2YJ6A

Conformational changes in the catalytic domain of the cpx-atpase copb- b upon nucleotide binding
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
251
structure length
248
Chain Sequence
ALSLYEKMLHKGMIIKNSNVYEKIKEIDTIIFNKTGTLTYGTPIVTQFIGDSLSLAYAASVEALSSHPIAKAIVKYAKEQGVKILEVKDFKEISGIGVRGKISDKIIEVKKAENNNDIAVYINGEPIASFNISDVPRPNLKDYLEKLKNEGLKIIILSGDKEDKVKELSKELNIQEYYSNLSPEDKVRIIEKLKQNGNKVLMIGDGVNDAAALALADVSVAMGNISKNVADIILVSNDIGTLLGLIKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conformational Changes in the Catalytic Domain of the Cpx-ATPase Copb-B Upon Nucleotide Binding
rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
molecule keywords COPPER-TRANSPORTING ATPASE
total genus 68
structure length 248
sequence length 251
chains with identical sequence B
ec nomenclature ec 3.6.1.36: Transferred entry: 7.2.2.19.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2yj6A01
3.40.1110.10 Alpha Beta 3-Layer(aba) Sandwich Calcium-transporting ATPase, cytoplasmic domain N Calcium-transporting ATPase, cytoplasmic domain N 2yj6A02
2P69A 4HYTA 2YMQA 3ZUPA 1WZCA 3A1DA 3R9KA 2CFRA 2YFYA 5ALLA 4AP9A 3L1UA 3ZTYA 3WKEA 5AICA 5AKGA 3OCYA 4KN8A 1EK2A 3QX7A 3I76A 4YGYA 5AW9A 4NV0A 1Z4QA 3J7TA 1JUDA 2A00A 2WF6A 3R4CA 4XE5A 1YNSA 1ZS9A 2P11A 3FPSA 4Y2RA 3WKBA 1QQ5A 3RF6A 2JAUA 1RC8A 3U26A 3R09A 4E88A 3L0YA 5AM2A 5AKHA 3DDHA 5AW3A 4BNDA 3AR9A 4KYTA 1ZD4A 4EEKA 3PDWA 5A3SA 1RPZA 2IYEA 3KBBA 2I55A 2B1QA 3P96A 1QQ6A 3I1YA 3OCWA 2Q4RA 3M9LA 2YMMA 3WK7A 1RKVA 4Y2UA 4BX3A 1QQ7A 2AH5A 5AW4A 3QUCA 1O08A 2GHQA 3SF0A 3U13A 1RQLA 4C4SA 3N8GA 4UMDA 2RAVA 1WR8A 3QU9A 4G9BA 2A29A 3U7GA 2YJ4A 3KDPA 1U2SA 3AR7A 2FPRA 3QNMA 1Z4MA 3A1CA 1ZRNA 3OTQA 2C88A 2ZOSA 5AKEA 3WK5A 3WK6A 4F71A 1PW5A 3M1YA 3IRUA 1SU4A 3DV9A 1VJRA 3WGUA 5AVXA 5ALGA 3N5KA 4UASA 2VKQA 2ZG6A 2BDEA 2AGVA 3E8MA 3L8FA 2ZXEA 3L8GA 2WM8A 4MUMA 2B30A 2YJ5A 4Y2QA 3L0CA 4CE6A 4PNHA 4KX3A 2I7DA 3ZU6A 2OYCA 1XP5A 3MN1A 4BEVA 1U02A 5AK6A 2B8JA 4H1WA 1T9ZA 3U7HB 5AW1A 1ZJJA 3L1VA 3GWIA 5ALNA 3ZWKA 1NRWA 3QUBA 3IJ5A 1TJ4A 1TE2A 1Z4OA 2B8EA 4NABA 3SMVA 3QUTA 2R8ZA 1YV9A 1Y8AA 5ALWA 4BBJA 4Y3UA 2HOQA 1Z88A 4I9FA 4UMFA 5AW8A 3E81A 5ALXA 4RESA 5ALKA 5T41A 1CR6A 5AW2A 1S8OA 2JAOA 1U7PA 2HF7A 4YIHA 2QYHA 5ALRA 3A3YA 2P9JA 3SLRA 2O2XA 3ZX5A 1O03A 4UMVA 1YJ5A 4NWIA 4UM7A 5AKXA 4J03A 2KMXA 3L5KA 5ALSA 3ZVMA 3N28A 4YCNA 3AR5A 2PKEA 3BA6A 2X4DA 3I6BA 1T5SA 4EELA 1RDFA 1RQNA 2NO5A 2ODAA 3AR4A 3PGLA 5AKIA 1RMQA 2ARFA 5ALUA 1VFPA 2D2VA 3AR6A 4UAUA 2ZBEA 4BX0A 5ALEA 2C8LA 3ONNA 4F72A 4HGQA 1AQ6A 3CZ4A 3SD7A 3F9RA 2JARA 2YJ3A 4Y2SA 5AW7A 3RFUA 3UMGA 5AKKA 5IS2A 3E84A 4DWOA 3KC2A 2B1RA 4CNQA 1RMTA 5AW6A 2G1AA 3D6JA 1QH9A 2G80A 5AK4A 1L7OA 4O8CA 4HGNA 1L7MA 5A3QA 4Y2YA 3N1UA 4B6JA 3U7EB 4J2TA 3AR3A 2QLTA 3WK9A 2GHTA 1TA0A 5AKLA 5IT0A 3AR2A 3FGOA 4DFDA 2CFTA 3OCUA 5ALMA 2FPWA 3EWIA 2R8EA 4UU0A 1YMQA 2FEAA 4OHFA 4FFDA 1U2TA 5AI8A 2YJ6A 4YIKA 1F5SA 1TJ3A 2HDOA 1Z4LA 1K1EA 2RB5A 5ALIA 4HGOA 3ZI4A 3L0BA 4UW9A 3FZQA 4HAIA 4IFTA 3B9RA 3KOOA 1WVIA 3MC1A 4UARA 1ZD2P 3UM9A 3WKCA 1ZOLA 3I28A 5AVSA 1T5TA 1RKUA 5AVUA 3N07A 1SWWA 2C9MA 2R8YA 3QU4A 1RMYA 2PR7A 2I34A 1YDFA 1RLMA 4UMEA 5AM5A 2W43A 2B82A 5AVZA 4ZEXA 2HEGA 1LVHA 5ALYA 1N9KA 4HGRA 1KYTA 5E0OA 2EARA 3E58A 2FPUA 2FI1A 3OCVA 3ZVNA 2WFAA 4CF5A 1LTQA 2HSZA 3ESRA 3WKAA 2R8XA 4Y2VA 4ZEWA 3ESQA 1FEZA 4KX5A 4C4TA 1MO7A 2YMPA 4EENA 2IOHA 5AI0A 3NAMA 4CF3A 3UMBA 5AVTA 4DW8A 4ZEVA 2ZBDA 3ZWDA 2Q5EA 3IB6A 5AESA 2HF2A 4QJBA 2OA0A 1J8DA 5AVVA 5JJBA 3ZVLA 3QGMA 2EAUA 3ED5A 4GXTA 4OD0A 5ALPA 1Z5UA 4I9GA 4EZEA 5ALZA 3FPBA 3HLTA 1Q3IA 2HCFA 1SWVA 2GFHA 3WK4A 3FVVA 3GYGA 3WK8A 2G09A 5AI9A 3S6JA 4Y2TA 2YMLA 3AR8A 4BYGA 4UAVA 1YS9A 2WHEA 5FP0A 2CFSA 3FM9A 4UM5A 4CF4A 1ZD3A 5AK3A 2AUTA 2IOFK 3QLEA 2G06A 2KMVA 5ALOA 3ET5A 1CQZA 2IOFA 2G08A 3MPOA 3QUQA 4C4RA 3SKYA 2RARA 3WKDA 2GO7A 2YN4A 3U7FB 2PQ0A 1IWOA 1U7OA 3DNPA 2ZBFA 5AK5A 4XOUA 2FUEA 2YY6A 5AI6A 3NIWA 2FDRA 1Q91A 1ZRMA 1RLOA 5ALFA 2NO4A 4AS3A 1L8OA 4KNVA 4XQ0A 5AI4A 3A1EA 5ALHA 3HYCA 3QU5A 3ZTWA 2W11A 3QYPA 2OM6A 4GIBA 5AKYA 2BY4A 3CNHA 2I6XA 5AI5A 5AW5A 2IA5A 1L7NA 2HX1A 5A3RA 3PCTA 3U19A 1EK1A 3B8EA 1RRCA 3L8EA 2WF5A 4UU1A 4BEWA 4AS2A 3W5AA 1XPJA 5AKJA 2W4MA 4OFZA 3QU7A 3TLMA 1Z4JA 3SHQA 2NYVA 4FYPA 4BNDB 5AM3A 1ZD5A 2G07A 4RETA 3VAYA 3KD3A 2FPXA 2ZBGA 5AHXA 4Y2PA 1MO8A 4L6AA 3W5CA 5ALJA 1RKQA 2AMYA 3EF0A 4FE3A 4Y2XA 5ALDA 1X42A 2C4NA 2C8KA 5AIAA 3SKXA 5AM0A 3NALA 2HO4A 4EX7A 1Z4IA 4OCZA 3L8HA 3W5BA 2FPSA 1N8NA 2HI0A 4MWOA 2DQSA 5ALQA 2I33A 2MU1A 2P27A 1Q92A 3QU2A 3ZX4A 5ALTA 2JGAA 2RBKA 1Z5GA 2BDUA 5AVWA 2OBBA 1MH9A 3EPRA 2MSNA 4KNWA 4BX2A 3QXGA 5AM1A 3DAOA 3B9BA 4L57A 4YCLA 3OCZA 4EX6A 5AVQA 1VJ5A 3NASA 2FUCA 1L6RA 3ZW7A 3W5DA 2YBDA 5ALVA 1SVJA 2O9JA 3OCXA 2HHLA 1L7PA 4JB3A 2GMWA 1U7QA 3OPXA 4IG4A 4BKMA 4DCCA 4L6CA 3PGVA 3EF1A 2EATA 4UATA 1XVIA 3KZXA 1WPGA 3NUQA 1TJ5A 1Z4KA 3NRJA 5AKZA 4NFLA 3WGVA 5AW0A 1J97A 1S2OA 1Z4NA 2WF9A 4Y2JA 1NF2A 3UMCA 3NANA 5AVRA 2G0AA 3K1ZA 1QYIA 3BWVA 5IT4A 2JAWA 3ET4A 4G63A 1NNLA 2WF7A 3L7YA 2WF8A 2B0CA 4QQFA 4NAVA 2I54A 5AVYA 5AIBA 2Q4TA 4HGPA 4YH1A 1RLTA 4YCMA 1Z4PX 4XPZA 3MMZA 5AM4A 1L8LA 2CN1A 4JDPA
chains in the Genus database with same CATH superfamily
3F3YA 2GZRA 2P41A 3QA3E 1BGWA 4HYTA 4EW2A 3EPKA 4H3HB 3SVLA 5B2FA 5TF0A 4IIDA 3PEYA 3K30A 1RQ7A 5LQJA 1U94A 2RC6A 2YFYA 2QL7A 2HWWA 1OGIA 2IHYA 3BREA 1II8B 1NI4B 3FWKA 1YC5A 4YVFA 4O4JF 3RWMB 4U2KA 1WB4A 2AMLA 2XGJA 1IY2A 1DC4A 1UPUA 4RZXA 4B87A 4YDQA 2DC1A 3TI9A 4TV9F 2Y3IA 4B6FA 1DC8A 4MDFA 3H9JA 3C5EA 1WM1A 1CIVA 2QZJA 3DE3X 1S3SA 3MJ4A 1ZWKA 4I14A 3UEOA 3R09A 4LY0A 2VTEA 3QFTA 4JP8A 2M6KA 1U3FA 4XXHA 1DJQA 2C2BA 2QV7A 2W6JA 4R31A 4YS6A 2X8JB 5AJHA 4YUWA 2I67A 3I64A 1CTQA 1XJCA 4KAAA 2Z2KA 2I7VA 1MV8A 4LSWA 4G89A 4I99A 1AKVA 1NI3A 2X23A 4HLUC 1FP2A 1BCSB 1NVFA 1ORRA 3CLUC 3Q15C 3VAAA 1VFNA 1JG3A 2N47A 5JPIA 2XB4A 1KBQA 4YAEA 3TBHA 3W2TA 4O2BB 2WWRA 3C85A 3RYIB 3AI2A 4A8JB 3FYTA 1WLYA 5IEBA 5CPFA 3PXUA 4RADA 5DI3A 4ZO7A 5J5CA 1SBQA 3WLLA 4A2PA 1ZMRA 4UNPA 1K5DA 5G4KB 1HMPA 4ER6A 2QVGA 3E82A 1W44A 4GMKA 4HLQB 1NPDA 5ADHA 1PNVA 3ABZA 4TL7A 4K6CA 8MHTA 2WI8A 1AOXA 1SZPA 3IKVA 5GAJA 2RAVA 3QU9A 4HBGA 5JSYA 3ZCQA 4EHBA 3UMMA 1A9YA 1JG2A 1FLAA 3FB4A 1Q83A 5FT9A 2X15A 3WFZA 4KR6A 1B74A 2BHRA 1VL0A 3ZWNA 4Q7LA 4CBVA 3GFTA 4UVHA 1VHTA 1ZRNA 3EPHA 2C88A 4PPYA 3GNQA 5ES3A 3LSYA 1QGAA 1G3IA 2QTCA 1P2VA 2ZRCA 3CZQA 4ERNA 1JVSA 4RSMA 1HWYA 1TQ2A 4QL3A 5HKKA 2AZXA 1ZCFA 1CUUA 4YPVA 5E9AA 2ZXEA 1XJ0A 5CX1A 3L8GA 4E21A 3RDPA 2R5FA 3PUXA 4IOJA 5BSKA 3M6AA 1RI3A 3H3XA 1Q77A 2GJ8A 3ZNPA 1A5TA 4WNYA 1XXLA 2Y05A 3MTAA 1VMDA 2GKGA 1VL2A 2W2KA 3L0CA 4TN5A 3UV6A 2HMWA 5DYIA 2HXYA 5GWXA 1GNVA 2H8KA 3BRWA 2XZTA 5CVVA 4HUQB 4YB8A 4U7TB 4O4IF 1G8KA 3K0HA 3N76A 4OJYA 4YCCA 4YYZA 4R8RA 5HGXA 3R9WA 1QR2A 2G5CA 2XUFA 3OM9A 1U02A 5AK6A 1IL0A 3W78A 5TXGA 5DFAA 4WEQA 1ESZA 3OECA 3L1VA 3RGGA 2RHDA 1SG9A 4G4SO 3WQBA 3ZE7A 1H2AS 3RRNA 4AJEA 3R9IA 1C8VB 2Q99A 1T35A 2RFLA 2XQVA 3GZ4A 3IJ5A 1WB6A 5HCNA 1AK1A 1EWVA 3HJCA 4GKBA 4QEZA 3SF8A 2G72A 1WCIB 2M9MA 2GAOA 4RD1A 1JI0A 5CLGA 2IWHA 1VKOA 2YJTD 2QLJA 3BMNA 3FZYA 3K0FB 3LIIA 3NDJA 1U7UA 5CLJA 5CVJA 4AXXA 5G3ZA 1GPUA 1DBVO 1E8DA 2BKVA 1SK9A 1QCCA 1XV5A 2FLKA 2I2XB 2X77A 3RFVA 5C2JB 5HJ2A 2Q29A 5IWCA 1DUVG 1B0ZA 1MPXA 4ND5A 1GHTA 4BLOA 1E4VA 7ABPA 3SX0A 2H2HA 2IYLD 3FZGA 3HU2A 3DONA 1B14A 1J0AA 2V0CA 5KTMA 3SLRA 1I2DA 2BI4A 1YJ5A 1TCVA 2HMAA 4NWIA 2B4AA 1N8KA 4F46A 4IIHA 2JLVA 3THXB 2VSNA 4Y0NA 3SQLA 1TK9A 4FHZA 3IX7A 4IJKA 4L9SA 1DPFA 2D7JA 2D8AA 1ZUIA 2YIMA 5H3HA 2R79A 3IXQA 4BAZA 3ZVMA 4JXXA 2GDJA 2BFEB 1M73E 3IDQA 4XD7D 2IELA 5EXSA 1TZCA 3MF4A 3TDKA 1FFHA 4MRAA 4MR7A 1JBEA 1R5BA 3TQOA 3K0EA 4AJ4A 1XQXA 3S2YA 4X65B 1NFFA 2W6QA 2LCIA 3H2SA 3M6XA 1CCWA 3JYHA 5E6UB 3TRHA 4XVCA 2I5PO 5AKIA 2IIVA 1OZGA 5IJ9A 5LQNA 4HGZA 2GTPA 4WUTA 2BGTA 4MQ5A 2GT1A 3UA3A 4UTPA 3TQFA 1I36A 1MJNA 5J4LA 4R1LA 5G53C 2V58A 2C8LA 3DVLA 3PRKE 4IH9A 4MLZA 1CS4C 4S35A 5EJFA 4ZGGA 3HG7A 4INJA 3R7WA 3BF7A 4OLFA 1PZGA 1AQ6A 2E21A 1ZGCA 2DUJA 2XMCA 5I9MA 3V8PA 3WLTA 2JARA 4OYRA 2I6QA 3K8ZA 4UULA 3RUFA 1KP2A 1QS0B 1WHSA 2WD7A 2XNCA 1XZPA 3C43A 3NIGB 4RH0A 1PFQA 2ATIA 1YE5A 1RS0A 3AP3A 5E38A 5J4VA 2XCRB 1PLLA 2UUAB 2GN0A 3CRW1 1CHNA 2Q21A 3GUHA 1PG2A 5DX1A 3UKDA 4LNUB 4A2CA 1AT1A 4DWOA 5DWQA 5B2EA 4W5NA 4KP7A 1URPA 3C45A 5F7ZA 2O8DA 3HWX1 3W90A 4FJ1A 2G80A 3I9V6 3WLHA 3STHA 4EHAA 3LYLA 4BJ5A 2CVQA 4KYVA 3HY4A 4A03A 3O83A 4EB3A 4OK3A 3GMIA 1LZLA 4TPKA 4BZQA 4HGNA 1OREA 1HF3A 2PVPA 4RV5A 1K6MA 1AM4D 2VNHA 4GAEA 4GXRA 4JFAA 1RXEA 1V5EA 1XZAA 4J0CA 4K9QA 3AUSA 3KB8A 3AR2A 4PLVA 3HM9A 5LMUB 3R8FA 1ETHA 1M1YE 1THGA 1KH3A 1QQBA 1M1YA 2PA3A 1USIA 2CFTA 2ONKA 3VR5D 4EZIA 2HKIA 4DV0B 2VSXA 3GNTA 3QOXA 1Y6GA 3F7TA 1CY0A 2DWOA 3CJQA 3MK31 4HH0A 4OLHA 3G13A 5EWJB 4BZPA 4C0SA 2YXNA 4DLTA 5LPNA 1QGZA 2HDOA 5CAEB 3EULA 3HCWA 1X2EA 1DBSA 2PAAA 3HFJA 3JRNA 4P83A 4H4EA 4QNNA 3VXKA 3HJNA 4CT0A 3EARA 4H77A 2WT9A 2GUGA 4J75A 4RZ3A 4TYQA 3FHJA 4WBNB 1YTLA 2C04A 2ONCA 1D4OA 2CLOB 1DDGA 1ZN8A 1ZH2A 2RI0A 1CJMA 2ZE8A 2XH8A 4PS0A 4UW9A 4XJTA 5EL0A 2J6HA 2XUOA 1QZZA 2OZEA 3R7WB 5FUMA 1V4NA 1XKTA 4KEAA 1AKTA 2H3EA 3T35A 2IT1A 3D3KA 1IZ7A 3A1TA 4PVDA 4YCJA 1RKUA 5AVUA 3JPWA 4RX1A 4TXJA 2Q4BA 3B78A 1ZIPA 1QDLB 5H16A 2PR7A 5KQPA 3LXRA 1I4WA 2BM1A 3FETA 3HKDB 4X97A 4K26A 4YRRA 3WB2A 1NW7A 1U8CB 2KSQA 5JJ5A 2Y0BA 4G2TA 4MUEA 4UMEA 4DCGA 4I9NA 1X80B 2YFHA 1RFLA 4N5HX 3H18A 2Q46A 5CJJA 3EY9A 3KLPX 2YWDA 4C6TB 3RC7A 4TYPA 4UXHA 1K4KA 3WG9A 3WIEA 3QY9A 3KAPA 2QE6A 2ENWA 5D85A 1CUVA 1G9XA 1JEYA 4CF5A 2XWBF 2PANA 2HSZA 3MQFA 3EDYA 5B3KA 1YRQA 3I1IA 4KRYA 1H2BA 1T29A 3TKAA 2Y1OA 2Z0MA 5TMPA 1RWKA 4P4SB 2HMYB 1A9RA 3PQEA 2YMPA 3H9QA 4RL4A 4C4TA 2PT5A 3K6SB 1IBMB 4GC9A 1VCOA 3O8OB 4PNPA 2B3TA 4NZPA 1N4AA 3T7IA 2BJVA 4PSKA 1LFAA 1K97A 4FX5A 4OG2A 5AVTA 3TNJA 4MZDA 1VTKA 1BRTA 3FCEA 3FDFA 1TM5E 3KPYA 5DHUA 4D3XA 1WMEA 3CZAA 2IS6A 5A6SA 1FDWA 1ZIDA 5JJBA 1ADFA 2UV8A 4PR3A 4YO8A 3PFIA 3STWA 1PLJA 3EXEB 1PJRA 3AXSA 2R96A 4PFKA 2F3TA 4D02A 3GG9A 1J5PA 1ZPDA 5C18A 2YZMA 4OJNA 3P4UA 4EOGA 3SYMA 3TECE 3PNQA 1WUTA 2E4VA 1MQSA 4BRSA 3G0OA 1D5CA 3RVQA 1NC3A 2FRVA 4OHMA 4X0EA 5BPFA 5CT8A 1T8UA 1YRAA 3A05A 2Q45A 1GPLA 2CFSA 4CF4A 5TT1A 1JIQA 1RYBA 3ND7A 3QWFA 4GLLA 5FCDA 1X8XA 4IVRA 1LK7A 1CERA 1DV2A 1M54A 1NLZA 3OZBA 5EMNA 1CQZA 1PQYA 1R10A 1CUFA 3T61A 4AU1A 4RNCA 4LE1A 3IR6A 2HXSA 3T5MA 3ZLVA 3JZIA 2DLNA 3PC4A 4I66A 4E6EA 3EGOA 4EJ6A 2G08A 1QC5A 1WQ1R 2HHCA 3D3QA 1U7XA 2YXBA 4LY6A 4PFJA 1A7JA 1MC1A 3R8CA 3QEAZ 3ONVA 3CEPB 4NI5A 2YVKA 1JXQA 1M6HA 3OQBA 3P9RA 4TQ9A 5ECWA 1L5FA 3DNPA 1U0JA 2XLBA 4XSVA 5J63A 4L75A 1QIHA 2ZBFA 1XKQA 2PWYA 1OASA 3MTGA 5JJIA 1ZK2A 4DHWA 2NV6A 1W5TA 2QTBA 1PEAA 5JBNA 5I47A 3ZJVA 1Q91A 2FW0A 2BMDA 4AKSA 1TCBA 1C81A 4BFXA 1KI8A 2C59A 2OTCA 3Q3GE 4YP6A 2RD2A 3WRYC 4DT1A 1JDSA 2ZSEA 1N32B 2XY4A 1U5AA 5JUWA 1M2GA 3HR8A 1IUPA 1DO2A 1RQRA 1O2DA 1CZHA 4CM6A 2CUZA 3G1TA 2IA5A 1WUIS 1PFWA 4QPPA 2QZ4A 5G4KA 3B1YA 2VT2A 3BCHA 5A5GA 5L9AA 3TE7A 2ZAIA 4U5QA 1L6IA 2IYWA 1OGYA 4FILA 4NJMA 3VSEA 1GNLA 4QU8A 2B4YA 1UBUS 2GZ1A 3I12A 4JBXA 1RHRA 3PR2B 3RV4A 5C1DA 4ACBA 4DE5A 4EGSA 1E5TA 2AEFA 4N82A 4R2XA 3VPBA 5AHOA 1P80A 1A4XA 1UJBA 2BEJA 2VT7A 3AT1A 3EGXB 2ZSIA 4ONEA 4B44A 2QD4A 2QY6A 4JYMA 4ZDIA 2XB9A 5FADA 2A9QA 1SQ0A 4XDYA 5DXAA 2C2GA 2QAJA 5FJIA 2KW5A 1U8XX 2GK3A 3IUBA 3O91A 1FLVA 3ABIA 1K86A 3GAAA 3P2YA 1SVNA 4ZGBA 3ZY2A 2C2OA 2BKEA 4OQYA 2YY5A 4Q3NA 2BWJA 2MR6A 3FPAA 1EHCA 2CJWA 1U7TA 1WCIA 1YIOA 2QHXA 3DHNA 4KLCA 3D6TB 2M1ZA 3FCXA 2XDQA 5K3FA 5EMHA 4YV2A 5I9NA 5JZVA 2GRJA 2C8KA 1CDDA 1PP4A 3KUDA 3T9EA 2PRKA 1JMYA 1P19A 4MDEA 1CZUA 5K0BA 2DGDA 4BNGA 3LYUA 5FUVA 5SYAA 1Q21A 1KI6A 3CT4A 2BCEA 3KHKA 4YCBA 3PNLA 1K8YB 2DPHA 2PWBA 2IEAA 3AEQA 5G40A 3VKFA 5BMVA 5BYBA 4HV4A 3H2ZA 3EEFA 1SHTX 3Q7TA 1LU9A 1XJWA 1HTBA 1U9CA 2H85A 5L3SA 4IJQA 5L3QB 1M83A 4RKFA 1YGPA 1RYDA 1Z5WA 1II0A 4QPZA 2OBBA 3TLJA 1L3CA 1Q12A 2YXEA 2C9YA 4LYDA 3DDNA 2DSTA 3F0TA 4QUDA 1HT0A 3H4IA 5FNVB 3AOEC 3R5KA 4J7AA 3LHFA 2QN1A 5CB0A 1D6NA 5LA6A 4BCDA 3PWKA 4QTTB 4U2DA 1GZDA 1GG8A 2UZ0A 5DKFA 1CE8B 4LKRA 3KKQA 2Z56A 4RPIA 1K89A 1Z7EA 3O03A 3RS3A 3RRBA 4YV1A 2UZ3A 1BA3A 2GNOA 5CFOA 1EXDA 1E9SA 2CBZA 3IT1A 4DV3B 1LLFA 1NV9A 5ELMA 4LJKA 5LQAA 4TGLA 2WBLC 4Z4FA 4TRNA 1ATZA 2OXTA 3N0XA 5F1PA 4A82A 1PK8A 1FVHA 4F93B 2AW5A 1F3LA 2CF5A 3EGIA 3GBSA 4FW8A 4NK4A 5DYTA 1KDYA 4DCCA 3HZZA 4OYHA 3NPAA 4QWWA 2ID8A 3PDIB 1VL6A 1R50A 1WXGA 3O21A 3D4PA 4PY2A 4BQQA 4IJUA 2NAFA 4RF3A 4UJ5A 3BHMA 4R2KA 1CLUA 1JYSA 3G2JA 4EJSC 1IN4A 4YUAA 3UJAA 3L3BA 4ZODA 1S2OA 3G2PA 2Z3VA 1I13A 3KCNA 5K2OA 1Y89A 1E0AA 1LDGA 4HWRA 3VVMA 3FW1A 4KAFA 3WMWA 1FF9A 1FYWA 4MO2A 3AHDA 1RAAA 1KJJA 4A7PA 2JH9A 4KIFA 4RPGA 3NBQA 2J3DA 3C39A 1Z0SA 3KR2A 4HHEA 1T5HX 1XTZA 1YBVA 4O4JB 2IU3A 3M1IA 1QIJA 2QRQA 1C3OA 4NZMA 2FXVA 4D7AA 721PA 3EODA 4O25A 3M6WA 4II2A 2HBZA 1YJQA 3ZY6A 1Y7LA 4LOKA 2EP5A 3V1UA 4KXFB 4CN8A 3NH9A 4F5DA 2IS1A 2IC5A 1O94D 1OUMA 4TLAA 4LYEA 3OP1A 1ZICA 4FI3C 1T3TA 3TYXA 2QG4A 2V1UA 2YL2A 1OTHA 3CVVA 3BXHA 3FDZB 3ZHQA 3PEVA 3V4VB 1DCKA 1JHRA 1HRDA 1X14A 2REBA 4OXXA 1ISRA 1O5TA 3V33A 2NX2A 3PXBA 4OGLA 4D5GA 1KEKA 2FW7A 1C7EA 2XUAA 1DUIA 3NTLA 3U7QB 3MUOA 4BGDA 3LC0A 3LXUX 4ZANA 2LNDA 3P32A 3JVVA 4QO8A 1QPBA 1Y37A 2IXFA 2O4UX 3H1AA 1XQ1A 3MCZA 2ZJ4A 3NEYA 3ENQA 3THRA 2YS6A 4ZT3A 1RT9A 3JU3A 4QBGB 3UCXA 3OCYA 5H4GA 4NCJA 4EVRA 3JATB 1EK2A 2ZRGA 3DL4A 3GRRA 5H02A 2QQGA 3JATA 5JVDF 3NC0C 2OAGA 4PYLA 3ZD8A 2HSJA 4Q9AA 1EI9A 3J7TA 3N7AA 5GPBA 2IYRA 4YRTA 4GF5A 2A00A 2I8AA 3MINA 3BWBA 3PC8C 2FMUA 3UAGA 2Z2XA 4DEXA 4F2HA 2UYHA 4K86A 3KYCB 4FC7A 3AQIA 4R6XA 1RP7A 2PNJA 2RE8A 2GHIA 1R66A 2YW2A 2D5AA 3LCJA 1JAYA 1K7SN 1TUGA 5FOXA 4RIFA 6AT1A 3QVSA 4MKGA 3ZD6A 1FQKA 2O2GA 2H2FA 2FG6C 4FZ3A 4PC3A 5HZMA 2A9VA 5CT6A 4QG7A 5CCXA 1SUIA 2VK4A 1RAGA 2MHCA 4LC1A 5H8WA 6GPBA 1GUZA 1L4UA 2ZLBA 4YDHB 4WJLA 4LISA 3FFAA 1W4RA 3DKPA 3N8HA 4V0SA 1KXJA 4QYWA 4BDSA 1GPNA 2KPOA 3HA7A 3KLBA 5H5JA 4DYHA 3OFNA 2RCNA 3I83A 4C9BA 1E2FA 2RONA 4PG8A 1YE8A 2GLXA 2H31A 3E35A 4DARA 3ZHUA 5BRAA 4MMZB 1SXHA 1MV5A 1WR8A 2OHGA 4G9BA 4H6XA 4OSOA 4HS4A 5ILQA 3H9EO 4AB1A 2IBSA 1CR2A 1T2VA 2RKOA 3FROA 4QXMA 4ZI7A 2D0PB 4PG7A 1L5YA 3DOCA 5TGZA 3GA0A 1NW8A 3CCCA 2EKQA 3S29A 3N2YA 1M1YB 2DTEA 3ZE9A 3KQMA 1R0XA 3L06A 4AZ3B 3TZBA 4JBWA 2VH1A 3ROZA 1G4UR 2EIXA 1JDUA 2Z57A 3P20A 4JI3B 1U0OC 5AVXA 3N7UA 2Q8QA 4L4XA 3N5KA 4FHCA 2RJOA 1I0IA 2Y2UA 3BXGA 3GXOA 4UE3S 5JISA 5LXTB 3X3HA 4D3FA 3KZCA 4QJIA 3MFQA 4DA0A 4E7PA 4DLVA 1SCJA 2VRNA 4P5DA 3SIRA 3FIUA 2ZETA 4EL5A 1E89A 1IVSA 2VNJA 4EW3A 1NUTA 4OATA 4ZOLF 2RK3A 4B45A 4CM8A 3SZMA 3PD1A 4JB8A 1RM3A 3BXFA 4HRYA 4JOQA 4PZAA 3HUDA 3LPAA 4MVJM 4AIRA 2WWTA 5ALNA 4AKIA 3EEBA 4MWEA 2YV4A 1KFEB 3QUBA 2I66A 4H6PA 5BW4A 4LS3A 2W2MA 2WZBA 4H7JA 3W9BA 3BK2A 1BCSA 3JS5A 1ESDA 2X76A 5F98A 3EH1A 3OOWA 1LW6E 1E3SA 3PQDA 5EVJA 1T5OA 1H2ZA 2AN5A 1IY9A 1EFUA 4UMFA 4I9FA 4XFJA 4JQOA 1Y6ZA 3EAGA 4YJDA 3HJHA 3S2SA 5BV7A 4AP6A 3QHPA 2LXNA 2VQEB 2Q5FA 1K6IA 2VP2A 1IU9A 4RKRA 3UOGA 4WZ6A 4DC9A 2ZRNA 4RS4A 3RKRA 1IJFA 1S1CA 1P61B 4IMIB 3V2HA 4MVJA 3W06A 4ARSA 4D41A 5I4KA 4XPIA 1G8HA 2VPIA 3C6BA 4FFLA 4ZYZA 5CA1A 3M33A 3RVSA 5IHPA 4ZT5A 3KZNA 3P5SA 1UFVA 4BNNA 2WSIA 2OPHA 4X95A 3SZGA 1MTZA 2A0FA 1FFXA 2VNSA 3FUCA 1CUYA 1DB3A 3JYOA 3VZPA 3FR7A 2PZKA 2CSUA 1X1CA 2XRYA 3FCOA 4BNYA 3K9CA 1DWPA 2NACA 3QVGB 2C1ZA 4OMUA 5DBOA 3E15A 3VBEA 1XPOA 4QOEA 1XDWA 2PUTA 4MKXA 2ZBPA 3MS4A 1RDFA 4WN9A 3PGLA 4LF5B 1ACJA 3D2BA 3R7DA 2BFBA 1XMJA 1ENOA 2A33A 1DU4A 3BUSA 2BCJQ 3Q0TA 3P45A 2ZBEA 3MW8A 1NG9A 1OGJA 4C6HA 4H7DA 1XB2A 2VAVA 3OWXA 4I5EA 1W36D 3PQ8A 3IDZA 3TCNA 5A4FS 3Q4GA 2HQ1A 2Q41A 2YJ3A 4R01A 1T0JB 4HBZA 2VP3A 3H4VA 4ABYA 5I7FA 2QSJA 1O96B 3D6FA 4LX8A 3H5TA 3O82A 5FI5A 2MSDB 4JL5A 3E3NA 4Q47A 2IPXA 1Q84A 2LR0A 1A1VA 1E3DA 2HBRA 3OIYA 4BLVA 1OA1A 3H5LA 2PUHA 1NVVR 4QBIA 1RMTA 1Y5NA 4B7UA 1QH9A 4WXYB 5BY2A 1WY7A 3A6DA 3SJAA 5KJFA 3UMYA 2NXCA 2QAIA 3L02A 2ZR8A 3TZKA 4GKJB 3ST7A 4KREA 2FRDC 5K9ZA 4YAJA 3L8DA 4FGKA 4Y6OA 2Z2YA 3PC7A 2OCYC 4Q7JB 1XG5A 4EPRA 1QKIA 4HQLA 4Q0MA 2B4KA 1T2NA 1Y7PA 2XWJI 3OMXA 1SAYA 3R5FA 2QY9A 5EUBA 3HR7A 3UBMA 1XWFA 3THOA 1C0IA 2ID4A 2AS0A 2JI6A 2WA1A 3EXAA 5IDQA 2Y71A 1G19A 4AG3A 3F4LA 3LUFA 2X1VA 2VDLB 5LL6P 5AI8A 4PW0A 1U0EA 3P4XA 1B42A 1H6CA 2PSEA 4RKEA 3HY6A 5IAGA 5SZHB 2CDRA 4I50B 1XN4A 1MCZA 3PITA 1T13A 3KT3A 5FULA 5B1DA 4BMCA 3RM3A 3ZI4A 3KWJA 4MR7B 4Q19A 5AR1A 2OQVA 1G60A 4EP1A 3G5TA 2I6UA 3RYCA 3UWPA 4B2LA 3VR4A 1E6EA 5EIBD 4MYHA 3WWEA 2O14A 4YHBA 3OZFA 1G0OA 2P2SA 2QR5A 2VHCA 2DRIA 1SB9A 1TU3A 2OENG 3MHPA 4FCWA 2EL7A 3RBVA 2GN4A 2WB4A 3NVKI 4WOKA 4NU6A 5G4LA 4LMBA 1DTSA 1YIAA 2HHAA 3TLGB 1KU0A 2CNDA 1F0KA 2C9MA 4UTXA 3MJHA 4O5AA 4DXAA 1KSGA 5KYGA 3V7WA 2YYSA 2OZLB 3AI3A 5TT0A 1DJNA 1J90A 1EUDB 3NVDA 3S1AA 2G5GX 4TSKA 1FIUA 3C3XA 3SSOA 5B36A 3QE9Y 4G23A 1SUPA 5AM5A 1EA7A 3AU8A 1IE3A 1SKUA 4NARA 4BRZA 1HORA 2ILVA 4L4SA 5K3CA 1TTTA 2JFZA 3O5AA 2ETXA 1R8SA 3ETDA 3PZRA 1OHHA 1D7OA 1BXZA 2WFAA 1SKBA 4OMFG 4ZYUA 4WKNA 1DSSG 3JR7A 4GM4A 1WBJB 1KS9A 1DX4A 3EGDB 2VDPB 3P9SA 4BVFA 4ENSA 2WU8A 2XVZA 1TVCA 3NPMA 3BC1A 3EXG1 4IKOA 4MV6A 4JI5B 4NNOA 5IT9A 4CF3A 6ADHA 4RA6B 2ST1A 2HBYA 2ZRDA 1D2EA 4FFMA 4RF2A 3UMBA 4AW9A 2WHRA 3WYNA 4R2MA 2C29D 1UDWA 4M0KA 2ZYGA 1J21A 4A2QA 3W2GA 5BWLA 3IQWA 3U4CA 1IBCA 2C0CA 2J3MA 4ON9A 1XELA 1J8DA 3D4BA 4WJZA 4KG7A 5DIFA 2BEVB 2OA0A 1FNBA 4Q9LA 3V8NA 4JUDX 3NVAA 2ZJ1A 1MVLA 4J2HA 1RWOA 4HXEB 2ONJA 1GPBA 1R74A 5H59A 1U8TA 4QUKA 4BTVA 1JFSA 1FX0A 2B6HA 1US8B 3K0CC 1VXOA 3BDVA 3WK8A 5AI9A 5HQ3B 2Q7XA 4PPQA 3T3MB 4CEIA 1CUHA 1H2EA 2K6GA 4P53A 3UCFA 2HZ7A 4ENVA 3MYRA 2XADA 1Z82A 2I4MA 1BKYA 5FPKA 1T3LA 2H06A 2HWKA 2V65A 1WIWA 5LUAA 4NOJA 3ICPA 3TNFA 2IOFA 3MELA 5E4TA 2PKCA 1KIAA 2ADMA 2OORA 4KMMA 4E2FA 4ZYTA 4GXNA 4TMXA 1AQLA 2PS9A 4JEHA 3QUQA 4TS1A 3ZHVA 4H3KB 2IU4A 3R41A 3VR5H 1AGYA 1O87A 2X8LA 1AGXA 3CB2A 1E96A 4B76A 3R75A 4RSHA 3P9NA 5LQDA 3LLVA 2O1XA 2VJOA 1SCBA 1VB5A 3ZR4B 3AEZA 2DPXA 4HDOB 2FW8A 3CEAA 4ZAVA 1N25A 5TB5A 1O0SA 3CUKA 3ZIDA 1KI7A 1O5OA 1D07A 1ULSA 3A1EA 1AN9A 3IE1A 1NULA 2KQUA 4LBWA 4A3SA 5B6IA 1TD9A 5L3SB 5LNK6 1NASA 3G0GA 1OH8A 1XRMA 4YMIA 4HMOA 2QJTA 1GNTA 2GM4A 5CK4A 1P2FA 3VTZA 1PJ2A 2W0MA 4J91A 4CCSA 1R0CA 2ZB2A 4F6CA 3TINA 2I6XA 1UQTA 3UUFA 1B8OA 2ACWA 2CVHA 4DSAA 3DS8A 4OUDA 1RBZA 1CU1A 4RTMA 1AJEA 5L8VA 3KQTA 2WFMA 1Y42X 2FHPA 5HIMA 3EBLA 1XZEA 3PQFA 1CLEA 3TVYA 4YT8A 2RHGB 4CETA 1H0KA 5IWAB 4LVNA 4L4YA 4OAQA 2VBCA 2WUWE 2ZIGA 2G9QA 3LGXA 2VAMA 2NVUA 2XF2A 4RBNA 2DZDA 2GF2A 2REXB 3BL6A 3QU7A 1K7YA 4MQEB 4RJIA 5AOVA 3TLMA 2AJTA 1G7CA 4YP7A 1BXKA 1H8EA 1WXXA 1Y8RB 2OP1A 3PWSA 2QGFA 4IQGA 3DO5A 2YHAA 2BFFA 4QWMA 1S3GA 1ZCJA 4Q1BA 1LJLA 2F3SA 3DL2A 2F8TA 2HRRA 2ZRIA 2PLAA 3LWZA 3CLHA 3IR5A 2JLWA 4UDOA 1JVBA 1P0PA 3HZOA 4LWOA 2BE7A 2II6A 2H8GA 2WK1A 4Y2PA 5IT5A 1W9MA 4ZOLB 2FKNA 2P30A 5HCUA 1IN6A 1VSTA 5FO1A 3L18A 3RG8A 2EKLA 3SDSA 3TB4A 1U9JA 3E0QA 3U49A 1NE7A 1ZI9A 2XRFA 1GGJA 3MUFA 5AIAA 3VR5A 4D74A 4QBFA 4G0MA 3GQBB 5G41A 4WXEA 1CZLA 4IOLA 2YC2C 4CFZA 4UFNA 3UB3A 2GAAA 5M7EA 2IWRA 1N8NA 3AZOA 1RCFA 2I7XA 1IOLA 2H11A 1Q1ZA 1NZFA 4TMZA 2I33A 3GPDG 4LXGA 4G1CA 4MVJG 5A4KA 2XCOA 3QU2A 3ILVA 4R05A 1JXAA 3K2EA 3ZWAA 2FFRA 2JGAA 1CUXA 2BDUA 1Z5ZA 3FSGA 3U39A 1XF1A 3SQXA 5LNK1 1I10A 2FH5B 3H86A 2FA9A 1MX1A 1TUBB 3FAKA 1GT6A 5ICMA 1SCNE 4J4BA 4MA4A 1S3IA 4M9CA 1NL3A 3WNCA 1QTNA 3LS2A 1DV1A 4EQ6B 1KAQA 1NN0A 2DX7A 1ITZA 1KKMA 4Q01A 5AJUA 1DX6A 2X0EA 1UK8A 1Y80A 5M3BA 5KX5B 3VZCA 2PGIA 2CY0A 2C8JA 1IHUA 4BN0A 3FOEC 3QYAA 2NPFA 4TS4A 3TLKA 5A03A 1BDHA 3DWIA 3D64A 5KTKA 1FXWF 4LYAA 2NUTB 4Z6KA 1T24A 5IXYA 3MA0A 1SVJA 5L40A 2O2IA 1CVRA 3H11A 1TTHA 5JMOA 5GVRA 3HTXA 1GL6A 4F3TA 5HF9A 4DQDA 2EWWA 3M4ZA 5ICGA 5E8RA 1U7QA 1MRSA 4F38A 2Q3DA 3FCCA 3OLWA 1PIWA 3IQIX 4J0HA 4NBNA 4PAGA 3TL6A 1UR5A 3E1SA 2OYRA 1M8FA 2GCEA 3C0KA 3SOZA 5DCWA 1PZHA 1M1UA 4F3NA 3JAKA 4B74A 4HVCA 3ZH2A 4LHXA 1KRHA 1T6NA 4QGSA 1UBNA 3KWLA 1AIPA 3IAS1 5FPSA 1B3RA 1EX1A 1OXKB 3N70A 1X70A 3OFND 5B7NA 3NANA 5KJ1A 3DKRA 4A0FA 3TRKA 3K1ZA 4JUCA 4J1QA 4Q1VA 5H80A 4YAKA 5IJ9B 4V1CI 1AA6A 1MX5A 4OH1A 4TT3D 1SIOA 3AV0B 4MWSA 1USGA 1WTAA 3WGQA 3ZV3A 4OFWA 4PNZA 4MUBA 2H16A 5DTQA 3D8TA 3QYFA 1GSIA 1B7GO 2REOA 3GJ7A 3OJWA 2E4XA 3FFXA 3HCPA 2B0CA 2QUBA 3FB1A 1SQ6A 3G0CA 1NN5A 1U7ZA 1Y63A 1P33A 2OGSA 2R00C 4Q4AB 5J1TB 1B1CA 1OLXB 2O8CB 1G3MA 2DH5A 2IHVA 1ZW6A 3BS4A 3UTCA 3T0FA 3LBFA 1MOQA 2IV2X 1T6XA 2OBMA 4EAQA 3LAWA 4GYWA 3VPAA 3HE3A 1SHKA 4KXYA 2P69A 4DV2B 1YZKA 3GFBA 1IVNA 1WF6A 4QASA 2PDAA 1ACMA 1W94A 4MPTA 5E7JA 4PXYA 4DQXA 5A4DA 2AC4A 5DK4A 1OAAA 1AVTA 2CFRA 3DZBA 2A5JA 3MGCA 3HCCA 3OJ0A 1KO5A 1FZTA 5E6SA 4C4ZA 3BMOB 4DRZA 5IN5A 1DADA 2HU2A 3AL0C 2BI8A 4PV7A 2RI6A 5D5QA 5AKGA 3T3IA 3VMMA 1NX9A 3AY6A 2MMGA 3VNAA 4B9AA 5LM3A 2G7ZA 2J3KA 2FR0A 4IKEA 1NXXA 1OKKA 2ZBRA 2Z95A 3DFMA 2PZGA 2SCUA 5LWHA 3JWPA 5A2QA 3P2KA 1N9GA 4HN4B 4UU8A 4OB7A 1JFRA 4LHVA 3K1YA 3CVJA 3MRSA 2P5YA 4UJ3A 4JK3A 4ARZB 4CM8B 4CM9A 4B34A 1UQUA 4H1HA 1EINA 4KQEA 4LYGA 4P3XA 4RPHA 3WHPA 4EEKA 4Y2HA 1PNTA 4D4JA 3KBBA 5HS4A 2LCFA 3UQZA 1RHKA 2VDWA 2Q3MA 3GEIA 4BXOB 4MRMA 2EG9A 3M2PA 3KSRA 3IEVA 2IHBA 3Q87B 1FMFA 2VIIA 2A86A 1E3EA 3KSDO 3OIGA 1IH8A 3RVJA 1LI5A 4PU0A 1W36B 4MEBA 3O1JC 1BMQA 4G1EB 1C3OB 4RCYA 3I1FA 5LDHA 4O4JA 3WBBA 1J9EA 4YAWA 4JLBA 4H6VA 1A9XA 3ZN2A 1H2WA 2FZKA 4UBJA 4I4TB 4PPGA 3F1LA 4AZ3A 4KFCA 1B73A 3HADA 4EO7A 1Z4MA 1KPGA 3A1CA 4MKRA 4QG3A 1E2BA 1Q95A 3EEIA 1DNPA 2FTKE 4EFKA 3AVXA 4D8UA 2WFLB 4P35A 3OU7A 4G0PA 1DKPA 4G5RA 1XDGA 2QG6A 4QFBA 5G3YA 1G21A 1ULZA 3ZZUA 1XEXA 4F9FA 1N78A 1VYTA 3FIJA 3FPFA 2BFCB 1UJ5A 1Z7YA 5HCIA 2ZJBA 4QQ8A 1E20A 4JR2A 5BQ5A 4W6QA 1J22A 4TMKA 4AJIA 2Q5QA 1ZA2A 1ZKDA 3K9NA 1XR3A 2DULA 1KBOA 1BVUA 1M7GA 3RSOA 3TQTA 2KBEA 3WRYA 3RYFA 5FNVA 2EKDA 4A1FA 4HDMB 1BROA 1W8IA 4HFMA 4MUMA 2K87A 4Y6GB 3X1XA 4BKPA 3SYTA 4KPUB 3FMIA 2WSSD 5CYOA 3O7WA 2ZREA 3E9CA 1T3GA 5AMXA 2E0IA 3GT3A 4B33A 5DNEA 1F6WA 3WFJA 2C5EA 3CUYA 3KOZA 4R7ZA 3L4JA 1NMYA 2ZIZA 2LE0A 2O0MA 3D31A 4CEJB 4BEVA 4LXUA 3STTA 1ZRHA 4I8IA 3QF4A 4EGCB 4NJEA 1A96A 5KREA 3RYIA 3ZYZA 1MO3A 1CIJA 2AN4A 2XW6A 4U1RA 5I45A 3IP5A 3ACBA 1P2UA 1JB1A 1TE2A 5GMOA 4YUVA 1Z4OA 1MO2A 3BRWD 3Q5EA 3NTVA 4REOA 4B0OA 5FWXB 1HKHA 2PWPA 1Z29A 2YJGA 3UJDA 2AZMA 3GI1A 4YRJA 3OA0A 3V55A 1HFJA 4GG1A 3C7AA 4NFSA 4AZWA 3N8NA 1DIBA 1G3RA 3AHHA 3NP7A 3KZMA 2A58A 3TN7A 2IYAA 5AVOA 3ICEA 5FR1A 2G71A 3WICA 2QIOA 4RTQA 4LE2A 1X19A 4H35A 4KVAA 3IP3A 3L41A 3GEEA 1XCBA 4W63A 4QUIA 3NJRA 3R20A 2F2TA 3K15A 4BJ6A 1O7JA 3Q12A 4XARA 3NBAA 3L9WA 1PL7A 1QIIA 2RK6A 3WDKA 4HNTA 4V1CB 1F51E 4G0OA 3UT6A 3ZX5A 1GCIA 2CDCA 2CMDA 3GJ4A 4RZHA 1E4EA 2NYUA 4K6HA 4D3SA 5C5IA 5IAAA 4H17A 3WO1A 3AOEA 4IIUA 4N40A 3L5KA 2FMHA 4RCVA 3X2FA 2UXBB 1ZL0A 2PLWA 4BRWA 1SC1A 4RS3A 5GIPE 3PT5A 1DAMA 1UH5A 5BN3B 4NY1A 5LYYA 1NF8A 1CZNA 4FLMA 2AVNA 4L0MA 2R7AA 2HFJA 1J2JA 1JKJA 1ZA1A 3BEDA 4M98A 5JH7F 2DY0A 2BF7A 3TVTA 4KJXA 1JW9B 5IFLA 3Q9LA 5HOQA 3PTAA 1VLJA 3DPUA 2PGXA 5IUKC 4GM0A 1VFPA 1NI5A 1YKSA 3WAKA 2GBPA 5HPYB 1AQJA 4UAUA 4BX0A 3AUYA 2HK7A 4QXAA 1AKWA 3DC2A 1ATIA 4DSZA 1IAQA 2IYFA 3ZZMA 1EDDA 2Q3LA 5A3JA 3O2NA 3HRHA 3CGWA 1U2EA 2GH1A 4L3WA 2EBFX 4X7PA 1KYVA 2JGKA 1E94E 2IEGA 3PDIA 3HCEA 2GO1A 2HW8A 5JZMA 1RXSA 4MS1B 1NG1A 3TOVA 4M1WA 5IVHA 3FPCA 3HA5A 1NM5A 2AFHA 4TSFD 4AWBA 5KJEA 1KC3A 2OORC 1E98A 2TYSB 2YINC 4PLZA 4RA9B 1Y1KE 4F21A 1OX5A 2B1RA 4ZKEA 5JS8A 2ZB7A 5DH9A 5CDUA 5FOWA 1DZIA 1E3TA 4LBVA 4WXHA 3W3ZB 4G24A 3CO5A 4NYIR 1UEJA 3IQEA 4RY2A 5KO2A 5JATA 1ISHA 4I1IA 1PCXA 5COBA 1W0KD 3E5NA 3ZJUA 3CR8A 3RHSA 3ELYA 4H31A 3SZLA 5BP7A 3GUZA 3IVMA 4EG7A 3DNMA 2IODA 1ODCA 1RRKA 2DCMA 1TJPB 2GPYA 2I8LA 1NURA 3SSMA 3ZDYB 2H9IA 2WUDA 3IV7A 1MW8X 1N2IA 1QUFA 2AJCA 3COWA 4I6JA 3HZHA 4ZO4A 3AEYA 5LQCA 3HI6A 1XF9A 4B32A 5EA2A 1DFIA 1K0FA 1Q2XA 2AVDA 1RXIA 2QX6A 1ODSA 2ZRFA 3EFHA 3FMFA 3KVVA 4GLJA 4YJ3B 4AP5A 1ECFA 1EFRD 1K1EA 1ZSNA 2BHSA 1GQFA 5ESDA 1TOAA 4R84A 1SEPA 1ZVQA 5HF8A 3P0FA 4LA4A 4IEIA 5K0FA 3GEPA 1LSUA 5GADl 4IFTA 2GVZC 2H5IA 2P4EA 3I8SA 3Q7IA 1P3JA 4BE9A 4DMHA 1RJFA 4F4DA 5C35A 4QICA 3BIWA 4CHTA 1L4YA 4AY6A 2KLBA 3I28A 2JLCA 4M1SA 2VXOA 3V8VA 5H9VA 4JYAB 4QRHA 1YONA 2R8YA 4URZR 2X6QA 1MVOA 2I34A 1IEVA 1DAHA 1M2FA 4M54A 3K4QA 1VLLA 3DGEC 4QOIA 4YACA 5IH7A 3FYDA 4L95C 5LU8A 3OX4A 4D42A 3AETA 1VHLA 1TU0A 3ASZA 4N3AA 4N18A 3RUAA 4LRTB 4MUKA 3RANA 3M5WA 2BELA 2I4LA 3HDQA 3KJXA 4IHQA 3KDSE 2JGRA 4D6PA 3A3OA 4EVIA 2FPUA 1Q74A 4QC2A 1GP2A 3OE7A 3PVSA 4NOLA 1L7BA 4B3FX 2J3IA 3ELBA 1OB5A 2C4TA 2IZ5A 4YLGA 4XRGA 5A0VA 1B8UA 4CL2A 1F9AA 2OCPA 3K35A 1MB9A 2F67A 3GFRA 4LGVA 3UB4A 3RT1A 2C2ZA 4R8VA 3LE8A 4D44A 3QEMB 1BGXT 2LKDA 1EEXB 2QRUA 4F04A 1HR0B 3LWDA 1V11B 2MSCB 4YFYA 2Z4SA 1QH8A 2FP3A 5GP1A 3VZRA 5J58A 3RVMA 1MA0A 1WPXA 2WMNB 1RZVA 2QU8A 3G2HA 3IB6A 1PTJC 3OOSA 1V3VA 5GJVC 1KEEB 3OZSA 1V4BA 4BB0A 3N05A 1H0HA 3FVQA 4HB0A 2NSJA 4U2EA 5JQGA 3I1JA 2NT4A 3FPBA 2XR1A 3C6ZA 1PE0A 4CF7A 3UNXA 4TM7A 2OFPA 4FOOA 3JSXA 1GT91 3GFVA 3QWBA 2OY0A 2H9AA 1ULUA 1XTVA 2VQSA 2YZGA 4YDRA 3ZD9A 3LQ4A 4DDWA 3QFCA 4QYIB 4RM3A 2PX3A 2ZULA 1CB7A 4QDZA 5LJLA 4JB2A 3ADBA 1K98A 2ZRJA 1T5LA 1U3DA 2LGJA 2Y1WA 2Q3FA 4L8FA 1E5XA 1TM3E 1BMFA 1EBUA 2QVZX 5ALOA 5FBLB 1ZIYA 2JD0A 4LX0A 1BVHA 1K9SA 1EUYA 5GONF 4TKVA 3TQHA 2F00A 4HXYA 3L7DA 4MKZA 3NZEA 5KTTA 4EWLA 4AUKA 3VZQA 1IBRA 3C8ZA 2QSYA 2YCBA 3TX6A 4DF3A 2GO7A 3RAGA 2HA6A 1OX4B 2FPLA 4GU5A 4IQ4A 5HEKA 4A2WA 2VDUE 4B17A 4B6SA 2Q8NA 3QTBA 3M49A 4Q9DA 1T4GA 1U7OA 3GY0A 5A05A 3DBRB 3RR2A 2C99A 2EV9A 3SEQA 2JZCA 4QZVA 2VHTA 5JCPA 4IJWA 4ZJYA 5KNDA 4JP3A 1QS0A 1WHSB 1FTYA 2VK1A 2WD7B 3AF4A 4KWEA 1GGEA 4IX1A 2BM9A 1IPFA 2FDRA 4V0KA 3GLHB 3EIFA 4PQFA 1E9AA 4MR9B 5JQWA 2BCGY 2CNLA 1NFRA 1N34B 3LO8A 4J2OA 1JDNA 1H1LB 1OV4A 1KZYC 4AYXA 4QDKA 4LZLA 1F12A 4LNUA 1HH4A 1J2YA 4MQFB 3Q2KA 2ETVA 1CDZA 3EIXA 4BMPB 4YQFA 3EVNA 4D3ZA 3C6XA 3FYUC 1QM5A 2ZIUB 3MBOA 3ZQ4A 4F06A 4CKWA 1WXQA 1OLSB 3OZAA 4JJ6A 4WX2B 3CNHA 4IDOA 2VL7A 4Y2GA 4RKYA 5P21A 2WICA 1MN6A 1JZSA 3OPMA 1H6BA 3QTLA 3QVGA 2V96A 4UQPA 3RSGA 6LDHA 3UJNA 5L45A 1IG0A 3WSWA 4BQOA 1G6KA 3IBYA 2YVUA 2QLLA 2OFWA 1EDOA 2WF5A 2VHXA 3A6JA 3FVTA 1AS0A 3A25A 4K6FA 2AD5A 2AXEA 3PE3A 1P9LA 4EHHA 4XWOA 4EPYA 2H9YA 2X7XA 4PC7A 4UEKA 2WSLA 1YKGA 2ARKA 3CLSC 3T3EA 5LMZA 1FQJA 1JQ5A 2GAIA 2QW1A 2YASA 3QNWA 2NAPA 1P1CA 5F2KA 3LOQA 4U6SA 3AERA 5JAOA 5IEJA 1S0UA 4E14A 2XUGA 3UJCA 1C4WA 3FNIA 3QWHA 4U9UA 1GIAA 3DE2X 3ROQA 4P2BA 4CQMD 4FZJA 2FVXA 2IV7A 1NMXA 2PYDA 4BNMA 2ZVJA 1K8QA 3UPUA 5DGTA 1GN9A 1F1JA 4BCBA 2YH2A 2IZOA 5LZ5A 1QFJA 2JFHA 4HLUA 3UJ7A 4NCNA 4O63O 4ER5A 4IIJB 4JI0B 5KTNA 4CDNA 2CXPA 4TYMA 4D98A 1C29B 2FSVA 2ODBA 4CTOA 1XZBA 1P5RA 2Q28A 1AXGA 2GPTA 4S1WA 4D57A 5KDDA 3DE5X 3BGIA 1AGPA 2I91A 4YDSA 3IIJA 3BICA 1WMAA 3F6YA 5SZKB 3SKXA 3T7SA 2FUKA 2OMEA 3TSCA 3VOBA 4CMKA 1R8JA 2OBXA 2YVAA 4KGVA 1G1AA 4P7FA 1ADBA 4WZBB 5DYNA 3LA8A 3ZCPA 3CF4A 5FB3A 1ZHFA 2GEFA 3IMFA 1Z62A 3UOAB 2GCOB 4Q6WA 5DULA 1NQTA 4EO4A 2AHRA 2PLNA 2SKEA 3ZX4A 4GT1A 4C7MA 4R4JA 3ZE8A 4LRXA 2AFVA 1RI5A 3QI2A 4ME6A 1H8HD 3MAJA 4NP6A 2PD4A 4R8SA 1TZJA 4D25A 2WMDA 2GJSA 3HCRA 5LYJF 2AIRA 2JD1A 3D1JA 5KQGA 3SQWA 4TVSA 1ADYA 2IV3A 4WACA 1UKZA 1OYYA 4W5RA 1JG7A 1T0IA 2VRCD 1WETA 4OBEA 1GAXA 3PICA 3WLJA 3LOPA 2INGX 1T6BY 4AZSA 1U3GA 2XMPA 3VR4H 4DZRA 3RSHA 1XMVA 5J2TB 1AUXA 1HYHA 1KGSA 2QNRA 3DTVB 5EUQB 4INPA 5G0TA 4DA9A 5B1EA 4LK2A 5C7YA 4YR9A 3NGLA 4KI0A 1G3UA 5FHQA 3SSAA 2GMWA 3MLBA 5KSPA 5CX1B 5GV7A 1WEKA 3LP5A 4B81A 2O5RA 3TR5A 2C54A 1VHDA 3RAJA 1UPTA 4LGYA 4WD3A 4C08A 2XLCA 1VPEA 2G76A 4EBBA 5JS7A 5C1PA 5IAEA 4G37A 2AKYA 2ZJ5A 4IZHA 1N75A 2IEIA 2EFHB 3O4JA 4R3WA 5IKXA 1J8VA 2ZTMA 1NF9A 3BPSA 3CUTA 2FEWB 4EF4A 3W5SA 3GAMA 3CX6A 2Z8YM 2I4TA 2ZT6A 4FJ0A 1Z33A 5K20A 1FU8A 2NQ2C 3OX2A 4Q3AA 5JCOA 4WINA 5FIUA 1Q0SA 2PXHA 3GGCA 3M6IA 4U7GA 3WL5A 1C7ZA 2FSIA 4IGFA 5BUQA 4RZ2A 1ZM7A 3BWVA 3ZLBA 3KJHA 3A7EA 4F4JA 2WSSA 2Q5LA 3DVAA 3PFBA 4YP0A 1GTJ1 3H84A 3ET4A 5H83A 3ULKA 2VTBB 2XUDA 2VSQA 1Y8QA 1CIPA 3AFIA 4LUCA 4RD0A 4DIKA 1ZONA 1IZZA 1UBEA 2PQMA 3NGMA 3O47A 4MI6A 2I54A 2G25A 1LBSA 1VLHA 1FUIA 4M8KA 4QGBA 4Z8XA 4GHWA 1W48A 2HA5A 1ZOIA 3IAUA 4ZOAA 5A4JA 4I6EA 2PUEA 4RGYA 4A0SA 4NF2A 1ODJA 1SUEA 1IQUA 4J7CA 4P82A 3ZE2B 3HUUA 4JDPA 1J8YF 2CKDA 2P67A 1VMEA 4LZJA 3PKIA 4WLNA 4Y9DA 1V6CA 3WA6A 3UKOA 3HKBA 3FWZA 4R54A 4QULA 4W8HA 4DLRA 3AC0A 4KVGA 4WY5A 5I48A 3IVCA 5GJWC 1MFZA 1NMSA 1E3WA 1N7JA 4FYWA 2VHEA 1C9YA 1K63A 1XCGB 1D6MA 3WKEA 4EYQA 1I7LA 3WRWA 1M3SA 3EVTA 3AB3A 3O2JA 1XX6A 5HFNA 3PSAA 3QF7A 5I4BA 3NU1A 2JJYA 2ZDHA 5TPZD 5IM4A 1NI4A 3UAXA 1YD7A 2FRXA 2QXTA 1R27A 4GLBA 4RABA 1FUEA 1M2EA 1H5NA 4HMPA 3G88A 3FMVA 3QG1A 4UCQA 3RF6A 3WNZA 1D0IA 3P0HA 4MVJI 4J1SA 4IDNA 2OCIA 3VC3A 2NW6A 4O2LA 3DDHA 4FMCB 4UTRA 3DXZA 3S8EA 4M3NA 4ZVKA 4HNSA 2F1HA 4CKBB 4S04A 4C05A 3COJA 2QLFA 3GPIA 5G1PA 1I3CA 3AI1A 4EHJA 1YJXA 1TEVA 2X6TA 5EE5B 4H1UA 1EFHA 2HMTA 3ORFA 1B15A 1MORA 4CT5A 1HE2A 1OE0A 3IODA 4JKIA 4BE4A 1P3DA 5KWEA 4R68A 3RKUA 5B58C 3OCWA 4FHEA 3C5CA 4OYLA 4K3VA 1YZLA 1EJ2A 1RKVA 2CHUA 5IKPA 5CTAA 2YNMD 1FRNA 3UPTA 1THZA 1AB5A 5AW4A 1PS0A 2KWIA 2QQEA 1FDTA 4JYBA 3NHLA 4U7JA 2QZSA 3R7LA 1ZMOA 3INGA 4U7WA 3U17A 4E5DA 1PYGA 3KSAC 2V8BA 3SF0A 4ZGWA 3H2IA 3AWIA 3EZFA 3G2LA 3RO7A 3WIUA 4CKWB 5JH7B 2R60A 1KI4A 4R5MA 2YKGA 3SYRA 4MDHA 3ZQJA 5JVDA 1QU2A 4ZYVA 5A1JA 4RXUA 5JCJA 3A8TA 3DFIA 1LSJA 4FJ2A 3GJTA 3DDWA 4OLBA 2VAWA 3TGPA 2N9UA 3FSJX 2W4IA 3TX2A 3BMQA 5KNCH 2FJPA 1JZTA 1OZFA 1PW5A 4KXVA 4AULA 5M29A 1DXOA 2W6IA 4YJ3F 5DSXA 2R2AA 1TW3A 3DV9A 3LHDA 2CYCA 1W76A 3E03A 3NV7A 3JQ8A 1EMDA 4UUAA 5ALGA 5IW8A 1C8KA 5TPWB 2ZWPA 4UASA 2PMBA 3VPHA 4BWFB 1GUAA 5CLQA 3N8DA 4RL6A 1LBTA 1KQNA 1XDDA 2EW2A 3F6SA 4M38A 1BX1A 1E69A 2NU6B 2AI2A 2YJ5A 4IAOA 1I32A 1RAEA 1UEXC 4N7JA 3R6WA 4D0RA 4EHKA 1JSXA 1M76A 4PNHA 4QEDA 4DJFC 1WUYA 1KGDA 3IDAA 4MGEA 1UKCA 2X0RA 3CA8A 2DBRA 2CXNA 5ED4A 3U4QB 2Y9MB 4QYXA 2JLRA 3RLIA 1X39A 3I73A 2ORVA 2XBLA 4FDLA 4O4LA 2YIDA 3I32A 4YJKA 3S5UA 3SS8A 3R6GA 4Z54A 1FYXA 2QDKA 4QPJC 1D04A 4JT4A 3MG9A 1B2RA 2XMSA 4XM0A 1EWYA 1JKFA 1NRWA 1H4VB 5D3MA 3JWJA 1OR8A 2IXDA 1EXNA 1SUSA 1WABA 1PFKA 1P91A 2OECA 4V0LA 1HNWB 2D2IA 3AKEA 5DYGA 4KO2S 5EKTA 4XM1A 2G9NA 4FGJA 2H1RA 3ELWA 4UNQA 1F2VA 3A0UA 1U3CA 1DHRA 1UPXA 3X2EA 1M67A 4CIVA 1FXSA 4QUAA 1C4XA 2NUAB 2R66A 3AMVA 1XVTA 3QLTA 3C3CA 5LKAA 2DWQA 3KYDB 3IV9A 1E9DA 4MUHA 5KU1A 4R3UC 2ZW9A 3U40A 1IQ0A 2Q50A 1QXSA 4PYOA 4E46A 4ER3A 3I9FA 3DHYA 4YI5A 2J08A 4BU1A 2AOXA 2VP5A 4PXAA 4M9QA 3A28A 3OKPA 1M8PA 2X40A 1HDGO 1HYBA 3VUEA 4C14A 4OQMA 3X1YA 1AUPA 3QG5A 2BL4A 4XQEA 3ZJ4A 4ECAA 1KFJB 1RJWA 3WIDA 1XA0A 4UHJA 2BGWA 1G7SA 1N5RA 1SC9A 1XNJA 4CM9D 3RAEC 3TXAA 5I7EA 4WLUA 3TIIA 4M7PA 4WBNA 4DQKA 5A9SB 2ZM6B 2VYQA 1KJ9A 2I3ZA 3FF4A 2OBYA 2PGLA 4ND7A 3FR8A 4B3XA 3Q9NA 5DX8A 1RMQA 4RK7A 3WOHA 1KI9A 2ERYA 4J1TC 1OZ0A 1NVVQ 1RYYA 2R5NA 4GWGA 1O95C 3PUWA 4BWYA 2FMIA 3HMQA 4TS9A 5HILA 1AHHA 1EJ0A 2YOFA 3VKUA 5D2CA 4C01A 2RCYA 1F6DA 2PSHA 3OU6A 5B53A 1CF4A 1I1NA 3QKSA 4Y2SA 4BN4A 1HY3A 3IEKA 3R3VA 3RFUA 2VJQA 3QXSA 3ZQ6A 5GTDA 3U4QA 1T8TA 4MQ6A 4FVTA 4X44A 1MZVA 3A3NA 4NMLA 2HU7A 1KVSA 2CLCX 3FTNA 3IAEA 1J8FA 1UKEA 2WJ3A 3EVGA 1T3SA 4DIUA 3VU3A 5TS2A 4LYHA 3AM4A 3AKDA 4L8GA 4ND8B 3H5VA 3MEQA 2DJIA 5LD2B 4RPJA 1VPVA 1Z74A 4B1FA 4RKQA 2JIQA 3RF7A 3NXKA 2FYTA 3K4HA 3MQ2A 3N8KA 3VO2A 4OHUA 5JNSA 5K4GA 3JQ8B 2R6R1 2V7PA 1KK0A 1YZ3A 2P91A 1ZP6A 2RGBA 1REQA 4JZKA 1DKNA 4ZEOA 3ACCA 3GUCA 1PJAA 3ORYA 1Z28A 1PWXA 1WXFA 1MJHA 1KAHA 1PZNA 3UUGA 3ZK7A 3D3EA 4DUZB 4L7VA 2P77A 1J33A 1YAJA 1SIWA 2FZ4A 4XWGA 2E5WA 3PFKA 3S1SA 3WGZA 1ONBA 1X74A 4L16A 1M6VA 4HNGA 1ZINA 3KZVA 4EMUA 3O0TA 2JLAA 3OJOA 2QYOA 4ODIA 2FUNB 3T3GA 1DJLA 1ES9A 1PL0A 4KKXB 4O1IA 1YVPA 2VJYA 5KB3A 1L5NA 5WRFA 1MGOA 1YZVA 4UXJA 3T7DA 3BG5A 2IDJA 5JI2E 2X86A 1O0CA 2V6BA 1M74A 3PPVA 5CXSA 4B7CA 3GGGA 2VJNA 3K05A 4UARA 1YL5A 5KOIA 2FXIA 1RHJA 3CRNA 1DARA 2OOKA 2QTWB 4QXQA 5LP6C 4A5SA 1NSYA 1WOMA 3UBTA 3QU4A 2HK8A 3CLRD 2IYSA 3I9KA 3V2GA 3VC1A 3DOOA 2XQIA 4LSZA 1OPXA 4MP3A 4QUBA 2NGRA 3U56A 1CZRA 2W43A 1TLTA 3MCVA 5LC1A 3FNGA 4DZTA 1FNMA 2WYOA 1LVHA 3NYQA 4KWTA 5JD3A 3F3KA 5IJ0B 2XTZA 2ROQA 5FUBA 3IJEB 2E4YA 3T5AA 1NTOA 1VP3A 1R9JA 5L95A 3AEUB 4O08A 1CUIA 4EG8A 1MRNA 8ADHA 3U5ZB 2GZMA 4L2IA 4E08A 1DRJA 1Y9JA 4BO9A 5FOQA 4Q3LA 5JXHA 3X1DA 3HVJA 4AJKA 4CMCA 4ZI7F 5KYXB 1XJQA 5DBFA 4Q4AA 2RAUA 2VHVA 3CLTD 4PS1A 4RHYA 4WRRA 3K70D 3LF2A 3RJ9A 4URWR 3J80A 3NEJA 1L4LA 1XT6A 2WTMA 3GJ3A 3C8MA 4M0MA 3I01A 5CCDA 4WSOA 4EKYA 3CZMA 5H3CA 5KYXA 4PN7A 1JP7A 3MD0A 2QTNA 2EAUA 2BEUA 8AT1A 1XFDA 1KBZA 2TRSB 3CR7A 3G6WA 5EWJA 1C7RA 3FHCB 4OUKX 4BV3A 4ZDKA 4TMTA 1K6EA 4N54A 2IYYA 3GJ5A 3PK0A 3PVCA 5F3RA 1XTUA 1YZQA 4AD8A 4V38A 2IS2A 1LV7A 4P34A 1CZOA 2F9LA 4Y2TA 1V35A 3S6JA 2ODQA 3JARA 1IM5A 4MJ3A 3FSRA 4FGSA 3LFHA 3DQZA 3OP4A 5PNTA 2R6DA 4FN4A 1YBFA 2NZVG 5JARA 1Z6TA 2GZAA 3DMYA 4NU8X 4PHGA 3DULA 5KKNB 5YASA 2GGSA 3F6EX 3FBWA 1NGSA 3W34A 4EQZA 4KPUA 3D0RA 4B3BA 5FDFA 1USVA 3PQ3A 3IKMB 3CIFA 1KEWA 3EIHA 4Q4CA 5T8KA 1KZ1A 1XMXA 2IF2A 3B20A 5M04A 1GA6A 1IMJA 4MPRA 3ZI0A 3ICCA 3KKKA 2HJWA 5DN6D 5J2UF 1JEQB 3WXBA 4XVUA 2Z5FA 1VE7A 1SCUA 3VR3D 3ZQUA 3G8YA 2PGJA 1EWQA 4R2LA 1JNYA 4LK3A 2DPYA 5BNTA 2R6GA 2OT3B 3WB0A 1GUFA 1IWBB 3RUPA 5EHIA 2BFMA 5D87A 4AUNA 1KHHA 1HOXA 2CK3D 3AI7A 3LGSA 3PT9A 1XYGA 4EYOA 2OM6A 1T9GS 5HE9A 1OWOA 3W4KA 1ZAKA 1T1GA 1HRKA 2GPNA 5KKAA 2AG8A 2EJUA 3AVVA 1KC1A 3CONA 1MT3A 3I92A 3T54A 2G5PA 3V1YA 3WRXA 1FNCA 1N3BA 4EUFA 4PF1A 2XSZA 3FNFA 1GU7A 2D3WA 3LY5A 1CJKC 4IHAA 4LPSA 2XNSA 4G5XA 4OQPA 5DVZA 4PWZA 4YRDA 4JR1A 4YRPA 1TI7A 4AS2A 4RULA 4V0MA 1XPJA 1QHEA 4LJSA 3ZDAA 1OIXA 3FI0A 1PFUA 2YNMC 4FE4A 3O9ZA 1G17A 2MYTA 4PHCA 2WJPA 4E22A 2A94A 2AOVA 1XHEA 4DDTA 4FZRA 3QENA 5H3LA 2XOEA 2PUJA 3LQ1A 2G07A 2PV7A 2PFKA 5DX0A 1HL7A 4WY8A 4EI9A 2XE8A 1XVLA 4GPZA 5B4TA 1M2VA 4R83A 3A9UA 3T9DA 2G4LA 1W5EA 4PGAA 2BZGA 2GX6A 4C1NA 3ME5A 5ALJA 3UWKA 4D9EA 3D0OA 3OQHA 1N2OA 3VHLB 2HK9A 2DUMA 3HCDA 4WOJA 3ZU4A 3AKCA 3L43A 4BGVA 2CDAA 2XUHA 3OJFA 1X42A 4M0LA 3AUUA 1ZGZA 4ECEA 2GWRA 4FFWA 1NY5A 2R6ZA 5F2OA 3S7TA 3WMGA 4CKCB 3BWCA 4EY8A 3OBIA 1TO6A 1HQDA 4QYMA 2JKYA 4Z99A 4GI7A 1MZPA 1J0BA 2XUJA 3LRXA 1ZW1A 2FP4A 3W5BA 4PZUA 2W2XA 2YC4C 4X7RA 2O2SA 5FWYA 4JDUA 1HLDA 2O2JA 4BFWA 1SCAA 2VUSA 1LK5A 4QNMA 1JPVA 2XBUA 2C2WA 4V3CA 3QE0A 4ALJA 4II7A 2FUG6 1TYZA 1U3VA 3O8DA 2VRBA 5B6PA 1G6HA 1SQGA 1K75A 1U8EA 1WV1A 4B4OA 3ZHRA 1N2XA 1RZ3A 4HAZA 4KNWA 3C2QA 1MQ9A 3B1XA 4I6GA 1QHXA 5GY7A 1N6PA 3O0DA 4XRRA 3WMXA 2NU7A 3LF1A 3BQNB 2A84A 2IP4A 1SOAA 1JSRA 3FTDA 3Q9UA 1AGNA 3A6ZA 3B51X 3QKRA 4N9QA 1YS4A 4LRUA 5K51A 3M70A 5FTLA 4N48A 4UOZA 1I7SB 3RVRA 4K6GA 2WHPA 4QIHA 2E3JA 1OCEA 1JG4A 2I4IA 2XWSA 2QUIA 5EG5A 1D2RA 4XSGA 1UWLA 2VPWA 2RHOA 5IDVA 2J0VA 3UAWA 1V45E 2ABWA 1FDRA 4WFJA 3LTNC 3N0TA 2H4HA 3OTWA 1GV0A 1IBSA 5U4QA 5I7OA 4QDUA 3F47A 4U2GA 1TGYA 1QHHB 3GU3A 3UT5B 1BOOA 2VYFA 3V8QA 3ZZ0A 2F8SA 1V71A 1QHHA 1SA0B 4L6CA 5ARCA 1QFMA 2NOAA 5HQTA 1H4QA 2PBZA 2DPMA 4TSFA 1V7CA 1XVIA 4BL5A 1ODKA 2YVQA 5TF4A 1NP6A 3FVWA 1LI4A 3KT6A 4RJLA 3WGVA 5DBHX 4EM6A 1I4EB 5JXJA 5EHNA 5DM1A 4RC9A 2FW6A 3HBAA 2GYYA 4HH3C 4KN5A 2FWBA 4QA9A 3UMCA 3MWEB 1HURA 2Q1WA 1C9EA 2ZTSA 4C3VA 2O5VA 4OOEA 2PAFA 4ZYWA 1GZ4A 4HNHA 2P9EA 2BGJA 4JMPA 1R4AA 5SYNA 5HSGA 1VJ0A 2QMQA 3ADOA 4U00A 3ADDA 3ZU5A 1P72A 4HAWA 1HDXA 1FXWA 3HCOA 3NHSA 3QEKA 4MVJE 1J06A 1NTRA 2AQ8A 2L17A 3N0VA 4NOMA 1Z08A 1W4BA 3FPEA 1Y8CA 1QP8A 1UBCA 3PRJA 4Y7DA 5GZ3A 1TRHA 2Q07A 3D2LA 2B7LA 1CNMA 3OKFA 2VDMB 2QX9A 1AKNA 4GFDA 5TQJA 4AFNA 5K09A 4QYSA 3W2FA 1WW2A 3WV5A 5JXGA 1KSJA 1PSWA 3SBOA 1W49A 3H6GA 1GU0A 3VVBA 3U31A 3B6IA 1FTQA 2C2XA 3FKSD 3VR6H 1DDIA 3IMEA 4I3FA 2GFQA 4DIDA 1EFTA 1X7YA 2X9NA 1JQLB 2BH2A 3QSGA 3QOWA 1QH8B 4WCDA 1ONOA 2E4ZA 4X90A 1EWKA 3A1DA 2R5WA 2XYPA 2J7PD 4XSHA 4AP9A 2N1BA 3PEFA 1YR2A 3I3OA 2SKCA 4OQ4A 3TQRA 4QDTA 4W4TA 3L7MA 1M5RA 4MS3B 4RIHA 3C1AA 4TWRA 1QLHA 3AESB 4E07A 1K7XB 1W1IA 3TQQA 1TVKB 1YACA 1Z4QA 2ORIA 1TM7E 2P0AA 1BGVA 3NHKA 4XR4A 1HA3A 1HC7A 4A23A 5A9TA 1NPTO 2UVQA 2HD4A 1CNFA 4GUDA 2PXCA 3S0JA 1RC8A 3JD4A 2D5BA 3R0QA 2V9CA 4GZLA 2I1LA 2VYND 3C5WP 4WBXC 4IIXA 5KYUB 2QR3A 4BV8A 3HCFA 4NU0A 4WQMA 1YR3A 1TQ6A 2E4WA 3CT6A 1Q0HA 3IURA 5KQMA 1NJGA 4UBIA 5JHHB 1B0PA 1Q22A 4EJ2A 4BUCA 5H9WA 1TLFA 5IASA 4HAYA 5LP1A 1QTRA 1H1LA 3M9LA 4XA8A 2VH5R 3R0JA 4LXHA 3DDOA 4XWTA 5CEEA 1J49A 1XGKA 1NXWA 2Z3WA 3LT2A 3A9TA 1A7AA 3NDIA 4ZJPA 3WJ7A 3T3PB 2OV2A 5CDFE 2WKQA 1TKBA 1O08A 2P65A 3AJDA 4FOSA 3CFYA 4KWIA 3AUTA 1E9RA 4FWBA 4I55A 1DZ3A 2KMLA 1PR2A 4UMDA 2V7QD 4BBZA 1C2TA 3EJ6A 5J3JA 2C7GA 1GYQA 3E2MA 2G7MC 3FTPA 3DMDA 3EF3A 4ND8A 3IHKA 1Y6FA 3HZRA 4RWEA 3ADCA 3ESZA 3Q3CA 5BV1A 3BT7A 4W7HA 4ND1A 5D00A 3TNDA 5ICCA 3CXRA 3FJYA 3KWFA 4GSKA 4DEYA 1VJTA 1BG6A 4JC0A 2BKAA 1QHYA 4B3RB 2XQKA 3ND6A 2FPGB 1XLTA 4R16A 5KX5A 4KLRA 4CW7A 2WPDA 1UM9A 2VKQA 3B3GA 4HEQA 3TW4A 3SQMA 4FHFA 3FH0A 3ZDRA 3NTUA 5CB4B 3ON5A 3ERCA 1BHO1 2OC4A 3QKTA 3WLEA 3ENVA 5FKJA 1D2MA 3WDSA 2O2YA 3BJIC 1GRVA 1HDYA 2L42A 2NO9A 4XDGA 2V5UA 4ZT7A 4KXNA 3CCBA 4CM3A 4DDHA 4EIWA 2PUFA 1SR8A 2I7DA 2WE7A 4AO6A 4PONA 2O2EA 2I80A 1L7EA 1PDVA 4X8HA 5E6UA 5F52A 1GDHA 1V1RB 3BL5A 2OYCA 3VQTA 5INTA 2C31A 4G4IA 1JRLA 3K2IA 4LHYA 4YT5A 3E8XA 1KDOA 2OCBA 4RDIA 1E7YA 5KHAA 3BEOA 2AEEA 4XI9A 4H7FA 4A8PA 3N8IA 3FRJA 3MINB 5BT9A 4ZU3A 1YR9A 2QVLA 5EKXA 5JFOA 2UZ1A 5THQA 2OFOA 5TGTA 3MUEA 3NWBA 4NKRA 1BX0A 4URYR 4CFYA 5JAIA 2IE0A 3HR4A 4EKNB 3OX3A 3H42B 1Y1RA 2ZPAA 4Y3UA 5T67A 4F5YA 4FDMA 2VRWA 1UWKA 3EUFA 3MNFA 3WLKX 2HNBA 2IEDA 3WL8A 4E2WA 4JI7B 3C7KA 3L4SO 1BS2A 1JIXA 1FRFS 1MIOA 2JPDA 3HVHA 4O2BF 4MAAA 4YIHA 3K0BA 2GYWA 2WP8J 1IFXA 3EW9A 4MAFA 3LKDA 1QGUA 4K05A 2ODEA 3ITNA 1SPXA 3STXA 4PFQA 4AY2A 4OU5A 3U3KA 3FTEA 3EIEA 1SXJB 1O03A 2CE2X 1TRKA 1SXJA 2PSSA 4F2DA 5HVNA 1XCMA 5FBRB 5KINB 3AO0B 1OFHA 3IUYA 1JQEA 4YP5A 3UFBA 1BRMA 5C5EA 4P4LA 2YY7A 1VOTA 1HE4A 1JILA 4JQZA 2AFIE 3SYNA 3H9BA 3UV3A 3DDSA 5L3RA 4JSRA 3ROMA 1QCDA 2ODAA 3AR4A 3LUKA 3SCZA 5JC1A 2O7VA 4C4PA 1SKYE 1W85A 1DRUA 4C87A 4BFYA 4NMMA 1SC4A 3CRQA 4NRDA 1MAHA 4LTMA 2BHLA 1IN7A 1FVFA 3CPSA 1K7EB 3ZDDA 4P0PB 2ZRLA 4O0LA 3BFVA 4MKFA 4TLLB 3NBKA 4OYYA 1N0IA 5DWVA 4AN1A 3CZ4A 2JATA 4Y9RA 4UFPA 1EJBA 3SXUB 1MEJA 3ZY3A 4OI1A 2UKDA 4AJPA 2YUTA 1EVKA 3GF4A 2QBYB 4XEHA 4RSGA 4AS1A 1GKUB 4K6MA 5TVGA 3RV3A 5G0UA 1EQ2A 2FK7A 1QG2A 3CE9A 1WV0A 3FRIA 3LD9A 1YQWA 4CV3A 2RH4A 2V0NA 3PL5A 1QRAA 3GJ6A 3IUEA 3VR6D 4ZJZA 3QKIA 5A71A 2F90A 3GCDA 3DTTA 1G18A 2F1JA 4LE0A 4PSCA 4CLRB 3DD1A 1HEYA 3G5MA 4XGRA 4JOBA 1D0SA 1NIJA 2QYTA 4NEHB 5JVDB 4KQ2A 2G1JA 1Q5PA 4RGQA 5T3UA 1U90A 1LH0A 5T4HA 4BNFA 2IHNA 4KNYA 4B3GA 1SVIA 4H27A 2ENUA 2HY7A 3KRTA 4MI3A 3LDHA 3JCZA 4I81A 1TA0A 4I3GA 1EX9A 3THSA 3NR2A 2OGWA 1SVWA 3QPCA 4IWNA 3T9FA 2PKRA 3AF5A 4OHVA 3BJRA 3E22B 4HNAA 5K8VA 4YQEA 1IAVA 1GZSA 1PTKA 4CL8A 3QJGA 2UZIR 3GG2A 4TTRA 4UU0A 2O54A 3AHFA 1VYVA 2JFVA 1XD2B 1H2YA 2OO5C 1TM1E 1W19A 2ZBQA 3GT0A 3OSUA 1G4HA 4CKEB 2CK3A 4FYXA 1KYIA 2C2MA 2VYVA 3F6CA 3HHPA 3K1JA 2P40A 2OR3A 3T5DA 3P9IA 1TVMA 4FQ8A 1R12A 3BSWA 4RD6A 2IYPA 1JH9A 3L0BA 3TTYA 1IUOA 1MA3A 3ZV6A 3GLIB 1Q3HA 5LQSA 1GPDG 2E48A 4OSPA 4P7GA 4EF5A 2HJGA 2D74A 2GHRA 2X5OA 4RO0A 1T5BA 3BRQA 2VPXA 2C7QA 1I5OA 3DMRA 4NZYA 4D56A 3AG5A 1EK0A 1F4PA 4N8DA 4P31A 4PO3X 4R1NA 1K8ZB 5LXTF 3C3JA 2EKPA 2FEPA 1EBBA 1UC9A 3JQAB 2ZAOA 3WSTA 4HEA6 2ZRPA 2IPLA 2B82A 2I3DA 2C4WA 3NHPA 4GKVA 1WKCA 5EXXA 2F59A 4HGRA 3ZZNA 2ZRKA 3N2GB 4Q03A 4D0LB 3Q10A 4M83A 5EPOA 4G9EA 2Q2QA 1RAHA 2P2YA 5MGBA 3TLGA 3U4MA 2WG2A 1HOTA 2Q8PA 4J9UE 1KOLA 3GNLA 3C6QA 4AN4A 1VG0B 4KHPB 1ZJWA 5J4HA 3IUQA 4ZPXA 2AZDA 3EG5A 2FUG1 2AI1A 2XPCA 4ENQA 5ANRB 1JLMA 1T9HA 4HYYA 1R6BX 2HF9A 3QH4A 3WISA 4C0WA 1S89A 3D6UA 1MIOB 1UFKA 4WK4B 4CQLA 3EMDA 1VE1A 2ZBDA 3R7AA 3UF0A 3GJYA 4M1EA 4QJBA 2VCHA 4YJHB 5AVVA 2YHUA 2PZ8A 1HDEA 1FYVA 3ED5A 4I9GA 4YXWD 1JEJA 1W88A 2HR1A 1O97D 1OWNA 1EK6A 3QW2A 3LLMA 3SGLA 3Q3VA 3AM5A 5AUPB 1Q3IA 2QP9X 1YQGA 3SICE 2DBYA 1THTA 1Y6RA 1XJ5A 3PWTA 4HNAB 3UMFA 2YMLA 2HHJA 2W00A 3A32A 2WIJA 1FPMA 3DYIA 5EFZA 4RJJA 2W2VA 3R0VA 4EYSA 3V4PB 2YHIA 4RTKA 1G2PA 2DUUA 3EDMA 3GC6A 4TTSA 2XEXA 1JE1A 3O9MA 1AA9A 1SUFA 2EWMA 4ZAYA 3TTUA 3RJZA 2WJ6A 4ZMSA 2G77B 4NR0A 2OB2A 1RZUA 2J7KA 4GD3Q 4ZVPA 1F8YA 3D3WA 4ZTUB 3IT2A 2YN4A 1I2BA 1L2TA 4OHBA 4B5LA 4N6GA 4JR0A 3ZWXA 3TOSA 2X58A 1VM6A 3IDSA 2ZBVA 4CMEC 1H42A 1CVIA 4IZOA 4LWQA 4MVJH 4CXMA 1TEHA 2I4RA 4XOUA 1THMA 2XB8A 2DQ4A 1IYZA 1L5HA 1O9HA 1MC4A 4OV6B 4Z7OB 1GOTA 1ZOSA 1PWEA 2D62A 1SKQA 2NSDA 5KS2A 5CNMA 2H7XA 2Q7DA 4EYKA 2EEZA 4YN3A 1XNGA 3TG8A 3VSDA 2W90A 3H5NA 3CGGA 1DRWA 3TTXA 4XWYA 4XQ0A 2FN7A 4H1TA 4N6NA 5EE3A 3WADA 1T26A 3NFYA 5I01A 1UKVY 1SZDA 2CHEA 2RG1A 3H7AA 4KXMA 5C0OE 3DWGA 3ZY4A 3TFQA 3IAM6 2NTJA 4FLFA 2V7QA 4NYMR 2BGIA 4GIBA 3ABQB 4JS0A 5DHPA 5LZ2A 1UMBA 2C9ZA 3OOHA 3VJRA 3ZCRA 5DTJA 3RT9A 4Z7QB 5JYCA 1A4UA 1KRXA 4U39A 3W04A 1ID8A 1RJDA 2A0UA 5SZJA 1QF9A 3NONA 3CTPA 3QMMA 4CI9A 1JDPA 2CWWA 3O8RA 3EC7A 2OD9A 4ZZ1A 1ZNXA 3U19A 3HNRA 2XD9A 1C30B 4IDAA 4ISCA 1GQYA 1Q1GA 3H5WA 3W5AA 1Z6PA 4D46A 4UD2A 2WAMA 4ZN6A 1CFZA 3DLAA 3QBJA 1Q6ZA 1C0KA 2BRUA 1PT5A 4OI4A 1P4RA 4WOPA 3WMEA 2CL7X 3W3AA 3HFGA 4L28A 2ZUTA 3QJ5A 3S70A 4COKA 1GTMA 1ZM9A 3EQ9A 3M34A 1YAHA 1E3JA 1RLJA 4FYPA 2XB6A 4FFOA