2YJ7A

Crystal structure of a hyperstable protein from the precambrian period
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
105
structure length
105
Chain Sequence
SVIEVTDENFEQEVLKSDKPVLVDFWAPWCGPCRMIAPIIEELAKEYEGKVKVVKVNVDENPNTAAQYGIRSIPTLLLFKNGQVVDRLVGAQPKEALKERIDKHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conservation of Protein Structure Over Four Billion Years
pubmed doi rcsb
molecule keywords LPBCA THIOREDOXIN
molecule tags Oxidoreductase
source organism Synthetic construct
total genus 30
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2yj7A00
1ERVA 2OACA 1TRWA 2WDUA 2FUG2 2HSYA 5F8BA 3HVSA 5A4VA 3Q18A 6GSYA 2AV4A 4EL1A 3F3QA 1SKRB 4AJ7A 3HXSA 3RPNA 3TRQA 6GSSA 4DSRA 4K1FA 2LUSA 3P90A 4V2LA 1LBKA 5FT3A 2GQLA 3IDVA 3CTGA 1XFLA 3QAVA 2HZEA 1CQGA 2L6DA 2VCZA 3Q74A 5JCWA 1TRSA 4H86A 3F4TA 3UAPA 1O81A 3IK7A 2B7JA 4LMWA 3F6FA 1BJXA 2B6MA 3O3TA 3MNGA 4EUYA 1ERUA 2X8HA 3CSJA 2IPAA 4OWYA 2QKEA 4MPGA 3U5RE 3E3EA 3VURA 1FVJA 5H5RA 3KH9A 2RUEA 5G1LA 5JWQB 5DJLA 3R2QA 1GTUA 2YN1A 5CRHA 1AQWA 1SL2B 1R5AA 3FZ4A 4NHZA 5DQYA 1BX9A 3HDCA 2DIYA 3M1GA 3GRXA 5F05A 2JADA 3ERGA 5J9CA 4K0NA 4F0BA 3TCOA 1B48A 3SWLA 4IJ3A 4BWSA 3GNJA 2JACA 5IM9A 1GULA 1B9XC 2PVOC 1GNEA 16GSA 1H4OA 4XS1A 1H75A 4IW9A 2HSHA 3GA4A 3GN3A 3K8NA 1A23A 1WE0A 4MZCA 1QK8A 2MMOA 4HQZA 3KM6A 4DSSB 5D9TA 3ZZXA 4KX4A 1ZGNA 3GKMA 1F9MA 1GNWA 1GP1A 2R5GA 3TUEA 1XOBA 2QC7A 4KCAA 2YZHA 2C3QA 2XPEA 1AQVA 3GV1A 4X43A 2EIRA 2VL2C 4GF0A 3KEBA 4K7OA 5DBQA 1A0FA 4K8MA 2B1KA 4NMUA 2CVKA 4ILFA 1T00A 3M9KA 4YAPA 6GSWA 1YEPA 5ECQB 4OFMA 3VPQA 4KUNA 5J9BA 4O92A 2CV4A 3GX8A 2VCWA 3VI7A 1GUHA 2OBIA 2PGTA 2WRTA 3EMXA 3EC3A 2PBJA 4MZBA 4GTUA 4OFTA 2LQOA 3UBKA 4EDZA 4YQVA 4MMMA 4KCEA 2IJYA 4XS4B 3RHCA 3IC4A 1A0RP 4EDYA 4MH2A 2P0GA 5DCGA 3CBUA 1SL0B 2CX3A 2XHFA 1F2EA 3QFBC 1GWCA 4TR3A 3KP8A 3L9UA 1SKSB 4ZL7A 10GSA 2MZCA 1EWXA 4MF7A 1TK5B 5ECIB 1Z9HA 2LNSA 3D4TA 1EV4A 5HQPA 1XOAA 5A4UA 4HOJA 1OYJA 2DC5A 4TN8A 1WJKA 4FIWA 2CZ2A 4JEDA 9GSSA 2VIMA 5DALB 1AQXA 1AUCA 4MABA 3KTLA 3QR6A 1Q4JA 2HYXA 2TRCP 3QFAC 5IPGA 2H1GA 2H76A 18GSA 1X0RA 1XCCA 1JHBA 4MF5A 1T8EB 4IBPA 5G30A 3KXOA 3ZTLA 1XWAA 3HJMA 3J7Yb 1V9WA 4OCEA 4KB3A 4MK3A 2EIOA 5HR1A 4PQHA 3ME7A 1TXXA 3UOMA 4OD7A 4TRXA 2M46A 1RK4A 3LWAA 4YQMA 5CRDA 4WBJA 1PA3A 2LS5A 5IMFA 5B6MA 2HT9A 4BL7A 4DSQA 3VWXA 3D4MA 2DJ1A 1QGVA 3D21A 1GLQA 1T1VA 4TXOA 1YKCA 3P2AA 4IP6A 4HJ2A 1VF1A 5KN1A 1ABAA 5IPHA 5AGYA 1GTBA 4IS0A 3FRCA 4RQXA 4ZBDA 3J7Yk 2LEGA 1XXUA 3TOTA 1X9SB 1MDIA 4V1Ap 1QQ2A 3S9FA 5ECHB 3BBYA 3KTBA 1GRXA 3CSIA 1R4WA 4QL7A 1R5PA 4IP1A 3O76A 3RDWA 2VUPA 4ZB6A 1SK1A 2DMLA 3CMIA 4HU9A 5JCUA 2IMEA 4CDOA 1Q98A 2R37A 4NPBA 4KDUA 3ZREA 1OVNA 4E8EA 5G5FA 5AIXA 4AF2A 5LCZA 3VWWA 5L71A 2FA8A 2IL3A 6GSVA 2VO4A 1RW1A 4ZBBA 4TR1A 1NSWA 5CNWA 3PGTA 1WPIA 3KCMA 4ZXGA 3W6GA 5ECPB 1SYRA 2J9HA 3QOUA 3QCPA 4RQRA 1JLVA 2FD3A 3TKQA 1SK0A 2FNOA 5DCHA 4GWRA 2MYGA 1MTCA 2HRFA 1ZOFA 1ST9A 20GSA 2XBQA 4J57E 1WIKA 3F6DA 3HZ4A 3LQ7A 4X0XA 3KIJA 2F3MA 5IMAA 2I4AA 5ECSA 1X5EA 4KA0A 1YDKA 3KJYA 2QGVA 3BJ5A 5IO2A 3CRTA 2V6KA 5EVOA 3I69A 2YPMA 5IOXA 1WWJA 5B7CA 2FLSA 3C8EA 2OE0A 1AIUA 5F06A 2DLXA 4GSNA 3GIXA 5ECKB 3IBHA 5HFGA 1A2LA 2HXKA 2R6KA 5G2ZA 4POBA 2L4QA 1PGTA 4ZB8A 1M9AA 4HEA2 1GL8A 3GH9A 4OCFA 1NHYA 2VL9A 1XWKA 2FWGA 4EO3A 3DEXA 3FZ5A 4KW6A 2WS2A 1J08A 2ZUPA 1OC8A 3U6VA 3APOA 5F07A 3CSHA 3FKFA 2BJXA 5KN2A 4I2UA 3N5OA 3GL3A 4N30A 3DVXA 2Z9SA 1BQ7A 1EGOA 4POLA 2JSZA 5G1KA 1EP8A 3ZITA 3ZMKA 2YZUA 5KN0A 3CYNA 2XC2A 2NVLA 5IOWA 4POMA 1YJ6A 2CT6A 5FWGA 5CRWA 3I6AA 3O6TA 4PNFA 5C04A 1PQNA 4EC0A 1FB0A 1ZYEA 3TOUA 1XZOA 1MDKA 4WEYA 3IOSA 5HR3A 5IMCA 3IAS2 1K0DA 2OKAA 1PKZA 1FG4A 2OE1A 4QQ7A 1ML6A 2CQ9A 3GTUB 2CX4A 2VCVA 2K8VA 2RLIA 3UJ1A 4FH8A 5E59A 4G9HA 2L57A 2JSYA 2H8LA 2BTOT 1PKWA 1BEDA 4ML1A 1JZRA 3UEMA 1OAZA 3FR3A 1TK8B 2V32A 3TJKA 5AN1A 1GUKA 3NZNA 1HQOA 4RI6A 1M2AA 3F3RA 2MBSA 5H5SA 1XW9A 3C73A 1W4VA 3BCIA 4HQSA 4HUAA 4G2EA 3WGDA 3HJPA 1SK2A 3FY7A 2GLRA 2KOKA 1BYEA 2GSQA 2IFQA 3L78A 1AXDA 1G6YA 1YKAA 2H30A 2DJ0A 4I97A 2XPDA 4Q5NA 1E2YA 1M2BA 3HVVA 4WBRD 1PN9A 3P8WA 4MJCA 3N9JA 2WGRA 3FR9A 3VWUA 4CW9A 4I8BA 3W8JA 3ME8A 1USBA 1EGRA 1R7HA 5D93A 3FZAA 5HR0A 4JR6A 1ILOA 2R4VA 2GSRA 4ZL8A 1GSYA 1OKTA 5D8IA 1GSFA 5B8AA 4F9ZA 13GSA 2NDOA 2PVQA 17GSA 4ECCA 3C71A 1G6WA 1M0UA 1TU7A 2FWFA 2P5RA 3GKNA 3US3A 4D73A 2GVPA 2ON7A 2H71A 3ISOA 3FYGA 3I43A 1VF2A 2I81A 4J2FA 1V57A 3F8UA 1A2JA 2C0FA 1URMA 2DJJA 4KAEA 5LD0A 1K0BA 2C0DA 3M3MA 3HY2A 3ZIJA 4HU7A 1NM3A 4I6XA 4LLRA 4V2NA 1J0FA 4JU5A 3BD2A 1U3IA 1EEJA 3TKPA 2GT6A 4WXTA 1LU4A 3EMPA 3D5JA 2F51A 4KNDA 2VLVA 6GSXA 4ZIJA 3TKSA 5A5KA 1GSQA 1W89A 5GZZB 2F9SA 5KEJA 3KGKA 4KSMA 2E0QA 4N0ZA 2CVBA 3A2VA 3KZQA 1FO5A 4OMVA 1XVQA 4HZ2A 3FHKA 4MDCA 4BVXA 4MA9A 4P3YB 2MBTA 1KEBA 3OR5A 2AHEA 2O8VB 4GRFA 2LNTA 4TXVA 1XIYA 2VM1A 3LGCA 4F03A 1FB6A 3PR8A 5H5QA 2C3TA 3IPZA 4IQ1A 5ECLB 4ULXA 1DE1A 1TW9A 5DQSA 1QXHA 2O85A 2DJKA 2ZCTA 3BCKA 1FOVA 1IYIA 3DXBA 1A2MA 3H79A 4G19A 2YV7A 2H1AA 3G7IA 3FW2A 3UVTA 2RM5A 3DKSA 1JZOA 4WETA 3TDGA 3WYWA 3F0IA 2EIQA 2N5FA 4V2MA 2N5AA 4MPFA 3QMXA 1SD8A 4GCIA 4BWQA 2R2JA 3G9BA 3HVXA 2H19A 5IO0A 4IVFA 5CP1A 4ECBA 3LEFA 3A3TA 3ZL5A 2LRNA 5DAKA 1GTAA 3IAM2 2YWMA 3TRXA 4QL9A 5ID2A 2YWNA 3MWHA 3Q6OA 1OKDA 2C4JA 2CAQA 2PMTA 2KHPA 2N5BA 2YOIA 1PL1A 2B7KA 2JZSA 1NW2A 2F8FA 2B5EA 1ZCPA 1V2AA 3I9V2 4I5QA 1DUGA 4GQCA 4IJIA 3IE3A 1M7TA 4PGTA 2IMKA 4N0VA 2AB6A 3H1NA 4AJ8A 1MD4A 1XVWA 2J23A 3GURA 2OE3A 2FY6A 1Z3EA 2H74A 2RUFA 3IXRA 1PMTA 4XCSA 3LG6A 1IYHA 2YWIA 1ZZYA 4YH2A 3TJFA 4FYUA 3LJRA 2MMNA 4PX1A 4K7NA 2F8AA 1O8WA 5JWOB 5G31A 2WZ9A 2VD0A 1AC1A 2GDRA 1SJ6A 1N8JA 1VGLA 1V98A 1YZXA 5HR2A 2PU9C 3ZVJA 3Q19A 14GSA 4GSTA 2H75A 2M80A 4KH7A 2H01A 1K0OA 2FA4A 3GHAA 5JWRB 4O7HA 4F2IA 3DD3A 1TP9A 4EKZA 2IIYA 1BG5A 3TRPA 2H70A 5E4WA 5G5EA 2K8SA 4EXJA 1UA5A 3VK9A 4ML6A 2IMFA 2VCXA 3D6IA 2IWTA 3IA1A 5DVBA 4MJAA 3GSTA 4JRRA 3ED3A 3GH6A 1OC9A 1Z7PA 3GKKA 3HD5A 5EPFA 1GSDA 3C1RA 1TI1A 4HZ4A 1XW5A 3UIWA 1EV9A 7GSSA 3QDNA 1S3CA 5KN3A 5CO3A 3HKRA 4TR4A 4EE0A 2OA7A 4ZL9A 1OE7A 2CZ3A 4DEJA 1EP7A 2LRTA 1O85A 4ACSA 4X1UA 2H73A 2AUVA 2VL3A 5COHA 3M9JA 4LL4B 3BOAA 4TR1B 3E9JB 5DDLA 2AJQB 3QAWA 1MEKA 3ZVJD 1G0TA 4XRDA 3LSZA 3V1WA 3EU3A 3HJOA 2MMZA 2HLSA 2H0IA 2BMXA 3ZYWA 2VCTA 4MLYA 3H4KA 1LJRA 4L5OA 1ON4A 1PX7A 2GZPA 1F3AA 1R26A 3D0ZA 4OO4A 2HRNA 1X5CA 2ZNMA 4O32A 3DGQA 1SD9A 4MJEA 3IHQA 4ECJA 3RPPA 3LYPA 2V41A 1EZKA 4CHSA 4TW5A 3RBTA 2O87A 3TB2A 1FAAA 4Z7XA 1DE2A 4OFNA 2B1LA 1ZYQB 2WULA 1B4PA 1K0AA 2YWOA 6GSTA 1ACVA 1AW9A 6GSUA 1XWCA 3GX0A 1T4ZA 1XWBA 3H8QA 4XHMA 1JLWA 2PUKC 1HNCA 1JZWA 2V6OA 3KH7A 4IN0A 4HI7A 5CREA 5IMZA 5C00A 3IRAA 2VLTA 1SU9A 1GTIA 1TTZA 4FYCA 2FGXA 3G7JA 5IMVA 2H6YA 2HE3A 3DIEA 1WP0A 1XW6A 4K7IA 2MMAA 5CRGA 3KP9A 3DMLA 1X9WB 1Y6EA 2KUCA 2LQQA 1FW1A 2YANA 1RQMA 4RI7A 2PPTA 4EF0A 1UN2A 3EURA 1SKWB 1ZMAA 1MD3A 3EINA 2TRXA 2YCDA 2TIRA 4IQAA 2I9HA 1SYXA 3GMFA 3UBLA 3E0UA 2O7KA 3TKSE 4O5RA 2I1UA 5ECRB 2VM2A 2JL4A 1SENA 5D73A 3H93A 3QAGA 4JZQA 1XPVA 1G7OA 4FYBA 2H72A 3W8SA 4IKHA 1PRXA 1C72A 3ZIVA 4DSSA 3L9VA 2C1YA 5AIVA 1K0NA 3ZLPA 4J56E 4ZB9A 2HZEB 1TKDB 5DJMA 3EU4A 2A2RA 2GTUA 5ECNB 3VPTA 2A4VA 2K18A 2YNXA 3WT2A 1B9YC 3EYTA 3TKSC 3TJGA 22GSA 1SL1B 3MAKA 1Z7RA 1Z6NA 4GXZA 5CAXA 1Z6MA 4AGSA 1BAYA 2O89A 3NIVA 4ID0A 1O73A 1TI3A 2IFQB 2PN8A 2FWHA 2X64A 3L4NA 3GUSA 4NV2A 1HNAA 2A2SA 3LYKA 2IN3A 4Q5RA 2H0HA 3CXGA 3GL5A 3CTFA 3HCZA 2NPBA 5ENUA 3UL3A 4F0CA 4F82A 2IMIA 2DIZA 1B8XA 4JBBA 1FVKA 2L4CA 3HHVA 4XS4A 3D22A 5D9XA 4L5LA 2M72A 3FZ9A 3DYRA 1GLPA 2VOCA 2EC4A 1TU8A 4KSOA 3KMOA 2B5YA 1TDIA 4LMVA 2DJ3A 3VI5A 3KD0A 1N2AA 4RUVA 5J3RA 4POKA 5ELAA 1HD2A 2L59A 2PWJA 1U87A 2L5LA 2CA8A 1T7PB 1V40A 2L6CA 1XWGA 3TGZA 4NAXA 1PX6A 1T3BA 4MF6A 4XTSA 3GKXA 4HS1A 8GSSA 3VFIA 2C0EA 3QD9A 3WT1A 4D73B 3IR4A 1K0MA 4GLTA 2FCHA 3UMAA 5A4WA 2V1MA 2ALBA 5DALA 2GSSA 2OJLA 4LA1A 3ZFBA 3M0FA 3LFLA 1I9DA 3IV4A 1TOFA 4BA7A 2GQKA 2VD1A 5J5NA 1UC7A 4L8EA 2HI7A 4K2DA 4KE3A 3PINA 4GQFA 2XBIA 4K6XA 3LXTA 3GYKA 3GFKA 3PH9A 5INYA 2VL2A 2X8GA 4OO5A 3A2XA 1M9BA 3WD6A 3FK8A 1F6MC 3WGEA 12GSA 3APQA 4IELA 4K0GA 1K3LA 2K9FA 1TK0B 1PD21 2P31A 1WRYA 1GSEA 4NXIA 1Z5YE 1A8LA 1T4YA 1K3YA 1O7UA 1HYUA 1OC3A 2X8CA 4PNGA 3F4RA 5GSSA 1EOGA 1JZDA 3KMNA 4LL1B 3M8NA 1GUMA 3RHBA 4ECIA 5IMDA 1QUWA 5HFIA 3EWLA 2VLUA 1DBYA 5J4UA 2GS3A 3JCML 2DSAA 5ECMB 1XBSA 1KTEA 2LJRA 2H66A 2GZYA 1S3AA 2H1BA 5B8BA 4PQ1A 5GAPD 2AAWA 2L5OA 1THOA 2AYTA 5EL8A 3A2WA 2FHEA 1YEXA 1X9MB 3L0HA 3DRNA 4BPYA 1G7EA 1U3AA 1VF3A 3HA9A 1MDJA 2YP6A 4KDYA 2H1DA 2ON5A 1TRVA 2VCQA 3DVWA 3GSSA 3MDKA 1TRUA 2C8UA 1NHOA 4TR0A 1K0CA 2REMA 4MJBA 4I2TA 1PL2A 3HYPA 3NOFA 1UVZA 3WGXA 1DSBA 4KDXA 2H6XA 3VLNA 5D96A 2H6ZA 4TKYA 5F0GA 1SJZA 4MCUA 3TJJA 2LJKA 2LTKA 3UARA 5D9VA 1GSSA 1ZL9A 2V2GA 1JFUA 2B5XA 1SJIA 5CYYA 2LJAA 4Q5FA 5DAKB 1QFNA 4PUFC 4TVEA 5FHIA 4NWYA 1VF4A 5ID2B 3G7YA 2WJUA 5GSTA 1B4QA 1ERTA 1KBNA 2PERA 11GSA 4JE1A 1WOUA 5GAND 2P5QA 4MP4A 4TXOB 3P7XA 4ZILA 4HDEA 4PUAA 2NTOA 2DMMA 4IHUA 4L0WA 5AISA 4V1Ag 5J41A 1YQ1A 1U88A 2DJ2A 2CVDA 4G10A 4YQUA 5ELGA 3ZFLA 3FEUA 1M2DA 4TOPA 2LKUA 5IIZA 3DWVA 1YF0A 5D9WA 5EY6A 3ZMLA 2RIIA 2YV9A 2E2MA 2C3NA 4XS6A 4N10A 4K9ZA 2KLXA 2YJ7A 2K6VA 3ERFA 3LORA 4WF4A 4PURA 1KNGA 2D2ZA 2HNLA 2WFCA 2GQMA 3HZ8A 5ECOB 3CRUA 2NBSA 1THXA 1I5GA 2DBCA 4WR4A 3L9SA 4JR4A 1K3OA 1V58A 3RAZA 1TJDA 3UVHA 2E7PA 4Q5QA 3ZRDA 1E6BA 2HZFA 3TKRA 4MZWA 2X99A 4PQIA 4GSSA 4PXOA 2JZTA 2IMDA 2GGTA 3IK9A 2OBKA 2G2QA 2C0GA 1OE8A 4NV5A 5LNKe 1U6TA 1AAZA 1F3BA 1Y25A 1EEMA 2LV3A 1O6JA 1OC9B 1O8XA 2OADA 2KP1A 3VWVA 2C80A 3A5WA 4NHWA 2HFDA 1ERWA 2JZRA 4ZBAA 2GSTA 1HNBA 4E8HA 1EOHA 1YY7A 1M99A 1J9BA 4IGJA 2RM6A 3TJBA 19GSA 2ES7A 3ERWA 3F63A 2WCIA 2GZZA 2B3SA 1VRSD 3AY8A 3EE2A 1X5DA 4N11A 3GTUA 2I3YA 4WR5A 4MH3A 1YF1A 3F9UA 4FO5A 4BVYA 1QMVA 4DVCA 2CAIA 1A8YA 5ABRA 2JU5A 2FWEA 2VAFA 2YJHA 3FR6A 2LSTA 1FHEA 1CQHA 3EVIA 4AJ6A 1WMJA 4XRAA 1GH2A 5HFKA 3C7MA 3APSA 4L0UA 1A24A 2R3XA 5B6NA 2KP2A 2WB9A 4WKWA 3LXZA 4YAVA 1S3DA 2H0GA 1PSQA 3QPMA 3F4SA 4WF5A 4HJMA 5JCGA 2LRCA 1GSUA 2QSIA 1F37A 4XIHA 5IQYA 3MSZA 4ISDA 3C1SA 4EVMA 2GT5A 3SBCA 2E2GA 4KGIA 2G0FA
chains in the Genus database with same CATH superfamily
1ERVA 2OACA 1TRWA 2WDUA 2FUG2 2HSYA 5F8BA 3HVSA 5A4VA 3Q18A 6GSYA 2AV4A 4EL1A 3F3QA 1SKRB 4AJ7A 3HXSA 3RPNA 3TRQA 6GSSA 4DSRA 4K1FA 2LUSA 3P90A 4V2LA 1LBKA 5FT3A 2GQLA 3IDVA 3CTGA 1XFLA 3QAVA 2HZEA 3MYDA 1CQGA 2L6DA 2VCZA 3Q74A 5JCWA 1TRSA 4H86A 3F4TA 3UAPA 1O81A 3IK7A 2A2PA 2B7JA 4LMWA 3F6FA 1BJXA 2B6MA 3O3TA 3MNGA 4EUYA 1ERUA 2X8HA 3CSJA 2IPAA 3FMWA 4OWYA 2QKEA 4MPGA 3U5RE 3E3EA 3VURA 1FVJA 5H5RA 3KH9A 2RUEA 5G1LA 5JWQB 5DJLA 3R2QA 1GTUA 2YN1A 5CRHA 1AQWA 1SL2B 4ICYA 1R5AA 3FZ4A 4NHZA 5DQYA 1BX9A 3HDCA 2DIYA 3M1GA 3GRXA 5F05A 2JADA 3ERGA 5J9CA 4K0NA 4F0BA 3TCOA 1B48A 3SWLA 4IJ3A 4BWSA 3GNJA 2JACA 5IM9A 4YKGA 1GULA 1B9XC 2PVOC 1GNEA 16GSA 1H4OA 4XS1A 1H75A 4IW9A 2HSHA 3GA4A 3GN3A 3K8NA 1A23A 1WE0A 4MZCA 5BRTA 1QK8A 2MMOA 4HQZA 3KM6A 4DSSB 5D9TA 3ZZXA 4KX4A 1ZGNA 3GKMA 1F9MA 1GNWA 1GP1A 2R5GA 3TUEA 1XOBA 2QC7A 4KCAA 2YZHA 2C3QA 2XPEA 1AQVA 3GV1A 4X43A 2EIRA 2VL2C 4GF0A 3KEBA 4K7OA 5DBQA 1A0FA 4K8MA 2B1KA 4NMUA 2CVKA 4ILFA 1T00A 3M9KA 4YAPA 6GSWA 1YEPA 5ECQB 4OFMA 3VPQA 4KUNA 5J9BA 4O92A 2CV4A 3GX8A 2VCWA 3VI7A 1GUHA 2OBIA 2PGTA 2WRTA 3EMXA 3EC3A 1PFOA 2PBJA 4MZBA 4GTUA 4OFTA 2LQOA 3UBKA 4EDZA 4YQVA 4MMMA 4KCEA 2IJYA 4XS4B 3RHCA 3IC4A 1A0RP 4EDYA 4MH2A 2P0GA 5DCGA 3CBUA 1SL0B 2CX3A 2XHFA 1F2EA 3QFBC 1GWCA 4TR3A 3KP8A 3L9UA 1SKSB 4ZL7A 10GSA 2MZCA 1EWXA 4MF7A 1TK5B 5ECIB 1Z9HA 2LNSA 3D4TA 1EV4A 5HQPA 1XOAA 5A4UA 4HOJA 1OYJA 2DC5A 4TN8A 4KF9A 1WJKA 4FIWA 2CZ2A 4BVXB 4JEDA 9GSSA 2VIMA 5DALB 1AQXA 1AUCA 3R3EA 4MABA 3KTLA 3QR6A 1Q4JA 2HYXA 2TRCP 3IC8A 3QFAC 5IPGA 2H1GA 2H76A 18GSA 1X0RA 1XCCA 1JHBA 4MF5A 1T8EB 4IBPA 5G30A 3KXOA 3ZTLA 1XWAA 3HJMA 3J7Yb 1V9WA 4OCEA 4KB3A 4MK3A 2EIOA 5HR1A 4PQHA 3ME7A 1TXXA 3UOMA 4OD7A 4TRXA 2M46A 1RK4A 3LWAA 3PPUA 4YQMA 5CRDA 4WBJA 1PA3A 2LS5A 5IMFA 5B6MA 2HT9A 4BL7A 2DKHA 4DSQA 3VWXA 3D4MA 2DJ1A 1QGVA 3D21A 1GLQA 1T1VA 4TXOA 1YKCA 3P2AA 4IP6A 4FQUA 4HJ2A 1VF1A 5KN1A 1ABAA 5IPHA 5AGYA 4Z2RA 1GTBA 4IS0A 3FRCA 4RQXA 4ZBDA 3J7Yk 2LEGA 1XXUA 3TOTA 1X9SB 1MDIA 4V1Ap 1QQ2A 3S9FA 5ECHB 3BBYA 3KTBA 1GRXA 3CSIA 1R4WA 4QL7A 1R5PA 4IP1A 3O76A 3RDWA 2VUPA 4ZB6A 1SK1A 2DMLA 3CMIA 4HU9A 5JCUA 2IMEA 4CDOA 1Q98A 2R37A 4NPBA 4KDUA 3ZREA 1OVNA 4E8EA 5G5FA 4K5SA 5KOWA 5AIXA 4AF2A 5LCZA 3VWWA 5L71A 2FA8A 2IL3A 6GSVA 2VO4A 1RW1A 4ZBBA 4TR1A 1NSWA 5CNWA 3PGTA 1WPIA 3KCMA 4ZXGA 3W6GA 2X4AA 5ECPB 1SYRA 2J9HA 3QOUA 3QCPA 4RQRA 1JLVA 2FD3A 3TKQA 1SK0A 2FNOA 1M3IA 5DCHA 4GWRA 2MYGA 1MTCA 2HRFA 4CY6A 1ZOFA 1ST9A 20GSA 2XBQA 4J57E 1WIKA 3F6DA 3HZ4A 3LQ7A 4X0XA 3KIJA 2F3MA 5IMAA 2I4AA 5ECSA 1X5EA 4KA0A 1YDKA 3KJYA 2QGVA 3BJ5A 5IO2A 3CRTA 2V6KA 5EVOA 3CQFA 3I69A 2YPMA 5IOXA 1WWJA 5B7CA 2FLSA 3C8EA 2OE0A 1AIUA 5F06A 2DLXA 4GSNA 3GIXA 5ECKB 3IBHA 5HFGA 1A2LA 2HXKA 2R6KA 5G2ZA 2HRKA 4POBA 2L4QA 1PGTA 4ZB8A 1M9AA 4HEA2 1GL8A 3GH9A 4OCFA 1NHYA 2VL9A 1XWKA 2FWGA 4EO3A 3DEXA 3FZ5A 4KW6A 2WS2A 1J08A 1S3RA 2ZUPA 1OC8A 4Z2UA 3U6VA 3APOA 5F07A 3CSHA 3FKFA 2BJXA 5KN2A 4I2UA 3N5OA 3GL3A 4N30A 3DVXA 2Z9SA 1BQ7A 1EGOA 4POLA 2JSZA 5G1KA 1EP8A 3ZITA 3ZMKA 2YZUA 5KN0A 3CYNA 2XC2A 2NVLA 5IOWA 4POMA 1YJ6A 2A4HA 2CT6A 5FWGA 5CRWA 3I6AA 3O6TA 4PNFA 5C04A 1PQNA 4EC0A 1FB0A 4A5PA 1ZYEA 3TOUA 1XZOA 1MDKA 4WEYA 3IOSA 5HR3A 5IMCA 3IAS2 1K0DA 2OKAA 1PKZA 1FG4A 2OE1A 4QQ7A 1ML6A 2CQ9A 3GTUB 2CX4A 2VCVA 2K8VA 2RLIA 3UJ1A 4FH8A 5E59A 4G9HA 2L57A 2JSYA 2H8LA 2BTOT 1PKWA 1BEDA 4ML1A 1JZRA 3UEMA 1OAZA 3FR3A 1TK8B 2V32A 3TJKA 5AN1A 1GUKA 3NZNA 1HQOA 4RI6A 1M2AA 3F3RA 2MBSA 5H5SA 1XW9A 3C73A 1W4VA 2HRAA 3BCIA 4HQSA 4HUAA 4G2EA 3WGDA 3HJPA 1SK2A 3FY7A 2GLRA 2KOKA 1BYEA 2GSQA 2IFQA 3L78A 1AXDA 1G6YA 1YKAA 2H30A 2DJ0A 4I97A 2XPDA 4Q5NA 1E2YA 1M2BA 3HVVA 4WBRD 1PN9A 3P8WA 4MJCA 3N9JA 2WGRA 3FR9A 4G0KA 3VWUA 4CW9A 4I8BA 3W8JA 3ME8A 4EIQA 1USBA 1EGRA 1R7HA 5D93A 3FZAA 5HR0A 4JR6A 1ILOA 2R4VA 2GSRA 4ZL8A 1GSYA 1OKTA 5D8IA 1GSFA 5B8AA 4F9ZA 13GSA 2NDOA 2PVQA 17GSA 4ECCA 3C71A 4X4JA 1G6WA 1M0UA 1TU7A 2FWFA 2P5RA 3GKNA 3US3A 4D73A 2GVPA 2ON7A 2H71A 3ISOA 3FYGA 3I43A 1VF2A 2I81A 4J2FA 1V57A 3F8UA 1A2JA 2C0FA 1URMA 2DJJA 4KAEA 5LD0A 1K0BA 2C0DA 3M3MA 3HY2A 3ZIJA 4HU7A 1NM3A 4I6XA 4LLRA 4V2NA 1J0FA 4JU5A 3BD2A 1U3IA 1EEJA 3TKPA 2GT6A 4WXTA 1LU4A 3EMPA 3D5JA 3EPTA 2F51A 4BIKA 4KNDA 2VLVA 6GSXA 4ZIJA 3TKSA 5A5KA 1GSQA 1W89A 5GZZB 2F9SA 5KEJA 3KGKA 4KSMA 2E0QA 4N0ZA 2CVBA 3A2VA 3KZQA 1FO5A 4OMVA 1XVQA 4HZ2A 3FHKA 4MDCA 4BVXA 4MA9A 4P3YB 2MBTA 1KEBA 3OR5A 2AHEA 2O8VB 4GRFA 2LNTA 4TXVA 1XIYA 2VM1A 3LGCA 4F03A 1FB6A 3PR8A 5KOXA 5H5QA 2C3TA 3IPZA 4IQ1A 5ECLB 4ULXA 1DE1A 1TW9A 5DQSA 1QXHA 2O85A 2DJKA 2ZCTA 3BCKA 1FOVA 1IYIA 3DXBA 1A2MA 3H79A 4G19A 2YV7A 4YKFA 2H1AA 3G7IA 3FW2A 3UVTA 2RM5A 3DKSA 1JZOA 4WETA 3TDGA 3WYWA 3F0IA 2EIQA 2N5FA 4V2MA 2N5AA 4MPFA 3QMXA 1SD8A 4GCIA 4BWQA 2R2JA 3G9BA 3HVXA 2H19A 5IO0A 4IVFA 5CP1A 4ECBA 3LEFA 3A3TA 3ZL5A 2LRNA 1ZYNA 5DAKA 2HSMA 1GTAA 3IAM2 2YWMA 3TRXA 4QL9A 5ID2A 2YWNA 3MWHA 3Q6OA 1OKDA 2C4JA 2CAQA 2PMTA 2KHPA 2N5BA 2YOIA 1PL1A 2B7KA 2JZSA 1NW2A 2F8FA 2B5EA 1ZCPA 1V2AA 3I9V2 4I5QA 1DUGA 4GQCA 4IJIA 3IE3A 1M7TA 4PGTA 2IMKA 4N0VA 2AB6A 2UZ8A 3H1NA 4AJ8A 1MD4A 4O5UA 1XVWA 2J23A 3GURA 2OE3A 2FY6A 1Z3EA 2H74A 2RUFA 3IXRA 1PMTA 4XCSA 3LG6A 1IYHA 2YWIA 1ZZYA 4YH2A 3TJFA 4FYUA 3LJRA 3A5IA 2MMNA 4PX1A 4K7NA 2F8AA 1O8WA 5JWOB 5G31A 2WZ9A 2VD0A 1AC1A 2GDRA 4BL7B 1SJ6A 1N8JA 1VGLA 1V98A 1YZXA 5HR2A 2PU9C 3ZVJA 3Q19A 14GSA 4GSTA 2H75A 2M80A 4KH7A 2H01A 1K0OA 2FA4A 3GHAA 5JWRB 4O7HA 4F2IA 4HSCX 3DD3A 1TP9A 4EKZA 2IIYA 1BG5A 3TRPA 2H70A 5E4WA 2DKIA 5G5EA 2K8SA 4EXJA 1UA5A 3VK9A 4ML6A 2IMFA 2VCXA 3D6IA 1PN0A 2IWTA 3IA1A 5DVBA 4MJAA 3GSTA 4JRRA 3ED3A 3GH6A 1OC9A 1Z7PA 3GKKA 3HD5A 5EPFA 1GSDA 3C1RA 1TI1A 4HZ4A 1XW5A 3UIWA 1EV9A 7GSSA 3QDNA 2R0PA 1S3CA 4O5QA 5KN3A 5CO3A 3HKRA 4TR4A 4EE0A 2OA7A 4ZL9A 1OE7A 2CZ3A 4DEJA 1EP7A 2LRTA 1O85A 4ACSA 4X1UA 2H73A 2AUVA 2VL3A 5COHA 3M9JA 4LL4B 3BOAA 4TR1B 3E9JB 5DDLA 2AJQB 3QAWA 1MEKA 3ZVJD 1G0TA 4XRDA 3LSZA 3V1WA 3EU3A 3HJOA 2MMZA 2HLSA 2H0IA 2BMXA 3ZYWA 2VCTA 4MLYA 3H4KA 1LJRA 4L5OA 1ON4A 1PX7A 2GZPA 1F3AA 1R26A 3D0ZA 4OO4A 1XG8A 2HRNA 1X5CA 2ZNMA 4O32A 3DGQA 1SD9A 4MJEA 3IHQA 4ECJA 3RPPA 3LYPA 2V41A 1EZKA 4CHSA 4TW5A 3RBTA 2O87A 3TB2A 1FAAA 4Z7XA 1DE2A 4OFNA 2B1LA 1ZYQB 2WULA 1B4PA 1K0AA 2YWOA 6GSTA 1ACVA 1AW9A 6GSUA 1XWCA 3GX0A 1T4ZA 1XWBA 3H8QA 4XHMA 1JLWA 2PUKC 1HNCA 1JZWA 2V6OA 3KH7A 4IN0A 4HI7A 5CREA 5IMZA 5C00A 3IRAA 2VLTA 1SU9A 1GTIA 3IHGA 1TTZA 4FYCA 1ZYPA 4BVYB 2FGXA 3G7JA 5IMVA 2H6YA 2HE3A 3DIEA 1WP0A 1XW6A 4K7IA 2MMAA 5CRGA 3KP9A 3DMLA 1X9WB 1Y6EA 2KUCA 2LQQA 1FW1A 2YANA 1RQMA 4RI7A 2PPTA 4EF0A 1UN2A 3EURA 1SKWB 1ZMAA 1MD3A 3EINA 2TRXA 2YCDA 2TIRA 4IQAA 2I9HA 1SYXA 3GMFA 3UBLA 3E0UA 2O7KA 3TKSE 4O5RA 2I1UA 5ECRB 2VM2A 2JL4A 1SENA 5D73A 3H93A 3QAGA 4JZQA 1XPVA 1G7OA 4FYBA 2H72A 3W8SA 4IKHA 1PRXA 1C72A 3ZIVA 4DSSA 3L9VA 2C1YA 5AIVA 1K0NA 3ZLPA 4J56E 4ZB9A 2HZEB 1TKDB 5DJMA 3EU4A 2A2RA 2GTUA 5ECNB 3VPTA 2A4VA 2K18A 2YNXA 3WT2A 1B9YC 3EYTA 3TKSC 3TJGA 22GSA 1SL1B 3MAKA 1Z7RA 1Z6NA 4GXZA 5CAXA 1Z6MA 4AGSA 1BAYA 2O89A 3NIVA 4ID0A 1O73A 1TI3A 2IFQB 2PN8A 2FWHA 2X64A 3L4NA 3GUSA 4NV2A 1HNAA 2A2SA 3LYKA 2IN3A 4Q5RA 2H0HA 3CXGA 3GL5A 3CTFA 3HCZA 2NPBA 5ENUA 3UL3A 4F0CA 4F82A 2IMIA 2DIZA 1B8XA 4JBBA 1FVKA 2L4CA 3HVNA 3HHVA 4XS4A 3D22A 5D9XA 4L5LA 2M72A 3FZ9A 3DYRA 1GLPA 2VOCA 2EC4A 1TU8A 4KSOA 3KMOA 2B5YA 1TDIA 4LMVA 1FOHA 2DJ3A 3VI5A 3KD0A 1N2AA 4RUVA 5J3RA 4POKA 5ELAA 1HD2A 2L59A 2PWJA 1U87A 2L5LA 2CA8A 1T7PB 1V40A 2L6CA 1XWGA 3TGZA 4NAXA 2QA1A 1PX6A 1T3BA 4MF6A 4XTSA 3GKXA 4HS1A 8GSSA 3VFIA 2C0EA 3QD9A 3WT1A 4G0LA 4D73B 3IR4A 1K0MA 4GLTA 2FCHA 3UMAA 5A4WA 2V1MA 2ALBA 4G0IA 5DALA 2GSSA 2OJLA 4LA1A 3ZFBA 3M0FA 3LFLA 1I9DA 3IV4A 1TOFA 4BA7A 2GQKA 2VD1A 5J5NA 1UC7A 4L8EA 2HI7A 4K2DA 4KE3A 3PINA 4GQFA 2XBIA 4K6XA 3LXTA 3GYKA 3GFKA 3PH9A 5INYA 2VL2A 2X8GA 3MIXA 4OO5A 3A2XA 1M9BA 3WD6A 3FK8A 1F6MC 3WGEA 12GSA 3APQA 4IELA 4K0GA 1K3LA 2K9FA 1TK0B 1PD21 2P31A 1WRYA 1GSEA 4NXIA 1Z5YE 1A8LA 1T4YA 1K3YA 1O7UA 1HYUA 1OC3A 2X8CA 4PNGA 3F4RA 5GSSA 1EOGA 1JZDA 3KMNA 4LL1B 3M8NA 1GUMA 3RHBA 4ECIA 5IMDA 1QUWA 5HFIA 3EWLA 2VLUA 1DBYA 5J4UA 2GS3A 3JCML 2DSAA 5ECMB 1XBSA 1KTEA 2LJRA 2H66A 2GZYA 1S3AA 2H1BA 5B8BA 4PQ1A 5GAPD 2AAWA 2L5OA 1THOA 2AYTA 5EL8A 3A2WA 4Z2TA 2FHEA 1YEXA 1X9MB 3L0HA 3DRNA 4BPYA 1G7EA 1U3AA 1VF3A 3HA9A 1MDJA 2YP6A 4KDYA 2H1DA 2ON5A 1TRVA 2VCQA 3DVWA 3GSSA 3MDKA 1TRUA 2C8UA 1NHOA 4TR0A 1K0CA 2REMA 3LW9A 4MJBA 4I2TA 1PL2A 2R0CA 3HYPA 3NOFA 1UVZA 3WGXA 1DSBA 4KDXA 2H6XA 3VLNA 5D96A 2H6ZA 4TKYA 5F0GA 1SJZA 4MCUA 3TJJA 2LJKA 2LTKA 3UARA 5D9VA 1GSSA 1ZL9A 2V2GA 1JFUA 2B5XA 1SJIA 5CYYA 2LJAA 4Q5FA 5DAKB 1QFNA 4PUFC 4TVEA 5FHIA 4NWYA 1VF4A 5ID2B 3G7YA 2WJUA 5GSTA 1B4QA 1ERTA 1KBNA 2PERA 11GSA 4JE1A 1WOUA 4EIPA 4PTSA 5GAND 2P5QA 4MP4A 4TXOB 3P7XA 4ZILA 4HDEA 4PUAA 2NTOA 2DMMA 4IHUA 4L0WA 5AISA 4V1Ag 5J41A 1YQ1A 1U88A 2DJ2A 2CVDA 4G10A 4YQUA 5ELGA 3ZFLA 3FEUA 1M2DA 4TOPA 2LKUA 5IIZA 3DWVA 1YF0A 5D9WA 5EY6A 3ZMLA 2RIIA 2YV9A 2E2MA 2C3NA 4XS6A 4N10A 4CY8A 4K9ZA 2KLXA 2YJ7A 2K6VA 3ERFA 3LORA 4WF4A 4PURA 1KNGA 2D2ZA 2HNLA 2WFCA 2GQMA 3HZ8A 5ECOB 5BMUA 3CRUA 2NBSA 1THXA 1I5GA 2DBCA 4WR4A 3L9SA 4JR4A 1K3OA 1V58A 3RAZA 1TJDA 3UVHA 2E7PA 4Q5QA 3ZRDA 1E6BA 2HZFA 3TKRA 4K5RA 2X99A 4MZWA 4PQIA 4GSSA 4PXOA 2JZTA 2IMDA 2GGTA 3IK9A 2OBKA 2G2QA 4MNNA 2C0GA 1OE8A 4NV5A 5LNKe 1U6TA 1AAZA 1F3BA 1Y25A 1EEMA 2QA2A 2LV3A 1O6JA 1OC9B 1O8XA 2OADA 2KP1A 3VWVA 2C80A 3A5WA 4NHWA 2HFDA 1ERWA 2JZRA 4ZBAA 2GSTA 1HNBA 4E8HA 1EOHA 1YY7A 1M99A 1J9BA 4IGJA 2RM6A 3TJBA 19GSA 2ES7A 3ERWA 3F63A 2WCIA 2GZZA 2B3SA 1VRSD 3AY8A 3EE2A 1X5DA 4N11A 3GTUA 2I3YA 4WR5A 4MH3A 4K2XA 2X49A 1YF1A 3F9UA 4FO5A 4BVYA 1QMVA 4DVCA 2CAIA 1A8YA 2R0GA 5ABRA 2JU5A 2FWEA 2VAFA 2YJHA 3FR6A 1M3JA 2LSTA 1FHEA 1CQHA 3EVIA 4AJ6A 1WMJA 4XRAA 1GH2A 5HFKA 3C7MA 3APSA 4L0UA 1A24A 2R3XA 5B6NA 2KP2A 2WB9A 4WKWA 3LXZA 4YAVA 1S3DA 2H0GA 1PSQA 3QPMA 3F4SA 4WF5A 4HJMA 5JCGA 4USSA 2LRCA 1GSUA 2QSIA 1F37A 4XIHA 5IQYA 3MSZA 4ISDA 3C1SA 4EVMA 2GT5A 3SBCA 2E2GA 4KGIA 2G0FA
chains in the Genus database with same CATH topology
1ERVA 2OACA 1TRWA 2WDUA 2FUG2 2HSYA 5F8BA 3HVSA 5A4VA 3Q18A 6GSYA 2AV4A 4EL1A 3F3QA 1SKRB 4AJ7A 3HXSA 3RPNA 3TRQA 6GSSA 4DSRA 4K1FA 2LUSA 3P90A 4V2LA 1LBKA 5FT3A 2GQLA 3IDVA 3CTGA 1XFLA 3QAVA 2HZEA 3MYDA 1CQGA 2L6DA 2VCZA 3Q74A 5JCWA 1TRSA 4H86A 3F4TA 3UAPA 1O81A 3IK7A 2A2PA 2B7JA 4LMWA 3F6FA 1BJXA 2B6MA 3O3TA 3MNGA 4EUYA 1ERUA 2X8HA 3CSJA 2IPAA 3FMWA 4OWYA 2QKEA 4MPGA 3U5RE 3E3EA 3VURA 1FVJA 5H5RA 3KH9A 2RUEA 5G1LA 5JWQB 5DJLA 3R2QA 1GTUA 2YN1A 5CRHA 1AQWA 1SL2B 4ICYA 1R5AA 3FZ4A 4NHZA 5DQYA 1BX9A 3HDCA 2DIYA 3M1GA 3GRXA 5F05A 2JADA 3ERGA 5J9CA 4K0NA 4F0BA 3TCOA 1B48A 3SWLA 4IJ3A 4BWSA 3GNJA 2JACA 5IM9A 4YKGA 1GULA 1B9XC 2PVOC 1GNEA 16GSA 1H4OA 4XS1A 1H75A 4IW9A 2HSHA 3GA4A 3GN3A 3K8NA 1A23A 1WE0A 4MZCA 5BRTA 1QK8A 2MMOA 4HQZA 3KM6A 4DSSB 5D9TA 3ZZXA 4KX4A 1ZGNA 3GKMA 1F9MA 1GNWA 1GP1A 2R5GA 3TUEA 1XOBA 2QC7A 4KCAA 2YZHA 2C3QA 2XPEA 1AQVA 3GV1A 4X43A 2EIRA 2VL2C 4GF0A 3KEBA 4K7OA 5DBQA 1A0FA 4K8MA 2B1KA 4NMUA 2CVKA 4ILFA 1T00A 3M9KA 4YAPA 6GSWA 1YEPA 5ECQB 4OFMA 3VPQA 4KUNA 5J9BA 4O92A 2CV4A 3GX8A 2VCWA 3VI7A 1GUHA 2OBIA 2PGTA 2WRTA 3EMXA 3EC3A 2PBJA 4MZBA 4GTUA 4OFTA 2LQOA 3UBKA 4EDZA 4YQVA 4MMMA 4KCEA 2IJYA 4XS4B 3RHCA 3IC4A 1A0RP 4EDYA 4MH2A 2P0GA 5DCGA 3CBUA 1SL0B 2CX3A 2XHFA 1F2EA 3QFBC 1GWCA 4TR3A 3KP8A 3L9UA 1SKSB 4ZL7A 10GSA 2MZCA 1EWXA 4MF7A 1TK5B 5ECIB 1Z9HA 2LNSA 3D4TA 1EV4A 5HQPA 1XOAA 5A4UA 4HOJA 1OYJA 2DC5A 4TN8A 4KF9A 1WJKA 4FIWA 2CZ2A 4BVXB 4JEDA 9GSSA 2VIMA 5DALB 1AQXA 1AUCA 3R3EA 4MABA 3KTLA 3QR6A 1Q4JA 2HYXA 2TRCP 3IC8A 3QFAC 5IPGA 2H1GA 2H76A 18GSA 1X0RA 1XCCA 1JHBA 4MF5A 1T8EB 4IBPA 5G30A 3KXOA 3ZTLA 1XWAA 3HJMA 3J7Yb 1V9WA 4OCEA 4KB3A 4MK3A 2EIOA 5HR1A 4PQHA 3ME7A 1TXXA 3UOMA 4OD7A 4TRXA 2M46A 1RK4A 3LWAA 3PPUA 4YQMA 5CRDA 4WBJA 1PA3A 2LS5A 5IMFA 5B6MA 2HT9A 4BL7A 2DKHA 4DSQA 3VWXA 3D4MA 2DJ1A 1QGVA 3D21A 1GLQA 1T1VA 4TXOA 1YKCA 3P2AA 4IP6A 4FQUA 4HJ2A 1VF1A 5KN1A 1ABAA 5IPHA 5AGYA 4Z2RA 1GTBA 4IS0A 3FRCA 4RQXA 4ZBDA 3J7Yk 2LEGA 1XXUA 3TOTA 1X9SB 1MDIA 4V1Ap 1QQ2A 3S9FA 5ECHB 3BBYA 3KTBA 1GRXA 3CSIA 1R4WA 4QL7A 1R5PA 4IP1A 3O76A 3RDWA 2VUPA 4ZB6A 1SK1A 2DMLA 3CMIA 4HU9A 5JCUA 2IMEA 4CDOA 1Q98A 2R37A 4NPBA 4KDUA 3ZREA 1OVNA 4E8EA 5G5FA 4K5SA 5KOWA 5AIXA 4AF2A 5LCZA 3VWWA 5L71A 2FA8A 2IL3A 6GSVA 2VO4A 1RW1A 4ZBBA 4TR1A 1NSWA 5CNWA 3PGTA 1WPIA 3KCMA 4ZXGA 3W6GA 2X4AA 5ECPB 1SYRA 2J9HA 3QOUA 3QCPA 4RQRA 1JLVA 2FD3A 3TKQA 1SK0A 2FNOA 5DCHA 4GWRA 2MYGA 1MTCA 2HRFA 4CY6A 1ZOFA 1ST9A 20GSA 2XBQA 4J57E 1WIKA 3F6DA 3HZ4A 3LQ7A 4X0XA 3KIJA 2F3MA 5IMAA 2I4AA 5ECSA 1X5EA 4KA0A 1YDKA 3KJYA 2QGVA 3BJ5A 5IO2A 3CRTA 2V6KA 5EVOA 3I69A 2YPMA 5IOXA 1WWJA 5B7CA 2FLSA 3C8EA 2OE0A 1AIUA 5F06A 2DLXA 4GSNA 3GIXA 5ECKB 3IBHA 5HFGA 1A2LA 2HXKA 2R6KA 5G2ZA 2HRKA 4POBA 2L4QA 1PGTA 4ZB8A 1M9AA 4HEA2 1GL8A 3GH9A 4OCFA 1NHYA 2VL9A 1XWKA 2FWGA 4EO3A 3DEXA 3FZ5A 4KW6A 2WS2A 1J08A 2ZUPA 1OC8A 4Z2UA 3U6VA 3APOA 5F07A 3CSHA 3FKFA 2BJXA 5KN2A 4I2UA 3N5OA 3GL3A 4N30A 3DVXA 2Z9SA 1BQ7A 1EGOA 4POLA 2JSZA 5G1KA 1EP8A 3ZITA 3ZMKA 2YZUA 5KN0A 3CYNA 2XC2A 2NVLA 5IOWA 4POMA 1YJ6A 2A4HA 2CT6A 5FWGA 5CRWA 3I6AA 3O6TA 4PNFA 5C04A 1PQNA 4EC0A 1FB0A 4A5PA 1ZYEA 3TOUA 1XZOA 1MDKA 4WEYA 3IOSA 5HR3A 5IMCA 3IAS2 1K0DA 2OKAA 1PKZA 1FG4A 2OE1A 4QQ7A 1ML6A 2CQ9A 3GTUB 2CX4A 2VCVA 2K8VA 2RLIA 3UJ1A 4FH8A 5E59A 4G9HA 2L57A 2JSYA 2H8LA 2BTOT 1PKWA 1BEDA 4ML1A 1JZRA 3UEMA 1OAZA 3FR3A 1TK8B 2V32A 3TJKA 5AN1A 1GUKA 3NZNA 1HQOA 4RI6A 1M2AA 3F3RA 2MBSA 5H5SA 1XW9A 3C73A 1W4VA 2HRAA 3BCIA 4HQSA 4HUAA 4G2EA 3WGDA 3HJPA 1SK2A 3FY7A 2GLRA 2KOKA 1BYEA 2GSQA 2IFQA 3L78A 1AXDA 1G6YA 1YKAA 2H30A 2DJ0A 4I97A 2XPDA 4Q5NA 1E2YA 1M2BA 3HVVA 4WBRD 1PN9A 3P8WA 4MJCA 3N9JA 2WGRA 3FR9A 4G0KA 3VWUA 4CW9A 4I8BA 3W8JA 3ME8A 4EIQA 1USBA 1EGRA 1R7HA 5D93A 3FZAA 5HR0A 4JR6A 1ILOA 2R4VA 2GSRA 4ZL8A 1GSYA 1OKTA 5D8IA 1GSFA 5B8AA 4F9ZA 13GSA 2NDOA 2PVQA 17GSA 4ECCA 3C71A 4X4JA 1G6WA 1M0UA 1TU7A 2FWFA 2P5RA 3GKNA 3US3A 4D73A 2GVPA 2ON7A 2H71A 3ISOA 3FYGA 3I43A 1VF2A 2I81A 4J2FA 1V57A 3F8UA 1A2JA 2C0FA 1URMA 2DJJA 4KAEA 5LD0A 1K0BA 2C0DA 3M3MA 3HY2A 3ZIJA 4HU7A 1NM3A 4I6XA 4LLRA 4V2NA 1J0FA 4JU5A 3BD2A 1U3IA 1EEJA 3TKPA 2GT6A 4WXTA 1LU4A 3EMPA 3D5JA 3EPTA 2F51A 4KNDA 2VLVA 6GSXA 4ZIJA 3TKSA 5A5KA 1GSQA 1W89A 5GZZB 2F9SA 5KEJA 3KGKA 4KSMA 2E0QA 4N0ZA 2CVBA 3A2VA 3KZQA 1FO5A 4OMVA 1XVQA 4HZ2A 3FHKA 4MDCA 4BVXA 4MA9A 4P3YB 2MBTA 1KEBA 3OR5A 2AHEA 2O8VB 4GRFA 2LNTA 4TXVA 1XIYA 2VM1A 3LGCA 4F03A 1FB6A 3PR8A 5KOXA 5H5QA 2C3TA 3IPZA 4IQ1A 5ECLB 4ULXA 1DE1A 1TW9A 5DQSA 1QXHA 2O85A 2DJKA 2ZCTA 3BCKA 1FOVA 1IYIA 3DXBA 1A2MA 3H79A 4G19A 2YV7A 4YKFA 2H1AA 3G7IA 3FW2A 3UVTA 2RM5A 3DKSA 1JZOA 4WETA 3TDGA 3WYWA 3F0IA 2EIQA 2N5FA 4V2MA 2N5AA 4MPFA 3QMXA 1SD8A 4GCIA 4BWQA 2R2JA 3G9BA 3HVXA 2H19A 5IO0A 4IVFA 5CP1A 4ECBA 3LEFA 3A3TA 3ZL5A 2LRNA 1ZYNA 5DAKA 2HSMA 1GTAA 3IAM2 2YWMA 3TRXA 4QL9A 5ID2A 2YWNA 3MWHA 3Q6OA 1OKDA 2C4JA 2CAQA 2PMTA 2KHPA 2N5BA 2YOIA 1PL1A 2B7KA 2JZSA 1NW2A 2F8FA 2B5EA 1ZCPA 1V2AA 3I9V2 4I5QA 1DUGA 4GQCA 4IJIA 3IE3A 1M7TA 4PGTA 2IMKA 4N0VA 2AB6A 2UZ8A 3H1NA 4AJ8A 1MD4A 4O5UA 1XVWA 2J23A 3GURA 2OE3A 2FY6A 1Z3EA 2H74A 2RUFA 3IXRA 1PMTA 4XCSA 3LG6A 1IYHA 2YWIA 1ZZYA 4YH2A 3TJFA 4FYUA 3LJRA 3A5IA 2MMNA 4PX1A 4K7NA 2F8AA 1O8WA 5JWOB 5G31A 2WZ9A 2VD0A 1AC1A 2GDRA 4BL7B 1SJ6A 1N8JA 1VGLA 1V98A 1YZXA 5HR2A 2PU9C 3ZVJA 3Q19A 14GSA 4GSTA 2H75A 2M80A 4KH7A 2H01A 1K0OA 2FA4A 3GHAA 5JWRB 4O7HA 4F2IA 3DD3A 1TP9A 4EKZA 2IIYA 1BG5A 3TRPA 2H70A 5E4WA 2DKIA 5G5EA 2K8SA 4EXJA 1UA5A 3VK9A 4ML6A 2IMFA 2VCXA 3D6IA 1PN0A 2IWTA 3IA1A 5DVBA 4MJAA 3GSTA 4JRRA 3ED3A 3GH6A 1OC9A 1Z7PA 3GKKA 3HD5A 5EPFA 1GSDA 3C1RA 1TI1A 4HZ4A 1XW5A 3UIWA 1EV9A 7GSSA 3QDNA 2R0PA 1S3CA 4O5QA 5KN3A 5CO3A 3HKRA 4TR4A 4EE0A 2OA7A 4ZL9A 1OE7A 2CZ3A 4DEJA 1EP7A 2LRTA 1O85A 4ACSA 4X1UA 2H73A 2AUVA 2VL3A 5COHA 3M9JA 4LL4B 3BOAA 4TR1B 3E9JB 5DDLA 2AJQB 3QAWA 1MEKA 3ZVJD 1G0TA 4XRDA 3LSZA 3V1WA 3EU3A 3HJOA 2MMZA 2HLSA 2H0IA 2BMXA 3ZYWA 2VCTA 4MLYA 3H4KA 1LJRA 4L5OA 1ON4A 1PX7A 2GZPA 1F3AA 1R26A 3D0ZA 4OO4A 2HRNA 1X5CA 2ZNMA 4O32A 3DGQA 1SD9A 4MJEA 3IHQA 4ECJA 3RPPA 3LYPA 2V41A 1EZKA 4CHSA 4TW5A 3RBTA 2O87A 3TB2A 1FAAA 4Z7XA 1DE2A 4OFNA 2B1LA 1ZYQB 2WULA 1B4PA 1K0AA 2YWOA 6GSTA 1ACVA 1AW9A 6GSUA 1XWCA 3GX0A 1T4ZA 1XWBA 3H8QA 4XHMA 1JLWA 2PUKC 1HNCA 1JZWA 2V6OA 3KH7A 4IN0A 4HI7A 5CREA 5IMZA 5C00A 3IRAA 2VLTA 1SU9A 1GTIA 3IHGA 1TTZA 4FYCA 1ZYPA 4BVYB 2FGXA 3G7JA 5IMVA 2H6YA 2HE3A 3DIEA 1WP0A 1XW6A 4K7IA 2MMAA 5CRGA 3KP9A 3DMLA 1X9WB 1Y6EA 2KUCA 2LQQA 1FW1A 2YANA 1RQMA 4RI7A 2PPTA 4EF0A 1UN2A 3EURA 1SKWB 1ZMAA 1MD3A 3EINA 2TRXA 2YCDA 2TIRA 4IQAA 2I9HA 1SYXA 3GMFA 3UBLA 3E0UA 2O7KA 3TKSE 4O5RA 2I1UA 5ECRB 2VM2A 2JL4A 1SENA 5D73A 3H93A 3QAGA 4JZQA 1XPVA 1G7OA 4FYBA 2H72A 3W8SA 4IKHA 1PRXA 1C72A 3ZIVA 4DSSA 3L9VA 2C1YA 5AIVA 1K0NA 3ZLPA 4J56E 4ZB9A 2HZEB 1TKDB 5DJMA 3EU4A 2A2RA 2GTUA 5ECNB 3VPTA 2A4VA 2K18A 2YNXA 3WT2A 1B9YC 3EYTA 3TKSC 3TJGA 22GSA 1SL1B 3MAKA 1Z7RA 1Z6NA 4GXZA 5CAXA 1Z6MA 4AGSA 1BAYA 2O89A 3NIVA 4ID0A 1O73A 1TI3A 2IFQB 2PN8A 2FWHA 2X64A 3L4NA 3GUSA 4NV2A 1HNAA 2A2SA 3LYKA 2IN3A 4Q5RA 2H0HA 3CXGA 3GL5A 3CTFA 3HCZA 2NPBA 5ENUA 3UL3A 4F0CA 4F82A 2IMIA 2DIZA 1B8XA 4JBBA 1FVKA 2L4CA 3HHVA 4XS4A 3D22A 5D9XA 4L5LA 2M72A 3FZ9A 3DYRA 1GLPA 2VOCA 2EC4A 1TU8A 4KSOA 3KMOA 2B5YA 1TDIA 4LMVA 1FOHA 2DJ3A 3VI5A 3KD0A 1N2AA 4RUVA 5J3RA 4POKA 5ELAA 1HD2A 2L59A 2PWJA 1U87A 2L5LA 2CA8A 1T7PB 1V40A 2L6CA 1XWGA 3TGZA 4NAXA 2QA1A 1PX6A 1T3BA 4MF6A 4XTSA 3GKXA 4HS1A 8GSSA 3VFIA 2C0EA 3QD9A 3WT1A 4G0LA 4D73B 3IR4A 1K0MA 4GLTA 2FCHA 3UMAA 5A4WA 2V1MA 2ALBA 4G0IA 5DALA 2GSSA 2OJLA 4LA1A 3ZFBA 3M0FA 3LFLA 1I9DA 3IV4A 1TOFA 4BA7A 2GQKA 2VD1A 5J5NA 1UC7A 4L8EA 2HI7A 4K2DA 4KE3A 3PINA 4GQFA 2XBIA 4K6XA 3LXTA 3GYKA 3GFKA 3PH9A 5INYA 2VL2A 2X8GA 3MIXA 4OO5A 3A2XA 1M9BA 3WD6A 3FK8A 1F6MC 3WGEA 12GSA 3APQA 4IELA 4K0GA 1K3LA 2K9FA 1TK0B 1PD21 2P31A 1WRYA 1GSEA 4NXIA 1Z5YE 1A8LA 1T4YA 1K3YA 1O7UA 1HYUA 1OC3A 2X8CA 4PNGA 3F4RA 5GSSA 1EOGA 1JZDA 3KMNA 4LL1B 3M8NA 1GUMA 3RHBA 4ECIA 5IMDA 1QUWA 5HFIA 3EWLA 2VLUA 1DBYA 5J4UA 2GS3A 3JCML 2DSAA 5ECMB 1XBSA 1KTEA 2LJRA 2H66A 2GZYA 1S3AA 2H1BA 5B8BA 4PQ1A 5GAPD 2AAWA 2L5OA 1THOA 2AYTA 5EL8A 3A2WA 4Z2TA 2FHEA 1YEXA 1X9MB 3L0HA 3DRNA 4BPYA 1G7EA 1U3AA 1VF3A 3HA9A 1MDJA 2YP6A 4KDYA 2H1DA 2ON5A 1TRVA 2VCQA 3DVWA 3GSSA 3MDKA 1TRUA 2C8UA 1NHOA 4TR0A 1K0CA 2REMA 3LW9A 4MJBA 4I2TA 1PL2A 2R0CA 3HYPA 3NOFA 1UVZA 3WGXA 1DSBA 4KDXA 2H6XA 3VLNA 5D96A 2H6ZA 4TKYA 5F0GA 1SJZA 4MCUA 3TJJA 2LJKA 2LTKA 3UARA 5D9VA 1GSSA 1ZL9A 2V2GA 1JFUA 2B5XA 1SJIA 5CYYA 2LJAA 4Q5FA 5DAKB 1QFNA 4PUFC 4TVEA 5FHIA 4NWYA 1VF4A 5ID2B 3G7YA 2WJUA 5GSTA 1B4QA 1ERTA 1KBNA 2PERA 11GSA 4JE1A 1WOUA 4EIPA 4PTSA 5GAND 2P5QA 4MP4A 4TXOB 3P7XA 4ZILA 4HDEA 4PUAA 2NTOA 2DMMA 4IHUA 4L0WA 5AISA 4V1Ag 5J41A 1YQ1A 1U88A 2DJ2A 2CVDA 4G10A 4YQUA 5ELGA 3ZFLA 3FEUA 1M2DA 4TOPA 2LKUA 5IIZA 3DWVA 1YF0A 5D9WA 5EY6A 3ZMLA 2RIIA 2YV9A 2E2MA 2C3NA 4XS6A 4N10A 4CY8A 4K9ZA 2KLXA 2YJ7A 2K6VA 3ERFA 3LORA 4WF4A 4PURA 1KNGA 2D2ZA 2HNLA 2WFCA 2GQMA 3HZ8A 5ECOB 5BMUA 3CRUA 2NBSA 1THXA 1I5GA 2DBCA 4WR4A 3L9SA 4JR4A 1K3OA 1V58A 3RAZA 1TJDA 3UVHA 2E7PA 4Q5QA 3ZRDA 1E6BA 2HZFA 3TKRA 4K5RA 2X99A 4MZWA 4PQIA 4GSSA 4PXOA 2JZTA 2IMDA 2GGTA 3IK9A 2OBKA 2G2QA 4MNNA 2C0GA 1OE8A 4NV5A 5LNKe 1U6TA 1AAZA 1F3BA 1Y25A 1EEMA 2QA2A 2LV3A 1O6JA 1OC9B 1O8XA 2OADA 2KP1A 3VWVA 2C80A 3A5WA 4NHWA 2HFDA 1ERWA 2JZRA 4ZBAA 2GSTA 1HNBA 4E8HA 1EOHA 1YY7A 1M99A 1J9BA 4IGJA 2RM6A 3TJBA 19GSA 2ES7A 3ERWA 3F63A 2WCIA 2GZZA 2B3SA 1VRSD 3AY8A 3EE2A 1X5DA 4N11A 3GTUA 2I3YA 4WR5A 4MH3A 4K2XA 2X49A 1YF1A 3F9UA 4FO5A 4BVYA 1QMVA 4DVCA 2CAIA 1A8YA 2R0GA 5ABRA 2JU5A 2FWEA 2VAFA 2YJHA 3FR6A 2LSTA 1FHEA 1CQHA 3EVIA 4AJ6A 1WMJA 4XRAA 1GH2A 5HFKA 3C7MA 3APSA 4L0UA 1A24A 2R3XA 5B6NA 2KP2A 2WB9A 4WKWA 3LXZA 4YAVA 1S3DA 2H0GA 1PSQA 3QPMA 3F4SA 4WF5A 4HJMA 5JCGA 4USSA 2LRCA 1GSUA 2QSIA 1F37A 4XIHA 5IQYA 3MSZA 4ISDA 3C1SA 4EVMA 2GT5A 3SBCA 2E2GA 4KGIA 2G0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ERV A;  2OAC A;  1TRW A;  2WDU A;  2FUG 2;  2HSY A;  5F8B A;  3HVS A;  5A4V A;  3Q18 A;  6GSY A;  2AV4 A;  4EL1 A;  3F3Q A;  1SKR B;  4AJ7 A;  3HXS A;  3RPN A;  3TRQ A;  6GSS A;  4DSR A;  4K1F A;  2LUS A;  3P90 A;  4V2L A;  1LBK A;  5FT3 A;  2GQL A;  3IDV A;  3CTG A;  1XFL A;  3QAV A;  2HZE A;  1CQG A;  2L6D A;  2VCZ A;  3Q74 A;  5JCW A;  1TRS A;  4H86 A;  3F4T A;  3UAP A;  1O81 A;  3IK7 A;  2B7J A;  4LMW A;  3F6F A;  1BJX A;  2B6M A;  3O3T A;  3MNG A;  4EUY A;  1ERU A;  2X8H A;  3CSJ A;  2IPA A;  4OWY A;  2QKE A;  4MPG A;  3U5R E;  3E3E A;  3VUR A;  1FVJ A;  5H5R A;  3KH9 A;  2RUE A;  5G1L A;  5JWQ B;  5DJL A;  3R2Q A;  1GTU A;  2YN1 A;  5CRH A;  1AQW A;  1SL2 B;  1R5A A;  3FZ4 A;  4NHZ A;  5DQY A;  1BX9 A;  3HDC A;  2DIY A;  3M1G A;  3GRX A;  5F05 A;  2JAD A;  3ERG A;  5J9C A;  4K0N A;  4F0B A;  3TCO A;  1B48 A;  3SWL A;  4IJ3 A;  4BWS A;  3GNJ A;  2JAC A;  5IM9 A;  1GUL A;  1B9X C;  2PVO C;  1GNE A;  16GS A;  1H4O A;  4XS1 A;  1H75 A;  4IW9 A;  2HSH A;  3GA4 A;  3GN3 A;  3K8N A;  1A23 A;  1WE0 A;  4MZC A;  1QK8 A;  2MMO A;  4HQZ A;  3KM6 A;  4DSS B;  5D9T A;  3ZZX A;  4KX4 A;  1ZGN A;  3GKM A;  1F9M A;  1GNW A;  1GP1 A;  2R5G A;  3TUE A;  1XOB A;  2QC7 A;  4KCA A;  2YZH A;  2C3Q A;  2XPE A;  1AQV A;  3GV1 A;  4X43 A;  2EIR A;  2VL2 C;  4GF0 A;  3KEB A;  4K7O A;  5DBQ A;  1A0F A;  4K8M A;  2B1K A;  4NMU A;  2CVK A;  4ILF A;  1T00 A;  3M9K A;  4YAP A;  6GSW A;  1YEP A;  5ECQ B;  4OFM A;  3VPQ A;  4KUN A;  5J9B A;  4O92 A;  2CV4 A;  3GX8 A;  2VCW A;  3VI7 A;  1GUH A;  2OBI A;  2PGT A;  2WRT A;  3EMX A;  3EC3 A;  2PBJ A;  4MZB A;  4GTU A;  4OFT A;  2LQO A;  3UBK A;  4EDZ A;  4YQV A;  4MMM A;  4KCE A;  2IJY A;  4XS4 B;  3RHC A;  3IC4 A;  1A0R P;  4EDY A;  4MH2 A;  2P0G A;  5DCG A;  3CBU A;  1SL0 B;  2CX3 A;  2XHF A;  1F2E A;  3QFB C;  1GWC A;  4TR3 A;  3KP8 A;  3L9U A;  1SKS B;  4ZL7 A;  10GS A;  2MZC A;  1EWX A;  4MF7 A;  1TK5 B;  5ECI B;  1Z9H A;  2LNS A;  3D4T A;  1EV4 A;  5HQP A;  1XOA A;  5A4U A;  4HOJ A;  1OYJ A;  2DC5 A;  4TN8 A;  1WJK A;  4FIW A;  2CZ2 A;  4JED A;  9GSS A;  2VIM A;  5DAL B;  1AQX A;  1AUC A;  4MAB A;  3KTL A;  3QR6 A;  1Q4J A;  2HYX A;  2TRC P;  3QFA C;  5IPG A;  2H1G A;  2H76 A;  18GS A;  1X0R A;  1XCC A;  1JHB A;  4MF5 A;  1T8E B;  4IBP A;  5G30 A;  3KXO A;  3ZTL A;  1XWA A;  3HJM A;  3J7Y b;  1V9W A;  4OCE A;  4KB3 A;  4MK3 A;  2EIO A;  5HR1 A;  4PQH A;  3ME7 A;  1TXX A;  3UOM A;  4OD7 A;  4TRX A;  2M46 A;  1RK4 A;  3LWA A;  4YQM A;  5CRD A;  4WBJ A;  1PA3 A;  2LS5 A;  5IMF A;  5B6M A;  2HT9 A;  4BL7 A;  4DSQ A;  3VWX A;  3D4M A;  2DJ1 A;  1QGV A;  3D21 A;  1GLQ A;  1T1V A;  4TXO A;  1YKC A;  3P2A A;  4IP6 A;  4HJ2 A;  1VF1 A;  5KN1 A;  1ABA A;  5IPH A;  5AGY A;  1GTB A;  4IS0 A;  3FRC A;  4RQX A;  4ZBD A;  3J7Y k;  2LEG A;  1XXU A;  3TOT A;  1X9S B;  1MDI A;  4V1A p;  1QQ2 A;  3S9F A;  5ECH B;  3BBY A;  3KTB A;  1GRX A;  3CSI A;  1R4W A;  4QL7 A;  1R5P A;  4IP1 A;  3O76 A;  3RDW A;  2VUP A;  4ZB6 A;  1SK1 A;  2DML A;  3CMI A;  4HU9 A;  5JCU A;  2IME A;  4CDO A;  1Q98 A;  2R37 A;  4NPB A;  4KDU A;  3ZRE A;  1OVN A;  4E8E A;  5G5F A;  5AIX A;  4AF2 A;  5LCZ A;  3VWW A;  5L71 A;  2FA8 A;  2IL3 A;  6GSV A;  2VO4 A;  1RW1 A;  4ZBB A;  4TR1 A;  1NSW A;  5CNW A;  3PGT A;  1WPI A;  3KCM A;  4ZXG A;  3W6G A;  5ECP B;  1SYR A;  2J9H A;  3QOU A;  3QCP A;  4RQR A;  1JLV A;  2FD3 A;  3TKQ A;  1SK0 A;  2FNO A;  5DCH A;  4GWR A;  2MYG A;  1MTC A;  2HRF A;  1ZOF A;  1ST9 A;  20GS A;  2XBQ A;  4J57 E;  1WIK A;  3F6D A;  3HZ4 A;  3LQ7 A;  4X0X A;  3KIJ A;  2F3M A;  5IMA A;  2I4A A;  5ECS A;  1X5E A;  4KA0 A;  1YDK A;  3KJY A;  2QGV A;  3BJ5 A;  5IO2 A;  3CRT A;  2V6K A;  5EVO A;  3I69 A;  2YPM A;  5IOX A;  1WWJ A;  5B7C A;  2FLS A;  3C8E A;  2OE0 A;  1AIU A;  5F06 A;  2DLX A;  4GSN A;  3GIX A;  5ECK B;  3IBH A;  5HFG A;  1A2L A;  2HXK A;  2R6K A;  5G2Z A;  4POB A;  2L4Q A;  1PGT A;  4ZB8 A;  1M9A A;  4HEA 2;  1GL8 A;  3GH9 A;  4OCF A;  1NHY A;  2VL9 A;  1XWK A;  2FWG A;  4EO3 A;  3DEX A;  3FZ5 A;  4KW6 A;  2WS2 A;  1J08 A;  2ZUP A;  1OC8 A;  3U6V A;  3APO A;  5F07 A;  3CSH A;  3FKF A;  2BJX A;  5KN2 A;  4I2U A;  3N5O A;  3GL3 A;  4N30 A;  3DVX A;  2Z9S A;  1BQ7 A;  1EGO A;  4POL A;  2JSZ A;  5G1K A;  1EP8 A;  3ZIT A;  3ZMK A;  2YZU A;  5KN0 A;  3CYN A;  2XC2 A;  2NVL A;  5IOW A;  4POM A;  1YJ6 A;  2CT6 A;  5FWG A;  5CRW A;  3I6A A;  3O6T A;  4PNF A;  5C04 A;  1PQN A;  4EC0 A;  1FB0 A;  1ZYE A;  3TOU A;  1XZO A;  1MDK A;  4WEY A;  3IOS A;  5HR3 A;  5IMC A;  3IAS 2;  1K0D A;  2OKA A;  1PKZ A;  1FG4 A;  2OE1 A;  4QQ7 A;  1ML6 A;  2CQ9 A;  3GTU B;  2CX4 A;  2VCV A;  2K8V A;  2RLI A;  3UJ1 A;  4FH8 A;  5E59 A;  4G9H A;  2L57 A;  2JSY A;  2H8L A;  2BTO T;  1PKW A;  1BED A;  4ML1 A;  1JZR A;  3UEM A;  1OAZ A;  3FR3 A;  1TK8 B;  2V32 A;  3TJK A;  5AN1 A;  1GUK A;  3NZN A;  1HQO A;  4RI6 A;  1M2A A;  3F3R A;  2MBS A;  5H5S A;  1XW9 A;  3C73 A;  1W4V A;  3BCI A;  4HQS A;  4HUA A;  4G2E A;  3WGD A;  3HJP A;  1SK2 A;  3FY7 A;  2GLR A;  2KOK A;  1BYE A;  2GSQ A;  2IFQ A;  3L78 A;  1AXD A;  1G6Y A;  1YKA A;  2H30 A;  2DJ0 A;  4I97 A;  2XPD A;  4Q5N A;  1E2Y A;  1M2B A;  3HVV A;  4WBR D;  1PN9 A;  3P8W A;  4MJC A;  3N9J A;  2WGR A;  3FR9 A;  3VWU A;  4CW9 A;  4I8B A;  3W8J A;  3ME8 A;  1USB A;  1EGR A;  1R7H A;  5D93 A;  3FZA A;  5HR0 A;  4JR6 A;  1ILO A;  2R4V A;  2GSR A;  4ZL8 A;  1GSY A;  1OKT A;  5D8I A;  1GSF A;  5B8A A;  4F9Z A;  13GS A;  2NDO A;  2PVQ A;  17GS A;  4ECC A;  3C71 A;  1G6W A;  1M0U A;  1TU7 A;  2FWF A;  2P5R A;  3GKN A;  3US3 A;  4D73 A;  2GVP A;  2ON7 A;  2H71 A;  3ISO A;  3FYG A;  3I43 A;  1VF2 A;  2I81 A;  4J2F A;  1V57 A;  3F8U A;  1A2J A;  2C0F A;  1URM A;  2DJJ A;  4KAE A;  5LD0 A;  1K0B A;  2C0D A;  3M3M A;  3HY2 A;  3ZIJ A;  4HU7 A;  1NM3 A;  4I6X A;  4LLR A;  4V2N A;  1J0F A;  4JU5 A;  3BD2 A;  1U3I A;  1EEJ A;  3TKP A;  2GT6 A;  4WXT A;  1LU4 A;  3EMP A;  3D5J A;  2F51 A;  4KND A;  2VLV A;  6GSX A;  4ZIJ A;  3TKS A;  5A5K A;  1GSQ A;  1W89 A;  5GZZ B;  2F9S A;  5KEJ A;  3KGK A;  4KSM A;  2E0Q A;  4N0Z A;  2CVB A;  3A2V A;  3KZQ A;  1FO5 A;  4OMV A;  1XVQ A;  4HZ2 A;  3FHK A;  4MDC A;  4BVX A;  4MA9 A;  4P3Y B;  2MBT A;  1KEB A;  3OR5 A;  2AHE A;  2O8V B;  4GRF A;  2LNT A;  4TXV A;  1XIY A;  2VM1 A;  3LGC A;  4F03 A;  1FB6 A;  3PR8 A;  5H5Q A;  2C3T A;  3IPZ A;  4IQ1 A;  5ECL B;  4ULX A;  1DE1 A;  1TW9 A;  5DQS A;  1QXH A;  2O85 A;  2DJK A;  2ZCT A;  3BCK A;  1FOV A;  1IYI A;  3DXB A;  1A2M A;  3H79 A;  4G19 A;  2YV7 A;  2H1A A;  3G7I A;  3FW2 A;  3UVT A;  2RM5 A;  3DKS A;  1JZO A;  4WET A;  3TDG A;  3WYW A;  3F0I A;  2EIQ A;  2N5F A;  4V2M A;  2N5A A;  4MPF A;  3QMX A;  1SD8 A;  4GCI A;  4BWQ A;  2R2J A;  3G9B A;  3HVX A;  2H19 A;  5IO0 A;  4IVF A;  5CP1 A;  4ECB A;  3LEF A;  3A3T A;  3ZL5 A;  2LRN A;  5DAK A;  1GTA A;  3IAM 2;  2YWM A;  3TRX A;  4QL9 A;  5ID2 A;  2YWN A;  3MWH A;  3Q6O A;  1OKD A;  2C4J A;  2CAQ A;  2PMT A;  2KHP A;  2N5B A;  2YOI A;  1PL1 A;  2B7K A;  2JZS A;  1NW2 A;  2F8F A;  2B5E A;  1ZCP A;  1V2A A;  3I9V 2;  4I5Q A;  1DUG A;  4GQC A;  4IJI A;  3IE3 A;  1M7T A;  4PGT A;  2IMK A;  4N0V A;  2AB6 A;  3H1N A;  4AJ8 A;  1MD4 A;  1XVW A;  2J23 A;  3GUR A;  2OE3 A;  2FY6 A;  1Z3E A;  2H74 A;  2RUF A;  3IXR A;  1PMT A;  4XCS A;  3LG6 A;  1IYH A;  2YWI A;  1ZZY A;  4YH2 A;  3TJF A;  4FYU A;  3LJR A;  2MMN A;  4PX1 A;  4K7N A;  2F8A A;  1O8W A;  5JWO B;  5G31 A;  2WZ9 A;  2VD0 A;  1AC1 A;  2GDR A;  1SJ6 A;  1N8J A;  1VGL A;  1V98 A;  1YZX A;  5HR2 A;  2PU9 C;  3ZVJ A;  3Q19 A;  14GS A;  4GST A;  2H75 A;  2M80 A;  4KH7 A;  2H01 A;  1K0O A;  2FA4 A;  3GHA A;  5JWR B;  4O7H A;  4F2I A;  3DD3 A;  1TP9 A;  4EKZ A;  2IIY A;  1BG5 A;  3TRP A;  2H70 A;  5E4W A;  5G5E A;  2K8S A;  4EXJ A;  1UA5 A;  3VK9 A;  4ML6 A;  2IMF A;  2VCX A;  3D6I A;  2IWT A;  3IA1 A;  5DVB A;  4MJA A;  3GST A;  4JRR A;  3ED3 A;  3GH6 A;  1OC9 A;  1Z7P A;  3GKK A;  3HD5 A;  5EPF A;  1GSD A;  3C1R A;  1TI1 A;  4HZ4 A;  1XW5 A;  3UIW A;  1EV9 A;  7GSS A;  3QDN A;  1S3C A;  5KN3 A;  5CO3 A;  3HKR A;  4TR4 A;  4EE0 A;  2OA7 A;  4ZL9 A;  1OE7 A;  2CZ3 A;  4DEJ A;  1EP7 A;  2LRT A;  1O85 A;  4ACS A;  4X1U A;  2H73 A;  2AUV A;  2VL3 A;  5COH A;  3M9J A;  4LL4 B;  3BOA A;  4TR1 B;  3E9J B;  5DDL A;  2AJQ B;  3QAW A;  1MEK A;  3ZVJ D;  1G0T A;  4XRD A;  3LSZ A;  3V1W A;  3EU3 A;  3HJO A;  2MMZ A;  2HLS A;  2H0I A;  2BMX A;  3ZYW A;  2VCT A;  4MLY A;  3H4K A;  1LJR A;  4L5O A;  1ON4 A;  1PX7 A;  2GZP A;  1F3A A;  1R26 A;  3D0Z A;  4OO4 A;  2HRN A;  1X5C A;  2ZNM A;  4O32 A;  3DGQ A;  1SD9 A;  4MJE A;  3IHQ A;  4ECJ A;  3RPP A;  3LYP A;  2V41 A;  1EZK A;  4CHS A;  4TW5 A;  3RBT A;  2O87 A;  3TB2 A;  1FAA A;  4Z7X A;  1DE2 A;  4OFN A;  2B1L A;  1ZYQ B;  2WUL A;  1B4P A;  1K0A A;  2YWO A;  6GST A;  1ACV A;  1AW9 A;  6GSU A;  1XWC A;  3GX0 A;  1T4Z A;  1XWB A;  3H8Q A;  4XHM A;  1JLW A;  2PUK C;  1HNC A;  1JZW A;  2V6O A;  3KH7 A;  4IN0 A;  4HI7 A;  5CRE A;  5IMZ A;  5C00 A;  3IRA A;  2VLT A;  1SU9 A;  1GTI A;  1TTZ A;  4FYC A;  2FGX A;  3G7J A;  5IMV A;  2H6Y A;  2HE3 A;  3DIE A;  1WP0 A;  1XW6 A;  4K7I A;  2MMA A;  5CRG A;  3KP9 A;  3DML A;  1X9W B;  1Y6E A;  2KUC A;  2LQQ A;  1FW1 A;  2YAN A;  1RQM A;  4RI7 A;  2PPT A;  4EF0 A;  1UN2 A;  3EUR A;  1SKW B;  1ZMA A;  1MD3 A;  3EIN A;  2TRX A;  2YCD A;  2TIR A;  4IQA A;  2I9H A;  1SYX A;  3GMF A;  3UBL A;  3E0U A;  2O7K A;  3TKS E;  4O5R A;  2I1U A;  5ECR B;  2VM2 A;  2JL4 A;  1SEN A;  5D73 A;  3H93 A;  3QAG A;  4JZQ A;  1XPV A;  1G7O A;  4FYB A;  2H72 A;  3W8S A;  4IKH A;  1PRX A;  1C72 A;  3ZIV A;  4DSS A;  3L9V A;  2C1Y A;  5AIV A;  1K0N A;  3ZLP A;  4J56 E;  4ZB9 A;  2HZE B;  1TKD B;  5DJM A;  3EU4 A;  2A2R A;  2GTU A;  5ECN B;  3VPT A;  2A4V A;  2K18 A;  2YNX A;  3WT2 A;  1B9Y C;  3EYT A;  3TKS C;  3TJG A;  22GS A;  1SL1 B;  3MAK A;  1Z7R A;  1Z6N A;  4GXZ A;  5CAX A;  1Z6M A;  4AGS A;  1BAY A;  2O89 A;  3NIV A;  4ID0 A;  1O73 A;  1TI3 A;  2IFQ B;  2PN8 A;  2FWH A;  2X64 A;  3L4N A;  3GUS A;  4NV2 A;  1HNA A;  2A2S A;  3LYK A;  2IN3 A;  4Q5R A;  2H0H A;  3CXG A;  3GL5 A;  3CTF A;  3HCZ A;  2NPB A;  5ENU A;  3UL3 A;  4F0C A;  4F82 A;  2IMI A;  2DIZ A;  1B8X A;  4JBB A;  1FVK A;  2L4C A;  3HHV A;  4XS4 A;  3D22 A;  5D9X A;  4L5L A;  2M72 A;  3FZ9 A;  3DYR A;  1GLP A;  2VOC A;  2EC4 A;  1TU8 A;  4KSO A;  3KMO A;  2B5Y A;  1TDI A;  4LMV A;  2DJ3 A;  3VI5 A;  3KD0 A;  1N2A A;  4RUV A;  5J3R A;  4POK A;  5ELA A;  1HD2 A;  2L59 A;  2PWJ A;  1U87 A;  2L5L A;  2CA8 A;  1T7P B;  1V40 A;  2L6C A;  1XWG A;  3TGZ A;  4NAX A;  1PX6 A;  1T3B A;  4MF6 A;  4XTS A;  3GKX A;  4HS1 A;  8GSS A;  3VFI A;  2C0E A;  3QD9 A;  3WT1 A;  4D73 B;  3IR4 A;  1K0M A;  4GLT A;  2FCH A;  3UMA A;  5A4W A;  2V1M A;  2ALB A;  5DAL A;  2GSS A;  2OJL A;  4LA1 A;  3ZFB A;  3M0F A;  3LFL A;  1I9D A;  3IV4 A;  1TOF A;  4BA7 A;  2GQK A;  2VD1 A;  5J5N A;  1UC7 A;  4L8E A;  2HI7 A;  4K2D A;  4KE3 A;  3PIN A;  4GQF A;  2XBI A;  4K6X A;  3LXT A;  3GYK A;  3GFK A;  3PH9 A;  5INY A;  2VL2 A;  2X8G A;  4OO5 A;  3A2X A;  1M9B A;  3WD6 A;  3FK8 A;  1F6M C;  3WGE A;  12GS A;  3APQ A;  4IEL A;  4K0G A;  1K3L A;  2K9F A;  1TK0 B;  1PD2 1;  2P31 A;  1WRY A;  1GSE A;  4NXI A;  1Z5Y E;  1A8L A;  1T4Y A;  1K3Y A;  1O7U A;  1HYU A;  1OC3 A;  2X8C A;  4PNG A;  3F4R A;  5GSS A;  1EOG A;  1JZD A;  3KMN A;  4LL1 B;  3M8N A;  1GUM A;  3RHB A;  4ECI A;  5IMD A;  1QUW A;  5HFI A;  3EWL A;  2VLU A;  1DBY A;  5J4U A;  2GS3 A;  3JCM L;  2DSA A;  5ECM B;  1XBS A;  1KTE A;  2LJR A;  2H66 A;  2GZY A;  1S3A A;  2H1B A;  5B8B A;  4PQ1 A;  5GAP D;  2AAW A;  2L5O A;  1THO A;  2AYT A;  5EL8 A;  3A2W A;  2FHE A;  1YEX A;  1X9M B;  3L0H A;  3DRN A;  4BPY A;  1G7E A;  1U3A A;  1VF3 A;  3HA9 A;  1MDJ A;  2YP6 A;  4KDY A;  2H1D A;  2ON5 A;  1TRV A;  2VCQ A;  3DVW A;  3GSS A;  3MDK A;  1TRU A;  2C8U A;  1NHO A;  4TR0 A;  1K0C A;  2REM A;  4MJB A;  4I2T A;  1PL2 A;  3HYP A;  3NOF A;  1UVZ A;  3WGX A;  1DSB A;  4KDX A;  2H6X A;  3VLN A;  5D96 A;  2H6Z A;  4TKY A;  5F0G A;  1SJZ A;  4MCU A;  3TJJ A;  2LJK A;  2LTK A;  3UAR A;  5D9V A;  1GSS A;  1ZL9 A;  2V2G A;  1JFU A;  2B5X A;  1SJI A;  5CYY A;  2LJA A;  4Q5F A;  5DAK B;  1QFN A;  4PUF C;  4TVE A;  5FHI A;  4NWY A;  1VF4 A;  5ID2 B;  3G7Y A;  2WJU A;  5GST A;  1B4Q A;  1ERT A;  1KBN A;  2PER A;  11GS A;  4JE1 A;  1WOU A;  5GAN D;  2P5Q A;  4MP4 A;  4TXO B;  3P7X A;  4ZIL A;  4HDE A;  4PUA A;  2NTO A;  2DMM A;  4IHU A;  4L0W A;  5AIS A;  4V1A g;  5J41 A;  1YQ1 A;  1U88 A;  2DJ2 A;  2CVD A;  4G10 A;  4YQU A;  5ELG A;  3ZFL A;  3FEU A;  1M2D A;  4TOP A;  2LKU A;  5IIZ A;  3DWV A;  1YF0 A;  5D9W A;  5EY6 A;  3ZML A;  2RII A;  2YV9 A;  2E2M A;  2C3N A;  4XS6 A;  4N10 A;  4K9Z A;  2KLX A;  2YJ7 A;  2K6V A;  3ERF A;  3LOR A;  4WF4 A;  4PUR A;  1KNG A;  2D2Z A;  2HNL A;  2WFC A;  2GQM A;  3HZ8 A;  5ECO B;  3CRU A;  2NBS A;  1THX A;  1I5G A;  2DBC A;  4WR4 A;  3L9S A;  4JR4 A;  1K3O A;  1V58 A;  3RAZ A;  1TJD A;  3UVH A;  2E7P A;  4Q5Q A;  3ZRD A;  1E6B A;  2HZF A;  3TKR A;  4MZW A;  2X99 A;  4PQI A;  4GSS A;  4PXO A;  2JZT A;  2IMD A;  2GGT A;  3IK9 A;  2OBK A;  2G2Q A;  2C0G A;  1OE8 A;  4NV5 A;  5LNK e;  1U6T A;  1AAZ A;  1F3B A;  1Y25 A;  1EEM A;  2LV3 A;  1O6J A;  1OC9 B;  1O8X A;  2OAD A;  2KP1 A;  3VWV A;  2C80 A;  3A5W A;  4NHW A;  2HFD A;  1ERW A;  2JZR A;  4ZBA A;  2GST A;  1HNB A;  4E8H A;  1EOH A;  1YY7 A;  1M99 A;  1J9B A;  4IGJ A;  2RM6 A;  3TJB A;  19GS A;  2ES7 A;  3ERW A;  3F63 A;  2WCI A;  2GZZ A;  2B3S A;  1VRS D;  3AY8 A;  3EE2 A;  1X5D A;  4N11 A;  3GTU A;  2I3Y A;  4WR5 A;  4MH3 A;  1YF1 A;  3F9U A;  4FO5 A;  4BVY A;  1QMV A;  4DVC A;  2CAI A;  1A8Y A;  5ABR A;  2JU5 A;  2FWE A;  2VAF A;  2YJH A;  3FR6 A;  2LST A;  1FHE A;  1CQH A;  3EVI A;  4AJ6 A;  1WMJ A;  4XRA A;  1GH2 A;  5HFK A;  3C7M A;  3APS A;  4L0U A;  1A24 A;  2R3X A;  5B6N A;  2KP2 A;  2WB9 A;  4WKW A;  3LXZ A;  4YAV A;  1S3D A;  2H0G A;  1PSQ A;  3QPM A;  3F4S A;  4WF5 A;  4HJM A;  5JCG A;  2LRC A;  1GSU A;  2QSI A;  1F37 A;  4XIH A;  5IQY A;  3MSZ A;  4ISD A;  3C1S A;  4EVM A;  2GT5 A;  3SBC A;  2E2G A;  4KGI A;  2G0F A; 
#chains in the Genus database with same CATH topology
 1ERV A;  2OAC A;  1TRW A;  2WDU A;  2FUG 2;  2HSY A;  5F8B A;  3HVS A;  5A4V A;  3Q18 A;  6GSY A;  2AV4 A;  4EL1 A;  3F3Q A;  1SKR B;  4AJ7 A;  3HXS A;  3RPN A;  3TRQ A;  6GSS A;  4DSR A;  4K1F A;  2LUS A;  3P90 A;  4V2L A;  1LBK A;  5FT3 A;  2GQL A;  3IDV A;  3CTG A;  1XFL A;  3QAV A;  2HZE A;  3MYD A;  1CQG A;  2L6D A;  2VCZ A;  3Q74 A;  5JCW A;  1TRS A;  4H86 A;  3F4T A;  3UAP A;  1O81 A;  3IK7 A;  2A2P A;  2B7J A;  4LMW A;  3F6F A;  1BJX A;  2B6M A;  3O3T A;  3MNG A;  4EUY A;  1ERU A;  2X8H A;  3CSJ A;  2IPA A;  3FMW A;  4OWY A;  2QKE A;  4MPG A;  3U5R E;  3E3E A;  3VUR A;  1FVJ A;  5H5R A;  3KH9 A;  2RUE A;  5G1L A;  5JWQ B;  5DJL A;  3R2Q A;  1GTU A;  2YN1 A;  5CRH A;  1AQW A;  1SL2 B;  4ICY A;  1R5A A;  3FZ4 A;  4NHZ A;  5DQY A;  1BX9 A;  3HDC A;  2DIY A;  3M1G A;  3GRX A;  5F05 A;  2JAD A;  3ERG A;  5J9C A;  4K0N A;  4F0B A;  3TCO A;  1B48 A;  3SWL A;  4IJ3 A;  4BWS A;  3GNJ A;  2JAC A;  5IM9 A;  4YKG A;  1GUL A;  1B9X C;  2PVO C;  1GNE A;  16GS A;  1H4O A;  4XS1 A;  1H75 A;  4IW9 A;  2HSH A;  3GA4 A;  3GN3 A;  3K8N A;  1A23 A;  1WE0 A;  4MZC A;  5BRT A;  1QK8 A;  2MMO A;  4HQZ A;  3KM6 A;  4DSS B;  5D9T A;  3ZZX A;  4KX4 A;  1ZGN A;  3GKM A;  1F9M A;  1GNW A;  1GP1 A;  2R5G A;  3TUE A;  1XOB A;  2QC7 A;  4KCA A;  2YZH A;  2C3Q A;  2XPE A;  1AQV A;  3GV1 A;  4X43 A;  2EIR A;  2VL2 C;  4GF0 A;  3KEB A;  4K7O A;  5DBQ A;  1A0F A;  4K8M A;  2B1K A;  4NMU A;  2CVK A;  4ILF A;  1T00 A;  3M9K A;  4YAP A;  6GSW A;  1YEP A;  5ECQ B;  4OFM A;  3VPQ A;  4KUN A;  5J9B A;  4O92 A;  2CV4 A;  3GX8 A;  2VCW A;  3VI7 A;  1GUH A;  2OBI A;  2PGT A;  2WRT A;  3EMX A;  3EC3 A;  1PFO A;  2PBJ A;  4MZB A;  4GTU A;  4OFT A;  2LQO A;  3UBK A;  4EDZ A;  4YQV A;  4MMM A;  4KCE A;  2IJY A;  4XS4 B;  3RHC A;  3IC4 A;  1A0R P;  4EDY A;  4MH2 A;  2P0G A;  5DCG A;  3CBU A;  1SL0 B;  2CX3 A;  2XHF A;  1F2E A;  3QFB C;  1GWC A;  4TR3 A;  3KP8 A;  3L9U A;  1SKS B;  4ZL7 A;  10GS A;  2MZC A;  1EWX A;  4MF7 A;  1TK5 B;  5ECI B;  1Z9H A;  2LNS A;  3D4T A;  1EV4 A;  5HQP A;  1XOA A;  5A4U A;  4HOJ A;  1OYJ A;  2DC5 A;  4TN8 A;  4KF9 A;  1WJK A;  4FIW A;  2CZ2 A;  4BVX B;  4JED A;  9GSS A;  2VIM A;  5DAL B;  1AQX A;  1AUC A;  3R3E A;  4MAB A;  3KTL A;  3QR6 A;  1Q4J A;  2HYX A;  2TRC P;  3IC8 A;  3QFA C;  5IPG A;  2H1G A;  2H76 A;  18GS A;  1X0R A;  1XCC A;  1JHB A;  4MF5 A;  1T8E B;  4IBP A;  5G30 A;  3KXO A;  3ZTL A;  1XWA A;  3HJM A;  3J7Y b;  1V9W A;  4OCE A;  4KB3 A;  4MK3 A;  2EIO A;  5HR1 A;  4PQH A;  3ME7 A;  1TXX A;  3UOM A;  4OD7 A;  4TRX A;  2M46 A;  1RK4 A;  3LWA A;  3PPU A;  4YQM A;  5CRD A;  4WBJ A;  1PA3 A;  2LS5 A;  5IMF A;  5B6M A;  2HT9 A;  4BL7 A;  2DKH A;  4DSQ A;  3VWX A;  3D4M A;  2DJ1 A;  1QGV A;  3D21 A;  1GLQ A;  1T1V A;  4TXO A;  1YKC A;  3P2A A;  4IP6 A;  4FQU A;  4HJ2 A;  1VF1 A;  5KN1 A;  1ABA A;  5IPH A;  5AGY A;  4Z2R A;  1GTB A;  4IS0 A;  3FRC A;  4RQX A;  4ZBD A;  3J7Y k;  2LEG A;  1XXU A;  3TOT A;  1X9S B;  1MDI A;  4V1A p;  1QQ2 A;  3S9F A;  5ECH B;  3BBY A;  3KTB A;  1GRX A;  3CSI A;  1R4W A;  4QL7 A;  1R5P A;  4IP1 A;  3O76 A;  3RDW A;  2VUP A;  4ZB6 A;  1SK1 A;  2DML A;  3CMI A;  4HU9 A;  5JCU A;  2IME A;  4CDO A;  1Q98 A;  2R37 A;  4NPB A;  4KDU A;  3ZRE A;  1OVN A;  4E8E A;  5G5F A;  4K5S A;  5KOW A;  5AIX A;  4AF2 A;  5LCZ A;  3VWW A;  5L71 A;  2FA8 A;  2IL3 A;  6GSV A;  2VO4 A;  1RW1 A;  4ZBB A;  4TR1 A;  1NSW A;  5CNW A;  3PGT A;  1WPI A;  3KCM A;  4ZXG A;  3W6G A;  2X4A A;  5ECP B;  1SYR A;  2J9H A;  3QOU A;  3QCP A;  4RQR A;  1JLV A;  2FD3 A;  3TKQ A;  1SK0 A;  2FNO A;  1M3I A;  5DCH A;  4GWR A;  2MYG A;  1MTC A;  2HRF A;  4CY6 A;  1ZOF A;  1ST9 A;  20GS A;  2XBQ A;  4J57 E;  1WIK A;  3F6D A;  3HZ4 A;  3LQ7 A;  4X0X A;  3KIJ A;  2F3M A;  5IMA A;  2I4A A;  5ECS A;  1X5E A;  4KA0 A;  1YDK A;  3KJY A;  2QGV A;  3BJ5 A;  5IO2 A;  3CRT A;  2V6K A;  5EVO A;  3CQF A;  3I69 A;  2YPM A;  5IOX A;  1WWJ A;  5B7C A;  2FLS A;  3C8E A;  2OE0 A;  1AIU A;  5F06 A;  2DLX A;  4GSN A;  3GIX A;  5ECK B;  3IBH A;  5HFG A;  1A2L A;  2HXK A;  2R6K A;  5G2Z A;  2HRK A;  4POB A;  2L4Q A;  1PGT A;  4ZB8 A;  1M9A A;  4HEA 2;  1GL8 A;  3GH9 A;  4OCF A;  1NHY A;  2VL9 A;  1XWK A;  2FWG A;  4EO3 A;  3DEX A;  3FZ5 A;  4KW6 A;  2WS2 A;  1J08 A;  1S3R A;  2ZUP A;  1OC8 A;  4Z2U A;  3U6V A;  3APO A;  5F07 A;  3CSH A;  3FKF A;  2BJX A;  5KN2 A;  4I2U A;  3N5O A;  3GL3 A;  4N30 A;  3DVX A;  2Z9S A;  1BQ7 A;  1EGO A;  4POL A;  2JSZ A;  5G1K A;  1EP8 A;  3ZIT A;  3ZMK A;  2YZU A;  5KN0 A;  3CYN A;  2XC2 A;  2NVL A;  5IOW A;  4POM A;  1YJ6 A;  2A4H A;  2CT6 A;  5FWG A;  5CRW A;  3I6A A;  3O6T A;  4PNF A;  5C04 A;  1PQN A;  4EC0 A;  1FB0 A;  4A5P A;  1ZYE A;  3TOU A;  1XZO A;  1MDK A;  4WEY A;  3IOS A;  5HR3 A;  5IMC A;  3IAS 2;  1K0D A;  2OKA A;  1PKZ A;  1FG4 A;  2OE1 A;  4QQ7 A;  1ML6 A;  2CQ9 A;  3GTU B;  2CX4 A;  2VCV A;  2K8V A;  2RLI A;  3UJ1 A;  4FH8 A;  5E59 A;  4G9H A;  2L57 A;  2JSY A;  2H8L A;  2BTO T;  1PKW A;  1BED A;  4ML1 A;  1JZR A;  3UEM A;  1OAZ A;  3FR3 A;  1TK8 B;  2V32 A;  3TJK A;  5AN1 A;  1GUK A;  3NZN A;  1HQO A;  4RI6 A;  1M2A A;  3F3R A;  2MBS A;  5H5S A;  1XW9 A;  3C73 A;  1W4V A;  2HRA A;  3BCI A;  4HQS A;  4HUA A;  4G2E A;  3WGD A;  3HJP A;  1SK2 A;  3FY7 A;  2GLR A;  2KOK A;  1BYE A;  2GSQ A;  2IFQ A;  3L78 A;  1AXD A;  1G6Y A;  1YKA A;  2H30 A;  2DJ0 A;  4I97 A;  2XPD A;  4Q5N A;  1E2Y A;  1M2B A;  3HVV A;  4WBR D;  1PN9 A;  3P8W A;  4MJC A;  3N9J A;  2WGR A;  3FR9 A;  4G0K A;  3VWU A;  4CW9 A;  4I8B A;  3W8J A;  3ME8 A;  4EIQ A;  1USB A;  1EGR A;  1R7H A;  5D93 A;  3FZA A;  5HR0 A;  4JR6 A;  1ILO A;  2R4V A;  2GSR A;  4ZL8 A;  1GSY A;  1OKT A;  5D8I A;  1GSF A;  5B8A A;  4F9Z A;  13GS A;  2NDO A;  2PVQ A;  17GS A;  4ECC A;  3C71 A;  4X4J A;  1G6W A;  1M0U A;  1TU7 A;  2FWF A;  2P5R A;  3GKN A;  3US3 A;  4D73 A;  2GVP A;  2ON7 A;  2H71 A;  3ISO A;  3FYG A;  3I43 A;  1VF2 A;  2I81 A;  4J2F A;  1V57 A;  3F8U A;  1A2J A;  2C0F A;  1URM A;  2DJJ A;  4KAE A;  5LD0 A;  1K0B A;  2C0D A;  3M3M A;  3HY2 A;  3ZIJ A;  4HU7 A;  1NM3 A;  4I6X A;  4LLR A;  4V2N A;  1J0F A;  4JU5 A;  3BD2 A;  1U3I A;  1EEJ A;  3TKP A;  2GT6 A;  4WXT A;  1LU4 A;  3EMP A;  3D5J A;  3EPT A;  2F51 A;  4BIK A;  4KND A;  2VLV A;  6GSX A;  4ZIJ A;  3TKS A;  5A5K A;  1GSQ A;  1W89 A;  5GZZ B;  2F9S A;  5KEJ A;  3KGK A;  4KSM A;  2E0Q A;  4N0Z A;  2CVB A;  3A2V A;  3KZQ A;  1FO5 A;  4OMV A;  1XVQ A;  4HZ2 A;  3FHK A;  4MDC A;  4BVX A;  4MA9 A;  4P3Y B;  2MBT A;  1KEB A;  3OR5 A;  2AHE A;  2O8V B;  4GRF A;  2LNT A;  4TXV A;  1XIY A;  2VM1 A;  3LGC A;  4F03 A;  1FB6 A;  3PR8 A;  5KOX A;  5H5Q A;  2C3T A;  3IPZ A;  4IQ1 A;  5ECL B;  4ULX A;  1DE1 A;  1TW9 A;  5DQS A;  1QXH A;  2O85 A;  2DJK A;  2ZCT A;  3BCK A;  1FOV A;  1IYI A;  3DXB A;  1A2M A;  3H79 A;  4G19 A;  2YV7 A;  4YKF A;  2H1A A;  3G7I A;  3FW2 A;  3UVT A;  2RM5 A;  3DKS A;  1JZO A;  4WET A;  3TDG A;  3WYW A;  3F0I A;  2EIQ A;  2N5F A;  4V2M A;  2N5A A;  4MPF A;  3QMX A;  1SD8 A;  4GCI A;  4BWQ A;  2R2J A;  3G9B A;  3HVX A;  2H19 A;  5IO0 A;  4IVF A;  5CP1 A;  4ECB A;  3LEF A;  3A3T A;  3ZL5 A;  2LRN A;  1ZYN A;  5DAK A;  2HSM A;  1GTA A;  3IAM 2;  2YWM A;  3TRX A;  4QL9 A;  5ID2 A;  2YWN A;  3MWH A;  3Q6O A;  1OKD A;  2C4J A;  2CAQ A;  2PMT A;  2KHP A;  2N5B A;  2YOI A;  1PL1 A;  2B7K A;  2JZS A;  1NW2 A;  2F8F A;  2B5E A;  1ZCP A;  1V2A A;  3I9V 2;  4I5Q A;  1DUG A;  4GQC A;  4IJI A;  3IE3 A;  1M7T A;  4PGT A;  2IMK A;  4N0V A;  2AB6 A;  2UZ8 A;  3H1N A;  4AJ8 A;  1MD4 A;  4O5U A;  1XVW A;  2J23 A;  3GUR A;  2OE3 A;  2FY6 A;  1Z3E A;  2H74 A;  2RUF A;  3IXR A;  1PMT A;  4XCS A;  3LG6 A;  1IYH A;  2YWI A;  1ZZY A;  4YH2 A;  3TJF A;  4FYU A;  3LJR A;  3A5I A;  2MMN A;  4PX1 A;  4K7N A;  2F8A A;  1O8W A;  5JWO B;  5G31 A;  2WZ9 A;  2VD0 A;  1AC1 A;  2GDR A;  4BL7 B;  1SJ6 A;  1N8J A;  1VGL A;  1V98 A;  1YZX A;  5HR2 A;  2PU9 C;  3ZVJ A;  3Q19 A;  14GS A;  4GST A;  2H75 A;  2M80 A;  4KH7 A;  2H01 A;  1K0O A;  2FA4 A;  3GHA A;  5JWR B;  4O7H A;  4F2I A;  4HSC X;  3DD3 A;  1TP9 A;  4EKZ A;  2IIY A;  1BG5 A;  3TRP A;  2H70 A;  5E4W A;  2DKI A;  5G5E A;  2K8S A;  4EXJ A;  1UA5 A;  3VK9 A;  4ML6 A;  2IMF A;  2VCX A;  3D6I A;  1PN0 A;  2IWT A;  3IA1 A;  5DVB A;  4MJA A;  3GST A;  4JRR A;  3ED3 A;  3GH6 A;  1OC9 A;  1Z7P A;  3GKK A;  3HD5 A;  5EPF A;  1GSD A;  3C1R A;  1TI1 A;  4HZ4 A;  1XW5 A;  3UIW A;  1EV9 A;  7GSS A;  3QDN A;  2R0P A;  1S3C A;  4O5Q A;  5KN3 A;  5CO3 A;  3HKR A;  4TR4 A;  4EE0 A;  2OA7 A;  4ZL9 A;  1OE7 A;  2CZ3 A;  4DEJ A;  1EP7 A;  2LRT A;  1O85 A;  4ACS A;  4X1U A;  2H73 A;  2AUV A;  2VL3 A;  5COH A;  3M9J A;  4LL4 B;  3BOA A;  4TR1 B;  3E9J B;  5DDL A;  2AJQ B;  3QAW A;  1MEK A;  3ZVJ D;  1G0T A;  4XRD A;  3LSZ A;  3V1W A;  3EU3 A;  3HJO A;  2MMZ A;  2HLS A;  2H0I A;  2BMX A;  3ZYW A;  2VCT A;  4MLY A;  3H4K A;  1LJR A;  4L5O A;  1ON4 A;  1PX7 A;  2GZP A;  1F3A A;  1R26 A;  3D0Z A;  4OO4 A;  1XG8 A;  2HRN A;  1X5C A;  2ZNM A;  4O32 A;  3DGQ A;  1SD9 A;  4MJE A;  3IHQ A;  4ECJ A;  3RPP A;  3LYP A;  2V41 A;  1EZK A;  4CHS A;  4TW5 A;  3RBT A;  2O87 A;  3TB2 A;  1FAA A;  4Z7X A;  1DE2 A;  4OFN A;  2B1L A;  1ZYQ B;  2WUL A;  1B4P A;  1K0A A;  2YWO A;  6GST A;  1ACV A;  1AW9 A;  6GSU A;  1XWC A;  3GX0 A;  1T4Z A;  1XWB A;  3H8Q A;  4XHM A;  1JLW A;  2PUK C;  1HNC A;  1JZW A;  2V6O A;  3KH7 A;  4IN0 A;  4HI7 A;  5CRE A;  5IMZ A;  5C00 A;  3IRA A;  2VLT A;  1SU9 A;  1GTI A;  3IHG A;  1TTZ A;  4FYC A;  1ZYP A;  4BVY B;  2FGX A;  3G7J A;  5IMV A;  2H6Y A;  2HE3 A;  3DIE A;  1WP0 A;  1XW6 A;  4K7I A;  2MMA A;  5CRG A;  3KP9 A;  3DML A;  1X9W B;  1Y6E A;  2KUC A;  2LQQ A;  1FW1 A;  2YAN A;  1RQM A;  4RI7 A;  2PPT A;  4EF0 A;  1UN2 A;  3EUR A;  1SKW B;  1ZMA A;  1MD3 A;  3EIN A;  2TRX A;  2YCD A;  2TIR A;  4IQA A;  2I9H A;  1SYX A;  3GMF A;  3UBL A;  3E0U A;  2O7K A;  3TKS E;  4O5R A;  2I1U A;  5ECR B;  2VM2 A;  2JL4 A;  1SEN A;  5D73 A;  3H93 A;  3QAG A;  4JZQ A;  1XPV A;  1G7O A;  4FYB A;  2H72 A;  3W8S A;  4IKH A;  1PRX A;  1C72 A;  3ZIV A;  4DSS A;  3L9V A;  2C1Y A;  5AIV A;  1K0N A;  3ZLP A;  4J56 E;  4ZB9 A;  2HZE B;  1TKD B;  5DJM A;  3EU4 A;  2A2R A;  2GTU A;  5ECN B;  3VPT A;  2A4V A;  2K18 A;  2YNX A;  3WT2 A;  1B9Y C;  3EYT A;  3TKS C;  3TJG A;  22GS A;  1SL1 B;  3MAK A;  1Z7R A;  1Z6N A;  4GXZ A;  5CAX A;  1Z6M A;  4AGS A;  1BAY A;  2O89 A;  3NIV A;  4ID0 A;  1O73 A;  1TI3 A;  2IFQ B;  2PN8 A;  2FWH A;  2X64 A;  3L4N A;  3GUS A;  4NV2 A;  1HNA A;  2A2S A;  3LYK A;  2IN3 A;  4Q5R A;  2H0H A;  3CXG A;  3GL5 A;  3CTF A;  3HCZ A;  2NPB A;  5ENU A;  3UL3 A;  4F0C A;  4F82 A;  2IMI A;  2DIZ A;  1B8X A;  4JBB A;  1FVK A;  2L4C A;  3HVN A;  3HHV A;  4XS4 A;  3D22 A;  5D9X A;  4L5L A;  2M72 A;  3FZ9 A;  3DYR A;  1GLP A;  2VOC A;  2EC4 A;  1TU8 A;  4KSO A;  3KMO A;  2B5Y A;  1TDI A;  4LMV A;  1FOH A;  2DJ3 A;  3VI5 A;  3KD0 A;  1N2A A;  4RUV A;  5J3R A;  4POK A;  5ELA A;  1HD2 A;  2L59 A;  2PWJ A;  1U87 A;  2L5L A;  2CA8 A;  1T7P B;  1V40 A;  2L6C A;  1XWG A;  3TGZ A;  4NAX A;  2QA1 A;  1PX6 A;  1T3B A;  4MF6 A;  4XTS A;  3GKX A;  4HS1 A;  8GSS A;  3VFI A;  2C0E A;  3QD9 A;  3WT1 A;  4G0L A;  4D73 B;  3IR4 A;  1K0M A;  4GLT A;  2FCH A;  3UMA A;  5A4W A;  2V1M A;  2ALB A;  4G0I A;  5DAL A;  2GSS A;  2OJL A;  4LA1 A;  3ZFB A;  3M0F A;  3LFL A;  1I9D A;  3IV4 A;  1TOF A;  4BA7 A;  2GQK A;  2VD1 A;  5J5N A;  1UC7 A;  4L8E A;  2HI7 A;  4K2D A;  4KE3 A;  3PIN A;  4GQF A;  2XBI A;  4K6X A;  3LXT A;  3GYK A;  3GFK A;  3PH9 A;  5INY A;  2VL2 A;  2X8G A;  3MIX A;  4OO5 A;  3A2X A;  1M9B A;  3WD6 A;  3FK8 A;  1F6M C;  3WGE A;  12GS A;  3APQ A;  4IEL A;  4K0G A;  1K3L A;  2K9F A;  1TK0 B;  1PD2 1;  2P31 A;  1WRY A;  1GSE A;  4NXI A;  1Z5Y E;  1A8L A;  1T4Y A;  1K3Y A;  1O7U A;  1HYU A;  1OC3 A;  2X8C A;  4PNG A;  3F4R A;  5GSS A;  1EOG A;  1JZD A;  3KMN A;  4LL1 B;  3M8N A;  1GUM A;  3RHB A;  4ECI A;  5IMD A;  1QUW A;  5HFI A;  3EWL A;  2VLU A;  1DBY A;  5J4U A;  2GS3 A;  3JCM L;  2DSA A;  5ECM B;  1XBS A;  1KTE A;  2LJR A;  2H66 A;  2GZY A;  1S3A A;  2H1B A;  5B8B A;  4PQ1 A;  5GAP D;  2AAW A;  2L5O A;  1THO A;  2AYT A;  5EL8 A;  3A2W A;  4Z2T A;  2FHE A;  1YEX A;  1X9M B;  3L0H A;  3DRN A;  4BPY A;  1G7E A;  1U3A A;  1VF3 A;  3HA9 A;  1MDJ A;  2YP6 A;  4KDY A;  2H1D A;  2ON5 A;  1TRV A;  2VCQ A;  3DVW A;  3GSS A;  3MDK A;  1TRU A;  2C8U A;  1NHO A;  4TR0 A;  1K0C A;  2REM A;  3LW9 A;  4MJB A;  4I2T A;  1PL2 A;  2R0C A;  3HYP A;  3NOF A;  1UVZ A;  3WGX A;  1DSB A;  4KDX A;  2H6X A;  3VLN A;  5D96 A;  2H6Z A;  4TKY A;  5F0G A;  1SJZ A;  4MCU A;  3TJJ A;  2LJK A;  2LTK A;  3UAR A;  5D9V A;  1GSS A;  1ZL9 A;  2V2G A;  1JFU A;  2B5X A;  1SJI A;  5CYY A;  2LJA A;  4Q5F A;  5DAK B;  1QFN A;  4PUF C;  4TVE A;  5FHI A;  4NWY A;  1VF4 A;  5ID2 B;  3G7Y A;  2WJU A;  5GST A;  1B4Q A;  1ERT A;  1KBN A;  2PER A;  11GS A;  4JE1 A;  1WOU A;  4EIP A;  4PTS A;  5GAN D;  2P5Q A;  4MP4 A;  4TXO B;  3P7X A;  4ZIL A;  4HDE A;  4PUA A;  2NTO A;  2DMM A;  4IHU A;  4L0W A;  5AIS A;  4V1A g;  5J41 A;  1YQ1 A;  1U88 A;  2DJ2 A;  2CVD A;  4G10 A;  4YQU A;  5ELG A;  3ZFL A;  3FEU A;  1M2D A;  4TOP A;  2LKU A;  5IIZ A;  3DWV A;  1YF0 A;  5D9W A;  5EY6 A;  3ZML A;  2RII A;  2YV9 A;  2E2M A;  2C3N A;  4XS6 A;  4N10 A;  4CY8 A;  4K9Z A;  2KLX A;  2YJ7 A;  2K6V A;  3ERF A;  3LOR A;  4WF4 A;  4PUR A;  1KNG A;  2D2Z A;  2HNL A;  2WFC A;  2GQM A;  3HZ8 A;  5ECO B;  5BMU A;  3CRU A;  2NBS A;  1THX A;  1I5G A;  2DBC A;  4WR4 A;  3L9S A;  4JR4 A;  1K3O A;  1V58 A;  3RAZ A;  1TJD A;  3UVH A;  2E7P A;  4Q5Q A;  3ZRD A;  1E6B A;  2HZF A;  3TKR A;  4K5R A;  2X99 A;  4MZW A;  4PQI A;  4GSS A;  4PXO A;  2JZT A;  2IMD A;  2GGT A;  3IK9 A;  2OBK A;  2G2Q A;  4MNN A;  2C0G A;  1OE8 A;  4NV5 A;  5LNK e;  1U6T A;  1AAZ A;  1F3B A;  1Y25 A;  1EEM A;  2QA2 A;  2LV3 A;  1O6J A;  1OC9 B;  1O8X A;  2OAD A;  2KP1 A;  3VWV A;  2C80 A;  3A5W A;  4NHW A;  2HFD A;  1ERW A;  2JZR A;  4ZBA A;  2GST A;  1HNB A;  4E8H A;  1EOH A;  1YY7 A;  1M99 A;  1J9B A;  4IGJ A;  2RM6 A;  3TJB A;  19GS A;  2ES7 A;  3ERW A;  3F63 A;  2WCI A;  2GZZ A;  2B3S A;  1VRS D;  3AY8 A;  3EE2 A;  1X5D A;  4N11 A;  3GTU A;  2I3Y A;  4WR5 A;  4MH3 A;  4K2X A;  2X49 A;  1YF1 A;  3F9U A;  4FO5 A;  4BVY A;  1QMV A;  4DVC A;  2CAI A;  1A8Y A;  2R0G A;  5ABR A;  2JU5 A;  2FWE A;  2VAF A;  2YJH A;  3FR6 A;  1M3J A;  2LST A;  1FHE A;  1CQH A;  3EVI A;  4AJ6 A;  1WMJ A;  4XRA A;  1GH2 A;  5HFK A;  3C7M A;  3APS A;  4L0U A;  1A24 A;  2R3X A;  5B6N A;  2KP2 A;  2WB9 A;  4WKW A;  3LXZ A;  4YAV A;  1S3D A;  2H0G A;  1PSQ A;  3QPM A;  3F4S A;  4WF5 A;  4HJM A;  5JCG A;  4USS A;  2LRC A;  1GSU A;  2QSI A;  1F37 A;  4XIH A;  5IQY A;  3MSZ A;  4ISD A;  3C1S A;  4EVM A;  2GT5 A;  3SBC A;  2E2G A;  4KGI A;  2G0F A; 
#chains in the Genus database with same CATH homology
 1ERV A;  2OAC A;  1TRW A;  2WDU A;  2FUG 2;  2HSY A;  5F8B A;  3HVS A;  5A4V A;  3Q18 A;  6GSY A;  2AV4 A;  4EL1 A;  3F3Q A;  1SKR B;  4AJ7 A;  3HXS A;  3RPN A;  3TRQ A;  6GSS A;  4DSR A;  4K1F A;  2LUS A;  3P90 A;  4V2L A;  1LBK A;  5FT3 A;  2GQL A;  3IDV A;  3CTG A;  1XFL A;  3QAV A;  2HZE A;  3MYD A;  1CQG A;  2L6D A;  2VCZ A;  3Q74 A;  5JCW A;  1TRS A;  4H86 A;  3F4T A;  3UAP A;  1O81 A;  3IK7 A;  2A2P A;  2B7J A;  4LMW A;  3F6F A;  1BJX A;  2B6M A;  3O3T A;  3MNG A;  4EUY A;  1ERU A;  2X8H A;  3CSJ A;  2IPA A;  3FMW A;  4OWY A;  2QKE A;  4MPG A;  3U5R E;  3E3E A;  3VUR A;  1FVJ A;  5H5R A;  3KH9 A;  2RUE A;  5G1L A;  5JWQ B;  5DJL A;  3R2Q A;  1GTU A;  2YN1 A;  5CRH A;  1AQW A;  1SL2 B;  4ICY A;  1R5A A;  3FZ4 A;  4NHZ A;  5DQY A;  1BX9 A;  3HDC A;  2DIY A;  3M1G A;  3GRX A;  5F05 A;  2JAD A;  3ERG A;  5J9C A;  4K0N A;  4F0B A;  3TCO A;  1B48 A;  3SWL A;  4IJ3 A;  4BWS A;  3GNJ A;  2JAC A;  5IM9 A;  4YKG A;  1GUL A;  1B9X C;  2PVO C;  1GNE A;  16GS A;  1H4O A;  4XS1 A;  1H75 A;  4IW9 A;  2HSH A;  3GA4 A;  3GN3 A;  3K8N A;  1A23 A;  1WE0 A;  4MZC A;  5BRT A;  1QK8 A;  2MMO A;  4HQZ A;  3KM6 A;  4DSS B;  5D9T A;  3ZZX A;  4KX4 A;  1ZGN A;  3GKM A;  1F9M A;  1GNW A;  1GP1 A;  2R5G A;  3TUE A;  1XOB A;  2QC7 A;  4KCA A;  2YZH A;  2C3Q A;  2XPE A;  1AQV A;  3GV1 A;  4X43 A;  2EIR A;  2VL2 C;  4GF0 A;  3KEB A;  4K7O A;  5DBQ A;  1A0F A;  4K8M A;  2B1K A;  4NMU A;  2CVK A;  4ILF A;  1T00 A;  3M9K A;  4YAP A;  6GSW A;  1YEP A;  5ECQ B;  4OFM A;  3VPQ A;  4KUN A;  5J9B A;  4O92 A;  2CV4 A;  3GX8 A;  2VCW A;  3VI7 A;  1GUH A;  2OBI A;  2PGT A;  2WRT A;  3EMX A;  3EC3 A;  2PBJ A;  4MZB A;  4GTU A;  4OFT A;  2LQO A;  3UBK A;  4EDZ A;  4YQV A;  4MMM A;  4KCE A;  2IJY A;  4XS4 B;  3RHC A;  3IC4 A;  1A0R P;  4EDY A;  4MH2 A;  2P0G A;  5DCG A;  3CBU A;  1SL0 B;  2CX3 A;  2XHF A;  1F2E A;  3QFB C;  1GWC A;  4TR3 A;  3KP8 A;  3L9U A;  1SKS B;  4ZL7 A;  10GS A;  2MZC A;  1EWX A;  4MF7 A;  1TK5 B;  5ECI B;  1Z9H A;  2LNS A;  3D4T A;  1EV4 A;  5HQP A;  1XOA A;  5A4U A;  4HOJ A;  1OYJ A;  2DC5 A;  4TN8 A;  4KF9 A;  1WJK A;  4FIW A;  2CZ2 A;  4BVX B;  4JED A;  9GSS A;  2VIM A;  5DAL B;  1AQX A;  1AUC A;  3R3E A;  4MAB A;  3KTL A;  3QR6 A;  1Q4J A;  2HYX A;  2TRC P;  3IC8 A;  3QFA C;  5IPG A;  2H1G A;  2H76 A;  18GS A;  1X0R A;  1XCC A;  1JHB A;  4MF5 A;  1T8E B;  4IBP A;  5G30 A;  3KXO A;  3ZTL A;  1XWA A;  3HJM A;  3J7Y b;  1V9W A;  4OCE A;  4KB3 A;  4MK3 A;  2EIO A;  5HR1 A;  4PQH A;  3ME7 A;  1TXX A;  3UOM A;  4OD7 A;  4TRX A;  2M46 A;  1RK4 A;  3LWA A;  3PPU A;  4YQM A;  5CRD A;  4WBJ A;  1PA3 A;  2LS5 A;  5IMF A;  5B6M A;  2HT9 A;  4BL7 A;  2DKH A;  4DSQ A;  3VWX A;  3D4M A;  2DJ1 A;  1QGV A;  3D21 A;  1GLQ A;  1T1V A;  4TXO A;  1YKC A;  3P2A A;  4IP6 A;  4FQU A;  4HJ2 A;  1VF1 A;  5KN1 A;  1ABA A;  5IPH A;  5AGY A;  4Z2R A;  1GTB A;  4IS0 A;  3FRC A;  4RQX A;  4ZBD A;  3J7Y k;  2LEG A;  1XXU A;  3TOT A;  1X9S B;  1MDI A;  4V1A p;  1QQ2 A;  3S9F A;  5ECH B;  3BBY A;  3KTB A;  1GRX A;  3CSI A;  1R4W A;  4QL7 A;  1R5P A;  4IP1 A;  3O76 A;  3RDW A;  2VUP A;  4ZB6 A;  1SK1 A;  2DML A;  3CMI A;  4HU9 A;  5JCU A;  2IME A;  4CDO A;  1Q98 A;  2R37 A;  4NPB A;  4KDU A;  3ZRE A;  1OVN A;  4E8E A;  5G5F A;  4K5S A;  5KOW A;  5AIX A;  4AF2 A;  5LCZ A;  3VWW A;  5L71 A;  2FA8 A;  2IL3 A;  6GSV A;  2VO4 A;  1RW1 A;  4ZBB A;  4TR1 A;  1NSW A;  5CNW A;  3PGT A;  1WPI A;  3KCM A;  4ZXG A;  3W6G A;  2X4A A;  5ECP B;  1SYR A;  2J9H A;  3QOU A;  3QCP A;  4RQR A;  1JLV A;  2FD3 A;  3TKQ A;  1SK0 A;  2FNO A;  5DCH A;  4GWR A;  2MYG A;  1MTC A;  2HRF A;  4CY6 A;  1ZOF A;  1ST9 A;  20GS A;  2XBQ A;  4J57 E;  1WIK A;  3F6D A;  3HZ4 A;  3LQ7 A;  4X0X A;  3KIJ A;  2F3M A;  5IMA A;  2I4A A;  5ECS A;  1X5E A;  4KA0 A;  1YDK A;  3KJY A;  2QGV A;  3BJ5 A;  5IO2 A;  3CRT A;  2V6K A;  5EVO A;  3I69 A;  2YPM A;  5IOX A;  1WWJ A;  5B7C A;  2FLS A;  3C8E A;  2OE0 A;  1AIU A;  5F06 A;  2DLX A;  4GSN A;  3GIX A;  5ECK B;  3IBH A;  5HFG A;  1A2L A;  2HXK A;  2R6K A;  5G2Z A;  2HRK A;  4POB A;  2L4Q A;  1PGT A;  4ZB8 A;  1M9A A;  4HEA 2;  1GL8 A;  3GH9 A;  4OCF A;  1NHY A;  2VL9 A;  1XWK A;  2FWG A;  4EO3 A;  3DEX A;  3FZ5 A;  4KW6 A;  2WS2 A;  1J08 A;  2ZUP A;  1OC8 A;  4Z2U A;  3U6V A;  3APO A;  5F07 A;  3CSH A;  3FKF A;  2BJX A;  5KN2 A;  4I2U A;  3N5O A;  3GL3 A;  4N30 A;  3DVX A;  2Z9S A;  1BQ7 A;  1EGO A;  4POL A;  2JSZ A;  5G1K A;  1EP8 A;  3ZIT A;  3ZMK A;  2YZU A;  5KN0 A;  3CYN A;  2XC2 A;  2NVL A;  5IOW A;  4POM A;  1YJ6 A;  2A4H A;  2CT6 A;  5FWG A;  5CRW A;  3I6A A;  3O6T A;  4PNF A;  5C04 A;  1PQN A;  4EC0 A;  1FB0 A;  4A5P A;  1ZYE A;  3TOU A;  1XZO A;  1MDK A;  4WEY A;  3IOS A;  5HR3 A;  5IMC A;  3IAS 2;  1K0D A;  2OKA A;  1PKZ A;  1FG4 A;  2OE1 A;  4QQ7 A;  1ML6 A;  2CQ9 A;  3GTU B;  2CX4 A;  2VCV A;  2K8V A;  2RLI A;  3UJ1 A;  4FH8 A;  5E59 A;  4G9H A;  2L57 A;  2JSY A;  2H8L A;  2BTO T;  1PKW A;  1BED A;  4ML1 A;  1JZR A;  3UEM A;  1OAZ A;  3FR3 A;  1TK8 B;  2V32 A;  3TJK A;  5AN1 A;  1GUK A;  3NZN A;  1HQO A;  4RI6 A;  1M2A A;  3F3R A;  2MBS A;  5H5S A;  1XW9 A;  3C73 A;  1W4V A;  2HRA A;  3BCI A;  4HQS A;  4HUA A;  4G2E A;  3WGD A;  3HJP A;  1SK2 A;  3FY7 A;  2GLR A;  2KOK A;  1BYE A;  2GSQ A;  2IFQ A;  3L78 A;  1AXD A;  1G6Y A;  1YKA A;  2H30 A;  2DJ0 A;  4I97 A;  2XPD A;  4Q5N A;  1E2Y A;  1M2B A;  3HVV A;  4WBR D;  1PN9 A;  3P8W A;  4MJC A;  3N9J A;  2WGR A;  3FR9 A;  4G0K A;  3VWU A;  4CW9 A;  4I8B A;  3W8J A;  3ME8 A;  4EIQ A;  1USB A;  1EGR A;  1R7H A;  5D93 A;  3FZA A;  5HR0 A;  4JR6 A;  1ILO A;  2R4V A;  2GSR A;  4ZL8 A;  1GSY A;  1OKT A;  5D8I A;  1GSF A;  5B8A A;  4F9Z A;  13GS A;  2NDO A;  2PVQ A;  17GS A;  4ECC A;  3C71 A;  4X4J A;  1G6W A;  1M0U A;  1TU7 A;  2FWF A;  2P5R A;  3GKN A;  3US3 A;  4D73 A;  2GVP A;  2ON7 A;  2H71 A;  3ISO A;  3FYG A;  3I43 A;  1VF2 A;  2I81 A;  4J2F A;  1V57 A;  3F8U A;  1A2J A;  2C0F A;  1URM A;  2DJJ A;  4KAE A;  5LD0 A;  1K0B A;  2C0D A;  3M3M A;  3HY2 A;  3ZIJ A;  4HU7 A;  1NM3 A;  4I6X A;  4LLR A;  4V2N A;  1J0F A;  4JU5 A;  3BD2 A;  1U3I A;  1EEJ A;  3TKP A;  2GT6 A;  4WXT A;  1LU4 A;  3EMP A;  3D5J A;  3EPT A;  2F51 A;  4KND A;  2VLV A;  6GSX A;  4ZIJ A;  3TKS A;  5A5K A;  1GSQ A;  1W89 A;  5GZZ B;  2F9S A;  5KEJ A;  3KGK A;  4KSM A;  2E0Q A;  4N0Z A;  2CVB A;  3A2V A;  3KZQ A;  1FO5 A;  4OMV A;  1XVQ A;  4HZ2 A;  3FHK A;  4MDC A;  4BVX A;  4MA9 A;  4P3Y B;  2MBT A;  1KEB A;  3OR5 A;  2AHE A;  2O8V B;  4GRF A;  2LNT A;  4TXV A;  1XIY A;  2VM1 A;  3LGC A;  4F03 A;  1FB6 A;  3PR8 A;  5KOX A;  5H5Q A;  2C3T A;  3IPZ A;  4IQ1 A;  5ECL B;  4ULX A;  1DE1 A;  1TW9 A;  5DQS A;  1QXH A;  2O85 A;  2DJK A;  2ZCT A;  3BCK A;  1FOV A;  1IYI A;  3DXB A;  1A2M A;  3H79 A;  4G19 A;  2YV7 A;  4YKF A;  2H1A A;  3G7I A;  3FW2 A;  3UVT A;  2RM5 A;  3DKS A;  1JZO A;  4WET A;  3TDG A;  3WYW A;  3F0I A;  2EIQ A;  2N5F A;  4V2M A;  2N5A A;  4MPF A;  3QMX A;  1SD8 A;  4GCI A;  4BWQ A;  2R2J A;  3G9B A;  3HVX A;  2H19 A;  5IO0 A;  4IVF A;  5CP1 A;  4ECB A;  3LEF A;  3A3T A;  3ZL5 A;  2LRN A;  1ZYN A;  5DAK A;  2HSM A;  1GTA A;  3IAM 2;  2YWM A;  3TRX A;  4QL9 A;  5ID2 A;  2YWN A;  3MWH A;  3Q6O A;  1OKD A;  2C4J A;  2CAQ A;  2PMT A;  2KHP A;  2N5B A;  2YOI A;  1PL1 A;  2B7K A;  2JZS A;  1NW2 A;  2F8F A;  2B5E A;  1ZCP A;  1V2A A;  3I9V 2;  4I5Q A;  1DUG A;  4GQC A;  4IJI A;  3IE3 A;  1M7T A;  4PGT A;  2IMK A;  4N0V A;  2AB6 A;  2UZ8 A;  3H1N A;  4AJ8 A;  1MD4 A;  4O5U A;  1XVW A;  2J23 A;  3GUR A;  2OE3 A;  2FY6 A;  1Z3E A;  2H74 A;  2RUF A;  3IXR A;  1PMT A;  4XCS A;  3LG6 A;  1IYH A;  2YWI A;  1ZZY A;  4YH2 A;  3TJF A;  4FYU A;  3LJR A;  3A5I A;  2MMN A;  4PX1 A;  4K7N A;  2F8A A;  1O8W A;  5JWO B;  5G31 A;  2WZ9 A;  2VD0 A;  1AC1 A;  2GDR A;  4BL7 B;  1SJ6 A;  1N8J A;  1VGL A;  1V98 A;  1YZX A;  5HR2 A;  2PU9 C;  3ZVJ A;  3Q19 A;  14GS A;  4GST A;  2H75 A;  2M80 A;  4KH7 A;  2H01 A;  1K0O A;  2FA4 A;  3GHA A;  5JWR B;  4O7H A;  4F2I A;  3DD3 A;  1TP9 A;  4EKZ A;  2IIY A;  1BG5 A;  3TRP A;  2H70 A;  5E4W A;  2DKI A;  5G5E A;  2K8S A;  4EXJ A;  1UA5 A;  3VK9 A;  4ML6 A;  2IMF A;  2VCX A;  3D6I A;  1PN0 A;  2IWT A;  3IA1 A;  5DVB A;  4MJA A;  3GST A;  4JRR A;  3ED3 A;  3GH6 A;  1OC9 A;  1Z7P A;  3GKK A;  3HD5 A;  5EPF A;  1GSD A;  3C1R A;  1TI1 A;  4HZ4 A;  1XW5 A;  3UIW A;  1EV9 A;  7GSS A;  3QDN A;  2R0P A;  1S3C A;  4O5Q A;  5KN3 A;  5CO3 A;  3HKR A;  4TR4 A;  4EE0 A;  2OA7 A;  4ZL9 A;  1OE7 A;  2CZ3 A;  4DEJ A;  1EP7 A;  2LRT A;  1O85 A;  4ACS A;  4X1U A;  2H73 A;  2AUV A;  2VL3 A;  5COH A;  3M9J A;  4LL4 B;  3BOA A;  4TR1 B;  3E9J B;  5DDL A;  2AJQ B;  3QAW A;  1MEK A;  3ZVJ D;  1G0T A;  4XRD A;  3LSZ A;  3V1W A;  3EU3 A;  3HJO A;  2MMZ A;  2HLS A;  2H0I A;  2BMX A;  3ZYW A;  2VCT A;  4MLY A;  3H4K A;  1LJR A;  4L5O A;  1ON4 A;  1PX7 A;  2GZP A;  1F3A A;  1R26 A;  3D0Z A;  4OO4 A;  2HRN A;  1X5C A;  2ZNM A;  4O32 A;  3DGQ A;  1SD9 A;  4MJE A;  3IHQ A;  4ECJ A;  3RPP A;  3LYP A;  2V41 A;  1EZK A;  4CHS A;  4TW5 A;  3RBT A;  2O87 A;  3TB2 A;  1FAA A;  4Z7X A;  1DE2 A;  4OFN A;  2B1L A;  1ZYQ B;  2WUL A;  1B4P A;  1K0A A;  2YWO A;  6GST A;  1ACV A;  1AW9 A;  6GSU A;  1XWC A;  3GX0 A;  1T4Z A;  1XWB A;  3H8Q A;  4XHM A;  1JLW A;  2PUK C;  1HNC A;  1JZW A;  2V6O A;  3KH7 A;  4IN0 A;  4HI7 A;  5CRE A;  5IMZ A;  5C00 A;  3IRA A;  2VLT A;  1SU9 A;  1GTI A;  3IHG A;  1TTZ A;  4FYC A;  1ZYP A;  4BVY B;  2FGX A;  3G7J A;  5IMV A;  2H6Y A;  2HE3 A;  3DIE A;  1WP0 A;  1XW6 A;  4K7I A;  2MMA A;  5CRG A;  3KP9 A;  3DML A;  1X9W B;  1Y6E A;  2KUC A;  2LQQ A;  1FW1 A;  2YAN A;  1RQM A;  4RI7 A;  2PPT A;  4EF0 A;  1UN2 A;  3EUR A;  1SKW B;  1ZMA A;  1MD3 A;  3EIN A;  2TRX A;  2YCD A;  2TIR A;  4IQA A;  2I9H A;  1SYX A;  3GMF A;  3UBL A;  3E0U A;  2O7K A;  3TKS E;  4O5R A;  2I1U A;  5ECR B;  2VM2 A;  2JL4 A;  1SEN A;  5D73 A;  3H93 A;  3QAG A;  4JZQ A;  1XPV A;  1G7O A;  4FYB A;  2H72 A;  3W8S A;  4IKH A;  1PRX A;  1C72 A;  3ZIV A;  4DSS A;  3L9V A;  2C1Y A;  5AIV A;  1K0N A;  3ZLP A;  4J56 E;  4ZB9 A;  2HZE B;  1TKD B;  5DJM A;  3EU4 A;  2A2R A;  2GTU A;  5ECN B;  3VPT A;  2A4V A;  2K18 A;  2YNX A;  3WT2 A;  1B9Y C;  3EYT A;  3TKS C;  3TJG A;  22GS A;  1SL1 B;  3MAK A;  1Z7R A;  1Z6N A;  4GXZ A;  5CAX A;  1Z6M A;  4AGS A;  1BAY A;  2O89 A;  3NIV A;  4ID0 A;  1O73 A;  1TI3 A;  2IFQ B;  2PN8 A;  2FWH A;  2X64 A;  3L4N A;  3GUS A;  4NV2 A;  1HNA A;  2A2S A;  3LYK A;  2IN3 A;  4Q5R A;  2H0H A;  3CXG A;  3GL5 A;  3CTF A;  3HCZ A;  2NPB A;  5ENU A;  3UL3 A;  4F0C A;  4F82 A;  2IMI A;  2DIZ A;  1B8X A;  4JBB A;  1FVK A;  2L4C A;  3HHV A;  4XS4 A;  3D22 A;  5D9X A;  4L5L A;  2M72 A;  3FZ9 A;  3DYR A;  1GLP A;  2VOC A;  2EC4 A;  1TU8 A;  4KSO A;  3KMO A;  2B5Y A;  1TDI A;  4LMV A;  1FOH A;  2DJ3 A;  3VI5 A;  3KD0 A;  1N2A A;  4RUV A;  5J3R A;  4POK A;  5ELA A;  1HD2 A;  2L59 A;  2PWJ A;  1U87 A;  2L5L A;  2CA8 A;  1T7P B;  1V40 A;  2L6C A;  1XWG A;  3TGZ A;  4NAX A;  2QA1 A;  1PX6 A;  1T3B A;  4MF6 A;  4XTS A;  3GKX A;  4HS1 A;  8GSS A;  3VFI A;  2C0E A;  3QD9 A;  3WT1 A;  4G0L A;  4D73 B;  3IR4 A;  1K0M A;  4GLT A;  2FCH A;  3UMA A;  5A4W A;  2V1M A;  2ALB A;  4G0I A;  5DAL A;  2GSS A;  2OJL A;  4LA1 A;  3ZFB A;  3M0F A;  3LFL A;  1I9D A;  3IV4 A;  1TOF A;  4BA7 A;  2GQK A;  2VD1 A;  5J5N A;  1UC7 A;  4L8E A;  2HI7 A;  4K2D A;  4KE3 A;  3PIN A;  4GQF A;  2XBI A;  4K6X A;  3LXT A;  3GYK A;  3GFK A;  3PH9 A;  5INY A;  2VL2 A;  2X8G A;  3MIX A;  4OO5 A;  3A2X A;  1M9B A;  3WD6 A;  3FK8 A;  1F6M C;  3WGE A;  12GS A;  3APQ A;  4IEL A;  4K0G A;  1K3L A;  2K9F A;  1TK0 B;  1PD2 1;  2P31 A;  1WRY A;  1GSE A;  4NXI A;  1Z5Y E;  1A8L A;  1T4Y A;  1K3Y A;  1O7U A;  1HYU A;  1OC3 A;  2X8C A;  4PNG A;  3F4R A;  5GSS A;  1EOG A;  1JZD A;  3KMN A;  4LL1 B;  3M8N A;  1GUM A;  3RHB A;  4ECI A;  5IMD A;  1QUW A;  5HFI A;  3EWL A;  2VLU A;  1DBY A;  5J4U A;  2GS3 A;  3JCM L;  2DSA A;  5ECM B;  1XBS A;  1KTE A;  2LJR A;  2H66 A;  2GZY A;  1S3A A;  2H1B A;  5B8B A;  4PQ1 A;  5GAP D;  2AAW A;  2L5O A;  1THO A;  2AYT A;  5EL8 A;  3A2W A;  4Z2T A;  2FHE A;  1YEX A;  1X9M B;  3L0H A;  3DRN A;  4BPY A;  1G7E A;  1U3A A;  1VF3 A;  3HA9 A;  1MDJ A;  2YP6 A;  4KDY A;  2H1D A;  2ON5 A;  1TRV A;  2VCQ A;  3DVW A;  3GSS A;  3MDK A;  1TRU A;  2C8U A;  1NHO A;  4TR0 A;  1K0C A;  2REM A;  3LW9 A;  4MJB A;  4I2T A;  1PL2 A;  2R0C A;  3HYP A;  3NOF A;  1UVZ A;  3WGX A;  1DSB A;  4KDX A;  2H6X A;  3VLN A;  5D96 A;  2H6Z A;  4TKY A;  5F0G A;  1SJZ A;  4MCU A;  3TJJ A;  2LJK A;  2LTK A;  3UAR A;  5D9V A;  1GSS A;  1ZL9 A;  2V2G A;  1JFU A;  2B5X A;  1SJI A;  5CYY A;  2LJA A;  4Q5F A;  5DAK B;  1QFN A;  4PUF C;  4TVE A;  5FHI A;  4NWY A;  1VF4 A;  5ID2 B;  3G7Y A;  2WJU A;  5GST A;  1B4Q A;  1ERT A;  1KBN A;  2PER A;  11GS A;  4JE1 A;  1WOU A;  4EIP A;  4PTS A;  5GAN D;  2P5Q A;  4MP4 A;  4TXO B;  3P7X A;  4ZIL A;  4HDE A;  4PUA A;  2NTO A;  2DMM A;  4IHU A;  4L0W A;  5AIS A;  4V1A g;  5J41 A;  1YQ1 A;  1U88 A;  2DJ2 A;  2CVD A;  4G10 A;  4YQU A;  5ELG A;  3ZFL A;  3FEU A;  1M2D A;  4TOP A;  2LKU A;  5IIZ A;  3DWV A;  1YF0 A;  5D9W A;  5EY6 A;  3ZML A;  2RII A;  2YV9 A;  2E2M A;  2C3N A;  4XS6 A;  4N10 A;  4CY8 A;  4K9Z A;  2KLX A;  2YJ7 A;  2K6V A;  3ERF A;  3LOR A;  4WF4 A;  4PUR A;  1KNG A;  2D2Z A;  2HNL A;  2WFC A;  2GQM A;  3HZ8 A;  5ECO B;  5BMU A;  3CRU A;  2NBS A;  1THX A;  1I5G A;  2DBC A;  4WR4 A;  3L9S A;  4JR4 A;  1K3O A;  1V58 A;  3RAZ A;  1TJD A;  3UVH A;  2E7P A;  4Q5Q A;  3ZRD A;  1E6B A;  2HZF A;  3TKR A;  4K5R A;  2X99 A;  4MZW A;  4PQI A;  4GSS A;  4PXO A;  2JZT A;  2IMD A;  2GGT A;  3IK9 A;  2OBK A;  2G2Q A;  4MNN A;  2C0G A;  1OE8 A;  4NV5 A;  5LNK e;  1U6T A;  1AAZ A;  1F3B A;  1Y25 A;  1EEM A;  2QA2 A;  2LV3 A;  1O6J A;  1OC9 B;  1O8X A;  2OAD A;  2KP1 A;  3VWV A;  2C80 A;  3A5W A;  4NHW A;  2HFD A;  1ERW A;  2JZR A;  4ZBA A;  2GST A;  1HNB A;  4E8H A;  1EOH A;  1YY7 A;  1M99 A;  1J9B A;  4IGJ A;  2RM6 A;  3TJB A;  19GS A;  2ES7 A;  3ERW A;  3F63 A;  2WCI A;  2GZZ A;  2B3S A;  1VRS D;  3AY8 A;  3EE2 A;  1X5D A;  4N11 A;  3GTU A;  2I3Y A;  4WR5 A;  4MH3 A;  4K2X A;  2X49 A;  1YF1 A;  3F9U A;  4FO5 A;  4BVY A;  1QMV A;  4DVC A;  2CAI A;  1A8Y A;  2R0G A;  5ABR A;  2JU5 A;  2FWE A;  2VAF A;  2YJH A;  3FR6 A;  2LST A;  1FHE A;  1CQH A;  3EVI A;  4AJ6 A;  1WMJ A;  4XRA A;  1GH2 A;  5HFK A;  3C7M A;  3APS A;  4L0U A;  1A24 A;  2R3X A;  5B6N A;  2KP2 A;  2WB9 A;  4WKW A;  3LXZ A;  4YAV A;  1S3D A;  2H0G A;  1PSQ A;  3QPM A;  3F4S A;  4WF5 A;  4HJM A;  5JCG A;  4USS A;  2LRC A;  1GSU A;  2QSI A;  1F37 A;  4XIH A;  5IQY A;  3MSZ A;  4ISD A;  3C1S A;  4EVM A;  2GT5 A;  3SBC A;  2E2G A;  4KGI A;  2G0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...