZ7A 4TWZA 3CRMA 4II3A 1WY7A 3T5AA 2PS1A 3DZ8A 1Y3HA 3DL0A 4IQ4A 4AO6A 3O8DA 5M5BA 2ARFA 1W4AA 4GM4A 2NU9A 2CDAA 3IRVA 3CRVA 4MRAA 2XGJA 1II8B 4MLZA 3GFSA 3IIEA 1A71A 4ZAYA 4FBLA 2AGVA 3TH5A 2G70A 3P9ZA 4LOIA 4U02A 3RUCA 1S3SA 4B7CA 3CKLA 1OI7A 2Y2UA 4WNYA 3W05A 2UUOA 2Z57A 3NT2A 1A1SA 3I37X 2BHNA 4P4GA 2GNPA 4EPVA 3SLKA 3BF8A 3IA7A 1I9GA 3RC9A 1KK0A 4TWBA 3TL6A 1NAIA 1U0FA 1YOVA 4M7OA 3TLBA 5HF8A 1RHRA 3U39A 3NM6B 2JFXA 3OEHD 3R6WA 1JMYA 4DLPA 3ET5A 3S81A 4HI0E 2ZRKA 1QX3A 3FTCA 3U19A 2GSWA 5AJUA 1RXIA 4YPFA 2Y1OA 1SKQA 3PGVA 2KYRA 1HDXA 2GAIA 3ACDA 1H0KA 3HR4A 1XG5A 4G4SO 3VNBA 3VNQA 3WISA 1CQXA 3STHA 2IYZA 3PBKA 4ID9A 1V4BA 1SG0A 2BMVA 4UEOA 1T9BA 4LS3A 2A0FA 4MPJA 4RHFA 4XH9B 3EDYA 2DUMA 4KGXA 3UKJA 4AD8A 5LIPA 1YTUA 4NTZA 3K5PA 2IZZA 3TSCA 1L5WA 3WWYA 1Z8HA 1MF7A 3U5ZB 3JWHA 4UOZA 4X7RA 3C43A 5DLDA 2PE5A 2OECA 2YBDA 3AEQA 4OHVA 4Q4JA 4BIIA 5DMHA 2W83A 1P72A 2NZXA 1UJCA 4A6EA 4QUEA 1E9VA 2C2MA 1ZZGA 1QOPB 2WT9A 1VIVA 3I8XA 3LUFA 4MYUA 4P7FA 4PFSA 4PICA 1EM6A 1Q22A 3DZDA 1BKYA 4Q7JB 1TJ5A 1C2TA 1N5IA 4O4LF 3U6BA 3GLGB 1R15A 3UWPA 4Z2AA 5IUNC 1E4OA 1LLQA 2JLBA 4Y7CA 2D74A 4HNVA 1A5SB 1G2PA 5TARA 2AE1A 4E7OA 3LQ1A 3NYQA 1EX6A 3UAOA 1VPLA 2EX1A 1FYVA 2AN5A 1AJEA 4BO7A 1K5DA 1KNXA 2CD9A 2FRDC 4CM5A 2GBLA 5JMPA 1QCYA 3U5TA 1XNHA 4HWPA 3RTCA 3NKLA 2GYWA 2ZJ5A 2ZDHA 3ZUPA 4CF3A 1XRSB 2CUKA 2CXTA 5JYBA 4L4XA 3MT8A 2QV0A 2NZUG 2GLTA 1V8PA 1M72A 4DN6A 2LP4Y 2ZJ0A 1A98A 3ZE0B 1ZJJA 1MBZA 1RBYA 1Q1NA 1M8PA 4LSGA 1Y5LA 2MINA 3BX1A 2WVGA 3DKPA 4RV4A 3W5JA 4JXZA 5B5SA 5DZSA 2Z5GA 3EGDB 3RJ5A 2XUKA 2FEWB 3SF0A 3OZTA 1KKMA 1BFDA 5ALXA 1Z34A 5TQ2A 3TAXA 3VISA 3A8TA 4B79A 3ZWMA 1F8GA 4OSPA 2NQ8A 3IBTA 1OYOA 3VZRA 4LY9A 3JQQA 3OBIA 4N0PA 3DVQX 4EB6A 5HP4A 4U7DA 2ZUDA 3FKSD 4QHTA 5EI5A 3W4JA 5DNYB 2NZJA 4JYCA 2P2DA 4RMJA 5KX5B 4PVCA 2NXCA 3T61A 3BTSA 3DOCA 2WTMA 2X3UA 1JFSA 2NYUA 1MX9A 1S2IA 3X1ZA 5DN6A 1DXOA 2GCOB 3G8YA 2QUKA 4ZGBA 1MQSA 4ML3A 2G5PA 2V0GA 4WOKA 3KJIA 5AK5A 3P20A 4CLXA 3LKDA 4CODB 2BI4A 3JQ9C 1CJKC 1X15A 2YYAA 1ZWLA 5YASA 4PSDA 1JW9B 2ISQA 4W9RA 3GJ0A 1ZI8A 1RYZA 4LZJA 2E37A 4UNIA 3WQBA 3ZW8A 4QGSA 4PX9A 4DCTA 4WE3A 3GFRA 4YLYA 5HE9A 3T5PA 2XUIA 3VU9A 4MCJA 2GH1A 3ASZA 1O9BA 2C88A 4TQGA 2CB9A 3S8YA 2O8BA 2F1KA 1U9ZA 1GGHA 1NZDA 1SQ0A 2Y0EA 1YCDA 5G1OA 3R74A 3V1TC 4I5EA 2DJ5A 1VMAA 3MAJA 3K31A 1H6DA 3K94A 1M2HA 4ZN6A 2F90A 4NKRA 4E70A 1RHMA 5I01A 2FGKA 1E9RA 1VJ0A 2DULA 3HUEA 4J0GA 2WP0A 3OLZA 4H2DA 3RNLA 1Z6TA 3AB8A 1CXZA 3QBEA 5B57C 4EARA 4JY7A 5KWJA 2F62A 1Q11A 5LQRA 1WF6A 3MWDB 5AI5A 1FB5A 1UBOS 1GGJA 2RIPA 3KYDB 4RABA 4MRPA 1YZVA 4ZI2A 2W2PA 2LWIA 1FFCA 5HGJA 1U7QA 1O87A 3ELUA 4NR0A 1W94A 3OLWA 2VDLB 2COEA 2WVAA 3GBPA 1J99A 1G41A 3D3QA 3WIBA 3OHMA 4DV3B 4K6KA 2O05A 2WB4A 5B7NA 4MWZA 2C95A 2J9XB 4HGRA 2WAOA 5SZKB 2XE8A 3D1VA 3UG7A 2JGDA 3THOA 1I33A 2ODTX 1CDEA 1X9HA 4W5QA 2E55A 3IOCA 4AJJA 5FPSA 4OYRA 4TXMA 3II6X 4EX7A 4B3HA 1NURA 1EFRA 1HDEA 3UFXB 2KMLA 1CV2A 4H35A 4Q03A 3W6UA 3ITNA 2FHPA 3L43A 4FN5A 4U6NA 1DKNA 2A5LA 1ZMBA 5C8ZA 1BN7A 5JAIA 1NMSA 2IXFA 4NBNA 3QIAA 2XUPA 2EJWA 2PZGA 1RRGA 3M3PA 3IPAA 3ZIAD 1ODIA 5EHIA 2WAYA 3PUWA 3EAQA 3VVCA 4B3DA 1FDWA 1ZJWA 4DZTA 3DT6A 1T0PA 5EMNA 4YREA 3KOUA 2O2EA 4P92A 1JVNA 1XA0A 1ZH4A 3ZVLA 5E38A 3FHLA 4JFRA 2ONJA 4HPXB 2UYHA 3PXXA 2XUFA 2JFVA 4MKRA 3WB2A 1OZHA 1SUCA 1XPJA 1KU6A 1F38A 1U2GC 2P2YA 2WKSA 3B6KA 3B9QA 3NC1C 3ICPA 3NKFA 1BZYA 4YMWA 2BSQA 2ZP1A 5DYYA 2QY9A 4IIHA 2FKNA 4MS3A 1YR2A 3ZWKA 2QU8A 2H2DA 4P80A 4D46A 3ESZA 3CCFA 1CYDA 4XSVA 1DXYA 1JZQA 2QRZA 4ER5A 1GZDA 1DIGA 3NVDA 5K45A 1YFLA 1KVSA 4LXHA 3BICA 2CUNA 4G3XA 3R24A 2ACWA 4HZIA 4RO0A 4AQYB 5HKOA 4P5EA 2IP2A 3N8NA 2JATA 3E4DA 3I58A 1QJCA 4C06A 3I3OA 1T0JB 2ZZKA 1X1TA 2J45A 6AT1A 4EA6A 3ZY3A 1Y6RA 1CVLA 3AEKB 2B34A 3ROMA 3H2JA 5KSYA 2C20A 1V8ZA 2CVFA 4JA0A 3O84A 3NO4A 1MO4A 3FF4A 3AKCA 3OMXA 2ZAOA 1BNCA 3HU3A 4PC3A 4XKJA 1CF2O 2AXEA 2G06A 2VWGA 2ADFA 3JQAD 3T5BA 3T3DA 4Q1CA 1RACA 4LX8A 2J87A 2GS9A 4O4HA 4O4JF 1RPZA 5G0VA 1NF3A 2WD8A 3HYCA 2X0FA 1DAPA 2HSWA 3INNA 4BN5A 4IMRA 4TLBA 1FNCA 3HSKA 5C1OA 4IXTA 4CM1A 4DWOA 3FCXA 2H6EA 3DZKA 2JBAA 4FT2A 5DV9A 2QTHA 1Z7GA 4PBRA 5DK4A 1DI0A 1ZOSA 2WWTA 3PNOA 3VDNB 4KREA 2W6IA 1WDMA 2NYRA 1GV0A 1VZ3A 3F90A 3WK9A 3ZKWA 4A0HA 5GV7A 5JQWA 2O8VA 3PE3A 3LXRA 4EGAA 4OV6B 1VL1A 2PT6A 3RW9A 4M4SA 2DSNA 1ZUIA 3FDFA 4NFLA 4DLUA 5CDYA 2AMLA 3ICWA 3VJLA 3PNPA 3DR3A 1SQ6A 2CMHA 5HK9A 2A1TS 1Z4NA 1OW3B 2DY1A 3BGIA 5EHNA 3S2YA 2VJQA 4ACAA 1HH4A 4R1TA 4X54A 3RU7A 4HVAA 3H18A 1WV0A 2D2VA 3HBJA 3WLKX 4F86A 2D59A 1R8YA 1OTYA 2AA3A 1GUDA 2DR0A 4II2A 1W6UA 1N6NA 2HCFA 3KKQA 4KR3A 1TNDA 1QV7A 5DSXA 4IDCA 4OQLA 4WKGA 2M6LA 2QDKA 4E2FA 1QHFA 2DY0A 4RL4A 3A1TA 4WFIA 1YBVA 1PVDA 3DAFA 2OGSA 4I55B 2BT4A 4MHOA 4QO8A 3AP1A 3V7NA 5LKAA 2ACVA 3VU9B 3I32A 3LC7O 3T9EA 4J1SA 3OJCA 1RVV1 4A92A 3WLFA 2HQBA 5MGBA 2RKBA 5KTPA 4FPXA 3EOBI 3LA6A 1SD5A 1T6BY 3A36A 4G0OA 4TS3A 5DM2A 4CIBA 2VCHA 2HHCA 2E4ZA 3MCVA 2CNOA 1TT5A 1ZVKA 4MAMA 3Q3VA 2CXQA 5A4FS 2DCMA 2QN7A 2LDBA 5AVYA 3ND7A 5LOVF 4H6VA 5AI8A 3IT2A 3KELA 3ZHVA 1MZPA 1HV8A 2PSEA 1IPFA 2GN4A 1PSDA 3EZ7A 2XH8A 3JVUA 3DLBA 1DZIA 2LV8A 1YR9A 2GWHA 4QYXA 5EWLA 2XMPA 4IMIB 4POAA 2Q1TA 3KG2A 3DKKA 4UE3S 1P75A 3M9LA 4J03A 3O4JA 1SG9A 4A2CA 4UOQA 4BL5A 4E4YA 1L8QA 5LMNB 3K8ZA 1HDYA 4Y6SA 2V65A 1NNI1 4HVTA 1U3VA 2N1MA 5ITZA 3IEPA 1KIMA 3DAYA 1CY6A 2EBFX 3L8EA 4Q9HA 1GZ3A 3NVMB 4D0LB 1F7UA 1H85A 4AMZA 2ERYA 4ND7A 2XRZA 3NR2A 4R1NA 4IW3B 2VDRB 2NZYA 3G13A 1LV8A 5EZYA 4OMFG 1Z0KA 3GJQA 1W8IA 4CKCA 5LB4A 5BN3A 1K8RA 3MWKA 4LTDA 5FNVA 4GGPA 1U0LA 3EXFB 4E6PA 3V8BA 3LUAA 4NXNB 1KO5A 1RWKA 5KHAA 5ALWA 5SZHB 3RIGA 2YV4A 3VI3B 1GU7A 2PH7A 5K5EA 5J23A 2QF7A 4YCAA 4AC9A 3K7EA 1N2JA 5GJVC 4B6SA 1QP4A 3E81A 2B8NA 3ZIUA 3K0CA 4OXYA 3LHSA 2GOYA 3KBBA 4HUJA 1UMDA 1TECE 2B1IA 4NJEA 1J0EA 1YUMA 4ZCTA 3LDAA 3BMQA 5BUZA 1XVAA 2BZ0A