2YJ7A

Crystal structure of a hyperstable protein from the precambrian period
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
105
structure length
105
Chain Sequence
b'SVIEVTDENFEQEVLKSDKPVLVDFWAPWCGPCRMIAPIIEELAKEYEGKVKVVKVNVDENPNTAAQYGIRSIPTLLLFKNGQVVDRLVGAQPKEALKERIDKHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conservation of Protein Structure Over Four Billion Years
pubmed doi rcsb
molecule keywords LPBCA THIOREDOXIN
source organism Synthetic construct
molecule tags Oxidoreductase
total genus 30
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2yj7A00
4MLYA 3EWLA 5GAND 3US3A 4F82A 1WOUA 1F9MA 2E2GA 1MTCA 3QR6A 4MK3A 5D9WA 4ZBBA 1PSQA 3TRQA 1H75A 4NV5A 1ERWA 1ZYEA 4MZWA 3K8NA 4NWYA 1Q4JA 2RM5A 2L6CA 2EC4A 1KTEA 2H1DA 4GQCA 3VWVA 5KN3A 4V2MA 3FHKA 3H4KA 2C0EA 4ZBAA 2K8SA 1BAYA 2DIZA 3GYKA 2PERA 3UBKA 4ZL7A 2LUSA 1F6MC 1TRVA 3BBYA 1WJKA 2FWFA 3LJRA 4N10A 1ZCPA 2C80A 1G6WA 2VLVA 3I69A 4V2NA 4TW5A 5KN1A 3TKRA 3BCKA 5ECKB 3UVTA 3DVXA 3CTFA 1SKSB 2HI7A 2VL3A 1SK0A 3EMXA 2P0GA 3QPMA 2JSYA 4MJEA 4EXJA 4TVEA 1GH2A 2X64A 1YZXA 4KSOA 2CVDA 2AHEA 2IN3A 4FO5A 1OC8A 3J7Yb 2VCWA 1EV9A 4GTUA 4G9HA 2HFDA 1NW2A 1R7HA 2I81A 3GV1A 2MMNA 4XRAA 4YQUA 2F51A 1EGRA 5GSSA 3LG6A 2H0IA 1HD2A 2B1LA 1ZZYA 3LQ7A 4BWSA 5H5QA 2L4CA 4EF0A 2GSRA 3ZRDA 3ZFBA 2LNSA 2CQ9A 5CO3A 3ZIJA 3F4RA 4K7IA 4H86A 4BPYA 1WIKA 4EKZA 1SKRB 2CV4A 1XWAA 2CVBA 2B3SA 4XTSA 3VURA 4N30A 1N2AA 2WULA 5JWRB 1FB6A 1TW9A 3FY7A 3SWLA 1A8LA 4GSTA 2VL9A 4YH2A 4ULXA 2HRNA 3PGTA 5GSTA 5A4UA 3FR6A 4KW6A 3DRNA 1ZYQB 1GRXA 3PH9A 5CAXA 1ZL9A 2IJYA 3CTGA 4GLTA 2H6YA 4K1FA 4DVCA 1PQNA 1RQMA 5DAKB 4HQZA 4TR1A 1XW6A 2WB9A 5JWOB 5F0GA 2IMDA 4IW9A 3L4NA 2HZEB 4NXIA 2K18A 1U6TA 4BVYA 3D0ZA 5CREA 3GURA 4MABA 5HFIA 4LL4B 2VL2A 5IO2A 5G1KA 4BA7A 5G30A 3TB2A 2VLUA 1DE2A 3IBHA 1TP9A 3QAWA 2CAQA 5JCGA 4N0VA 4KNDA 2GZZA 2PBJA 2I3YA 4TXOA 5IMVA 5ECPB 2YV7A 4ZL9A 2VLTA 2FWHA 1SJIA 1Z5YE 3CRTA 2PVQA 2HLSA 2O8VB 1ML6A 2WGRA 4ECBA 3KEBA 1RW1A 1A0FA 2GQMA 1X5CA 5D93A 1K0DA 4MJCA 2VL2C 1TTZA 1DUGA 3HZ8A 5AN1A 2YJHA 1KBNA 1F2EA 2LRCA 2H73A 4WBJA 3F6FA 1FVKA 1CQHA 2PN8A 4WEYA 1MD4A 2B7JA 2DJKA 4WF4A 3GH9A 2YOIA 3FR3A 1PX6A 1QK8A 5CP1A 5HR2A 3ZLPA 1JZWA 3GX8A 1PMTA 3G7YA 1U87A 2GS3A 2YN1A 5D8IA 3HA9A 1R5AA 1V57A 2PMTA 3F63A 4K7OA 4IHUA 4ZB8A 1GSEA 1K0OA 2WS2A 2DC5A 1TI1A 1B8XA 1SL0B 1CQGA 2C8UA 1VGLA 2VD0A 2GQKA 4MJBA 5HFKA 2TRCP 1PL1A 4NHWA 4X43A 3UIWA 2KUCA 4IQ1A 1QUWA 2F8FA 1DE1A 4TR3A 3UAPA 1TU7A 3W6GA 3LEFA 5B6NA 3ZREA 1EOGA 3PINA 1B9XC 2YWIA 1M2BA 2H74A 3GKKA 3TUEA 1U3IA 3VPTA 4OD7A 3LXTA 4IKHA 1JZOA 1K3OA 2H72A 1XW5A 3VI7A 3F0IA 4YAVA 2LSTA 4PUAA 1I9DA 4AF2A 2B5XA 3QAVA 4PGTA 4XS6A 1BYEA 5IQYA 2BTOT 3QFBC 4BWQA 2P5QA 1K3YA 4PQHA 3D22A 3ZITA 4MDCA 3BD2A 4EL1A 2EIOA 4O92A 3QCPA 1PRXA 3F8UA 3O76A 5ECMB 3GMFA 4TRXA 2IFQA 4DSRA 3G7IA 3VWUA 6GSYA 4RI7A 6GSWA 2R3XA 3FR9A 1GSDA 2EIQA 2H01A 5G2ZA 3CSIA 6GSVA 2YWMA 5J9BA 5ABRA 2VCTA 2X8GA 1A2MA 2KHPA 2V41A 2NBSA 1ERVA 4WKWA 5AGYA 1SYXA 5E59A 2GSSA 1OC3A 5KN0A 3HYPA 1GTIA 4NV2A 2Z9SA 4ZILA 5LCZA 3DMLA 4AGSA 2H1GA 1X0RA 2R37A 5H5RA 5HFGA 1ABAA 4KDYA 2KP1A 4OFMA 3IRAA 2CT6A 1E2YA 1YKAA 1WPIA 3VFIA 3QAGA 2OKAA 3ME8A 1GSYA 1TK0B 3EU4A 3GKNA 2FGXA 4KCEA 1ZGNA 4MA9A 4DEJA 1QXHA 4JR6A 4MCUA 1V58A 1N8JA 1EGOA 3IPZA 2DJ0A 4PNFA 4V1Ap 3UVHA 1GNEA 1FB0A 3I43A 4Z7XA 4P3YB 2WRTA 3UEMA 1AC1A 3TKSA 2CZ3A 5H5SA 3GRXA 3KZQA 5JCWA 5DJLA 2XBQA 2DMLA 1T4YA 5JCUA 1K3LA 2WZ9A 5EVOA 3Q19A 1WE0A 4OMVA 5CRWA 3TJFA 1UVZA 3C1SA 4XS1A 2A2RA 3CXGA 16GSA 1MDIA 4JRRA 4NMUA 4EC0A 2R4VA 1OC9A 2LNTA 5HR0A 5IIZA 4J2FA 2IMFA 1JZRA 1SK1A 3ZIVA 4POLA 3MAKA 3TJKA 2A2SA 3F3RA 1HNAA 5ECLB 2H0HA 4IVFA 1BX9A 3EU3A 1TRSA 2HSHA 5LNKe 4O5RA 1GSUA 3IDVA 4L5OA 3TGZA 1Z7RA 2VD1A 3IAS2 1Z9HA 1R5PA 2L57A 2M72A 3FZ4A 2DMMA 1A0RP 1ACVA 1VF4A 2ON5A 2DJ1A 3GKXA 4PUFC 5IMAA 3HXSA 1EZKA 10GSA 3D21A 5A5KA 5EPFA 5G31A 2AUVA 1Y6EA 2N5FA 4K6XA 2QGVA 2F8AA 4MF5A 1O6JA 4N11A 3EINA 3Q74A 2H1BA 4MZBA 2MMZA 5CYYA 1S3DA 3LYPA 1O85A 3H93A 5HR3A 1OVNA 2I9HA 4POBA 3GL5A 5CRGA 5ELGA 2KLXA 1M9AA 3ZZXA 1WWJA 2DSAA 1XOAA 3C1RA 3ME7A 5D9TA 4KB3A 1RK4A 3GTUA 5G5FA 4Q5NA 1NHYA 3W8JA 1BEDA 2YJ7A 4E8HA 3G7JA 1B4PA 3APSA 1VRSD 5ECSA 4XIHA 3C71A 1KNGA 3V1WA 3Q18A 4IS0A 5IOWA 1C72A 1QQ2A 3F6DA 2P5RA 2GT6A 4ECJA 11GSA 2H1AA 2L4QA 3GKMA 3ZTLA 1XWGA 2JSZA 1Z3EA 3QDNA 2L6DA 2WDUA 8GSSA 3FKFA 3M9JA 5IPGA 4POMA 2LJAA 5J41A 6GSSA 3TJGA 1G6YA 1YY7A 4DSQA 2PGTA 2XPDA 2J23A 6GSTA 5IM9A 5FHIA 1PL2A 2JZSA 4X0XA 1LBKA 1KEBA 3Q6OA 4GSNA 1SU9A 2XBIA 3QOUA 3KIJA 2H19A 4KUNA 5A4WA 2B7KA 3TKPA 3FW2A 3ZL5A 5EY6A 3IK9A 2FY6A 3L9UA 4ML6A 3FRCA 3H1NA 5EL8A 4ISDA 3EC3A 3EURA 6GSXA 4HZ4A 4TOPA 4GXZA 1M0UA 4ZBDA 1IYIA 2H0GA 1PA3A 4ZB6A 2LRTA 4WETA 3HZ4A 4PX1A 4TR1B 2A4VA 3GUSA 3GNJA 3KTBA 3RBTA 2YP6A 2O7KA 1FW1A 1F37A 3KGKA 2V6KA 1OE8A 4IGJA 1X9MB 4AJ8A 2K6VA 1AQXA 4CW9A 3P8WA 2NTOA 1K0AA 2OBKA 3KP9A 3HVXA 4FYCA 2N5AA 5ECQB 3HJOA 1GLQA 4TXOB 2ZCTA 1XVQA 3KP8A 1J0FA 1T7PB 2VCVA 1GL8A 1GP1A 4GF0A 2H75A 2I1UA 4JZQA 3CRUA 1VF3A 3EYTA 1T00A 4JU5A 2CVKA 2E7PA 3M8NA 3TJJA 1Z6MA 4DSSA 5KN2A 4TN8A 1T4ZA 5HR1A 3UOMA 2ZNMA 3HKRA 3RHCA 1AQWA 4EUYA 3DYRA 5IMFA 1TJDA 2PWJA 1J08A 4HI7A 2H76A 2C0DA 1VF2A 3C73A 4F9ZA 2AV4A 3FK8A 2K9FA 4OCEA 3P7XA 5GZZB 3N9JA 1SJZA 2MMOA 1K0BA 3GL3A 2JZTA 1R26A 2O87A 1M99A 3U6VA 4JR4A 1NHOA 2MBSA 1GSSA 1JLVA 4OFNA 2FLSA 2XC2A 3D5JA 1V98A 1SL2B 5B7CA 3C7MA 5IO0A 1GUMA 3IC4A 4TR0A 2NVLA 1OYJA 2FNOA 1A23A 2C3NA 1W89A 4HU9A 2DBCA 3E0UA 2RIIA 7GSSA 3I9V2 5DVBA 1YJ6A 5DQYA 1TOFA 5ECHB 2V2GA 2O85A 1Z6NA 2X99A 1XIYA 2RM6A 1VF1A 4N0ZA 5AIVA 1A8YA 3LXZA 3APQA 3GH6A 3N5OA 3FYGA 5DALB 1K0NA 20GSA 1UA5A 2MMAA 4LL1B 1USBA 4TKYA 2VOCA 2HNLA 5J5NA 1M9BA 1V2AA 3ED3A 3A5WA 3S9FA 2G0FA 1SK2A 5DDLA 4J56E 1M2AA 2CX3A 4L8EA 1OKDA 4EDZA 3GA4A 3NIVA 3NOFA 3MWHA 3HJMA 3C8EA 5DALA 1GUHA 4KAEA 3F4TA 4FIWA 4ZXGA 1MDKA 2RUFA 1B48A 5G1LA 4GRFA 3VWWA 5D9XA 17GSA 2IFQB 4POKA 2C3TA 1Z7PA 1TU8A 6GSUA 4F2IA 1FHEA 3DKSA 4HOJA 1EEJA 1EOHA 4OCFA 2IMKA 3QD9A 3WGEA 1SD8A 5B8BA 4V1Ag 5C00A 4MF6A 4E8EA 2MBTA 4YQVA 4KSMA 2PVOC 3GFKA 1FVJA 1TK8B 4IELA 3UL3A 1Q98A 1ST9A 2HZFA 2RUEA 3HCZA 4L0UA 5ECOB 3LORA 2YZUA 3RPNA 5AIXA 4ZB9A 2JU5A 5CRHA 3ERWA 3KXOA 1TXXA 1ZMAA 4MH3A 5F07A 2FD3A 2CAIA 2BMXA 2J9HA 3RHBA 4FH8A 3HD5A 4JE1A 3U5RE 2C4JA 5IMZA 4ECCA 1NM3A 4IQAA 1THOA 3GSSA 3OR5A 2KP2A 5C04A 4OWYA 2DJJA 1GULA 1WRYA 2C3QA 4F0CA 1DBYA 3PR8A 4QL7A 2QC7A 2HE3A 1GWCA 2VAFA 19GSA 2VM1A 4BL7A 1EEMA 2JACA 4I2TA 1OC9B 3KH9A 1OE7A 4FYBA 3FZ9A 3IOSA 1I5GA 2H70A 2P31A 1SL1B 4K0GA 4KGIA 2R5GA 2GQLA 5G5EA 3M1GA 13GSA 1T8EB 2ES7A 1YF1A 2HXKA 3HY2A 4QL9A 3P90A 5JWQB 3TKSE 4CDOA 5DBQA 4OO4A 3HJPA 5A4VA 3F4SA 3W8SA 2RLIA 4AJ6A 2DLXA 2YWOA 3O6TA 4RI6A 4TR4A 1ERUA 4GSSA 2IMIA 1XCCA 4AJ7A 2OACA 2JZRA 4K0NA 3NZNA 4WBRD 2OJLA 1A24A 3ZYWA 4PNGA 3DWVA 3TDGA 1HYUA 1AUCA 5IMDA 2L59A 4XHMA 3IV4A 3BJ5A 1G7EA 3GHAA 3DIEA 5FWGA 1SKWB 2FHEA 1UC7A 4IN0A 1R4WA 2C0FA 4K9ZA 4KCAA 2V6OA 2YCDA 1G0TA 1X5EA 3KCMA 5D9VA 22GSA 2R6KA 2H71A 1TRUA 3R2QA 1J9BA 3D4TA 2IMEA 1PKWA 4D73B 3FZ5A 4ML1A 1FOVA 3CBUA 1B4QA 1BQ7A 2B1KA 1T1VA 3GTUB 4KDXA 5ENUA 4NAXA 2PUKC 5FT3A 2FWEA 4D73A 2YANA 2XHFA 4GQFA 2CA8A 3TJBA 3MDKA 3LSZA 5J9CA 3EE2A 3TKQA 2C1YA 1K0MA 5CNWA 3IXRA 3L0HA 4JEDA 2GGTA 1XWCA 3ZMLA 1O8XA 2L5LA 1YDKA 2YPMA 1XZOA 2OBIA 2HRFA 3ERGA 1M7TA 2FA4A 2CZ2A 1GTUA 5DJMA 4BVXA 3KM6A 2VIMA 1TKDB 4NHZA 3L9SA 4XS4B 1EV4A 2WCIA 4L5LA 3G9BA 2LS5A 4ZIJA 3IHQA 1JHBA 4NPBA 4MPFA 4I97A 2PPTA 2F3MA 3VK9A 2AB6A 1HQOA 4WF5A 3D4MA 5KEJA 1T3BA 3BOAA 1XW9A 2GZPA 4IJ3A 3L9VA 3ZMKA 1OAZA 4EE0A 1XWKA 3E3EA 3WYWA 5LD0A 1PGTA 2XPEA 1UN2A 4LMWA 3UBLA 3LWAA 2OE0A 4MMMA 4XS4A 2GLRA 2V32A 1TRWA 3E9JB 3IA1A 2HYXA 1BG5A 2GT5A 1PN9A 1B9YC 2BJXA 1PKZA 1O73A 4PQIA 2VCZA 4KDUA 5E4WA 1MD3A 2LV3A 2H6ZA 1XOBA 4WXTA 1V40A 3FZAA 4MF7A 2H6XA 3O3TA 3TCOA 2WJUA 3ZVJA 1ILOA 2M46A 1EP7A 4ECIA 2HT9A 5B8AA 1YEPA 5IMCA 2G2QA 3KTLA 1THXA 3IAM2 5ELAA 1NSWA 1SJ6A 1ERTA 1JZDA 18GSA 1EWXA 2H66A 3SBCA 1MEKA 4EVMA 5HQPA 2E0QA 1K0CA 3TOTA 2M80A 1EP8A 1PD21 4CHSA 4HUAA 1HNCA 4F0BA 4ILFA 3ZFLA 2REMA 1H4OA 1GTAA 2MZCA 4RQRA 4HU7A 3CSHA 1AAZA 4HDEA 2LRNA 5F06A 1GLPA 2ALBA 3RDWA 3F3QA 3EMPA 4PXOA 4DSSB 4KH7A 3A3TA 1QMVA 2FWGA 2YWNA 5IOXA 5B6MA 4EO3A 2E2MA 4MJAA 3QMXA 2VUPA 14GSA 1SENA 2H30A 3WGDA 2F9SA 2VM2A 5L71A 2QKEA 2WFCA 1IYHA 2GDRA 4OO5A 1XVWA 5ID2B 1U3AA 4TXVA 1JFUA 4HS1A 3WD6A 2X8HA 3AY8A 1O7UA 3KMOA 1YEXA 5DAKA 1X5DA 3BCIA 2IWTA 1HNBA 4X1UA 4ID0A 4FYUA 4GCIA 4YAPA 5ID2A 4K2DA 2HZEA 1XXUA 1QFNA 1GSFA 2TRXA 2FUG2 1FO5A 1GSQA 4ACSA 1XWBA 4MH2A 2PU9C 3L78A 1AIUA 1W4VA 3CMIA 2EIRA 4HZ2A 2D2ZA 3A2XA 3DEXA 1GNWA 2CX4A 2OA7A 2LTKA 2H8LA 3GN3A 3VLNA 3UARA 2VCXA 4LMVA 2O89A 1MDJA 4MZCA 3WT2A 2HSYA 4RUVA 4IBPA 2AJQB 1WMJA 3DVWA 5DQSA 3M3MA 1URMA 2QSIA 1O8WA 2GVPA 1A2LA 2LQQA 3HDCA 5D73A 1S3AA 2ZUPA 1F3AA 2K8VA 5CRDA 5IPHA 3IR4A 2N5BA 1X9WB 3VI5A 3WGXA 4KA0A 4RQXA 4HEA2 2FCHA 3HHVA 1E6BA 2JL4A 3TOUA 2L5OA 1YF0A 1YQ1A 2MYGA 2YV9A 3P2AA 5D96A 1O81A 2B6MA 2FA8A 4XCSA 2VCQA 1G7OA 4PURA 2I4AA 1JLWA 1PX7A 2LJKA 4HQSA 1SD9A 2TIRA 1XPVA 2AAWA 1U88A 4IP6A 3I6AA 2VO4A 5AISA 3WT1A 4KE3A 4MPGA 12GSA 1V9WA 3RAZA 3VWXA 2GZYA 2NDOA 4IP1A 4KX4A 3HVVA 3KD0A 3VPQA 3JCML 1X9SB 2YNXA 5ECNB 1FAAA 3H8QA 9GSSA 2OE3A 2IPAA 1XFLA 3J7Yk 4L0WA 3M9KA 4GWRA 3TRPA 1ZOFA 3EVIA 1XBSA 5F8BA 3IK7A 4G19A 1AW9A 2V1MA 1TI3A 1A2JA 2B5YA 3DD3A 1S3CA 2DJ3A 3M0FA 3KMNA 4I8BA 4WR5A 3GIXA 3GSTA 4XRDA 3DGQA 3ERFA 4G2EA 1GUKA 4MP4A 2X8CA 5COHA 3DXBA 4WR4A 1DSBA 1BJXA 3TRXA 2KOKA 3MNGA 2OADA 3MSZA 5DCHA 3QFAC 1LJRA 2DIYA 3LGCA 4J57E 4YQMA 4ZL8A 5DCGA 2ON7A 5ECRB 1Y25A 4HJMA 4O32A 4PQ1A 1GTBA 1M2DA 4IJIA 3ZVJD 4EDYA 3A2WA 4Q5RA 3RPPA 3LYKA 1OKTA 2R2JA 4K7NA 3IE3A 4I6XA 3CYNA 2IL3A 1FG4A 3A2VA 4QQ7A 3GX0A 2LKUA 2YZHA 3D6IA 4HJ2A 1LU4A 4LLRA 1SYRA 1F3BA 4F03A 1QGVA 3HVSA 1WP0A 4I5QA 2DJ2A 2NPBA 3F9UA 4Q5FA 4O7HA 5J3RA 1TK5B 1AXDA 3FEUA 4JBBA 2LJRA 4I2UA 3UMAA 3KJYA 5ECIB 5F05A 2AYTA 2OE1A 4K8MA 1YKCA 5J4UA 2GSTA 2B5EA 2LQOA 2JADA 5INYA 2C0GA 1ON4A 3TKSC 3CSJA 3ISOA 1AQVA 4OFTA 3APOA 1TDIA 2LEGA 3H79A 2GSQA 4LA1A 3KH7A 4Q5QA 4V2LA 3LFLA 2IIYA 5GAPD 2GTUA 3UJ1A 4G10A
chains in the Genus database with same CATH superfamily
4MLYA 3EWLA 5GAND 3US3A 4F82A 1WOUA 1F9MA 2E2GA 1MTCA 3QR6A 2R0GA 4MK3A 5D9WA 4ZBBA 1PSQA 3TRQA 1H75A 4NV5A 1ERWA 1ZYEA 4MZWA 3K8NA 4NWYA 1Q4JA 2RM5A 2L6CA 2EC4A 1KTEA 2H1DA 4GQCA 3VWVA 5KN3A 4V2MA 3FHKA 3H4KA 2C0EA 4ZBAA 2K8SA 1BAYA 2DIZA 3GYKA 2PERA 3UBKA 4ZL7A 2LUSA 1F6MC 1TRVA 3BBYA 3R3EA 1WJKA 2FWFA 3MIXA 3LJRA 4N10A 1ZCPA 3PPUA 2C80A 1G6WA 2VLVA 3I69A 4V2NA 4TW5A 5KN1A 3TKRA 3BCKA 5ECKB 3UVTA 3DVXA 3CTFA 1SKSB 2HI7A 2VL3A 1SK0A 3EMXA 2P0GA 3QPMA 2JSYA 4MJEA 4EXJA 4TVEA 1GH2A 2X64A 1YZXA 4KSOA 2CVDA 2AHEA 2IN3A 4FO5A 1OC8A 3J7Yb 2VCWA 1EV9A 4GTUA 4G9HA 2HFDA 1NW2A 1R7HA 2I81A 3LW9A 3GV1A 2MMNA 4XRAA 4YQUA 2F51A 1EGRA 5GSSA 3LG6A 2H0IA 1HD2A 2B1LA 1ZZYA 3LQ7A 4BWSA 5H5QA 2L4CA 4EF0A 2GSRA 3ZRDA 3ZFBA 2LNSA 2CQ9A 5CO3A 3ZIJA 3F4RA 4K7IA 4H86A 4BPYA 1WIKA 4EKZA 1SKRB 2CV4A 1XWAA 2CVBA 2B3SA 4XTSA 3VURA 4N30A 1N2AA 2WULA 5JWRB 1FB6A 1TW9A 3FY7A 3SWLA 1A8LA 4GSTA 2VL9A 4BIKA 4YH2A 4ULXA 2HRNA 3PGTA 1M3JA 5GSTA 5A4UA 3FR6A 4KW6A 3DRNA 1ZYQB 1GRXA 3PH9A 5CAXA 1ZL9A 2HSMA 2IJYA 3CTGA 4GLTA 2A4HA 2H6YA 4K1FA 4DVCA 1PQNA 1RQMA 5DAKB 4HQZA 4TR1A 1XW6A 2WB9A 5JWOB 5F0GA 2IMDA 4IW9A 3L4NA 2HZEB 4NXIA 2K18A 1U6TA 4BVYA 3D0ZA 5CREA 3GURA 4MABA 5HFIA 4LL4B 2VL2A 5IO2A 5G1KA 4BA7A 5G30A 3TB2A 2VLUA 1DE2A 3IBHA 1TP9A 3QAWA 2CAQA 5JCGA 4HSCX 4N0VA 4KNDA 2GZZA 2PBJA 2I3YA 4TXOA 5IMVA 5ECPB 2YV7A 4ZL9A 2VLTA 2FWHA 1SJIA 1Z5YE 3CRTA 2PVQA 2HLSA 2O8VB 1ML6A 2WGRA 4ECBA 3KEBA 1RW1A 1A0FA 2GQMA 1X5CA 5D93A 1K0DA 4MJCA 2VL2C 1TTZA 1DUGA 3HZ8A 5AN1A 2YJHA 1KBNA 1F2EA 2LRCA 2H73A 4WBJA 3F6FA 1FVKA 1CQHA 2PN8A 4WEYA 1MD4A 2B7JA 2DJKA 4WF4A 3GH9A 2YOIA 3FR3A 1PX6A 1QK8A 5CP1A 5HR2A 3ZLPA 1JZWA 3GX8A 1PMTA 3G7YA 1ZYPA 1U87A 2GS3A 2YN1A 5D8IA 3HA9A 1R5AA 1V57A 2PMTA 3F63A 4K7OA 4IHUA 4ZB8A 1GSEA 1K0OA 2WS2A 2DC5A 1TI1A 1B8XA 1SL0B 1CQGA 2C8UA 1VGLA 2VD0A 2GQKA 4MJBA 5HFKA 3A5IA 2TRCP 1PL1A 4NHWA 4X43A 3UIWA 2KUCA 4IQ1A 1QUWA 2F8FA 1DE1A 1ZYNA 4TR3A 3UAPA 1TU7A 3W6GA 3LEFA 5B6NA 3ZREA 1EOGA 3PINA 1B9XC 2YWIA 1M2BA 2H74A 3GKKA 3TUEA 1U3IA 3VPTA 4OD7A 3LXTA 4IKHA 1JZOA 1K3OA 2H72A 1XW5A 3VI7A 3F0IA 4YAVA 2LSTA 4PUAA 1I9DA 4G0IA 4AF2A 2B5XA 3QAVA 4PGTA 4XS6A 1BYEA 5IQYA 2BTOT 3QFBC 4BWQA 2P5QA 1K3YA 4PQHA 3D22A 3ZITA 4MDCA 3BD2A 4EL1A 2EIOA 4O92A 3QCPA 1PRXA 3F8UA 3O76A 5ECMB 3GMFA 4TRXA 2IFQA 4DSRA 3G7IA 3VWUA 6GSYA 4RI7A 6GSWA 2R3XA 3FR9A 1GSDA 2EIQA 2H01A 5G2ZA 3CSIA 6GSVA 2YWMA 5J9BA 5ABRA 2VCTA 2X8GA 1A2MA 2KHPA 2V41A 2NBSA 1ERVA 4WKWA 5AGYA 1SYXA 3HVNA 5E59A 2GSSA 1OC3A 5KN0A 3HYPA 1GTIA 4NV2A 2Z9SA 4ZILA 5LCZA 3DMLA 4AGSA 2H1GA 1X0RA 2R37A 5H5RA 5HFGA 1ABAA 4KDYA 2KP1A 4OFMA 3IRAA 2CT6A 1E2YA 1YKAA 1WPIA 3VFIA 3QAGA 2OKAA 3ME8A 1GSYA 1TK0B 3EU4A 3GKNA 2FGXA 4KCEA 1ZGNA 4MA9A 4DEJA 1QXHA 4JR6A 4MCUA 1V58A 1N8JA 1EGOA 3IPZA 2DJ0A 4PNFA 4V1Ap 3UVHA 1GNEA 1FB0A 3I43A 4Z7XA 4P3YB 2WRTA 3UEMA 1AC1A 3TKSA 2CZ3A 5H5SA 3GRXA 3KZQA 5JCWA 5DJLA 2XBQA 2DMLA 1T4YA 5JCUA 1K3LA 2WZ9A 5EVOA 3Q19A 1WE0A 4OMVA 5CRWA 3TJFA 1UVZA 3C1SA 4XS1A 2A2RA 3CXGA 16GSA 1MDIA 4JRRA 4NMUA 4EC0A 2R4VA 1OC9A 2LNTA 5HR0A 5IIZA 4J2FA 2IMFA 1JZRA 1SK1A 3ZIVA 4POLA 3MAKA 3TJKA 3FMWA 2A2SA 3F3RA 1HNAA 5ECLB 2H0HA 1FOHA 4IVFA 1BX9A 3EU3A 1TRSA 2HSHA 5LNKe 4O5RA 1GSUA 3IDVA 4L5OA 3TGZA 1Z7RA 2VD1A 3EPTA 3IAS2 1Z9HA 1R5PA 2L57A 2M72A 3FZ4A 2DMMA 1A0RP 1ACVA 1VF4A 2ON5A 2DJ1A 3GKXA 2QA2A 4PUFC 5IMAA 3HXSA 1EZKA 10GSA 3D21A 5A5KA 5EPFA 2X49A 2AUVA 5G31A 1Y6EA 2N5FA 4K6XA 2QGVA 2F8AA 4MF5A 1O6JA 4N11A 3EINA 3Q74A 4X4JA 2H1BA 4MZBA 2MMZA 5CYYA 1S3DA 3LYPA 1O85A 3H93A 5HR3A 1OVNA 2I9HA 4POBA 3GL5A 5CRGA 5ELGA 2KLXA 1M9AA 3ZZXA 1WWJA 2DSAA 1XOAA 3C1RA 3ME7A 5D9TA 1S3RA 4KB3A 1RK4A 3GTUA 5G5FA 4Q5NA 1NHYA 3W8JA 1BEDA 2YJ7A 4E8HA 3G7JA 1B4PA 3APSA 1VRSD 5ECSA 4XIHA 3C71A 1KNGA 3V1WA 3Q18A 4IS0A 5IOWA 1C72A 1QQ2A 4O5QA 3F6DA 2P5RA 2GT6A 4ECJA 11GSA 2H1AA 2L4QA 3GKMA 3ZTLA 1XWGA 2JSZA 1Z3EA 3QDNA 2L6DA 2WDUA 8GSSA 3FKFA 3M9JA 5IPGA 4POMA 2LJAA 5J41A 6GSSA 3TJGA 1G6YA 1YY7A 4DSQA 2PGTA 2XPDA 2J23A 6GSTA 5IM9A 5FHIA 1PL2A 2JZSA 4X0XA 1LBKA 1KEBA 3Q6OA 4GSNA 1SU9A 2XBIA 3QOUA 3KIJA 2H19A 4USSA 4KUNA 5A4WA 2B7KA 3TKPA 3FW2A 3ZL5A 5EY6A 3IK9A 2FY6A 3L9UA 4ML6A 3FRCA 3H1NA 5EL8A 4ISDA 3EC3A 3EURA 6GSXA 4HZ4A 4TOPA 4GXZA 1M0UA 4ZBDA 1IYIA 2H0GA 1PA3A 5BRTA 4ZB6A 2LRTA 4WETA 3HZ4A 4PX1A 4TR1B 2A4VA 3GUSA 3GNJA 3KTBA 3RBTA 2YP6A 2O7KA 1FW1A 4BVYB 1F37A 3KGKA 2V6KA 1OE8A 4IGJA 1X9MB 4AJ8A 2K6VA 1AQXA 4CW9A 3P8WA 2NTOA 1K0AA 2OBKA 3KP9A 3HVXA 4FYCA 2N5AA 5ECQB 3HJOA 1GLQA 4TXOB 2ZCTA 2UZ8A 1XVQA 3KP8A 1J0FA 1T7PB 2VCVA 1GL8A 1GP1A 4GF0A 2H75A 2I1UA 4JZQA 3CRUA 1VF3A 3EYTA 1T00A 4JU5A 2CVKA 2DKIA 2E7PA 3M8NA 4YKGA 3TJJA 1Z6MA 4DSSA 5KN2A 4TN8A 1T4ZA 5HR1A 3UOMA 2ZNMA 3HKRA 3RHCA 1AQWA 4EUYA 3DYRA 5IMFA 1TJDA 2PWJA 1J08A 4HI7A 2H76A 2C0DA 1VF2A 3C73A 4F9ZA 2AV4A 3FK8A 2K9FA 4OCEA 3P7XA 5GZZB 3N9JA 1SJZA 2MMOA 1K0BA 3GL3A 2JZTA 1R26A 2HRAA 2O87A 1M99A 3U6VA 4JR4A 1NHOA 2MBSA 1GSSA 1JLVA 4OFNA 2FLSA 2XC2A 3D5JA 1V98A 1SL2B 5B7CA 3C7MA 5IO0A 1GUMA 3IC4A 4TR0A 2NVLA 1OYJA 2FNOA 1A23A 2C3NA 1W89A 4HU9A 2DBCA 3E0UA 2RIIA 7GSSA 3I9V2 5DVBA 1YJ6A 5DQYA 1TOFA 5ECHB 2V2GA 2O85A 1Z6NA 2X99A 1XIYA 2RM6A 1VF1A 4N0ZA 5AIVA 1A8YA 3LXZA 3APQA 3GH6A 3N5OA 3FYGA 5DALB 1K0NA 20GSA 1UA5A 2MMAA 4LL1B 1USBA 4TKYA 2VOCA 2HNLA 2DKHA 5J5NA 1M9BA 1V2AA 3ED3A 3A5WA 3S9FA 2G0FA 1SK2A 5DDLA 4J56E 1M2AA 2CX3A 4L8EA 1OKDA 4EDZA 3GA4A 3NIVA 3NOFA 3MWHA 4EIQA 3HJMA 3C8EA 5DALA 1GUHA 4KAEA 3F4TA 4FIWA 4ZXGA 1MDKA 4ICYA 2RUFA 1B48A 5G1LA 4GRFA 3VWWA 5D9XA 17GSA 2IFQB 4POKA 2C3TA 1Z7PA 1TU8A 6GSUA 4F2IA 4YKFA 1FHEA 3DKSA 4HOJA 1EEJA 1EOHA 4OCFA 2IMKA 3QD9A 3WGEA 1SD8A 5B8BA 4V1Ag 5C00A 4MF6A 4E8EA 2MBTA 4YQVA 2R0PA 4KSMA 2PVOC 3GFKA 1FVJA 1TK8B 4IELA 3UL3A 1Q98A 1ST9A 2HZFA 2RUEA 3HCZA 4Z2UA 4L0UA 1PFOA 5ECOB 3LORA 2YZUA 3RPNA 5AIXA 4ZB9A 2JU5A 5CRHA 3ERWA 3KXOA 1TXXA 1ZMAA 4MH3A 5F07A 2FD3A 2CAIA 2BMXA 2J9HA 3RHBA 4FH8A 3HD5A 4JE1A 3U5RE 2C4JA 5IMZA 4ECCA 1NM3A 4IQAA 1THOA 3GSSA 3OR5A 2KP2A 5C04A 4OWYA 2DJJA 1GULA 1WRYA 2C3QA 4F0CA 1DBYA 3PR8A 4QL7A 2QC7A 2HE3A 1GWCA 2VAFA 19GSA 2VM1A 4BL7A 1EEMA 2A2PA 2JACA 4I2TA 1OC9B 3KH9A 1OE7A 4FYBA 3IC8A 3FZ9A 3IOSA 1I5GA 2H70A 2P31A 1SL1B 4K0GA 4KGIA 2R5GA 2GQLA 5G5EA 3M1GA 13GSA 1T8EB 2ES7A 3IHGA 1YF1A 2HXKA 3HY2A 4QL9A 3P90A 5JWQB 3TKSE 4CDOA 5DBQA 4OO4A 3HJPA 5A4VA 3F4SA 3W8SA 2RLIA 4AJ6A 2DLXA 2YWOA 3O6TA 4RI6A 4TR4A 1ERUA 4A5PA 4GSSA 2IMIA 1XCCA 4AJ7A 2OACA 2JZRA 4K0NA 3NZNA 4WBRD 2OJLA 4PTSA 1A24A 3ZYWA 4PNGA 3DWVA 3TDGA 1HYUA 1AUCA 5IMDA 2L59A 4XHMA 3IV4A 3BJ5A 1G7EA 3GHAA 3DIEA 5FWGA 1SKWB 2FHEA 1UC7A 4IN0A 1R4WA 2C0FA 4K9ZA 4KCAA 2V6OA 2YCDA 1G0TA 1X5EA 3KCMA 5D9VA 22GSA 4EIPA 2R6KA 2H71A 1TRUA 3R2QA 1J9BA 3D4TA 3CQFA 2IMEA 1PKWA 4D73B 3FZ5A 4ML1A 1FOVA 3CBUA 1B4QA 1BQ7A 2B1KA 1T1VA 3GTUB 4KDXA 5ENUA 4NAXA 2PUKC 5FT3A 2FWEA 4D73A 2YANA 2XHFA 4GQFA 2CA8A 4BVXB 3TJBA 3MDKA 5KOXA 3LSZA 5J9CA 3EE2A 3TKQA 2C1YA 1K0MA 5CNWA 3IXRA 3L0HA 4JEDA 2GGTA 1XWCA 3ZMLA 1O8XA 2L5LA 1YDKA 2YPMA 1XZOA 2OBIA 2HRFA 3ERGA 1M7TA 2FA4A 2CZ2A 1GTUA 5DJMA 4BVXA 3KM6A 2HRKA 2VIMA 1TKDB 4NHZA 4KF9A 3L9SA 4XS4B 1EV4A 2WCIA 4L5LA 3G9BA 2LS5A 4ZIJA 3IHQA 1JHBA 4NPBA 4MPFA 4I97A 2PPTA 2F3MA 3VK9A 2AB6A 1HQOA 4WF5A 3D4MA 5KEJA 1T3BA 3BOAA 1XW9A 4G0LA 2GZPA 4IJ3A 3L9VA 3ZMKA 1PN0A 1OAZA 2X4AA 4EE0A 1XWKA 3E3EA 3WYWA 5LD0A 1PGTA 2XPEA 1UN2A 4LMWA 3UBLA 3LWAA 2OE0A 4MMMA 4XS4A 2GLRA 2V32A 1TRWA 3E9JB 3IA1A 2HYXA 1BG5A 2GT5A 1PN9A 1B9YC 2BJXA 5KOWA 1PKZA 1O73A 4PQIA 2VCZA 4KDUA 5E4WA 1MD3A 2LV3A 2H6ZA 1XOBA 4WXTA 1V40A 3FZAA 4MF7A 2H6XA 3O3TA 3TCOA 2WJUA 3ZVJA 1ILOA 2M46A 1EP7A 4ECIA 2HT9A 5B8AA 1YEPA 5IMCA 2G2QA 3KTLA 1THXA 3IAM2 5ELAA 1M3IA 1NSWA 1SJ6A 1ERTA 1JZDA 18GSA 1EWXA 2H66A 3SBCA 1MEKA 4EVMA 5HQPA 2E0QA 1K0CA 3TOTA 2M80A 1EP8A 1PD21 4CHSA 4HUAA 1HNCA 4F0BA 4ILFA 3ZFLA 2REMA 1H4OA 1GTAA 2MZCA 4RQRA 4HU7A 3CSHA 1AAZA 4HDEA 2LRNA 5F06A 1GLPA 4CY6A 2ALBA 3RDWA 4CY8A 3F3QA 3EMPA 4PXOA 4DSSB 4KH7A 3A3TA 1QMVA 2FWGA 2YWNA 5IOXA 5B6MA 4EO3A 2E2MA 4MJAA 3QMXA 2VUPA 14GSA 1SENA 2H30A 3WGDA 2F9SA 2VM2A 5L71A 2QKEA 2WFCA 1IYHA 2GDRA 4OO5A 1XVWA 5ID2B 1U3AA 4TXVA 1JFUA 4HS1A 3WD6A 2X8HA 3MYDA 3AY8A 1O7UA 3KMOA 1YEXA 5DAKA 1X5DA 3BCIA 2IWTA 1HNBA 4X1UA 4ID0A 4FYUA 4GCIA 4YAPA 5ID2A 4K2DA 2HZEA 1XXUA 1QFNA 1GSFA 2TRXA 2FUG2 1FO5A 1GSQA 4ACSA 4MNNA 1XWBA 4MH2A 2PU9C 3L78A 1AIUA 1W4VA 3CMIA 2EIRA 4HZ2A 2D2ZA 3A2XA 3DEXA 1GNWA 2CX4A 2OA7A 2LTKA 2H8LA 3GN3A 3VLNA 3UARA 2VCXA 4LMVA 2O89A 1MDJA 4MZCA 3WT2A 2HSYA 4RUVA 4IBPA 2AJQB 1WMJA 3DVWA 5DQSA 3M3MA 1URMA 2QSIA 1O8WA 2GVPA 1A2LA 2LQQA 3HDCA 5D73A 1S3AA 4Z2TA 2ZUPA 1F3AA 2K8VA 5CRDA 5IPHA 3IR4A 4K5SA 2N5BA 1X9WB 3VI5A 3WGXA 4KA0A 4RQXA 4HEA2 2FCHA 3HHVA 1E6BA 4FQUA 2JL4A 3TOUA 2L5OA 1YF0A 1YQ1A 2MYGA 2YV9A 3P2AA 5D96A 1O81A 2B6MA 2FA8A 4XCSA 2VCQA 1G7OA 4PURA 2I4AA 1JLWA 1PX7A 2LJKA 4HQSA 1SD9A 2TIRA 1XPVA 2AAWA 1U88A 4IP6A 3I6AA 2VO4A 5AISA 3WT1A 4KE3A 4MPGA 12GSA 1V9WA 3RAZA 3VWXA 2GZYA 2NDOA 4IP1A 4KX4A 3HVVA 3KD0A 3VPQA 3JCML 1X9SB 2YNXA 5ECNB 5BMUA 1FAAA 1XG8A 3H8QA 9GSSA 2OE3A 2IPAA 1XFLA 3J7Yk 4L0WA 3M9KA 4GWRA 3TRPA 1ZOFA 3EVIA 1XBSA 5F8BA 3IK7A 4G19A 1AW9A 2V1MA 1TI3A 1A2JA 2B5YA 3DD3A 1S3CA 2DJ3A 3M0FA 3KMNA 4I8BA 4WR5A 3GIXA 3GSTA 4XRDA 3DGQA 3ERFA 4K2XA 4G2EA 1GUKA 4MP4A 2X8CA 5COHA 3DXBA 4BL7B 4WR4A 1DSBA 1BJXA 3TRXA 2KOKA 2R0CA 3MNGA 2OADA 3MSZA 3QFAC 1LJRA 2DIYA 3LGCA 4J57E 4YQMA 5DCHA 4ZL8A 5DCGA 2ON7A 5ECRB 1Y25A 4HJMA 4O32A 4PQ1A 1GTBA 2QA1A 4O5UA 1M2DA 4IJIA 3ZVJD 4EDYA 3A2WA 4Q5RA 3RPPA 3LYKA 1OKTA 2R2JA 4K7NA 3IE3A 4I6XA 3CYNA 2IL3A 1FG4A 3A2VA 4QQ7A 3GX0A 2LKUA 2YZHA 3D6IA 4HJ2A 1LU4A 4LLRA 1SYRA 1F3BA 4F03A 1QGVA 3HVSA 1WP0A 4I5QA 2DJ2A 2NPBA 3F9UA 4Q5FA 4O7HA 5J3RA 4Z2RA 1TK5B 1AXDA 3FEUA 4JBBA 4K5RA 2LJRA 4I2UA 3UMAA 3KJYA 5ECIB 5F05A 2AYTA 2OE1A 4K8MA 1YKCA 5J4UA 2GSTA 2B5EA 4G0KA 2LQOA 2JADA 5INYA 2C0GA 1ON4A 3TKSC 3CSJA 3ISOA 1AQVA 4OFTA 3APOA 1TDIA 2LEGA 3H79A 2GSQA 4LA1A 3KH7A 4Q5QA 4V2LA 3LFLA 2IIYA 5GAPD 2GTUA 3UJ1A 4G10A
chains in the Genus database with same CATH topology
4MLYA 3EWLA 5GAND 3US3A 4F82A 1WOUA 1F9MA 2E2GA 1MTCA 3QR6A 2R0GA 4MK3A 5D9WA 4ZBBA 1PSQA 3TRQA 1H75A 4NV5A 1ERWA 1ZYEA 4MZWA 3K8NA 4NWYA 1Q4JA 2RM5A 2L6CA 2EC4A 1KTEA 2H1DA 4GQCA 3VWVA 5KN3A 4V2MA 3FHKA 3H4KA 2C0EA 4ZBAA 2K8SA 1BAYA 2DIZA 3GYKA 2PERA 3UBKA 4ZL7A 2LUSA 1F6MC 1TRVA 3BBYA 3R3EA 1WJKA 2FWFA 3MIXA 3LJRA 4N10A 1ZCPA 3PPUA 2C80A 1G6WA 2VLVA 3I69A 4V2NA 4TW5A 5KN1A 3TKRA 3BCKA 5ECKB 3UVTA 3DVXA 3CTFA 1SKSB 2HI7A 2VL3A 1SK0A 3EMXA 2P0GA 3QPMA 2JSYA 4MJEA 4EXJA 4TVEA 1GH2A 2X64A 1YZXA 4KSOA 2CVDA 2AHEA 2IN3A 4FO5A 1OC8A 3J7Yb 2VCWA 1EV9A 4GTUA 4G9HA 2HFDA 1NW2A 1R7HA 2I81A 3LW9A 3GV1A 2MMNA 4XRAA 4YQUA 2F51A 1EGRA 5GSSA 3LG6A 2H0IA 1HD2A 2B1LA 1ZZYA 3LQ7A 4BWSA 5H5QA 2L4CA 4EF0A 2GSRA 3ZRDA 3ZFBA 2LNSA 2CQ9A 5CO3A 3ZIJA 3F4RA 4K7IA 4H86A 4BPYA 1WIKA 4EKZA 1SKRB 2CV4A 1XWAA 2CVBA 2B3SA 4XTSA 3VURA 4N30A 1N2AA 2WULA 5JWRB 1FB6A 1TW9A 3FY7A 3SWLA 1A8LA 4GSTA 2VL9A 4YH2A 4ULXA 2HRNA 3PGTA 5GSTA 5A4UA 3FR6A 4KW6A 3DRNA 1ZYQB 1GRXA 3PH9A 5CAXA 1ZL9A 2HSMA 2IJYA 3CTGA 4GLTA 2A4HA 2H6YA 4K1FA 4DVCA 1PQNA 1RQMA 5DAKB 4HQZA 4TR1A 1XW6A 2WB9A 5JWOB 5F0GA 2IMDA 4IW9A 3L4NA 2HZEB 4NXIA 2K18A 1U6TA 4BVYA 3D0ZA 5CREA 3GURA 4MABA 5HFIA 4LL4B 2VL2A 5IO2A 5G1KA 4BA7A 5G30A 3TB2A 2VLUA 1DE2A 3IBHA 1TP9A 3QAWA 2CAQA 5JCGA 4N0VA 4KNDA 2GZZA 2PBJA 2I3YA 4TXOA 5IMVA 5ECPB 2YV7A 4ZL9A 2VLTA 2FWHA 1SJIA 1Z5YE 3CRTA 2PVQA 2HLSA 2O8VB 1ML6A 2WGRA 4ECBA 3KEBA 1RW1A 1A0FA 2GQMA 1X5CA 5D93A 1K0DA 4MJCA 2VL2C 1TTZA 1DUGA 3HZ8A 5AN1A 2YJHA 1KBNA 1F2EA 2LRCA 2H73A 4WBJA 3F6FA 1FVKA 1CQHA 2PN8A 4WEYA 1MD4A 2B7JA 2DJKA 4WF4A 3GH9A 2YOIA 3FR3A 1PX6A 1QK8A 5CP1A 5HR2A 3ZLPA 1JZWA 3GX8A 1PMTA 3G7YA 1ZYPA 1U87A 2GS3A 2YN1A 5D8IA 3HA9A 1R5AA 1V57A 2PMTA 3F63A 4K7OA 4IHUA 4ZB8A 1GSEA 1K0OA 2WS2A 2DC5A 1TI1A 1B8XA 1SL0B 1CQGA 2C8UA 1VGLA 2VD0A 2GQKA 4MJBA 5HFKA 3A5IA 2TRCP 1PL1A 4NHWA 4X43A 3UIWA 2KUCA 4IQ1A 1QUWA 2F8FA 1DE1A 1ZYNA 4TR3A 3UAPA 1TU7A 3W6GA 3LEFA 5B6NA 3ZREA 1EOGA 3PINA 1B9XC 2YWIA 1M2BA 2H74A 3GKKA 3TUEA 1U3IA 3VPTA 4OD7A 3LXTA 4IKHA 1JZOA 1K3OA 2H72A 1XW5A 3VI7A 3F0IA 4YAVA 2LSTA 4PUAA 1I9DA 4G0IA 4AF2A 2B5XA 3QAVA 4PGTA 4XS6A 1BYEA 5IQYA 2BTOT 3QFBC 4BWQA 2P5QA 1K3YA 4PQHA 3D22A 3ZITA 4MDCA 3BD2A 4EL1A 2EIOA 4O92A 3QCPA 1PRXA 3F8UA 3O76A 5ECMB 3GMFA 4TRXA 2IFQA 4DSRA 3G7IA 3VWUA 6GSYA 4RI7A 6GSWA 2R3XA 3FR9A 1GSDA 2EIQA 2H01A 5G2ZA 3CSIA 6GSVA 2YWMA 5J9BA 5ABRA 2VCTA 2X8GA 1A2MA 2KHPA 2V41A 2NBSA 1ERVA 4WKWA 5AGYA 1SYXA 5E59A 2GSSA 1OC3A 5KN0A 3HYPA 1GTIA 4NV2A 2Z9SA 4ZILA 5LCZA 3DMLA 4AGSA 2H1GA 1X0RA 2R37A 5H5RA 5HFGA 1ABAA 4KDYA 2KP1A 4OFMA 3IRAA 2CT6A 1E2YA 1YKAA 1WPIA 3VFIA 3QAGA 2OKAA 3ME8A 1GSYA 1TK0B 3EU4A 3GKNA 2FGXA 4KCEA 1ZGNA 4MA9A 4DEJA 1QXHA 4JR6A 4MCUA 1V58A 1N8JA 1EGOA 3IPZA 2DJ0A 4PNFA 4V1Ap 3UVHA 1GNEA 1FB0A 3I43A 4Z7XA 4P3YB 2WRTA 3UEMA 1AC1A 3TKSA 2CZ3A 5H5SA 3GRXA 3KZQA 5JCWA 5DJLA 2XBQA 2DMLA 1T4YA 5JCUA 1K3LA 2WZ9A 5EVOA 3Q19A 1WE0A 4OMVA 5CRWA 3TJFA 1UVZA 3C1SA 4XS1A 2A2RA 3CXGA 16GSA 1MDIA 4JRRA 4NMUA 4EC0A 2R4VA 1OC9A 2LNTA 5HR0A 5IIZA 4J2FA 2IMFA 1JZRA 1SK1A 3ZIVA 4POLA 3MAKA 3TJKA 3FMWA 2A2SA 3F3RA 1HNAA 5ECLB 2H0HA 1FOHA 4IVFA 1BX9A 3EU3A 1TRSA 2HSHA 5LNKe 4O5RA 1GSUA 3IDVA 4L5OA 3TGZA 1Z7RA 2VD1A 3EPTA 3IAS2 1Z9HA 1R5PA 2L57A 2M72A 3FZ4A 2DMMA 1A0RP 1ACVA 1VF4A 2ON5A 2DJ1A 3GKXA 2QA2A 4PUFC 5IMAA 3HXSA 1EZKA 10GSA 3D21A 5A5KA 5EPFA 2X49A 2AUVA 5G31A 1Y6EA 2N5FA 4K6XA 2QGVA 2F8AA 4MF5A 1O6JA 4N11A 3EINA 3Q74A 4X4JA 2H1BA 4MZBA 2MMZA 5CYYA 1S3DA 3LYPA 1O85A 3H93A 5HR3A 1OVNA 2I9HA 4POBA 3GL5A 5CRGA 5ELGA 2KLXA 1M9AA 3ZZXA 1WWJA 2DSAA 1XOAA 3C1RA 3ME7A 5D9TA 4KB3A 1RK4A 3GTUA 5G5FA 4Q5NA 1NHYA 3W8JA 1BEDA 2YJ7A 4E8HA 3G7JA 1B4PA 3APSA 1VRSD 5ECSA 4XIHA 3C71A 1KNGA 3V1WA 3Q18A 4IS0A 5IOWA 1C72A 1QQ2A 4O5QA 3F6DA 2P5RA 2GT6A 4ECJA 11GSA 2H1AA 2L4QA 3GKMA 3ZTLA 1XWGA 2JSZA 1Z3EA 3QDNA 2L6DA 2WDUA 8GSSA 3FKFA 3M9JA 5IPGA 4POMA 2LJAA 5J41A 6GSSA 3TJGA 1G6YA 1YY7A 4DSQA 2PGTA 2XPDA 2J23A 6GSTA 5IM9A 5FHIA 1PL2A 2JZSA 4X0XA 1LBKA 1KEBA 3Q6OA 4GSNA 1SU9A 2XBIA 3QOUA 3KIJA 2H19A 4USSA 4KUNA 5A4WA 2B7KA 3TKPA 3FW2A 3ZL5A 5EY6A 3IK9A 2FY6A 3L9UA 4ML6A 3FRCA 3H1NA 5EL8A 4ISDA 3EC3A 3EURA 6GSXA 4HZ4A 4TOPA 4GXZA 1M0UA 4ZBDA 1IYIA 2H0GA 1PA3A 5BRTA 4ZB6A 2LRTA 4WETA 3HZ4A 4PX1A 4TR1B 2A4VA 3GUSA 3GNJA 3KTBA 3RBTA 2YP6A 2O7KA 1FW1A 4BVYB 1F37A 3KGKA 2V6KA 1OE8A 4IGJA 1X9MB 4AJ8A 2K6VA 1AQXA 4CW9A 3P8WA 2NTOA 1K0AA 2OBKA 3KP9A 3HVXA 4FYCA 2N5AA 5ECQB 3HJOA 1GLQA 4TXOB 2ZCTA 2UZ8A 1XVQA 3KP8A 1J0FA 1T7PB 2VCVA 1GL8A 1GP1A 4GF0A 2H75A 2I1UA 4JZQA 3CRUA 1VF3A 3EYTA 1T00A 4JU5A 2CVKA 2DKIA 2E7PA 3M8NA 4YKGA 3TJJA 1Z6MA 4DSSA 5KN2A 4TN8A 1T4ZA 5HR1A 3UOMA 2ZNMA 3HKRA 3RHCA 1AQWA 4EUYA 3DYRA 5IMFA 1TJDA 2PWJA 1J08A 4HI7A 2H76A 2C0DA 1VF2A 3C73A 4F9ZA 2AV4A 3FK8A 2K9FA 4OCEA 3P7XA 5GZZB 3N9JA 1SJZA 2MMOA 1K0BA 3GL3A 2JZTA 1R26A 2HRAA 2O87A 1M99A 3U6VA 4JR4A 1NHOA 2MBSA 1GSSA 1JLVA 4OFNA 2FLSA 2XC2A 3D5JA 1V98A 1SL2B 5B7CA 3C7MA 5IO0A 1GUMA 3IC4A 4TR0A 2NVLA 1OYJA 2FNOA 1A23A 2C3NA 1W89A 4HU9A 2DBCA 3E0UA 2RIIA 7GSSA 3I9V2 5DVBA 1YJ6A 5DQYA 1TOFA 5ECHB 2V2GA 2O85A 1Z6NA 2X99A 1XIYA 2RM6A 1VF1A 4N0ZA 5AIVA 1A8YA 3LXZA 3APQA 3GH6A 3N5OA 3FYGA 5DALB 1K0NA 20GSA 1UA5A 2MMAA 4LL1B 1USBA 4TKYA 2VOCA 2HNLA 2DKHA 5J5NA 1M9BA 1V2AA 3ED3A 3A5WA 3S9FA 2G0FA 1SK2A 5DDLA 4J56E 1M2AA 2CX3A 4L8EA 1OKDA 4EDZA 3GA4A 3NIVA 3NOFA 3MWHA 4EIQA 3HJMA 3C8EA 5DALA 1GUHA 4KAEA 3F4TA 4FIWA 4ZXGA 1MDKA 4ICYA 2RUFA 1B48A 5G1LA 4GRFA 3VWWA 5D9XA 17GSA 2IFQB 4POKA 2C3TA 1Z7PA 1TU8A 6GSUA 4F2IA 4YKFA 1FHEA 3DKSA 4HOJA 1EEJA 1EOHA 4OCFA 2IMKA 3QD9A 3WGEA 1SD8A 5B8BA 4V1Ag 5C00A 4MF6A 4E8EA 2MBTA 4YQVA 2R0PA 4KSMA 2PVOC 3GFKA 1FVJA 1TK8B 4IELA 3UL3A 1Q98A 1ST9A 2HZFA 2RUEA 3HCZA 4Z2UA 4L0UA 5ECOB 3LORA 2YZUA 3RPNA 5AIXA 4ZB9A 2JU5A 5CRHA 3ERWA 3KXOA 1TXXA 1ZMAA 4MH3A 5F07A 2FD3A 2CAIA 2BMXA 2J9HA 3RHBA 4FH8A 3HD5A 4JE1A 3U5RE 2C4JA 5IMZA 4ECCA 1NM3A 4IQAA 1THOA 3GSSA 3OR5A 2KP2A 5C04A 4OWYA 2DJJA 1GULA 1WRYA 2C3QA 4F0CA 1DBYA 3PR8A 4QL7A 2QC7A 2HE3A 1GWCA 2VAFA 19GSA 2VM1A 4BL7A 1EEMA 2A2PA 2JACA 4I2TA 1OC9B 3KH9A 1OE7A 4FYBA 3IC8A 3FZ9A 3IOSA 1I5GA 2H70A 2P31A 1SL1B 4K0GA 4KGIA 2R5GA 2GQLA 5G5EA 3M1GA 13GSA 1T8EB 2ES7A 3IHGA 1YF1A 2HXKA 3HY2A 4QL9A 3P90A 5JWQB 3TKSE 4CDOA 5DBQA 4OO4A 3HJPA 5A4VA 3F4SA 3W8SA 2RLIA 4AJ6A 2DLXA 2YWOA 3O6TA 4RI6A 4TR4A 1ERUA 4A5PA 4GSSA 2IMIA 1XCCA 4AJ7A 2OACA 2JZRA 4K0NA 3NZNA 4WBRD 2OJLA 4PTSA 1A24A 3ZYWA 4PNGA 3DWVA 3TDGA 1HYUA 1AUCA 5IMDA 2L59A 4XHMA 3IV4A 3BJ5A 1G7EA 3GHAA 3DIEA 5FWGA 1SKWB 2FHEA 1UC7A 4IN0A 1R4WA 2C0FA 4K9ZA 4KCAA 2V6OA 2YCDA 1G0TA 1X5EA 3KCMA 5D9VA 22GSA 4EIPA 2R6KA 2H71A 1TRUA 3R2QA 1J9BA 3D4TA 2IMEA 1PKWA 4D73B 3FZ5A 4ML1A 1FOVA 3CBUA 1B4QA 1BQ7A 2B1KA 1T1VA 3GTUB 4KDXA 5ENUA 4NAXA 2PUKC 5FT3A 2FWEA 4D73A 2YANA 2XHFA 4GQFA 2CA8A 4BVXB 3TJBA 3MDKA 5KOXA 3LSZA 5J9CA 3EE2A 3TKQA 2C1YA 1K0MA 5CNWA 3IXRA 3L0HA 4JEDA 2GGTA 1XWCA 3ZMLA 1O8XA 2L5LA 1YDKA 2YPMA 1XZOA 2OBIA 2HRFA 3ERGA 1M7TA 2FA4A 2CZ2A 1GTUA 5DJMA 4BVXA 3KM6A 2HRKA 2VIMA 1TKDB 4NHZA 4KF9A 3L9SA 4XS4B 1EV4A 2WCIA 4L5LA 3G9BA 2LS5A 4ZIJA 3IHQA 1JHBA 4NPBA 4MPFA 4I97A 2PPTA 2F3MA 3VK9A 2AB6A 1HQOA 4WF5A 3D4MA 5KEJA 1T3BA 3BOAA 1XW9A 4G0LA 2GZPA 4IJ3A 3L9VA 3ZMKA 1PN0A 1OAZA 2X4AA 4EE0A 1XWKA 3E3EA 3WYWA 5LD0A 1PGTA 2XPEA 1UN2A 4LMWA 3UBLA 3LWAA 2OE0A 4MMMA 4XS4A 2GLRA 2V32A 1TRWA 3E9JB 3IA1A 2HYXA 1BG5A 2GT5A 1PN9A 1B9YC 2BJXA 5KOWA 1PKZA 1O73A 4PQIA 2VCZA 4KDUA 5E4WA 1MD3A 2LV3A 2H6ZA 1XOBA 4WXTA 1V40A 3FZAA 4MF7A 2H6XA 3O3TA 3TCOA 2WJUA 3ZVJA 1ILOA 2M46A 1EP7A 4ECIA 2HT9A 5B8AA 1YEPA 5IMCA 2G2QA 3KTLA 1THXA 3IAM2 5ELAA 1NSWA 1SJ6A 1ERTA 1JZDA 18GSA 1EWXA 2H66A 3SBCA 1MEKA 4EVMA 5HQPA 2E0QA 1K0CA 3TOTA 2M80A 1EP8A 1PD21 4CHSA 4HUAA 1HNCA 4F0BA 4ILFA 3ZFLA 2REMA 1H4OA 1GTAA 2MZCA 4RQRA 4HU7A 3CSHA 1AAZA 4HDEA 2LRNA 5F06A 1GLPA 4CY6A 2ALBA 3RDWA 4CY8A 3F3QA 3EMPA 4PXOA 4DSSB 4KH7A 3A3TA 1QMVA 2FWGA 2YWNA 5IOXA 5B6MA 4EO3A 2E2MA 4MJAA 3QMXA 2VUPA 14GSA 1SENA 2H30A 3WGDA 2F9SA 2VM2A 5L71A 2QKEA 2WFCA 1IYHA 2GDRA 4OO5A 1XVWA 5ID2B 1U3AA 4TXVA 1JFUA 4HS1A 3WD6A 2X8HA 3MYDA 3AY8A 1O7UA 3KMOA 1YEXA 5DAKA 1X5DA 3BCIA 2IWTA 1HNBA 4X1UA 4ID0A 4FYUA 4GCIA 4YAPA 5ID2A 4K2DA 2HZEA 1XXUA 1QFNA 1GSFA 2TRXA 2FUG2 1FO5A 1GSQA 4ACSA 4MNNA 1XWBA 4MH2A 2PU9C 3L78A 1AIUA 1W4VA 3CMIA 2EIRA 4HZ2A 2D2ZA 3A2XA 3DEXA 1GNWA 2CX4A 2OA7A 2LTKA 2H8LA 3GN3A 3VLNA 3UARA 2VCXA 4LMVA 2O89A 1MDJA 4MZCA 3WT2A 2HSYA 4RUVA 4IBPA 2AJQB 1WMJA 3DVWA 5DQSA 3M3MA 1URMA 2QSIA 1O8WA 2GVPA 1A2LA 2LQQA 3HDCA 5D73A 1S3AA 4Z2TA 2ZUPA 1F3AA 2K8VA 5CRDA 5IPHA 3IR4A 4K5SA 2N5BA 1X9WB 3VI5A 3WGXA 4KA0A 4RQXA 4HEA2 2FCHA 3HHVA 1E6BA 4FQUA 2JL4A 3TOUA 2L5OA 1YF0A 1YQ1A 2MYGA 2YV9A 3P2AA 5D96A 1O81A 2B6MA 2FA8A 4XCSA 2VCQA 1G7OA 4PURA 2I4AA 1JLWA 1PX7A 2LJKA 4HQSA 1SD9A 2TIRA 1XPVA 2AAWA 1U88A 4IP6A 3I6AA 2VO4A 5AISA 3WT1A 4KE3A 4MPGA 12GSA 1V9WA 3RAZA 3VWXA 2GZYA 2NDOA 4IP1A 4KX4A 3HVVA 3KD0A 3VPQA 3JCML 1X9SB 2YNXA 5ECNB 5BMUA 1FAAA 3H8QA 9GSSA 2OE3A 2IPAA 1XFLA 3J7Yk 4L0WA 3M9KA 4GWRA 3TRPA 1ZOFA 3EVIA 1XBSA 5F8BA 3IK7A 4G19A 1AW9A 2V1MA 1TI3A 1A2JA 2B5YA 3DD3A 1S3CA 2DJ3A 3M0FA 3KMNA 4I8BA 4WR5A 3GIXA 3GSTA 4XRDA 3DGQA 3ERFA 4K2XA 4G2EA 1GUKA 4MP4A 2X8CA 5COHA 3DXBA 4BL7B 4WR4A 1DSBA 1BJXA 3TRXA 2KOKA 2R0CA 3MNGA 2OADA 3MSZA 3QFAC 1LJRA 2DIYA 3LGCA 4J57E 4YQMA 5DCHA 4ZL8A 5DCGA 2ON7A 5ECRB 1Y25A 4HJMA 4O32A 4PQ1A 1GTBA 2QA1A 4O5UA 1M2DA 4IJIA 3ZVJD 4EDYA 3A2WA 4Q5RA 3RPPA 3LYKA 1OKTA 2R2JA 4K7NA 3IE3A 4I6XA 3CYNA 2IL3A 1FG4A 3A2VA 4QQ7A 3GX0A 2LKUA 2YZHA 3D6IA 4HJ2A 1LU4A 4LLRA 1SYRA 1F3BA 4F03A 1QGVA 3HVSA 1WP0A 4I5QA 2DJ2A 2NPBA 3F9UA 4Q5FA 4O7HA 5J3RA 4Z2RA 1TK5B 1AXDA 3FEUA 4JBBA 4K5RA 2LJRA 4I2UA 3UMAA 3KJYA 5ECIB 5F05A 2AYTA 2OE1A 4K8MA 1YKCA 5J4UA 2GSTA 2B5EA 4G0KA 2LQOA 2JADA 5INYA 2C0GA 1ON4A 3TKSC 3CSJA 3ISOA 1AQVA 4OFTA 3APOA 1TDIA 2LEGA 3H79A 2GSQA 4LA1A 3KH7A 4Q5QA 4V2LA 3LFLA 2IIYA 5GAPD 2GTUA 3UJ1A 4G10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MLY A;  3EWL A;  5GAN D;  3US3 A;  4F82 A;  1WOU A;  1F9M A;  2E2G A;  1MTC A;  3QR6 A;  4MK3 A;  5D9W A;  4ZBB A;  1PSQ A;  3TRQ A;  1H75 A;  4NV5 A;  1ERW A;  1ZYE A;  4MZW A;  3K8N A;  4NWY A;  1Q4J A;  2RM5 A;  2L6C A;  2EC4 A;  1KTE A;  2H1D A;  4GQC A;  3VWV A;  5KN3 A;  4V2M A;  3FHK A;  3H4K A;  2C0E A;  4ZBA A;  2K8S A;  1BAY A;  2DIZ A;  3GYK A;  2PER A;  3UBK A;  4ZL7 A;  2LUS A;  1F6M C;  1TRV A;  3BBY A;  1WJK A;  2FWF A;  3LJR A;  4N10 A;  1ZCP A;  2C80 A;  1G6W A;  2VLV A;  3I69 A;  4V2N A;  4TW5 A;  5KN1 A;  3TKR A;  3BCK A;  5ECK B;  3UVT A;  3DVX A;  3CTF A;  1SKS B;  2HI7 A;  2VL3 A;  1SK0 A;  3EMX A;  2P0G A;  3QPM A;  2JSY A;  4MJE A;  4EXJ A;  4TVE A;  1GH2 A;  2X64 A;  1YZX A;  4KSO A;  2CVD A;  2AHE A;  2IN3 A;  4FO5 A;  1OC8 A;  3J7Y b;  2VCW A;  1EV9 A;  4GTU A;  4G9H A;  2HFD A;  1NW2 A;  1R7H A;  2I81 A;  3GV1 A;  2MMN A;  4XRA A;  4YQU A;  2F51 A;  1EGR A;  5GSS A;  3LG6 A;  2H0I A;  1HD2 A;  2B1L A;  1ZZY A;  3LQ7 A;  4BWS A;  5H5Q A;  2L4C A;  4EF0 A;  2GSR A;  3ZRD A;  3ZFB A;  2LNS A;  2CQ9 A;  5CO3 A;  3ZIJ A;  3F4R A;  4K7I A;  4H86 A;  4BPY A;  1WIK A;  4EKZ A;  1SKR B;  2CV4 A;  1XWA A;  2CVB A;  2B3S A;  4XTS A;  3VUR A;  4N30 A;  1N2A A;  2WUL A;  5JWR B;  1FB6 A;  1TW9 A;  3FY7 A;  3SWL A;  1A8L A;  4GST A;  2VL9 A;  4YH2 A;  4ULX A;  2HRN A;  3PGT A;  5GST A;  5A4U A;  3FR6 A;  4KW6 A;  3DRN A;  1ZYQ B;  1GRX A;  3PH9 A;  5CAX A;  1ZL9 A;  2IJY A;  3CTG A;  4GLT A;  2H6Y A;  4K1F A;  4DVC A;  1PQN A;  1RQM A;  5DAK B;  4HQZ A;  4TR1 A;  1XW6 A;  2WB9 A;  5JWO B;  5F0G A;  2IMD A;  4IW9 A;  3L4N A;  2HZE B;  4NXI A;  2K18 A;  1U6T A;  4BVY A;  3D0Z A;  5CRE A;  3GUR A;  4MAB A;  5HFI A;  4LL4 B;  2VL2 A;  5IO2 A;  5G1K A;  4BA7 A;  5G30 A;  3TB2 A;  2VLU A;  1DE2 A;  3IBH A;  1TP9 A;  3QAW A;  2CAQ A;  5JCG A;  4N0V A;  4KND A;  2GZZ A;  2PBJ A;  2I3Y A;  4TXO A;  5IMV A;  5ECP B;  2YV7 A;  4ZL9 A;  2VLT A;  2FWH A;  1SJI A;  1Z5Y E;  3CRT A;  2PVQ A;  2HLS A;  2O8V B;  1ML6 A;  2WGR A;  4ECB A;  3KEB A;  1RW1 A;  1A0F A;  2GQM A;  1X5C A;  5D93 A;  1K0D A;  4MJC A;  2VL2 C;  1TTZ A;  1DUG A;  3HZ8 A;  5AN1 A;  2YJH A;  1KBN A;  1F2E A;  2LRC A;  2H73 A;  4WBJ A;  3F6F A;  1FVK A;  1CQH A;  2PN8 A;  4WEY A;  1MD4 A;  2B7J A;  2DJK A;  4WF4 A;  3GH9 A;  2YOI A;  3FR3 A;  1PX6 A;  1QK8 A;  5CP1 A;  5HR2 A;  3ZLP A;  1JZW A;  3GX8 A;  1PMT A;  3G7Y A;  1U87 A;  2GS3 A;  2YN1 A;  5D8I A;  3HA9 A;  1R5A A;  1V57 A;  2PMT A;  3F63 A;  4K7O A;  4IHU A;  4ZB8 A;  1GSE A;  1K0O A;  2WS2 A;  2DC5 A;  1TI1 A;  1B8X A;  1SL0 B;  1CQG A;  2C8U A;  1VGL A;  2VD0 A;  2GQK A;  4MJB A;  5HFK A;  2TRC P;  1PL1 A;  4NHW A;  4X43 A;  3UIW A;  2KUC A;  4IQ1 A;  1QUW A;  2F8F A;  1DE1 A;  4TR3 A;  3UAP A;  1TU7 A;  3W6G A;  3LEF A;  5B6N A;  3ZRE A;  1EOG A;  3PIN A;  1B9X C;  2YWI A;  1M2B A;  2H74 A;  3GKK A;  3TUE A;  1U3I A;  3VPT A;  4OD7 A;  3LXT A;  4IKH A;  1JZO A;  1K3O A;  2H72 A;  1XW5 A;  3VI7 A;  3F0I A;  4YAV A;  2LST A;  4PUA A;  1I9D A;  4AF2 A;  2B5X A;  3QAV A;  4PGT A;  4XS6 A;  1BYE A;  5IQY A;  2BTO T;  3QFB C;  4BWQ A;  2P5Q A;  1K3Y A;  4PQH A;  3D22 A;  3ZIT A;  4MDC A;  3BD2 A;  4EL1 A;  2EIO A;  4O92 A;  3QCP A;  1PRX A;  3F8U A;  3O76 A;  5ECM B;  3GMF A;  4TRX A;  2IFQ A;  4DSR A;  3G7I A;  3VWU A;  6GSY A;  4RI7 A;  6GSW A;  2R3X A;  3FR9 A;  1GSD A;  2EIQ A;  2H01 A;  5G2Z A;  3CSI A;  6GSV A;  2YWM A;  5J9B A;  5ABR A;  2VCT A;  2X8G A;  1A2M A;  2KHP A;  2V41 A;  2NBS A;  1ERV A;  4WKW A;  5AGY A;  1SYX A;  5E59 A;  2GSS A;  1OC3 A;  5KN0 A;  3HYP A;  1GTI A;  4NV2 A;  2Z9S A;  4ZIL A;  5LCZ A;  3DML A;  4AGS A;  2H1G A;  1X0R A;  2R37 A;  5H5R A;  5HFG A;  1ABA A;  4KDY A;  2KP1 A;  4OFM A;  3IRA A;  2CT6 A;  1E2Y A;  1YKA A;  1WPI A;  3VFI A;  3QAG A;  2OKA A;  3ME8 A;  1GSY A;  1TK0 B;  3EU4 A;  3GKN A;  2FGX A;  4KCE A;  1ZGN A;  4MA9 A;  4DEJ A;  1QXH A;  4JR6 A;  4MCU A;  1V58 A;  1N8J A;  1EGO A;  3IPZ A;  2DJ0 A;  4PNF A;  4V1A p;  3UVH A;  1GNE A;  1FB0 A;  3I43 A;  4Z7X A;  4P3Y B;  2WRT A;  3UEM A;  1AC1 A;  3TKS A;  2CZ3 A;  5H5S A;  3GRX A;  3KZQ A;  5JCW A;  5DJL A;  2XBQ A;  2DML A;  1T4Y A;  5JCU A;  1K3L A;  2WZ9 A;  5EVO A;  3Q19 A;  1WE0 A;  4OMV A;  5CRW A;  3TJF A;  1UVZ A;  3C1S A;  4XS1 A;  2A2R A;  3CXG A;  16GS A;  1MDI A;  4JRR A;  4NMU A;  4EC0 A;  2R4V A;  1OC9 A;  2LNT A;  5HR0 A;  5IIZ A;  4J2F A;  2IMF A;  1JZR A;  1SK1 A;  3ZIV A;  4POL A;  3MAK A;  3TJK A;  2A2S A;  3F3R A;  1HNA A;  5ECL B;  2H0H A;  4IVF A;  1BX9 A;  3EU3 A;  1TRS A;  2HSH A;  5LNK e;  4O5R A;  1GSU A;  3IDV A;  4L5O A;  3TGZ A;  1Z7R A;  2VD1 A;  3IAS 2;  1Z9H A;  1R5P A;  2L57 A;  2M72 A;  3FZ4 A;  2DMM A;  1A0R P;  1ACV A;  1VF4 A;  2ON5 A;  2DJ1 A;  3GKX A;  4PUF C;  5IMA A;  3HXS A;  1EZK A;  10GS A;  3D21 A;  5A5K A;  5EPF A;  5G31 A;  2AUV A;  1Y6E A;  2N5F A;  4K6X A;  2QGV A;  2F8A A;  4MF5 A;  1O6J A;  4N11 A;  3EIN A;  3Q74 A;  2H1B A;  4MZB A;  2MMZ A;  5CYY A;  1S3D A;  3LYP A;  1O85 A;  3H93 A;  5HR3 A;  1OVN A;  2I9H A;  4POB A;  3GL5 A;  5CRG A;  5ELG A;  2KLX A;  1M9A A;  3ZZX A;  1WWJ A;  2DSA A;  1XOA A;  3C1R A;  3ME7 A;  5D9T A;  4KB3 A;  1RK4 A;  3GTU A;  5G5F A;  4Q5N A;  1NHY A;  3W8J A;  1BED A;  2YJ7 A;  4E8H A;  3G7J A;  1B4P A;  3APS A;  1VRS D;  5ECS A;  4XIH A;  3C71 A;  1KNG A;  3V1W A;  3Q18 A;  4IS0 A;  5IOW A;  1C72 A;  1QQ2 A;  3F6D A;  2P5R A;  2GT6 A;  4ECJ A;  11GS A;  2H1A A;  2L4Q A;  3GKM A;  3ZTL A;  1XWG A;  2JSZ A;  1Z3E A;  3QDN A;  2L6D A;  2WDU A;  8GSS A;  3FKF A;  3M9J A;  5IPG A;  4POM A;  2LJA A;  5J41 A;  6GSS A;  3TJG A;  1G6Y A;  1YY7 A;  4DSQ A;  2PGT A;  2XPD A;  2J23 A;  6GST A;  5IM9 A;  5FHI A;  1PL2 A;  2JZS A;  4X0X A;  1LBK A;  1KEB A;  3Q6O A;  4GSN A;  1SU9 A;  2XBI A;  3QOU A;  3KIJ A;  2H19 A;  4KUN A;  5A4W A;  2B7K A;  3TKP A;  3FW2 A;  3ZL5 A;  5EY6 A;  3IK9 A;  2FY6 A;  3L9U A;  4ML6 A;  3FRC A;  3H1N A;  5EL8 A;  4ISD A;  3EC3 A;  3EUR A;  6GSX A;  4HZ4 A;  4TOP A;  4GXZ A;  1M0U A;  4ZBD A;  1IYI A;  2H0G A;  1PA3 A;  4ZB6 A;  2LRT A;  4WET A;  3HZ4 A;  4PX1 A;  4TR1 B;  2A4V A;  3GUS A;  3GNJ A;  3KTB A;  3RBT A;  2YP6 A;  2O7K A;  1FW1 A;  1F37 A;  3KGK A;  2V6K A;  1OE8 A;  4IGJ A;  1X9M B;  4AJ8 A;  2K6V A;  1AQX A;  4CW9 A;  3P8W A;  2NTO A;  1K0A A;  2OBK A;  3KP9 A;  3HVX A;  4FYC A;  2N5A A;  5ECQ B;  3HJO A;  1GLQ A;  4TXO B;  2ZCT A;  1XVQ A;  3KP8 A;  1J0F A;  1T7P B;  2VCV A;  1GL8 A;  1GP1 A;  4GF0 A;  2H75 A;  2I1U A;  4JZQ A;  3CRU A;  1VF3 A;  3EYT A;  1T00 A;  4JU5 A;  2CVK A;  2E7P A;  3M8N A;  3TJJ A;  1Z6M A;  4DSS A;  5KN2 A;  4TN8 A;  1T4Z A;  5HR1 A;  3UOM A;  2ZNM A;  3HKR A;  3RHC A;  1AQW A;  4EUY A;  3DYR A;  5IMF A;  1TJD A;  2PWJ A;  1J08 A;  4HI7 A;  2H76 A;  2C0D A;  1VF2 A;  3C73 A;  4F9Z A;  2AV4 A;  3FK8 A;  2K9F A;  4OCE A;  3P7X A;  5GZZ B;  3N9J A;  1SJZ A;  2MMO A;  1K0B A;  3GL3 A;  2JZT A;  1R26 A;  2O87 A;  1M99 A;  3U6V A;  4JR4 A;  1NHO A;  2MBS A;  1GSS A;  1JLV A;  4OFN A;  2FLS A;  2XC2 A;  3D5J A;  1V98 A;  1SL2 B;  5B7C A;  3C7M A;  5IO0 A;  1GUM A;  3IC4 A;  4TR0 A;  2NVL A;  1OYJ A;  2FNO A;  1A23 A;  2C3N A;  1W89 A;  4HU9 A;  2DBC A;  3E0U A;  2RII A;  7GSS A;  3I9V 2;  5DVB A;  1YJ6 A;  5DQY A;  1TOF A;  5ECH B;  2V2G A;  2O85 A;  1Z6N A;  2X99 A;  1XIY A;  2RM6 A;  1VF1 A;  4N0Z A;  5AIV A;  1A8Y A;  3LXZ A;  3APQ A;  3GH6 A;  3N5O A;  3FYG A;  5DAL B;  1K0N A;  20GS A;  1UA5 A;  2MMA A;  4LL1 B;  1USB A;  4TKY A;  2VOC A;  2HNL A;  5J5N A;  1M9B A;  1V2A A;  3ED3 A;  3A5W A;  3S9F A;  2G0F A;  1SK2 A;  5DDL A;  4J56 E;  1M2A A;  2CX3 A;  4L8E A;  1OKD A;  4EDZ A;  3GA4 A;  3NIV A;  3NOF A;  3MWH A;  3HJM A;  3C8E A;  5DAL A;  1GUH A;  4KAE A;  3F4T A;  4FIW A;  4ZXG A;  1MDK A;  2RUF A;  1B48 A;  5G1L A;  4GRF A;  3VWW A;  5D9X A;  17GS A;  2IFQ B;  4POK A;  2C3T A;  1Z7P A;  1TU8 A;  6GSU A;  4F2I A;  1FHE A;  3DKS A;  4HOJ A;  1EEJ A;  1EOH A;  4OCF A;  2IMK A;  3QD9 A;  3WGE A;  1SD8 A;  5B8B A;  4V1A g;  5C00 A;  4MF6 A;  4E8E A;  2MBT A;  4YQV A;  4KSM A;  2PVO C;  3GFK A;  1FVJ A;  1TK8 B;  4IEL A;  3UL3 A;  1Q98 A;  1ST9 A;  2HZF A;  2RUE A;  3HCZ A;  4L0U A;  5ECO B;  3LOR A;  2YZU A;  3RPN A;  5AIX A;  4ZB9 A;  2JU5 A;  5CRH A;  3ERW A;  3KXO A;  1TXX A;  1ZMA A;  4MH3 A;  5F07 A;  2FD3 A;  2CAI A;  2BMX A;  2J9H A;  3RHB A;  4FH8 A;  3HD5 A;  4JE1 A;  3U5R E;  2C4J A;  5IMZ A;  4ECC A;  1NM3 A;  4IQA A;  1THO A;  3GSS A;  3OR5 A;  2KP2 A;  5C04 A;  4OWY A;  2DJJ A;  1GUL A;  1WRY A;  2C3Q A;  4F0C A;  1DBY A;  3PR8 A;  4QL7 A;  2QC7 A;  2HE3 A;  1GWC A;  2VAF A;  19GS A;  2VM1 A;  4BL7 A;  1EEM A;  2JAC A;  4I2T A;  1OC9 B;  3KH9 A;  1OE7 A;  4FYB A;  3FZ9 A;  3IOS A;  1I5G A;  2H70 A;  2P31 A;  1SL1 B;  4K0G A;  4KGI A;  2R5G A;  2GQL A;  5G5E A;  3M1G A;  13GS A;  1T8E B;  2ES7 A;  1YF1 A;  2HXK A;  3HY2 A;  4QL9 A;  3P90 A;  5JWQ B;  3TKS E;  4CDO A;  5DBQ A;  4OO4 A;  3HJP A;  5A4V A;  3F4S A;  3W8S A;  2RLI A;  4AJ6 A;  2DLX A;  2YWO A;  3O6T A;  4RI6 A;  4TR4 A;  1ERU A;  4GSS A;  2IMI A;  1XCC A;  4AJ7 A;  2OAC A;  2JZR A;  4K0N A;  3NZN A;  4WBR D;  2OJL A;  1A24 A;  3ZYW A;  4PNG A;  3DWV A;  3TDG A;  1HYU A;  1AUC A;  5IMD A;  2L59 A;  4XHM A;  3IV4 A;  3BJ5 A;  1G7E A;  3GHA A;  3DIE A;  5FWG A;  1SKW B;  2FHE A;  1UC7 A;  4IN0 A;  1R4W A;  2C0F A;  4K9Z A;  4KCA A;  2V6O A;  2YCD A;  1G0T A;  1X5E A;  3KCM A;  5D9V A;  22GS A;  2R6K A;  2H71 A;  1TRU A;  3R2Q A;  1J9B A;  3D4T A;  2IME A;  1PKW A;  4D73 B;  3FZ5 A;  4ML1 A;  1FOV A;  3CBU A;  1B4Q A;  1BQ7 A;  2B1K A;  1T1V A;  3GTU B;  4KDX A;  5ENU A;  4NAX A;  2PUK C;  5FT3 A;  2FWE A;  4D73 A;  2YAN A;  2XHF A;  4GQF A;  2CA8 A;  3TJB A;  3MDK A;  3LSZ A;  5J9C A;  3EE2 A;  3TKQ A;  2C1Y A;  1K0M A;  5CNW A;  3IXR A;  3L0H A;  4JED A;  2GGT A;  1XWC A;  3ZML A;  1O8X A;  2L5L A;  1YDK A;  2YPM A;  1XZO A;  2OBI A;  2HRF A;  3ERG A;  1M7T A;  2FA4 A;  2CZ2 A;  1GTU A;  5DJM A;  4BVX A;  3KM6 A;  2VIM A;  1TKD B;  4NHZ A;  3L9S A;  4XS4 B;  1EV4 A;  2WCI A;  4L5L A;  3G9B A;  2LS5 A;  4ZIJ A;  3IHQ A;  1JHB A;  4NPB A;  4MPF A;  4I97 A;  2PPT A;  2F3M A;  3VK9 A;  2AB6 A;  1HQO A;  4WF5 A;  3D4M A;  5KEJ A;  1T3B A;  3BOA A;  1XW9 A;  2GZP A;  4IJ3 A;  3L9V A;  3ZMK A;  1OAZ A;  4EE0 A;  1XWK A;  3E3E A;  3WYW A;  5LD0 A;  1PGT A;  2XPE A;  1UN2 A;  4LMW A;  3UBL A;  3LWA A;  2OE0 A;  4MMM A;  4XS4 A;  2GLR A;  2V32 A;  1TRW A;  3E9J B;  3IA1 A;  2HYX A;  1BG5 A;  2GT5 A;  1PN9 A;  1B9Y C;  2BJX A;  1PKZ A;  1O73 A;  4PQI A;  2VCZ A;  4KDU A;  5E4W A;  1MD3 A;  2LV3 A;  2H6Z A;  1XOB A;  4WXT A;  1V40 A;  3FZA A;  4MF7 A;  2H6X A;  3O3T A;  3TCO A;  2WJU A;  3ZVJ A;  1ILO A;  2M46 A;  1EP7 A;  4ECI A;  2HT9 A;  5B8A A;  1YEP A;  5IMC A;  2G2Q A;  3KTL A;  1THX A;  3IAM 2;  5ELA A;  1NSW A;  1SJ6 A;  1ERT A;  1JZD A;  18GS A;  1EWX A;  2H66 A;  3SBC A;  1MEK A;  4EVM A;  5HQP A;  2E0Q A;  1K0C A;  3TOT A;  2M80 A;  1EP8 A;  1PD2 1;  4CHS A;  4HUA A;  1HNC A;  4F0B A;  4ILF A;  3ZFL A;  2REM A;  1H4O A;  1GTA A;  2MZC A;  4RQR A;  4HU7 A;  3CSH A;  1AAZ A;  4HDE A;  2LRN A;  5F06 A;  1GLP A;  2ALB A;  3RDW A;  3F3Q A;  3EMP A;  4PXO A;  4DSS B;  4KH7 A;  3A3T A;  1QMV A;  2FWG A;  2YWN A;  5IOX A;  5B6M A;  4EO3 A;  2E2M A;  4MJA A;  3QMX A;  2VUP A;  14GS A;  1SEN A;  2H30 A;  3WGD A;  2F9S A;  2VM2 A;  5L71 A;  2QKE A;  2WFC A;  1IYH A;  2GDR A;  4OO5 A;  1XVW A;  5ID2 B;  1U3A A;  4TXV A;  1JFU A;  4HS1 A;  3WD6 A;  2X8H A;  3AY8 A;  1O7U A;  3KMO A;  1YEX A;  5DAK A;  1X5D A;  3BCI A;  2IWT A;  1HNB A;  4X1U A;  4ID0 A;  4FYU A;  4GCI A;  4YAP A;  5ID2 A;  4K2D A;  2HZE A;  1XXU A;  1QFN A;  1GSF A;  2TRX A;  2FUG 2;  1FO5 A;  1GSQ A;  4ACS A;  1XWB A;  4MH2 A;  2PU9 C;  3L78 A;  1AIU A;  1W4V A;  3CMI A;  2EIR A;  4HZ2 A;  2D2Z A;  3A2X A;  3DEX A;  1GNW A;  2CX4 A;  2OA7 A;  2LTK A;  2H8L A;  3GN3 A;  3VLN A;  3UAR A;  2VCX A;  4LMV A;  2O89 A;  1MDJ A;  4MZC A;  3WT2 A;  2HSY A;  4RUV A;  4IBP A;  2AJQ B;  1WMJ A;  3DVW A;  5DQS A;  3M3M A;  1URM A;  2QSI A;  1O8W A;  2GVP A;  1A2L A;  2LQQ A;  3HDC A;  5D73 A;  1S3A A;  2ZUP A;  1F3A A;  2K8V A;  5CRD A;  5IPH A;  3IR4 A;  2N5B A;  1X9W B;  3VI5 A;  3WGX A;  4KA0 A;  4RQX A;  4HEA 2;  2FCH A;  3HHV A;  1E6B A;  2JL4 A;  3TOU A;  2L5O A;  1YF0 A;  1YQ1 A;  2MYG A;  2YV9 A;  3P2A A;  5D96 A;  1O81 A;  2B6M A;  2FA8 A;  4XCS A;  2VCQ A;  1G7O A;  4PUR A;  2I4A A;  1JLW A;  1PX7 A;  2LJK A;  4HQS A;  1SD9 A;  2TIR A;  1XPV A;  2AAW A;  1U88 A;  4IP6 A;  3I6A A;  2VO4 A;  5AIS A;  3WT1 A;  4KE3 A;  4MPG A;  12GS A;  1V9W A;  3RAZ A;  3VWX A;  2GZY A;  2NDO A;  4IP1 A;  4KX4 A;  3HVV A;  3KD0 A;  3VPQ A;  3JCM L;  1X9S B;  2YNX A;  5ECN B;  1FAA A;  3H8Q A;  9GSS A;  2OE3 A;  2IPA A;  1XFL A;  3J7Y k;  4L0W A;  3M9K A;  4GWR A;  3TRP A;  1ZOF A;  3EVI A;  1XBS A;  5F8B A;  3IK7 A;  4G19 A;  1AW9 A;  2V1M A;  1TI3 A;  1A2J A;  2B5Y A;  3DD3 A;  1S3C A;  2DJ3 A;  3M0F A;  3KMN A;  4I8B A;  4WR5 A;  3GIX A;  3GST A;  4XRD A;  3DGQ A;  3ERF A;  4G2E A;  1GUK A;  4MP4 A;  2X8C A;  5COH A;  3DXB A;  4WR4 A;  1DSB A;  1BJX A;  3TRX A;  2KOK A;  3MNG A;  2OAD A;  3MSZ A;  5DCH A;  3QFA C;  1LJR A;  2DIY A;  3LGC A;  4J57 E;  4YQM A;  4ZL8 A;  5DCG A;  2ON7 A;  5ECR B;  1Y25 A;  4HJM A;  4O32 A;  4PQ1 A;  1GTB A;  1M2D A;  4IJI A;  3ZVJ D;  4EDY A;  3A2W A;  4Q5R A;  3RPP A;  3LYK A;  1OKT A;  2R2J A;  4K7N A;  3IE3 A;  4I6X A;  3CYN A;  2IL3 A;  1FG4 A;  3A2V A;  4QQ7 A;  3GX0 A;  2LKU A;  2YZH A;  3D6I A;  4HJ2 A;  1LU4 A;  4LLR A;  1SYR A;  1F3B A;  4F03 A;  1QGV A;  3HVS A;  1WP0 A;  4I5Q A;  2DJ2 A;  2NPB A;  3F9U A;  4Q5F A;  4O7H A;  5J3R A;  1TK5 B;  1AXD A;  3FEU A;  4JBB A;  2LJR A;  4I2U A;  3UMA A;  3KJY A;  5ECI B;  5F05 A;  2AYT A;  2OE1 A;  4K8M A;  1YKC A;  5J4U A;  2GST A;  2B5E A;  2LQO A;  2JAD A;  5INY A;  2C0G A;  1ON4 A;  3TKS C;  3CSJ A;  3ISO A;  1AQV A;  4OFT A;  3APO A;  1TDI A;  2LEG A;  3H79 A;  2GSQ A;  4LA1 A;  3KH7 A;  4Q5Q A;  4V2L A;  3LFL A;  2IIY A;  5GAP D;  2GTU A;  3UJ1 A;  4G10 A; 
#chains in the Genus database with same CATH topology
 4MLY A;  3EWL A;  5GAN D;  3US3 A;  4F82 A;  1WOU A;  1F9M A;  2E2G A;  1MTC A;  3QR6 A;  2R0G A;  4MK3 A;  5D9W A;  4ZBB A;  1PSQ A;  3TRQ A;  1H75 A;  4NV5 A;  1ERW A;  1ZYE A;  4MZW A;  3K8N A;  4NWY A;  1Q4J A;  2RM5 A;  2L6C A;  2EC4 A;  1KTE A;  2H1D A;  4GQC A;  3VWV A;  5KN3 A;  4V2M A;  3FHK A;  3H4K A;  2C0E A;  4ZBA A;  2K8S A;  1BAY A;  2DIZ A;  3GYK A;  2PER A;  3UBK A;  4ZL7 A;  2LUS A;  1F6M C;  1TRV A;  3BBY A;  3R3E A;  1WJK A;  2FWF A;  3MIX A;  3LJR A;  4N10 A;  1ZCP A;  3PPU A;  2C80 A;  1G6W A;  2VLV A;  3I69 A;  4V2N A;  4TW5 A;  5KN1 A;  3TKR A;  3BCK A;  5ECK B;  3UVT A;  3DVX A;  3CTF A;  1SKS B;  2HI7 A;  2VL3 A;  1SK0 A;  3EMX A;  2P0G A;  3QPM A;  2JSY A;  4MJE A;  4EXJ A;  4TVE A;  1GH2 A;  2X64 A;  1YZX A;  4KSO A;  2CVD A;  2AHE A;  2IN3 A;  4FO5 A;  1OC8 A;  3J7Y b;  2VCW A;  1EV9 A;  4GTU A;  4G9H A;  2HFD A;  1NW2 A;  1R7H A;  2I81 A;  3LW9 A;  3GV1 A;  2MMN A;  4XRA A;  4YQU A;  2F51 A;  1EGR A;  5GSS A;  3LG6 A;  2H0I A;  1HD2 A;  2B1L A;  1ZZY A;  3LQ7 A;  4BWS A;  5H5Q A;  2L4C A;  4EF0 A;  2GSR A;  3ZRD A;  3ZFB A;  2LNS A;  2CQ9 A;  5CO3 A;  3ZIJ A;  3F4R A;  4K7I A;  4H86 A;  4BPY A;  1WIK A;  4EKZ A;  1SKR B;  2CV4 A;  1XWA A;  2CVB A;  2B3S A;  4XTS A;  3VUR A;  4N30 A;  1N2A A;  2WUL A;  5JWR B;  1FB6 A;  1TW9 A;  3FY7 A;  3SWL A;  1A8L A;  4GST A;  2VL9 A;  4BIK A;  4YH2 A;  4ULX A;  2HRN A;  3PGT A;  1M3J A;  5GST A;  5A4U A;  3FR6 A;  4KW6 A;  3DRN A;  1ZYQ B;  1GRX A;  3PH9 A;  5CAX A;  1ZL9 A;  2HSM A;  2IJY A;  3CTG A;  4GLT A;  2A4H A;  2H6Y A;  4K1F A;  4DVC A;  1PQN A;  1RQM A;  5DAK B;  4HQZ A;  4TR1 A;  1XW6 A;  2WB9 A;  5JWO B;  5F0G A;  2IMD A;  4IW9 A;  3L4N A;  2HZE B;  4NXI A;  2K18 A;  1U6T A;  4BVY A;  3D0Z A;  5CRE A;  3GUR A;  4MAB A;  5HFI A;  4LL4 B;  2VL2 A;  5IO2 A;  5G1K A;  4BA7 A;  5G30 A;  3TB2 A;  2VLU A;  1DE2 A;  3IBH A;  1TP9 A;  3QAW A;  2CAQ A;  5JCG A;  4HSC X;  4N0V A;  4KND A;  2GZZ A;  2PBJ A;  2I3Y A;  4TXO A;  5IMV A;  5ECP B;  2YV7 A;  4ZL9 A;  2VLT A;  2FWH A;  1SJI A;  1Z5Y E;  3CRT A;  2PVQ A;  2HLS A;  2O8V B;  1ML6 A;  2WGR A;  4ECB A;  3KEB A;  1RW1 A;  1A0F A;  2GQM A;  1X5C A;  5D93 A;  1K0D A;  4MJC A;  2VL2 C;  1TTZ A;  1DUG A;  3HZ8 A;  5AN1 A;  2YJH A;  1KBN A;  1F2E A;  2LRC A;  2H73 A;  4WBJ A;  3F6F A;  1FVK A;  1CQH A;  2PN8 A;  4WEY A;  1MD4 A;  2B7J A;  2DJK A;  4WF4 A;  3GH9 A;  2YOI A;  3FR3 A;  1PX6 A;  1QK8 A;  5CP1 A;  5HR2 A;  3ZLP A;  1JZW A;  3GX8 A;  1PMT A;  3G7Y A;  1ZYP A;  1U87 A;  2GS3 A;  2YN1 A;  5D8I A;  3HA9 A;  1R5A A;  1V57 A;  2PMT A;  3F63 A;  4K7O A;  4IHU A;  4ZB8 A;  1GSE A;  1K0O A;  2WS2 A;  2DC5 A;  1TI1 A;  1B8X A;  1SL0 B;  1CQG A;  2C8U A;  1VGL A;  2VD0 A;  2GQK A;  4MJB A;  5HFK A;  3A5I A;  2TRC P;  1PL1 A;  4NHW A;  4X43 A;  3UIW A;  2KUC A;  4IQ1 A;  1QUW A;  2F8F A;  1DE1 A;  1ZYN A;  4TR3 A;  3UAP A;  1TU7 A;  3W6G A;  3LEF A;  5B6N A;  3ZRE A;  1EOG A;  3PIN A;  1B9X C;  2YWI A;  1M2B A;  2H74 A;  3GKK A;  3TUE A;  1U3I A;  3VPT A;  4OD7 A;  3LXT A;  4IKH A;  1JZO A;  1K3O A;  2H72 A;  1XW5 A;  3VI7 A;  3F0I A;  4YAV A;  2LST A;  4PUA A;  1I9D A;  4G0I A;  4AF2 A;  2B5X A;  3QAV A;  4PGT A;  4XS6 A;  1BYE A;  5IQY A;  2BTO T;  3QFB C;  4BWQ A;  2P5Q A;  1K3Y A;  4PQH A;  3D22 A;  3ZIT A;  4MDC A;  3BD2 A;  4EL1 A;  2EIO A;  4O92 A;  3QCP A;  1PRX A;  3F8U A;  3O76 A;  5ECM B;  3GMF A;  4TRX A;  2IFQ A;  4DSR A;  3G7I A;  3VWU A;  6GSY A;  4RI7 A;  6GSW A;  2R3X A;  3FR9 A;  1GSD A;  2EIQ A;  2H01 A;  5G2Z A;  3CSI A;  6GSV A;  2YWM A;  5J9B A;  5ABR A;  2VCT A;  2X8G A;  1A2M A;  2KHP A;  2V41 A;  2NBS A;  1ERV A;  4WKW A;  5AGY A;  1SYX A;  3HVN A;  5E59 A;  2GSS A;  1OC3 A;  5KN0 A;  3HYP A;  1GTI A;  4NV2 A;  2Z9S A;  4ZIL A;  5LCZ A;  3DML A;  4AGS A;  2H1G A;  1X0R A;  2R37 A;  5H5R A;  5HFG A;  1ABA A;  4KDY A;  2KP1 A;  4OFM A;  3IRA A;  2CT6 A;  1E2Y A;  1YKA A;  1WPI A;  3VFI A;  3QAG A;  2OKA A;  3ME8 A;  1GSY A;  1TK0 B;  3EU4 A;  3GKN A;  2FGX A;  4KCE A;  1ZGN A;  4MA9 A;  4DEJ A;  1QXH A;  4JR6 A;  4MCU A;  1V58 A;  1N8J A;  1EGO A;  3IPZ A;  2DJ0 A;  4PNF A;  4V1A p;  3UVH A;  1GNE A;  1FB0 A;  3I43 A;  4Z7X A;  4P3Y B;  2WRT A;  3UEM A;  1AC1 A;  3TKS A;  2CZ3 A;  5H5S A;  3GRX A;  3KZQ A;  5JCW A;  5DJL A;  2XBQ A;  2DML A;  1T4Y A;  5JCU A;  1K3L A;  2WZ9 A;  5EVO A;  3Q19 A;  1WE0 A;  4OMV A;  5CRW A;  3TJF A;  1UVZ A;  3C1S A;  4XS1 A;  2A2R A;  3CXG A;  16GS A;  1MDI A;  4JRR A;  4NMU A;  4EC0 A;  2R4V A;  1OC9 A;  2LNT A;  5HR0 A;  5IIZ A;  4J2F A;  2IMF A;  1JZR A;  1SK1 A;  3ZIV A;  4POL A;  3MAK A;  3TJK A;  3FMW A;  2A2S A;  3F3R A;  1HNA A;  5ECL B;  2H0H A;  1FOH A;  4IVF A;  1BX9 A;  3EU3 A;  1TRS A;  2HSH A;  5LNK e;  4O5R A;  1GSU A;  3IDV A;  4L5O A;  3TGZ A;  1Z7R A;  2VD1 A;  3EPT A;  3IAS 2;  1Z9H A;  1R5P A;  2L57 A;  2M72 A;  3FZ4 A;  2DMM A;  1A0R P;  1ACV A;  1VF4 A;  2ON5 A;  2DJ1 A;  3GKX A;  2QA2 A;  4PUF C;  5IMA A;  3HXS A;  1EZK A;  10GS A;  3D21 A;  5A5K A;  5EPF A;  2X49 A;  2AUV A;  5G31 A;  1Y6E A;  2N5F A;  4K6X A;  2QGV A;  2F8A A;  4MF5 A;  1O6J A;  4N11 A;  3EIN A;  3Q74 A;  4X4J A;  2H1B A;  4MZB A;  2MMZ A;  5CYY A;  1S3D A;  3LYP A;  1O85 A;  3H93 A;  5HR3 A;  1OVN A;  2I9H A;  4POB A;  3GL5 A;  5CRG A;  5ELG A;  2KLX A;  1M9A A;  3ZZX A;  1WWJ A;  2DSA A;  1XOA A;  3C1R A;  3ME7 A;  5D9T A;  1S3R A;  4KB3 A;  1RK4 A;  3GTU A;  5G5F A;  4Q5N A;  1NHY A;  3W8J A;  1BED A;  2YJ7 A;  4E8H A;  3G7J A;  1B4P A;  3APS A;  1VRS D;  5ECS A;  4XIH A;  3C71 A;  1KNG A;  3V1W A;  3Q18 A;  4IS0 A;  5IOW A;  1C72 A;  1QQ2 A;  4O5Q A;  3F6D A;  2P5R A;  2GT6 A;  4ECJ A;  11GS A;  2H1A A;  2L4Q A;  3GKM A;  3ZTL A;  1XWG A;  2JSZ A;  1Z3E A;  3QDN A;  2L6D A;  2WDU A;  8GSS A;  3FKF A;  3M9J A;  5IPG A;  4POM A;  2LJA A;  5J41 A;  6GSS A;  3TJG A;  1G6Y A;  1YY7 A;  4DSQ A;  2PGT A;  2XPD A;  2J23 A;  6GST A;  5IM9 A;  5FHI A;  1PL2 A;  2JZS A;  4X0X A;  1LBK A;  1KEB A;  3Q6O A;  4GSN A;  1SU9 A;  2XBI A;  3QOU A;  3KIJ A;  2H19 A;  4USS A;  4KUN A;  5A4W A;  2B7K A;  3TKP A;  3FW2 A;  3ZL5 A;  5EY6 A;  3IK9 A;  2FY6 A;  3L9U A;  4ML6 A;  3FRC A;  3H1N A;  5EL8 A;  4ISD A;  3EC3 A;  3EUR A;  6GSX A;  4HZ4 A;  4TOP A;  4GXZ A;  1M0U A;  4ZBD A;  1IYI A;  2H0G A;  1PA3 A;  5BRT A;  4ZB6 A;  2LRT A;  4WET A;  3HZ4 A;  4PX1 A;  4TR1 B;  2A4V A;  3GUS A;  3GNJ A;  3KTB A;  3RBT A;  2YP6 A;  2O7K A;  1FW1 A;  4BVY B;  1F37 A;  3KGK A;  2V6K A;  1OE8 A;  4IGJ A;  1X9M B;  4AJ8 A;  2K6V A;  1AQX A;  4CW9 A;  3P8W A;  2NTO A;  1K0A A;  2OBK A;  3KP9 A;  3HVX A;  4FYC A;  2N5A A;  5ECQ B;  3HJO A;  1GLQ A;  4TXO B;  2ZCT A;  2UZ8 A;  1XVQ A;  3KP8 A;  1J0F A;  1T7P B;  2VCV A;  1GL8 A;  1GP1 A;  4GF0 A;  2H75 A;  2I1U A;  4JZQ A;  3CRU A;  1VF3 A;  3EYT A;  1T00 A;  4JU5 A;  2CVK A;  2DKI A;  2E7P A;  3M8N A;  4YKG A;  3TJJ A;  1Z6M A;  4DSS A;  5KN2 A;  4TN8 A;  1T4Z A;  5HR1 A;  3UOM A;  2ZNM A;  3HKR A;  3RHC A;  1AQW A;  4EUY A;  3DYR A;  5IMF A;  1TJD A;  2PWJ A;  1J08 A;  4HI7 A;  2H76 A;  2C0D A;  1VF2 A;  3C73 A;  4F9Z A;  2AV4 A;  3FK8 A;  2K9F A;  4OCE A;  3P7X A;  5GZZ B;  3N9J A;  1SJZ A;  2MMO A;  1K0B A;  3GL3 A;  2JZT A;  1R26 A;  2HRA A;  2O87 A;  1M99 A;  3U6V A;  4JR4 A;  1NHO A;  2MBS A;  1GSS A;  1JLV A;  4OFN A;  2FLS A;  2XC2 A;  3D5J A;  1V98 A;  1SL2 B;  5B7C A;  3C7M A;  5IO0 A;  1GUM A;  3IC4 A;  4TR0 A;  2NVL A;  1OYJ A;  2FNO A;  1A23 A;  2C3N A;  1W89 A;  4HU9 A;  2DBC A;  3E0U A;  2RII A;  7GSS A;  3I9V 2;  5DVB A;  1YJ6 A;  5DQY A;  1TOF A;  5ECH B;  2V2G A;  2O85 A;  1Z6N A;  2X99 A;  1XIY A;  2RM6 A;  1VF1 A;  4N0Z A;  5AIV A;  1A8Y A;  3LXZ A;  3APQ A;  3GH6 A;  3N5O A;  3FYG A;  5DAL B;  1K0N A;  20GS A;  1UA5 A;  2MMA A;  4LL1 B;  1USB A;  4TKY A;  2VOC A;  2HNL A;  2DKH A;  5J5N A;  1M9B A;  1V2A A;  3ED3 A;  3A5W A;  3S9F A;  2G0F A;  1SK2 A;  5DDL A;  4J56 E;  1M2A A;  2CX3 A;  4L8E A;  1OKD A;  4EDZ A;  3GA4 A;  3NIV A;  3NOF A;  3MWH A;  4EIQ A;  3HJM A;  3C8E A;  5DAL A;  1GUH A;  4KAE A;  3F4T A;  4FIW A;  4ZXG A;  1MDK A;  4ICY A;  2RUF A;  1B48 A;  5G1L A;  4GRF A;  3VWW A;  5D9X A;  17GS A;  2IFQ B;  4POK A;  2C3T A;  1Z7P A;  1TU8 A;  6GSU A;  4F2I A;  4YKF A;  1FHE A;  3DKS A;  4HOJ A;  1EEJ A;  1EOH A;  4OCF A;  2IMK A;  3QD9 A;  3WGE A;  1SD8 A;  5B8B A;  4V1A g;  5C00 A;  4MF6 A;  4E8E A;  2MBT A;  4YQV A;  2R0P A;  4KSM A;  2PVO C;  3GFK A;  1FVJ A;  1TK8 B;  4IEL A;  3UL3 A;  1Q98 A;  1ST9 A;  2HZF A;  2RUE A;  3HCZ A;  4Z2U A;  4L0U A;  1PFO A;  5ECO B;  3LOR A;  2YZU A;  3RPN A;  5AIX A;  4ZB9 A;  2JU5 A;  5CRH A;  3ERW A;  3KXO A;  1TXX A;  1ZMA A;  4MH3 A;  5F07 A;  2FD3 A;  2CAI A;  2BMX A;  2J9H A;  3RHB A;  4FH8 A;  3HD5 A;  4JE1 A;  3U5R E;  2C4J A;  5IMZ A;  4ECC A;  1NM3 A;  4IQA A;  1THO A;  3GSS A;  3OR5 A;  2KP2 A;  5C04 A;  4OWY A;  2DJJ A;  1GUL A;  1WRY A;  2C3Q A;  4F0C A;  1DBY A;  3PR8 A;  4QL7 A;  2QC7 A;  2HE3 A;  1GWC A;  2VAF A;  19GS A;  2VM1 A;  4BL7 A;  1EEM A;  2A2P A;  2JAC A;  4I2T A;  1OC9 B;  3KH9 A;  1OE7 A;  4FYB A;  3IC8 A;  3FZ9 A;  3IOS A;  1I5G A;  2H70 A;  2P31 A;  1SL1 B;  4K0G A;  4KGI A;  2R5G A;  2GQL A;  5G5E A;  3M1G A;  13GS A;  1T8E B;  2ES7 A;  3IHG A;  1YF1 A;  2HXK A;  3HY2 A;  4QL9 A;  3P90 A;  5JWQ B;  3TKS E;  4CDO A;  5DBQ A;  4OO4 A;  3HJP A;  5A4V A;  3F4S A;  3W8S A;  2RLI A;  4AJ6 A;  2DLX A;  2YWO A;  3O6T A;  4RI6 A;  4TR4 A;  1ERU A;  4A5P A;  4GSS A;  2IMI A;  1XCC A;  4AJ7 A;  2OAC A;  2JZR A;  4K0N A;  3NZN A;  4WBR D;  2OJL A;  4PTS A;  1A24 A;  3ZYW A;  4PNG A;  3DWV A;  3TDG A;  1HYU A;  1AUC A;  5IMD A;  2L59 A;  4XHM A;  3IV4 A;  3BJ5 A;  1G7E A;  3GHA A;  3DIE A;  5FWG A;  1SKW B;  2FHE A;  1UC7 A;  4IN0 A;  1R4W A;  2C0F A;  4K9Z A;  4KCA A;  2V6O A;  2YCD A;  1G0T A;  1X5E A;  3KCM A;  5D9V A;  22GS A;  4EIP A;  2R6K A;  2H71 A;  1TRU A;  3R2Q A;  1J9B A;  3D4T A;  3CQF A;  2IME A;  1PKW A;  4D73 B;  3FZ5 A;  4ML1 A;  1FOV A;  3CBU A;  1B4Q A;  1BQ7 A;  2B1K A;  1T1V A;  3GTU B;  4KDX A;  5ENU A;  4NAX A;  2PUK C;  5FT3 A;  2FWE A;  4D73 A;  2YAN A;  2XHF A;  4GQF A;  2CA8 A;  4BVX B;  3TJB A;  3MDK A;  5KOX A;  3LSZ A;  5J9C A;  3EE2 A;  3TKQ A;  2C1Y A;  1K0M A;  5CNW A;  3IXR A;  3L0H A;  4JED A;  2GGT A;  1XWC A;  3ZML A;  1O8X A;  2L5L A;  1YDK A;  2YPM A;  1XZO A;  2OBI A;  2HRF A;  3ERG A;  1M7T A;  2FA4 A;  2CZ2 A;  1GTU A;  5DJM A;  4BVX A;  3KM6 A;  2HRK A;  2VIM A;  1TKD B;  4NHZ A;  4KF9 A;  3L9S A;  4XS4 B;  1EV4 A;  2WCI A;  4L5L A;  3G9B A;  2LS5 A;  4ZIJ A;  3IHQ A;  1JHB A;  4NPB A;  4MPF A;  4I97 A;  2PPT A;  2F3M A;  3VK9 A;  2AB6 A;  1HQO A;  4WF5 A;  3D4M A;  5KEJ A;  1T3B A;  3BOA A;  1XW9 A;  4G0L A;  2GZP A;  4IJ3 A;  3L9V A;  3ZMK A;  1PN0 A;  1OAZ A;  2X4A A;  4EE0 A;  1XWK A;  3E3E A;  3WYW A;  5LD0 A;  1PGT A;  2XPE A;  1UN2 A;  4LMW A;  3UBL A;  3LWA A;  2OE0 A;  4MMM A;  4XS4 A;  2GLR A;  2V32 A;  1TRW A;  3E9J B;  3IA1 A;  2HYX A;  1BG5 A;  2GT5 A;  1PN9 A;  1B9Y C;  2BJX A;  5KOW A;  1PKZ A;  1O73 A;  4PQI A;  2VCZ A;  4KDU A;  5E4W A;  1MD3 A;  2LV3 A;  2H6Z A;  1XOB A;  4WXT A;  1V40 A;  3FZA A;  4MF7 A;  2H6X A;  3O3T A;  3TCO A;  2WJU A;  3ZVJ A;  1ILO A;  2M46 A;  1EP7 A;  4ECI A;  2HT9 A;  5B8A A;  1YEP A;  5IMC A;  2G2Q A;  3KTL A;  1THX A;  3IAM 2;  5ELA A;  1M3I A;  1NSW A;  1SJ6 A;  1ERT A;  1JZD A;  18GS A;  1EWX A;  2H66 A;  3SBC A;  1MEK A;  4EVM A;  5HQP A;  2E0Q A;  1K0C A;  3TOT A;  2M80 A;  1EP8 A;  1PD2 1;  4CHS A;  4HUA A;  1HNC A;  4F0B A;  4ILF A;  3ZFL A;  2REM A;  1H4O A;  1GTA A;  2MZC A;  4RQR A;  4HU7 A;  3CSH A;  1AAZ A;  4HDE A;  2LRN A;  5F06 A;  1GLP A;  4CY6 A;  2ALB A;  3RDW A;  4CY8 A;  3F3Q A;  3EMP A;  4PXO A;  4DSS B;  4KH7 A;  3A3T A;  1QMV A;  2FWG A;  2YWN A;  5IOX A;  5B6M A;  4EO3 A;  2E2M A;  4MJA A;  3QMX A;  2VUP A;  14GS A;  1SEN A;  2H30 A;  3WGD A;  2F9S A;  2VM2 A;  5L71 A;  2QKE A;  2WFC A;  1IYH A;  2GDR A;  4OO5 A;  1XVW A;  5ID2 B;  1U3A A;  4TXV A;  1JFU A;  4HS1 A;  3WD6 A;  2X8H A;  3MYD A;  3AY8 A;  1O7U A;  3KMO A;  1YEX A;  5DAK A;  1X5D A;  3BCI A;  2IWT A;  1HNB A;  4X1U A;  4ID0 A;  4FYU A;  4GCI A;  4YAP A;  5ID2 A;  4K2D A;  2HZE A;  1XXU A;  1QFN A;  1GSF A;  2TRX A;  2FUG 2;  1FO5 A;  1GSQ A;  4ACS A;  4MNN A;  1XWB A;  4MH2 A;  2PU9 C;  3L78 A;  1AIU A;  1W4V A;  3CMI A;  2EIR A;  4HZ2 A;  2D2Z A;  3A2X A;  3DEX A;  1GNW A;  2CX4 A;  2OA7 A;  2LTK A;  2H8L A;  3GN3 A;  3VLN A;  3UAR A;  2VCX A;  4LMV A;  2O89 A;  1MDJ A;  4MZC A;  3WT2 A;  2HSY A;  4RUV A;  4IBP A;  2AJQ B;  1WMJ A;  3DVW A;  5DQS A;  3M3M A;  1URM A;  2QSI A;  1O8W A;  2GVP A;  1A2L A;  2LQQ A;  3HDC A;  5D73 A;  1S3A A;  4Z2T A;  2ZUP A;  1F3A A;  2K8V A;  5CRD A;  5IPH A;  3IR4 A;  4K5S A;  2N5B A;  1X9W B;  3VI5 A;  3WGX A;  4KA0 A;  4RQX A;  4HEA 2;  2FCH A;  3HHV A;  1E6B A;  4FQU A;  2JL4 A;  3TOU A;  2L5O A;  1YF0 A;  1YQ1 A;  2MYG A;  2YV9 A;  3P2A A;  5D96 A;  1O81 A;  2B6M A;  2FA8 A;  4XCS A;  2VCQ A;  1G7O A;  4PUR A;  2I4A A;  1JLW A;  1PX7 A;  2LJK A;  4HQS A;  1SD9 A;  2TIR A;  1XPV A;  2AAW A;  1U88 A;  4IP6 A;  3I6A A;  2VO4 A;  5AIS A;  3WT1 A;  4KE3 A;  4MPG A;  12GS A;  1V9W A;  3RAZ A;  3VWX A;  2GZY A;  2NDO A;  4IP1 A;  4KX4 A;  3HVV A;  3KD0 A;  3VPQ A;  3JCM L;  1X9S B;  2YNX A;  5ECN B;  5BMU A;  1FAA A;  1XG8 A;  3H8Q A;  9GSS A;  2OE3 A;  2IPA A;  1XFL A;  3J7Y k;  4L0W A;  3M9K A;  4GWR A;  3TRP A;  1ZOF A;  3EVI A;  1XBS A;  5F8B A;  3IK7 A;  4G19 A;  1AW9 A;  2V1M A;  1TI3 A;  1A2J A;  2B5Y A;  3DD3 A;  1S3C A;  2DJ3 A;  3M0F A;  3KMN A;  4I8B A;  4WR5 A;  3GIX A;  3GST A;  4XRD A;  3DGQ A;  3ERF A;  4K2X A;  4G2E A;  1GUK A;  4MP4 A;  2X8C A;  5COH A;  3DXB A;  4BL7 B;  4WR4 A;  1DSB A;  1BJX A;  3TRX A;  2KOK A;  2R0C A;  3MNG A;  2OAD A;  3MSZ A;  3QFA C;  1LJR A;  2DIY A;  3LGC A;  4J57 E;  4YQM A;  5DCH A;  4ZL8 A;  5DCG A;  2ON7 A;  5ECR B;  1Y25 A;  4HJM A;  4O32 A;  4PQ1 A;  1GTB A;  2QA1 A;  4O5U A;  1M2D A;  4IJI A;  3ZVJ D;  4EDY A;  3A2W A;  4Q5R A;  3RPP A;  3LYK A;  1OKT A;  2R2J A;  4K7N A;  3IE3 A;  4I6X A;  3CYN A;  2IL3 A;  1FG4 A;  3A2V A;  4QQ7 A;  3GX0 A;  2LKU A;  2YZH A;  3D6I A;  4HJ2 A;  1LU4 A;  4LLR A;  1SYR A;  1F3B A;  4F03 A;  1QGV A;  3HVS A;  1WP0 A;  4I5Q A;  2DJ2 A;  2NPB A;  3F9U A;  4Q5F A;  4O7H A;  5J3R A;  4Z2R A;  1TK5 B;  1AXD A;  3FEU A;  4JBB A;  4K5R A;  2LJR A;  4I2U A;  3UMA A;  3KJY A;  5ECI B;  5F05 A;  2AYT A;  2OE1 A;  4K8M A;  1YKC A;  5J4U A;  2GST A;  2B5E A;  4G0K A;  2LQO A;  2JAD A;  5INY A;  2C0G A;  1ON4 A;  3TKS C;  3CSJ A;  3ISO A;  1AQV A;  4OFT A;  3APO A;  1TDI A;  2LEG A;  3H79 A;  2GSQ A;  4LA1 A;  3KH7 A;  4Q5Q A;  4V2L A;  3LFL A;  2IIY A;  5GAP D;  2GTU A;  3UJ1 A;  4G10 A; 
#chains in the Genus database with same CATH homology
 4MLY A;  3EWL A;  5GAN D;  3US3 A;  4F82 A;  1WOU A;  1F9M A;  2E2G A;  1MTC A;  3QR6 A;  2R0G A;  4MK3 A;  5D9W A;  4ZBB A;  1PSQ A;  3TRQ A;  1H75 A;  4NV5 A;  1ERW A;  1ZYE A;  4MZW A;  3K8N A;  4NWY A;  1Q4J A;  2RM5 A;  2L6C A;  2EC4 A;  1KTE A;  2H1D A;  4GQC A;  3VWV A;  5KN3 A;  4V2M A;  3FHK A;  3H4K A;  2C0E A;  4ZBA A;  2K8S A;  1BAY A;  2DIZ A;  3GYK A;  2PER A;  3UBK A;  4ZL7 A;  2LUS A;  1F6M C;  1TRV A;  3BBY A;  3R3E A;  1WJK A;  2FWF A;  3MIX A;  3LJR A;  4N10 A;  1ZCP A;  3PPU A;  2C80 A;  1G6W A;  2VLV A;  3I69 A;  4V2N A;  4TW5 A;  5KN1 A;  3TKR A;  3BCK A;  5ECK B;  3UVT A;  3DVX A;  3CTF A;  1SKS B;  2HI7 A;  2VL3 A;  1SK0 A;  3EMX A;  2P0G A;  3QPM A;  2JSY A;  4MJE A;  4EXJ A;  4TVE A;  1GH2 A;  2X64 A;  1YZX A;  4KSO A;  2CVD A;  2AHE A;  2IN3 A;  4FO5 A;  1OC8 A;  3J7Y b;  2VCW A;  1EV9 A;  4GTU A;  4G9H A;  2HFD A;  1NW2 A;  1R7H A;  2I81 A;  3LW9 A;  3GV1 A;  2MMN A;  4XRA A;  4YQU A;  2F51 A;  1EGR A;  5GSS A;  3LG6 A;  2H0I A;  1HD2 A;  2B1L A;  1ZZY A;  3LQ7 A;  4BWS A;  5H5Q A;  2L4C A;  4EF0 A;  2GSR A;  3ZRD A;  3ZFB A;  2LNS A;  2CQ9 A;  5CO3 A;  3ZIJ A;  3F4R A;  4K7I A;  4H86 A;  4BPY A;  1WIK A;  4EKZ A;  1SKR B;  2CV4 A;  1XWA A;  2CVB A;  2B3S A;  4XTS A;  3VUR A;  4N30 A;  1N2A A;  2WUL A;  5JWR B;  1FB6 A;  1TW9 A;  3FY7 A;  3SWL A;  1A8L A;  4GST A;  2VL9 A;  4YH2 A;  4ULX A;  2HRN A;  3PGT A;  5GST A;  5A4U A;  3FR6 A;  4KW6 A;  3DRN A;  1ZYQ B;  1GRX A;  3PH9 A;  5CAX A;  1ZL9 A;  2HSM A;  2IJY A;  3CTG A;  4GLT A;  2A4H A;  2H6Y A;  4K1F A;  4DVC A;  1PQN A;  1RQM A;  5DAK B;  4HQZ A;  4TR1 A;  1XW6 A;  2WB9 A;  5JWO B;  5F0G A;  2IMD A;  4IW9 A;  3L4N A;  2HZE B;  4NXI A;  2K18 A;  1U6T A;  4BVY A;  3D0Z A;  5CRE A;  3GUR A;  4MAB A;  5HFI A;  4LL4 B;  2VL2 A;  5IO2 A;  5G1K A;  4BA7 A;  5G30 A;  3TB2 A;  2VLU A;  1DE2 A;  3IBH A;  1TP9 A;  3QAW A;  2CAQ A;  5JCG A;  4N0V A;  4KND A;  2GZZ A;  2PBJ A;  2I3Y A;  4TXO A;  5IMV A;  5ECP B;  2YV7 A;  4ZL9 A;  2VLT A;  2FWH A;  1SJI A;  1Z5Y E;  3CRT A;  2PVQ A;  2HLS A;  2O8V B;  1ML6 A;  2WGR A;  4ECB A;  3KEB A;  1RW1 A;  1A0F A;  2GQM A;  1X5C A;  5D93 A;  1K0D A;  4MJC A;  2VL2 C;  1TTZ A;  1DUG A;  3HZ8 A;  5AN1 A;  2YJH A;  1KBN A;  1F2E A;  2LRC A;  2H73 A;  4WBJ A;  3F6F A;  1FVK A;  1CQH A;  2PN8 A;  4WEY A;  1MD4 A;  2B7J A;  2DJK A;  4WF4 A;  3GH9 A;  2YOI A;  3FR3 A;  1PX6 A;  1QK8 A;  5CP1 A;  5HR2 A;  3ZLP A;  1JZW A;  3GX8 A;  1PMT A;  3G7Y A;  1ZYP A;  1U87 A;  2GS3 A;  2YN1 A;  5D8I A;  3HA9 A;  1R5A A;  1V57 A;  2PMT A;  3F63 A;  4K7O A;  4IHU A;  4ZB8 A;  1GSE A;  1K0O A;  2WS2 A;  2DC5 A;  1TI1 A;  1B8X A;  1SL0 B;  1CQG A;  2C8U A;  1VGL A;  2VD0 A;  2GQK A;  4MJB A;  5HFK A;  3A5I A;  2TRC P;  1PL1 A;  4NHW A;  4X43 A;  3UIW A;  2KUC A;  4IQ1 A;  1QUW A;  2F8F A;  1DE1 A;  1ZYN A;  4TR3 A;  3UAP A;  1TU7 A;  3W6G A;  3LEF A;  5B6N A;  3ZRE A;  1EOG A;  3PIN A;  1B9X C;  2YWI A;  1M2B A;  2H74 A;  3GKK A;  3TUE A;  1U3I A;  3VPT A;  4OD7 A;  3LXT A;  4IKH A;  1JZO A;  1K3O A;  2H72 A;  1XW5 A;  3VI7 A;  3F0I A;  4YAV A;  2LST A;  4PUA A;  1I9D A;  4G0I A;  4AF2 A;  2B5X A;  3QAV A;  4PGT A;  4XS6 A;  1BYE A;  5IQY A;  2BTO T;  3QFB C;  4BWQ A;  2P5Q A;  1K3Y A;  4PQH A;  3D22 A;  3ZIT A;  4MDC A;  3BD2 A;  4EL1 A;  2EIO A;  4O92 A;  3QCP A;  1PRX A;  3F8U A;  3O76 A;  5ECM B;  3GMF A;  4TRX A;  2IFQ A;  4DSR A;  3G7I A;  3VWU A;  6GSY A;  4RI7 A;  6GSW A;  2R3X A;  3FR9 A;  1GSD A;  2EIQ A;  2H01 A;  5G2Z A;  3CSI A;  6GSV A;  2YWM A;  5J9B A;  5ABR A;  2VCT A;  2X8G A;  1A2M A;  2KHP A;  2V41 A;  2NBS A;  1ERV A;  4WKW A;  5AGY A;  1SYX A;  5E59 A;  2GSS A;  1OC3 A;  5KN0 A;  3HYP A;  1GTI A;  4NV2 A;  2Z9S A;  4ZIL A;  5LCZ A;  3DML A;  4AGS A;  2H1G A;  1X0R A;  2R37 A;  5H5R A;  5HFG A;  1ABA A;  4KDY A;  2KP1 A;  4OFM A;  3IRA A;  2CT6 A;  1E2Y A;  1YKA A;  1WPI A;  3VFI A;  3QAG A;  2OKA A;  3ME8 A;  1GSY A;  1TK0 B;  3EU4 A;  3GKN A;  2FGX A;  4KCE A;  1ZGN A;  4MA9 A;  4DEJ A;  1QXH A;  4JR6 A;  4MCU A;  1V58 A;  1N8J A;  1EGO A;  3IPZ A;  2DJ0 A;  4PNF A;  4V1A p;  3UVH A;  1GNE A;  1FB0 A;  3I43 A;  4Z7X A;  4P3Y B;  2WRT A;  3UEM A;  1AC1 A;  3TKS A;  2CZ3 A;  5H5S A;  3GRX A;  3KZQ A;  5JCW A;  5DJL A;  2XBQ A;  2DML A;  1T4Y A;  5JCU A;  1K3L A;  2WZ9 A;  5EVO A;  3Q19 A;  1WE0 A;  4OMV A;  5CRW A;  3TJF A;  1UVZ A;  3C1S A;  4XS1 A;  2A2R A;  3CXG A;  16GS A;  1MDI A;  4JRR A;  4NMU A;  4EC0 A;  2R4V A;  1OC9 A;  2LNT A;  5HR0 A;  5IIZ A;  4J2F A;  2IMF A;  1JZR A;  1SK1 A;  3ZIV A;  4POL A;  3MAK A;  3TJK A;  3FMW A;  2A2S A;  3F3R A;  1HNA A;  5ECL B;  2H0H A;  1FOH A;  4IVF A;  1BX9 A;  3EU3 A;  1TRS A;  2HSH A;  5LNK e;  4O5R A;  1GSU A;  3IDV A;  4L5O A;  3TGZ A;  1Z7R A;  2VD1 A;  3EPT A;  3IAS 2;  1Z9H A;  1R5P A;  2L57 A;  2M72 A;  3FZ4 A;  2DMM A;  1A0R P;  1ACV A;  1VF4 A;  2ON5 A;  2DJ1 A;  3GKX A;  2QA2 A;  4PUF C;  5IMA A;  3HXS A;  1EZK A;  10GS A;  3D21 A;  5A5K A;  5EPF A;  2X49 A;  2AUV A;  5G31 A;  1Y6E A;  2N5F A;  4K6X A;  2QGV A;  2F8A A;  4MF5 A;  1O6J A;  4N11 A;  3EIN A;  3Q74 A;  4X4J A;  2H1B A;  4MZB A;  2MMZ A;  5CYY A;  1S3D A;  3LYP A;  1O85 A;  3H93 A;  5HR3 A;  1OVN A;  2I9H A;  4POB A;  3GL5 A;  5CRG A;  5ELG A;  2KLX A;  1M9A A;  3ZZX A;  1WWJ A;  2DSA A;  1XOA A;  3C1R A;  3ME7 A;  5D9T A;  4KB3 A;  1RK4 A;  3GTU A;  5G5F A;  4Q5N A;  1NHY A;  3W8J A;  1BED A;  2YJ7 A;  4E8H A;  3G7J A;  1B4P A;  3APS A;  1VRS D;  5ECS A;  4XIH A;  3C71 A;  1KNG A;  3V1W A;  3Q18 A;  4IS0 A;  5IOW A;  1C72 A;  1QQ2 A;  4O5Q A;  3F6D A;  2P5R A;  2GT6 A;  4ECJ A;  11GS A;  2H1A A;  2L4Q A;  3GKM A;  3ZTL A;  1XWG A;  2JSZ A;  1Z3E A;  3QDN A;  2L6D A;  2WDU A;  8GSS A;  3FKF A;  3M9J A;  5IPG A;  4POM A;  2LJA A;  5J41 A;  6GSS A;  3TJG A;  1G6Y A;  1YY7 A;  4DSQ A;  2PGT A;  2XPD A;  2J23 A;  6GST A;  5IM9 A;  5FHI A;  1PL2 A;  2JZS A;  4X0X A;  1LBK A;  1KEB A;  3Q6O A;  4GSN A;  1SU9 A;  2XBI A;  3QOU A;  3KIJ A;  2H19 A;  4USS A;  4KUN A;  5A4W A;  2B7K A;  3TKP A;  3FW2 A;  3ZL5 A;  5EY6 A;  3IK9 A;  2FY6 A;  3L9U A;  4ML6 A;  3FRC A;  3H1N A;  5EL8 A;  4ISD A;  3EC3 A;  3EUR A;  6GSX A;  4HZ4 A;  4TOP A;  4GXZ A;  1M0U A;  4ZBD A;  1IYI A;  2H0G A;  1PA3 A;  5BRT A;  4ZB6 A;  2LRT A;  4WET A;  3HZ4 A;  4PX1 A;  4TR1 B;  2A4V A;  3GUS A;  3GNJ A;  3KTB A;  3RBT A;  2YP6 A;  2O7K A;  1FW1 A;  4BVY B;  1F37 A;  3KGK A;  2V6K A;  1OE8 A;  4IGJ A;  1X9M B;  4AJ8 A;  2K6V A;  1AQX A;  4CW9 A;  3P8W A;  2NTO A;  1K0A A;  2OBK A;  3KP9 A;  3HVX A;  4FYC A;  2N5A A;  5ECQ B;  3HJO A;  1GLQ A;  4TXO B;  2ZCT A;  2UZ8 A;  1XVQ A;  3KP8 A;  1J0F A;  1T7P B;  2VCV A;  1GL8 A;  1GP1 A;  4GF0 A;  2H75 A;  2I1U A;  4JZQ A;  3CRU A;  1VF3 A;  3EYT A;  1T00 A;  4JU5 A;  2CVK A;  2DKI A;  2E7P A;  3M8N A;  4YKG A;  3TJJ A;  1Z6M A;  4DSS A;  5KN2 A;  4TN8 A;  1T4Z A;  5HR1 A;  3UOM A;  2ZNM A;  3HKR A;  3RHC A;  1AQW A;  4EUY A;  3DYR A;  5IMF A;  1TJD A;  2PWJ A;  1J08 A;  4HI7 A;  2H76 A;  2C0D A;  1VF2 A;  3C73 A;  4F9Z A;  2AV4 A;  3FK8 A;  2K9F A;  4OCE A;  3P7X A;  5GZZ B;  3N9J A;  1SJZ A;  2MMO A;  1K0B A;  3GL3 A;  2JZT A;  1R26 A;  2HRA A;  2O87 A;  1M99 A;  3U6V A;  4JR4 A;  1NHO A;  2MBS A;  1GSS A;  1JLV A;  4OFN A;  2FLS A;  2XC2 A;  3D5J A;  1V98 A;  1SL2 B;  5B7C A;  3C7M A;  5IO0 A;  1GUM A;  3IC4 A;  4TR0 A;  2NVL A;  1OYJ A;  2FNO A;  1A23 A;  2C3N A;  1W89 A;  4HU9 A;  2DBC A;  3E0U A;  2RII A;  7GSS A;  3I9V 2;  5DVB A;  1YJ6 A;  5DQY A;  1TOF A;  5ECH B;  2V2G A;  2O85 A;  1Z6N A;  2X99 A;  1XIY A;  2RM6 A;  1VF1 A;  4N0Z A;  5AIV A;  1A8Y A;  3LXZ A;  3APQ A;  3GH6 A;  3N5O A;  3FYG A;  5DAL B;  1K0N A;  20GS A;  1UA5 A;  2MMA A;  4LL1 B;  1USB A;  4TKY A;  2VOC A;  2HNL A;  2DKH A;  5J5N A;  1M9B A;  1V2A A;  3ED3 A;  3A5W A;  3S9F A;  2G0F A;  1SK2 A;  5DDL A;  4J56 E;  1M2A A;  2CX3 A;  4L8E A;  1OKD A;  4EDZ A;  3GA4 A;  3NIV A;  3NOF A;  3MWH A;  4EIQ A;  3HJM A;  3C8E A;  5DAL A;  1GUH A;  4KAE A;  3F4T A;  4FIW A;  4ZXG A;  1MDK A;  4ICY A;  2RUF A;  1B48 A;  5G1L A;  4GRF A;  3VWW A;  5D9X A;  17GS A;  2IFQ B;  4POK A;  2C3T A;  1Z7P A;  1TU8 A;  6GSU A;  4F2I A;  4YKF A;  1FHE A;  3DKS A;  4HOJ A;  1EEJ A;  1EOH A;  4OCF A;  2IMK A;  3QD9 A;  3WGE A;  1SD8 A;  5B8B A;  4V1A g;  5C00 A;  4MF6 A;  4E8E A;  2MBT A;  4YQV A;  2R0P A;  4KSM A;  2PVO C;  3GFK A;  1FVJ A;  1TK8 B;  4IEL A;  3UL3 A;  1Q98 A;  1ST9 A;  2HZF A;  2RUE A;  3HCZ A;  4Z2U A;  4L0U A;  5ECO B;  3LOR A;  2YZU A;  3RPN A;  5AIX A;  4ZB9 A;  2JU5 A;  5CRH A;  3ERW A;  3KXO A;  1TXX A;  1ZMA A;  4MH3 A;  5F07 A;  2FD3 A;  2CAI A;  2BMX A;  2J9H A;  3RHB A;  4FH8 A;  3HD5 A;  4JE1 A;  3U5R E;  2C4J A;  5IMZ A;  4ECC A;  1NM3 A;  4IQA A;  1THO A;  3GSS A;  3OR5 A;  2KP2 A;  5C04 A;  4OWY A;  2DJJ A;  1GUL A;  1WRY A;  2C3Q A;  4F0C A;  1DBY A;  3PR8 A;  4QL7 A;  2QC7 A;  2HE3 A;  1GWC A;  2VAF A;  19GS A;  2VM1 A;  4BL7 A;  1EEM A;  2A2P A;  2JAC A;  4I2T A;  1OC9 B;  3KH9 A;  1OE7 A;  4FYB A;  3IC8 A;  3FZ9 A;  3IOS A;  1I5G A;  2H70 A;  2P31 A;  1SL1 B;  4K0G A;  4KGI A;  2R5G A;  2GQL A;  5G5E A;  3M1G A;  13GS A;  1T8E B;  2ES7 A;  3IHG A;  1YF1 A;  2HXK A;  3HY2 A;  4QL9 A;  3P90 A;  5JWQ B;  3TKS E;  4CDO A;  5DBQ A;  4OO4 A;  3HJP A;  5A4V A;  3F4S A;  3W8S A;  2RLI A;  4AJ6 A;  2DLX A;  2YWO A;  3O6T A;  4RI6 A;  4TR4 A;  1ERU A;  4A5P A;  4GSS A;  2IMI A;  1XCC A;  4AJ7 A;  2OAC A;  2JZR A;  4K0N A;  3NZN A;  4WBR D;  2OJL A;  4PTS A;  1A24 A;  3ZYW A;  4PNG A;  3DWV A;  3TDG A;  1HYU A;  1AUC A;  5IMD A;  2L59 A;  4XHM A;  3IV4 A;  3BJ5 A;  1G7E A;  3GHA A;  3DIE A;  5FWG A;  1SKW B;  2FHE A;  1UC7 A;  4IN0 A;  1R4W A;  2C0F A;  4K9Z A;  4KCA A;  2V6O A;  2YCD A;  1G0T A;  1X5E A;  3KCM A;  5D9V A;  22GS A;  4EIP A;  2R6K A;  2H71 A;  1TRU A;  3R2Q A;  1J9B A;  3D4T A;  2IME A;  1PKW A;  4D73 B;  3FZ5 A;  4ML1 A;  1FOV A;  3CBU A;  1B4Q A;  1BQ7 A;  2B1K A;  1T1V A;  3GTU B;  4KDX A;  5ENU A;  4NAX A;  2PUK C;  5FT3 A;  2FWE A;  4D73 A;  2YAN A;  2XHF A;  4GQF A;  2CA8 A;  4BVX B;  3TJB A;  3MDK A;  5KOX A;  3LSZ A;  5J9C A;  3EE2 A;  3TKQ A;  2C1Y A;  1K0M A;  5CNW A;  3IXR A;  3L0H A;  4JED A;  2GGT A;  1XWC A;  3ZML A;  1O8X A;  2L5L A;  1YDK A;  2YPM A;  1XZO A;  2OBI A;  2HRF A;  3ERG A;  1M7T A;  2FA4 A;  2CZ2 A;  1GTU A;  5DJM A;  4BVX A;  3KM6 A;  2HRK A;  2VIM A;  1TKD B;  4NHZ A;  4KF9 A;  3L9S A;  4XS4 B;  1EV4 A;  2WCI A;  4L5L A;  3G9B A;  2LS5 A;  4ZIJ A;  3IHQ A;  1JHB A;  4NPB A;  4MPF A;  4I97 A;  2PPT A;  2F3M A;  3VK9 A;  2AB6 A;  1HQO A;  4WF5 A;  3D4M A;  5KEJ A;  1T3B A;  3BOA A;  1XW9 A;  4G0L A;  2GZP A;  4IJ3 A;  3L9V A;  3ZMK A;  1PN0 A;  1OAZ A;  2X4A A;  4EE0 A;  1XWK A;  3E3E A;  3WYW A;  5LD0 A;  1PGT A;  2XPE A;  1UN2 A;  4LMW A;  3UBL A;  3LWA A;  2OE0 A;  4MMM A;  4XS4 A;  2GLR A;  2V32 A;  1TRW A;  3E9J B;  3IA1 A;  2HYX A;  1BG5 A;  2GT5 A;  1PN9 A;  1B9Y C;  2BJX A;  5KOW A;  1PKZ A;  1O73 A;  4PQI A;  2VCZ A;  4KDU A;  5E4W A;  1MD3 A;  2LV3 A;  2H6Z A;  1XOB A;  4WXT A;  1V40 A;  3FZA A;  4MF7 A;  2H6X A;  3O3T A;  3TCO A;  2WJU A;  3ZVJ A;  1ILO A;  2M46 A;  1EP7 A;  4ECI A;  2HT9 A;  5B8A A;  1YEP A;  5IMC A;  2G2Q A;  3KTL A;  1THX A;  3IAM 2;  5ELA A;  1NSW A;  1SJ6 A;  1ERT A;  1JZD A;  18GS A;  1EWX A;  2H66 A;  3SBC A;  1MEK A;  4EVM A;  5HQP A;  2E0Q A;  1K0C A;  3TOT A;  2M80 A;  1EP8 A;  1PD2 1;  4CHS A;  4HUA A;  1HNC A;  4F0B A;  4ILF A;  3ZFL A;  2REM A;  1H4O A;  1GTA A;  2MZC A;  4RQR A;  4HU7 A;  3CSH A;  1AAZ A;  4HDE A;  2LRN A;  5F06 A;  1GLP A;  4CY6 A;  2ALB A;  3RDW A;  4CY8 A;  3F3Q A;  3EMP A;  4PXO A;  4DSS B;  4KH7 A;  3A3T A;  1QMV A;  2FWG A;  2YWN A;  5IOX A;  5B6M A;  4EO3 A;  2E2M A;  4MJA A;  3QMX A;  2VUP A;  14GS A;  1SEN A;  2H30 A;  3WGD A;  2F9S A;  2VM2 A;  5L71 A;  2QKE A;  2WFC A;  1IYH A;  2GDR A;  4OO5 A;  1XVW A;  5ID2 B;  1U3A A;  4TXV A;  1JFU A;  4HS1 A;  3WD6 A;  2X8H A;  3MYD A;  3AY8 A;  1O7U A;  3KMO A;  1YEX A;  5DAK A;  1X5D A;  3BCI A;  2IWT A;  1HNB A;  4X1U A;  4ID0 A;  4FYU A;  4GCI A;  4YAP A;  5ID2 A;  4K2D A;  2HZE A;  1XXU A;  1QFN A;  1GSF A;  2TRX A;  2FUG 2;  1FO5 A;  1GSQ A;  4ACS A;  4MNN A;  1XWB A;  4MH2 A;  2PU9 C;  3L78 A;  1AIU A;  1W4V A;  3CMI A;  2EIR A;  4HZ2 A;  2D2Z A;  3A2X A;  3DEX A;  1GNW A;  2CX4 A;  2OA7 A;  2LTK A;  2H8L A;  3GN3 A;  3VLN A;  3UAR A;  2VCX A;  4LMV A;  2O89 A;  1MDJ A;  4MZC A;  3WT2 A;  2HSY A;  4RUV A;  4IBP A;  2AJQ B;  1WMJ A;  3DVW A;  5DQS A;  3M3M A;  1URM A;  2QSI A;  1O8W A;  2GVP A;  1A2L A;  2LQQ A;  3HDC A;  5D73 A;  1S3A A;  4Z2T A;  2ZUP A;  1F3A A;  2K8V A;  5CRD A;  5IPH A;  3IR4 A;  4K5S A;  2N5B A;  1X9W B;  3VI5 A;  3WGX A;  4KA0 A;  4RQX A;  4HEA 2;  2FCH A;  3HHV A;  1E6B A;  4FQU A;  2JL4 A;  3TOU A;  2L5O A;  1YF0 A;  1YQ1 A;  2MYG A;  2YV9 A;  3P2A A;  5D96 A;  1O81 A;  2B6M A;  2FA8 A;  4XCS A;  2VCQ A;  1G7O A;  4PUR A;  2I4A A;  1JLW A;  1PX7 A;  2LJK A;  4HQS A;  1SD9 A;  2TIR A;  1XPV A;  2AAW A;  1U88 A;  4IP6 A;  3I6A A;  2VO4 A;  5AIS A;  3WT1 A;  4KE3 A;  4MPG A;  12GS A;  1V9W A;  3RAZ A;  3VWX A;  2GZY A;  2NDO A;  4IP1 A;  4KX4 A;  3HVV A;  3KD0 A;  3VPQ A;  3JCM L;  1X9S B;  2YNX A;  5ECN B;  5BMU A;  1FAA A;  3H8Q A;  9GSS A;  2OE3 A;  2IPA A;  1XFL A;  3J7Y k;  4L0W A;  3M9K A;  4GWR A;  3TRP A;  1ZOF A;  3EVI A;  1XBS A;  5F8B A;  3IK7 A;  4G19 A;  1AW9 A;  2V1M A;  1TI3 A;  1A2J A;  2B5Y A;  3DD3 A;  1S3C A;  2DJ3 A;  3M0F A;  3KMN A;  4I8B A;  4WR5 A;  3GIX A;  3GST A;  4XRD A;  3DGQ A;  3ERF A;  4K2X A;  4G2E A;  1GUK A;  4MP4 A;  2X8C A;  5COH A;  3DXB A;  4BL7 B;  4WR4 A;  1DSB A;  1BJX A;  3TRX A;  2KOK A;  2R0C A;  3MNG A;  2OAD A;  3MSZ A;  3QFA C;  1LJR A;  2DIY A;  3LGC A;  4J57 E;  4YQM A;  5DCH A;  4ZL8 A;  5DCG A;  2ON7 A;  5ECR B;  1Y25 A;  4HJM A;  4O32 A;  4PQ1 A;  1GTB A;  2QA1 A;  4O5U A;  1M2D A;  4IJI A;  3ZVJ D;  4EDY A;  3A2W A;  4Q5R A;  3RPP A;  3LYK A;  1OKT A;  2R2J A;  4K7N A;  3IE3 A;  4I6X A;  3CYN A;  2IL3 A;  1FG4 A;  3A2V A;  4QQ7 A;  3GX0 A;  2LKU A;  2YZH A;  3D6I A;  4HJ2 A;  1LU4 A;  4LLR A;  1SYR A;  1F3B A;  4F03 A;  1QGV A;  3HVS A;  1WP0 A;  4I5Q A;  2DJ2 A;  2NPB A;  3F9U A;  4Q5F A;  4O7H A;  5J3R A;  4Z2R A;  1TK5 B;  1AXD A;  3FEU A;  4JBB A;  4K5R A;  2LJR A;  4I2U A;  3UMA A;  3KJY A;  5ECI B;  5F05 A;  2AYT A;  2OE1 A;  4K8M A;  1YKC A;  5J4U A;  2GST A;  2B5E A;  4G0K A;  2LQO A;  2JAD A;  5INY A;  2C0G A;  1ON4 A;  3TKS C;  3CSJ A;  3ISO A;  1AQV A;  4OFT A;  3APO A;  1TDI A;  2LEG A;  3H79 A;  2GSQ A;  4LA1 A;  3KH7 A;  4Q5Q A;  4V2L A;  3LFL A;  2IIY A;  5GAP D;  2GTU A;  3UJ1 A;  4G10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...