2YJHA

Thiol peroxidase from yersinia psuedotuberculosis, inactive mutant c61s
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
165
structure length
165
Chain Sequence
TMTQTVHFQGNPVSVAGKLPQIGDKAKDFTLVAKDLSDVALSSFAGKRKVLNIFPSIDTGVSAASVRKFNQLAGELENTVVLCISSDLPFAQSRFCGAEGLSNVITLSTLRGADFKQAYGVAITEGPLAGLTARAVVVLDGQDNVIYSELVNEITTEPNYDAALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOL PEROXIDASE
publication title Structural Characterisation of Tpx from Yersinia Pseudotuberculosis Reveals Insights Into the Binding of Salicylidene Acylhydrazide Compounds.
pubmed doi rcsb
source organism Yersinia pseudotuberculosis
molecule tags Oxidoreductase
total genus 43
structure length 165
sequence length 165
ec nomenclature ec 1.11.1.-:
pdb deposition date 2011-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2yjhA00
4J57E 1SENA 1NHYA 2C3TA 1JZWA 3KP8A 1K3YA 5AN1A 1YF1A 4JZQA 1USBA 4MF6A 4X43A 4OFMA 4L5LA 3GH9A 3I69A 1UVZA 3CBUA 4KB3A 1K0MA 1V57A 4HI7A 1ERTA 4PNFA 5JWRB 2YZHA 3TJGA 5J9CA 2LJAA 1F6MC 1XVWA 4IGJA 4MLYA 3ZITA 2YWMA 1OC3A 2R2JA 5B6NA 2GDRA 3NZNA 5AIXA 5F07A 3TKRA 14GSA 2ZNMA 3M1GA 4I2UA 2GZZA 2B1LA 2YCDA 3G9BA 1V98A 3F6FA 1NW2A 4ZBBA 8GSSA 3AY8A 3TKSC 3IAM2 3RPNA 3A2WA 4KH7A 3SBCA 1YKAA 3RHCA 2EIOA 5ECHB 2A4VA 1B4PA 1WOUA 2DJ0A 2RIIA 1HNAA 2VL2C 4GSNA 1TRSA 1Z7RA 1HNBA 3GURA 1B4QA 4RI7A 1BEDA 1XW5A 3HJOA 3HDCA 4BVXA 2H1DA 4ML6A 2HFDA 4KA0A 5HR3A 2WB9A 4K9ZA 1TRWA 3DRNA 2C3QA 1EWXA 1JZOA 2BTOT 3KTBA 2V32A 5ID2B 1EGRA 4PURA 4AJ8A 1FVJA 2WZ9A 3J7Yb 1EV9A 3I6AA 4WF4A 1Q4JA 2VD1A 3JCML 4TXOA 3C1SA 5J9BA 1TTZA 3G7YA 1F9MA 1GUHA 4K2DA 2X99A 4IQ1A 4NMUA 3FZ5A 3UMAA 2ES7A 4ID0A 3GRXA 5CRHA 4GQFA 4V2LA 3D5JA 3F4RA 5ECLB 2PN8A 3FR3A 4F9ZA 4ECIA 3UL3A 1GUKA 4JBBA 19GSA 4K8MA 4LL4B 4XS6A 3MAKA 3ME8A 1UN2A 3CSHA 3L4NA 1GSQA 3ZVJD 3KEBA 2DBCA 1NHOA 4MDCA 1XOAA 2VOCA 4MZWA 1SU9A 1SL2B 4G9HA 2V41A 2MMZA 1WE0A 2LNSA 3ZVJA 3C8EA 4EF0A 1XFLA 1G6YA 2DIZA 2VLTA 3N5OA 1G6WA 5J41A 4EKZA 2CX3A 2VAFA 2CX4A 3CSIA 4EDYA 3QD9A 2ZUPA 2RM5A 5CO3A 18GSA 3RDWA 1PL2A 4I2TA 2LEGA 4HQZA 4TOPA 3FZ4A 3E0UA 1R4WA 16GSA 2FHEA 4AJ7A 1QQ2A 1A2JA 4ECCA 2KLXA 7GSSA 5D93A 2DSAA 3LWAA 1SJZA 3HKRA 2MBSA 4E8HA 2PPTA 4RI6A 1B48A 2C8UA 1XW9A 4GRFA 1XIYA 1KEBA 5CYYA 2GT6A 1TK0B 5AIVA 3KCMA 2B7KA 1OVNA 1AQWA 2H6XA 4N11A 2PUKC 2FWEA 1EOHA 2FCHA 3D4TA 2C80A 1TP9A 1JZRA 1NSWA 2VCVA 3CYNA 3GTUB 1B9XC 1PMTA 3TOTA 2VCZA 3L9SA 2F8AA 4POKA 3ZRDA 3W8JA 3FRCA 4KNDA 4JU5A 1E2YA 1GLPA 1WWJA 3MSZA 3A2XA 1M9BA 4V1Ag 4PNGA 2LRNA 3HA9A 2PWJA 2L5LA 6GSSA 3SWLA 4XS4A 1AQXA 1F3AA 3DIEA 1K0NA 4CW9A 4DSQA 2M46A 2HT9A 2PVOC 2VCWA 3IDVA 3VLNA 5DJLA 3MNGA 4JEDA 3KP9A 5ECSA 1W4VA 3UBKA 1EEJA 2YV7A 4I6XA 4JR6A 3KM6A 5IM9A 3RAZA 2FGXA 3DXBA 5L71A 4WEYA 4WBJA 3ERWA 5J4UA 4D73A 4YQVA 4N0VA 1TJDA 4DSRA 1FAAA 3D0ZA 4DSSB 3FKFA 3O6TA 3GA4A 3L0HA 4I97A 1T8EB 2IFQA 3UOMA 3C73A 3GKNA 3C7MA 3HVSA 4J56E 1J08A 3UARA 6GSYA 3M8NA 2WDUA 1GULA 3DVXA 2GZYA 3Q18A 2GZPA 3DD3A 2AB6A 2CVBA 1AC1A 2I1UA 3VI5A 1MD4A 1HNCA 1FW1A 4OO4A 1TKDB 3HVXA 4GF0A 1PD21 2LS5A 4F2IA 2VO4A 1M0UA 1SKRB 3GH6A 1WPIA 5JCWA 2VD0A 5IMVA 1BG5A 2FA8A 5ECIB 3EU3A 3ZFLA 20GSA 1T00A 3LGCA 5INYA 1H4OA 5CRGA 4GCIA 2WGRA 4YQMA 3QAVA 3O3TA 4FYBA 3WT2A 1C72A 2R6KA 4MPGA 4TR1A 4G19A 2O87A 1ZGNA 4OO5A 2JADA 4O7HA 2ALBA 3KD0A 2TRCP 1VF1A 3H8QA 3N9JA 3A5WA 5G31A 2O89A 5ECPB 1SYXA 1TK8B 4NAXA 5KN3A 3FR9A 4NHZA 3EMPA 3WD6A 2XHFA 4HJ2A 5GAPD 3IAS2 1HYUA 3P2AA 1XWGA 2XPDA 4MJCA 2VL3A 4HJMA 2F9SA 5DVBA 3WT1A 2B6MA 3M9KA 5AGYA 4N10A 2E7PA 1A0RP 4HDEA 2VLUA 3HZ8A 4F0CA 2PBJA 1U3AA 2H6ZA 2YPMA 2C0GA 2QSIA 2C0EA 1OC9A 2P31A 1O7UA 3L9VA 4FIWA 4QQ7A 4NHWA 4LL1B 2JZTA 1ERVA 1GTIA 2GVPA 4XIHA 5G1LA 4P3YB 3RBTA 4TR4A 1Y6EA 3IR4A 3W6GA 1DE2A 5AISA 1F3BA 1A8LA 2H70A 1DUGA 1A2MA 3CTGA 1Q98A 3GKMA 5ELGA 2P5RA 2E2MA 2MMOA 4EVMA 1IYHA 4ULXA 4IJIA 1N8JA 2JL4A 3QR6A 2H1GA 1SK0A 2IMKA 1SKSB 3QCPA 5IMDA 5A4VA 3TKSE 5IOXA 1Z6MA 4FYUA 3ZMLA 3F8UA 2NVLA 3BCKA 2YV9A 1QXHA 1URMA 2FY6A 3Q74A 1ZMAA 3IBHA 4AGSA 3IHQA 2H1AA 4QL7A 2VUPA 1THXA 4GSSA 5LD0A 3FZAA 2OACA 2IMIA 3F3QA 2L57A 1X5CA 4MP4A 4TR0A 5IO2A 6GSXA 2M80A 5HR1A 4ZXGA 2HZEB 4F03A 3HD5A 1M99A 2FUG2 4HS1A 2FWHA 3CXGA 3P7XA 2HI7A 3DMLA 3GKXA 4G10A 3VWUA 3D6IA 4LA1A 5FHIA 4AF2A 4BWQA 4MZCA 3ZREA 3M0FA 3VI7A 2C3NA 2DJ1A 2H01A 2H1BA 2MMNA 2O8VB 4GTUA 4HQSA 5F05A 5ECNB 2HZFA 3F3RA 1A0FA 1IYIA 3BOAA 3UEMA 1YQ1A 1LJRA 3FZ9A 1ZL9A 4CHSA 4NXIA 4PUAA 4JE1A 1XBSA 1GNWA 5C00A 4FYCA 2DJ2A 4MJBA 5H5SA 3GMFA 5IOWA 3KIJA 2IMDA 1A8YA 4I8BA 1PQNA 1PN9A 3ME7A 3VWWA 4NWYA 4POMA 5DBQA 2PERA 2GQLA 1GLQA 1X0RA 4IELA 1F2EA 1O8WA 2RM6A 2FWFA 3BJ5A 2QGVA 3E9JB 3C1RA 1MDIA 3LEFA 1T4YA 2MMAA 1V58A 3EURA 3QPMA 2L6DA 1JLWA 6GSWA 5KN0A 3QFBC 2LJKA 1SL0B 3TKSA 1GTAA 4KSMA 1VF3A 4MCUA 1K0DA 2CVKA 5DAKB 2H76A 2P5QA 1M9AA 1SD8A 3QDNA 4X0XA 3EVIA 2VL2A 3CTFA 2QC7A 2KHPA 1ZZYA 5ELAA 3HZ4A 2DMLA 2NBSA 2CZ3A 3RPPA 2C4JA 1O6JA 2VM1A 4L8EA 4PXOA 1VGLA 1W89A 5COHA 1N2AA 2FA4A 2CQ9A 2E2GA 3DEXA 2GSSA 2CZ2A 3IV4A 4ZBDA 2B3SA 4TN8A 1XVQA 2H30A 5EVOA 3KH9A 3IXRA 1U3IA 3HY2A 4AJ6A 2AV4A 4KSOA 5D9WA 1CQHA 4XRDA 5IPGA 3HJPA 2DJJA 2H66A 3LG6A 3TRXA 3QOUA 2XBQA 2CA8A 3VPTA 4Q5QA 2EC4A 4O5RA 4EUYA 5G2ZA 5JWQB 5ECMB 2LQQA 3IK7A 4K1FA 3F6DA 3A3TA 4TW5A 4J2FA 5A5KA 4KGIA 3G7JA 4RUVA 1XWCA 4GLTA 5DJMA 2K18A 1M2DA 5DALA 4V2MA 5G5EA 2QKEA 1CQGA 1QMVA 4OMVA 4WXTA 3WGEA 1AIUA 3GN3A 3HYPA 2C1YA 1WJKA 3H79A 4JRRA 4TXOB 1GSYA 4GQCA 4XCSA 1U88A 1AAZA 3GSSA 3KMOA 3I43A 4EE0A 4HZ4A 3UBLA 5CRDA 3H4KA 3TJBA 2V2GA 2HRFA 5D8IA 2FWGA 1WMJA 4Q5FA 3ZLPA 4WR5A 4RQXA 2F51A 2IL3A 3IK9A 3VK9A 2WS2A 2V6OA 2K9FA 5B7CA 1JHBA 3TDGA 1R7HA 4NPBA 4ISDA 2IPAA 5KEJA 2PMTA 3GL3A 2L4CA 2HNLA 2OE3A 2Z9SA 4L5OA 3UIWA 4H86A 3U6VA 1YKCA 3ZIVA 1GH2A 4K7IA 4V1Ap 3EWLA 1TW9A 1GSEA 3TUEA 2REMA 5F8BA 1MEKA 4WBRD 3NIVA 3TRQA 2VCQA 2DMMA 6GSTA 5EY6A 2G2QA 1EGOA 4KDUA 3HXSA 5LCZA 3K8NA 2YP6A 4OWYA 4FO5A 1G0TA 2JSZA 4GXZA 1GSFA 5DDLA 3APOA 3F4SA 4V2NA 11GSA 1Y25A 3HVVA 1EEMA 2F3MA 4X1UA 4ZB6A 5FT3A 4IP1A 1PRXA 3EU4A 1WRYA 5G1KA 3TJKA 1OKDA 2NDOA 3KJYA 1O85A 3GX8A 5ECQB 4E8EA 3UAPA 1UC7A 2DIYA 2JZSA 5G30A 1EOGA 3LYPA 1AW9A 3LXZA 5DCGA 3CSJA 5HR0A 2B1KA 3VWXA 1UA5A 4ECJA 1SKWB 2FLSA 3QMXA 5CNWA 3ERFA 1FO5A 4PUFC 2KUCA 3KGKA 2L4QA 1TRVA 1G7OA 2O7KA 3BD2A 3GFKA 22GSA 2CAQA 1XZOA 3KTLA 4K7NA 3ZMKA 4XRAA 5GSSA 1I5GA 5D73A 1BJXA 2GGTA 2YWIA 3PGTA 3TGZA 10GSA 1GNEA 2MZCA 1GWCA 1YEPA 5E59A 1PGTA 5ECKB 2AUVA 2YWNA 2N5FA 4TR3A 1TXXA 1HQOA 2GSTA 2R4VA 3LJRA 1U6TA 4WR4A 4O32A 1Z9HA 2B7JA 3A2VA 5CRWA 2C0DA 2VIMA 4LMVA 2FD3A 1XWAA 2I4AA 2EIRA 3ED3A 4D73B 2R3XA 5ABRA 1YDKA 4LMWA 1EP7A 4EDZA 1R26A 3L9UA 1JZDA 2IFQB 4F0BA 4POBA 2BJXA 2H75A 4BPYA 1QK8A 1XCCA 2XC2A 3FEUA 3APSA 1GSSA 2YANA 1I9DA 1M2BA 2O85A 6GSUA 1AXDA 2LJRA 2L5OA 5FWGA 3FW2A 4Z7XA 5ECRB 2CT6A 2K8SA 1X5DA 1MDKA 4ZB8A 4GSTA 2VLVA 3LYKA 1BX9A 1M2AA 3F0IA 3MWHA 2H6YA 1GRXA 3W8SA 1GP1A 1OKTA 4O92A 2R5GA 4ZILA 4ZB9A 2CVDA 3KXOA 1TOFA 4NV2A 4TR1B 4YH2A 4WF5A 3TKQA 1MD3A 2OKAA 1R5AA 1PX7A 3Q6OA 1YY7A 2N5AA 3D4MA 3TB2A 4Q5NA 1ST9A 3TCOA 2JU5A 4KE3A 2LQOA 1LBKA 4XS1A 4QL9A 2HSYA 2X8CA 1PA3A 5DQSA 1OAZA 1WP0A 1SJ6A 4DVCA 3E3EA 3CMIA 4MMMA 1S3AA 1TDIA 5ID2A 2RUEA 2LNTA 1X9SB 4KUNA 2P0GA 4G2EA 2ON7A 3KH7A 1K0OA 3IRAA 3GHAA 1ILOA 1U87A 3WYWA 1ZOFA 1TI3A 3V1WA 1OC9B 1JLVA 4MPFA 5GAND 1BQ7A 1K3OA 3ZIJA 1QUWA 4IKHA 2MYGA 4KDYA 3VPQA 2K8VA 2B5EA 2J23A 1RW1A 1A23A 3GUSA 3OR5A 2HYXA 2GLRA 3EMXA 1Z5YE 4YAPA 3M3MA 4MH3A 2GS3A 3ZYWA 3J7Yk 1S3CA 5HFIA 1O8XA 1JFUA 2GSQA 2OA7A 2G0FA 2GSRA 2X64A 1YF0A 5F06A 1BYEA 4EL1A 2RUFA 3GYKA 3TJJA 1E6BA 3U5RE 1YJ6A 2XBIA 1PL1A 1XWKA 3PH9A 2JACA 2HLSA 3F9UA 5HR2A 2H0GA 5C04A 5B8AA 1Z6NA 1GSUA 2L59A 2VL9A 2OBIA 2DC5A 2LRCA 1ZYEA 1WIKA 1ZCPA 5EL8A 1A24A 2LV3A 2GQMA 3EE2A 1PX6A 2DJKA 2CAIA 5D9XA 1XPVA 1X5EA 1Z3EA 3LSZA 4N30A 5D9TA 1GTBA 1PSQA 3NOFA 2HXKA 3KMNA 5A4WA 5GSTA 3GL5A 3FK8A 4OFTA 4TXVA 5IMCA 3CRTA 3TOUA 2WRTA 2JSYA 3GIXA 4FH8A 3ZTLA 2LSTA 4PGTA 4PX1A 3GTUA 1TK5B 2V6KA 3DYRA 2I3YA 3US3A 5IMFA 4WETA 4HZ2A 5JCUA 1EZKA 1MDJA 1K0AA 4YAVA 3GX0A 1SK1A 4KW6A 5IMZA 2YJ7A 3ERGA 4TRXA 1YEXA 4K0NA 1O81A 2GQKA 1ERUA 5IO0A 5J5NA 2KP2A 3FHKA 3C71A 4MJEA 3IC4A 1ML6A 2H8LA 1K3LA 2CV4A 1RK4A 5ECOB 5GZZB 2DLXA 3H1NA 3Q19A 1M7TA 5F0GA 4OCFA 2OJLA 2IMEA 3ISOA 3FR6A 13GSA 2HRNA 3IE3A 4KAEA 4ML1A 5KN1A 1DBYA 2WULA 1X9WB 4L0UA 5HFGA 3UVTA 2H19A 1ABAA 4MABA 1OC8A 5JWOB 1QGVA 2H0HA 1Z7PA 2J9HA 2KOKA 3H93A 5HFKA 3WGDA 4BL7A 1GSDA 3GSTA 2TIRA 1TU7A 2YNXA 5H5RA 4K0GA 4DSSA 4BA7A 2ZCTA 3IOSA 5G5FA 2H71A 2TRXA 2IIYA 3G7IA 2VCXA 4OCEA 3UVHA 2FNOA 4HU7A 1SJIA 2M72A 3DVWA 3CRUA 5CP1A 3L78A 1V9WA 3IA1A 3LFLA 3VURA 4MZBA 3TRPA 2V1MA 4WKWA 1FB0A 4JR4A 4PQ1A 1H75A 4HUAA 4MH2A 4TKYA 4CDOA 3GNJA 2D2ZA 2WFCA 1SK2A 2XPEA 4OD7A 4ZL7A 3M9JA 2X8HA 1GL8A 4YQUA 4IVFA 2YWOA 2VCTA 2YN1A 1LU4A 3LXTA 1MTCA 1T4ZA 2PGTA 4IN0A 4ECBA 3QAGA 1VF2A 1R5PA 1B9YC 1GTUA 4DEJA 1NM3A 4EC0A 1VF4A 1B8XA 1FVKA 4IP6A 3APQA 2H73A 5E4WA 1T3BA 4BVYA 4HU9A 2A2RA 2A2SA 4ZIJA 3TKPA 1TI1A 3EINA 2OE0A 4NV5A 1RQMA 4MJAA 1K0CA 2H72A 2I81A 3BCIA 5DALB 1SL1B 2GTUA 4IW9A 2RLIA 4ZL8A 2OBKA 5H5QA 1K0BA 3HCZA 2F8FA 4ZL9A 3PR8A 2YOIA 5B8BA 2ON5A 3DGQA 3P8WA 2H74A 1T7PB 1TU8A 4IHUA 4BWSA 1V40A 4XTSA 4MF5A 1FHEA 1YZXA 1ACVA 3UJ1A 3EYTA 1SD9A 2AYTA 17GSA 2NPBA 1PKWA 5IIZA 5JCGA 3WGXA 3TJFA 3MDKA 1XW6A 5CREA 2YJHA 1X9MB 1S3DA 1EP8A 1GUMA 2IN3A 2H0IA 3D21A 4POLA 4MF7A 2IWTA 4Q5RA 3S9FA 3IPZA 4PQIA 2MBTA 2GT5A 3HHVA 4XS4B 2VM2A 2JZRA 1J0FA 3LORA 1AQVA 5B6MA 5D9VA 1KBNA 2IJYA 3EC3A 1FOVA 12GSA 2OADA 2HE3A 4EO3A 4MK3A 1ON4A 1QFNA 4KCEA 4KCAA 2PU9C 1J9BA 2LKUA 2DJ3A 2LUSA 2R37A 3PINA 4HEA2 3O76A 1DE1A 2AAWA 1FG4A 2C0FA 1FB6A 1ZYQB 2PVQA 1XXUA 5IMAA 2WJUA 4F82A 4K6XA 3ZZXA 4MA9A 1EV4A 1DSBA 4EXJA 3F63A 3GKKA 1OYJA 2HZEA 4HOJA 4L0WA 2B5XA 2K6VA 4ACSA 5CAXA 1OE8A 5EPFA 5DQYA 3LQ7A 3VFIA 6GSVA 2AHEA 2X8GA 1ERWA 5IPHA 3QFAC 2L6CA 3KZQA 3D22A 2E0QA 3VWVA 5D96A 9GSSA 1THOA 4KDXA 1G7EA 1T1VA 4I5QA 2YZUA 1BAYA 1XOBA 3QAWA 1XWBA 3R2QA 5DCHA 5LNKe 4OFNA 2EIQA 1TRUA 4RQRA 2B5YA 4XHMA 3I9V2 1AUCA 3DKSA 3GV1A 4IQAA 5A4UA 3BBYA 1KTEA 3F4TA 4N0ZA 2IMFA 3ZFBA 4GWRA 3RHBA 2BMXA 2WCIA 3FYGA 4ILFA 5IQYA 2AJQB 5J3RA 4PQHA 4IBPA 4K7OA 2OE1A 2LTKA 3FY7A 1VRSD 2KP1A 2I9HA 5KN2A 1O73A 5HQPA 1OE7A 2HSHA 4TVEA 4IJ3A 2LRTA 1A2LA 3DWVA 3HJMA 1PKZA 4KX4A 3ZL5A 1SYRA 5ENUA 1F37A 1KNGA 5DAKA 4ZBAA 1V2AA 4LLRA 2NTOA 1HD2A 4IS0A 3P90A 2N5BA
chains in the Genus database with same CATH superfamily
4J57E 1SENA 1NHYA 2C3TA 1JZWA 3KP8A 1K3YA 5AN1A 1YF1A 4JZQA 1USBA 4MF6A 4X43A 4A5PA 4OFMA 4L5LA 3GH9A 3I69A 1UVZA 3CBUA 4KB3A 1K0MA 1V57A 4HI7A 4Z2RA 1ERTA 4PNFA 5JWRB 2YZHA 4EIPA 3TJGA 5J9CA 2LJAA 1F6MC 1XVWA 4IGJA 4MLYA 3ZITA 2YWMA 1OC3A 2R2JA 5B6NA 2GDRA 3NZNA 5AIXA 5F07A 3TKRA 14GSA 2ZNMA 3M1GA 4I2UA 2GZZA 2B1LA 2YCDA 2UZ8A 3G9BA 1V98A 3F6FA 1NW2A 4ZBBA 8GSSA 3AY8A 3TKSC 3IAM2 3RPNA 3A2WA 4KH7A 3SBCA 1YKAA 3RHCA 2EIOA 5ECHB 2A4VA 1B4PA 1WOUA 2DJ0A 2RIIA 1HNAA 2VL2C 4GSNA 1TRSA 1Z7RA 1HNBA 3GURA 1B4QA 4RI7A 1BEDA 1XW5A 3HJOA 3HDCA 4BVXA 2H1DA 4ML6A 2HFDA 4KA0A 5HR3A 2WB9A 4K9ZA 1TRWA 3DRNA 2C3QA 1EWXA 3HVNA 1JZOA 2BTOT 3KTBA 2V32A 5ID2B 1EGRA 4PURA 4AJ8A 1FVJA 2WZ9A 3J7Yb 1EV9A 3I6AA 4WF4A 1Q4JA 2VD1A 3JCML 4TXOA 3C1SA 5J9BA 1TTZA 3G7YA 1F9MA 1GUHA 4K2DA 2X99A 4IQ1A 4NMUA 3FZ5A 3UMAA 2ES7A 4ID0A 3GRXA 5CRHA 4GQFA 4V2LA 3D5JA 3F4RA 5ECLB 2PN8A 3FR3A 4F9ZA 4ECIA 3UL3A 1GUKA 4JBBA 19GSA 4K8MA 4LL4B 4XS6A 3MAKA 3ME8A 1UN2A 4ICYA 3CSHA 3L4NA 1GSQA 3ZVJD 3KEBA 2DBCA 1NHOA 4MDCA 1XOAA 2VOCA 4MZWA 1SU9A 3A5IA 1SL2B 4G9HA 2V41A 2MMZA 1WE0A 2LNSA 3ZVJA 3C8EA 4EF0A 1XFLA 1G6YA 2DIZA 2VLTA 3N5OA 1G6WA 5J41A 4EKZA 2CX3A 2VAFA 2CX4A 3CSIA 4EDYA 3QD9A 2ZUPA 2RM5A 5CO3A 18GSA 3RDWA 1PL2A 4I2TA 4K5RA 2LEGA 2QA1A 4HQZA 4TOPA 3FZ4A 3E0UA 1R4WA 16GSA 2FHEA 4X4JA 4AJ7A 1QQ2A 3PPUA 1A2JA 4ECCA 2KLXA 7GSSA 5D93A 2DSAA 3LWAA 1SJZA 3HKRA 2MBSA 4E8HA 2PPTA 4RI6A 1B48A 2C8UA 1XW9A 4GRFA 1XIYA 2HRAA 1KEBA 5CYYA 2GT6A 2R0CA 5AIVA 3KCMA 1TK0B 2B7KA 1OVNA 1AQWA 2H6XA 4N11A 2PUKC 2FWEA 1EOHA 2FCHA 3D4TA 2C80A 1TP9A 1JZRA 1NSWA 2VCVA 3CYNA 3GTUB 1B9XC 1PMTA 3TOTA 2VCZA 3L9SA 2F8AA 4POKA 3ZRDA 3W8JA 3FRCA 4KNDA 4JU5A 1E2YA 1GLPA 1WWJA 3MSZA 3A2XA 1M9BA 4V1Ag 4PNGA 2LRNA 3HA9A 2PWJA 2L5LA 4BIKA 6GSSA 3SWLA 4XS4A 1AQXA 1F3AA 3DIEA 1K0NA 4CW9A 4DSQA 2M46A 2HT9A 2PVOC 2VCWA 3IDVA 3VLNA 5DJLA 3MNGA 4JEDA 3KP9A 5ECSA 3FMWA 1W4VA 3UBKA 1EEJA 2YV7A 4I6XA 4JR6A 3KM6A 5IM9A 3RAZA 2FGXA 3DXBA 5L71A 4WEYA 4WBJA 3ERWA 5J4UA 4D73A 4YQVA 4N0VA 1TJDA 4DSRA 1FAAA 3D0ZA 4DSSB 3FKFA 3O6TA 3GA4A 3L0HA 4I97A 1T8EB 2IFQA 3UOMA 3C73A 2R0GA 3GKNA 3C7MA 3HVSA 4J56E 1J08A 3UARA 6GSYA 3M8NA 2WDUA 1GULA 3DVXA 2GZYA 3EPTA 3Q18A 2GZPA 3DD3A 2AB6A 2CVBA 1AC1A 2I1UA 3VI5A 1MD4A 1HNCA 1FW1A 4OO4A 1TKDB 3HVXA 4GF0A 1PD21 2LS5A 4F2IA 2VO4A 1M0UA 1SKRB 3GH6A 1WPIA 5JCWA 2VD0A 5IMVA 1BG5A 2FA8A 5ECIB 3EU3A 3ZFLA 20GSA 1T00A 3LGCA 5INYA 1H4OA 5CRGA 4GCIA 2WGRA 4YQMA 3QAVA 3O3TA 4FYBA 3WT2A 1C72A 2R6KA 4MPGA 4TR1A 4G19A 2O87A 1ZGNA 4OO5A 2JADA 4O7HA 2ALBA 3KD0A 2TRCP 1VF1A 3H8QA 3N9JA 4PTSA 3A5WA 5G31A 2O89A 5ECPB 1SYXA 4BVYB 1TK8B 4NAXA 5KN3A 3FR9A 4NHZA 3EMPA 3WD6A 2XHFA 4HJ2A 5GAPD 5BRTA 3IAS2 1HYUA 3P2AA 1XWGA 3IC8A 2XPDA 4MJCA 2VL3A 4HJMA 2F9SA 5DVBA 3WT1A 2B6MA 3M9KA 5AGYA 4N10A 2E7PA 1A0RP 4HDEA 2VLUA 2R0PA 3HZ8A 4F0CA 2PBJA 1U3AA 2H6ZA 2YPMA 2C0GA 2QSIA 2C0EA 1OC9A 2P31A 1O7UA 3L9VA 4FIWA 4QQ7A 4NHWA 4LL1B 2JZTA 1ERVA 1GTIA 2GVPA 4XIHA 5G1LA 4P3YB 3RBTA 4TR4A 1Y6EA 3IR4A 3W6GA 1DE2A 5AISA 1F3BA 1A8LA 2H70A 1DUGA 1A2MA 3CTGA 1Q98A 3GKMA 5ELGA 2P5RA 2E2MA 2MMOA 3MYDA 4EVMA 1IYHA 4ULXA 4IJIA 1N8JA 2JL4A 3QR6A 2H1GA 2A2PA 1SK0A 2IMKA 1SKSB 3QCPA 5IMDA 5A4VA 3TKSE 5IOXA 1Z6MA 4FYUA 3ZMLA 3F8UA 2NVLA 3BCKA 2YV9A 1QXHA 1URMA 2FY6A 3Q74A 1ZMAA 3IBHA 4AGSA 3IHQA 4G0IA 2H1AA 4QL7A 2VUPA 1THXA 2X4AA 4GSSA 5LD0A 3FZAA 2OACA 2IMIA 3F3QA 2L57A 1X5CA 4MP4A 4TR0A 5IO2A 6GSXA 2M80A 5HR1A 4ZXGA 2HZEB 4F03A 3HD5A 1M99A 2FUG2 4HS1A 2FWHA 3CXGA 3P7XA 4YKFA 2HI7A 3DMLA 3GKXA 4G10A 3VWUA 3D6IA 4LA1A 5FHIA 4AF2A 4BWQA 4MZCA 3ZREA 3M0FA 3VI7A 2C3NA 2DJ1A 2H01A 2H1BA 2MMNA 2O8VB 4GTUA 4HQSA 5F05A 5ECNB 2HZFA 3F3RA 1A0FA 1IYIA 3BOAA 3UEMA 1YQ1A 1LJRA 3FZ9A 1ZL9A 4CHSA 4NXIA 4PUAA 2HSMA 4JE1A 1XBSA 1GNWA 5C00A 4FYCA 1ZYPA 2DJ2A 4MJBA 5H5SA 3GMFA 5IOWA 3KIJA 2IMDA 1A8YA 4I8BA 1PQNA 1PN9A 3ME7A 3VWWA 4NWYA 4POMA 5KOXA 5DBQA 2PERA 2GQLA 1GLQA 1X0RA 4IELA 1F2EA 1O8WA 2RM6A 2FWFA 3BJ5A 2QGVA 3E9JB 3C1RA 1MDIA 3LEFA 1T4YA 2MMAA 1V58A 3EURA 3QPMA 2L6DA 1JLWA 1XG8A 6GSWA 5KN0A 3QFBC 2LJKA 1SL0B 3TKSA 1GTAA 4KSMA 1VF3A 4MCUA 1K0DA 2CVKA 5DAKB 2H76A 2P5QA 1M9AA 1SD8A 3QDNA 4X0XA 3EVIA 2VL2A 3CTFA 2QC7A 2KHPA 1ZZYA 5ELAA 3HZ4A 2DMLA 2NBSA 2CZ3A 3RPPA 2C4JA 1O6JA 2VM1A 4L8EA 4PXOA 1VGLA 1W89A 5COHA 1N2AA 2FA4A 2CQ9A 2E2GA 3DEXA 2GSSA 2CZ2A 3IV4A 4ZBDA 2B3SA 4TN8A 1XVQA 2H30A 5EVOA 3KH9A 3IXRA 1U3IA 3HY2A 4AJ6A 2AV4A 4KSOA 5D9WA 1CQHA 4XRDA 5IPGA 3HJPA 2DJJA 2H66A 3LG6A 3TRXA 3QOUA 1PFOA 2XBQA 2CA8A 3VPTA 4Q5QA 2EC4A 4O5RA 4EUYA 5G2ZA 5JWQB 5ECMB 2LQQA 3IK7A 4K1FA 3F6DA 3A3TA 4TW5A 4J2FA 5A5KA 4KGIA 4BVXB 3G7JA 4RUVA 1XWCA 4GLTA 3IHGA 5DJMA 2K18A 1M2DA 5DALA 4V2MA 5G5EA 2QKEA 1CQGA 1QMVA 4OMVA 4WXTA 3WGEA 1AIUA 3GN3A 3HYPA 2C1YA 1WJKA 3H79A 4JRRA 4TXOB 1GSYA 4GQCA 4XCSA 1U88A 1AAZA 3GSSA 3KMOA 3I43A 4EE0A 4HZ4A 3UBLA 5CRDA 3H4KA 3TJBA 2V2GA 2HRFA 5D8IA 2FWGA 1WMJA 4Q5FA 3ZLPA 4WR5A 4RQXA 2F51A 2IL3A 3IK9A 3VK9A 2WS2A 2V6OA 2K9FA 5B7CA 2DKHA 1JHBA 3TDGA 1R7HA 4NPBA 4ISDA 2IPAA 5KEJA 2PMTA 3GL3A 2L4CA 2HNLA 2OE3A 2Z9SA 4L5OA 3UIWA 4H86A 3U6VA 1YKCA 4K5SA 3ZIVA 1GH2A 4K7IA 4V1Ap 3EWLA 1TW9A 1GSEA 3TUEA 2REMA 5F8BA 1MEKA 4WBRD 3NIVA 3TRQA 2VCQA 2DMMA 3CQFA 6GSTA 5EY6A 2G2QA 1EGOA 4KDUA 3HXSA 5LCZA 3K8NA 4Z2TA 2YP6A 4OWYA 4FO5A 4BL7B 1G0TA 2JSZA 4GXZA 1GSFA 1S3RA 5DDLA 3APOA 3F4SA 4V2NA 11GSA 1Y25A 4EIQA 3HVVA 1EEMA 2F3MA 4X1UA 4ZB6A 5FT3A 4IP1A 1PRXA 3EU4A 1WRYA 2X49A 5G1KA 3TJKA 1OKDA 2NDOA 3KJYA 1O85A 3GX8A 5ECQB 4E8EA 3UAPA 1UC7A 2DIYA 2JZSA 5G30A 1EOGA 4G0KA 4USSA 3LYPA 1AW9A 3LXZA 5DCGA 3CSJA 5HR0A 2B1KA 3VWXA 1UA5A 4ECJA 1SKWB 2FLSA 3QMXA 5CNWA 3ERFA 1FO5A 4PUFC 2KUCA 3KGKA 2L4QA 1TRVA 1G7OA 2O7KA 3BD2A 3GFKA 1M3JA 22GSA 2CAQA 1XZOA 3KTLA 4K7NA 3ZMKA 4XRAA 5GSSA 1I5GA 5D73A 1BJXA 2GGTA 2YWIA 3PGTA 3TGZA 10GSA 4FQUA 1GNEA 2MZCA 1GWCA 1YEPA 5E59A 1PGTA 5ECKB 2AUVA 2YWNA 2N5FA 4TR3A 1TXXA 1HQOA 2GSTA 2R4VA 3LJRA 1U6TA 4WR4A 4O32A 1Z9HA 2B7JA 3A2VA 5CRWA 2C0DA 2VIMA 4LMVA 2FD3A 1XWAA 2I4AA 2DKIA 2EIRA 3ED3A 4D73B 2R3XA 5ABRA 1YDKA 4LMWA 1EP7A 4EDZA 1R26A 3L9UA 1JZDA 2IFQB 4F0BA 4POBA 2BJXA 2H75A 4BPYA 1QK8A 1XCCA 2XC2A 3FEUA 3APSA 1GSSA 2YANA 1I9DA 1M2BA 2O85A 6GSUA 2A4HA 1AXDA 2LJRA 2L5OA 5FWGA 3FW2A 4Z7XA 5ECRB 2CT6A 2K8SA 1X5DA 1MDKA 4ZB8A 4GSTA 2VLVA 3LYKA 1BX9A 1M2AA 3F0IA 3MWHA 2H6YA 1GRXA 3W8SA 1GP1A 1OKTA 4O92A 2R5GA 4ZILA 4ZB9A 2CVDA 3KXOA 1TOFA 4NV2A 4TR1B 4YH2A 4WF5A 3TKQA 1MD3A 2OKAA 1R5AA 1PX7A 3Q6OA 1YY7A 2N5AA 3D4MA 3TB2A 4Q5NA 1ST9A 3TCOA 2JU5A 4KE3A 2LQOA 1LBKA 4XS1A 4QL9A 2HSYA 2X8CA 1PA3A 5DQSA 2QA2A 1OAZA 1WP0A 1SJ6A 4DVCA 3E3EA 3CMIA 4MMMA 1S3AA 1TDIA 5ID2A 2RUEA 2LNTA 1X9SB 4KUNA 2P0GA 4G2EA 2ON7A 3KH7A 1K0OA 3IRAA 3GHAA 1ILOA 1U87A 3WYWA 1ZOFA 1TI3A 3V1WA 1OC9B 1JLVA 4MPFA 5GAND 1BQ7A 1K3OA 3ZIJA 1QUWA 4IKHA 2MYGA 4KDYA 3VPQA 4HSCX 2K8VA 2B5EA 2J23A 1RW1A 1A23A 3GUSA 3OR5A 2HYXA 2GLRA 3EMXA 1Z5YE 3LW9A 4YAPA 3M3MA 5BMUA 4MH3A 2GS3A 3ZYWA 3J7Yk 1S3CA 5HFIA 1O8XA 1JFUA 2GSQA 2OA7A 2G0FA 2GSRA 2X64A 1YF0A 5F06A 1BYEA 4EL1A 2RUFA 3GYKA 3TJJA 1E6BA 3U5RE 1YJ6A 2XBIA 1PL1A 1XWKA 3PH9A 2JACA 2HLSA 3F9UA 5HR2A 2H0GA 5C04A 5B8AA 4MNNA 1Z6NA 4K2XA 1GSUA 2L59A 2VL9A 2OBIA 2DC5A 2LRCA 1ZYEA 1WIKA 1ZCPA 5EL8A 1A24A 2LV3A 2GQMA 3EE2A 4YKGA 1PX6A 2DJKA 2CAIA 5D9XA 1XPVA 1X5EA 1Z3EA 3LSZA 4N30A 5D9TA 1GTBA 1PSQA 3NOFA 2HXKA 3KMNA 4O5QA 5A4WA 5GSTA 3GL5A 3FK8A 4OFTA 4TXVA 4O5UA 5IMCA 3CRTA 3TOUA 2WRTA 2JSYA 3GIXA 4FH8A 3ZTLA 2LSTA 4PGTA 4PX1A 3GTUA 1TK5B 2V6KA 3DYRA 2I3YA 3US3A 5IMFA 4WETA 4HZ2A 5JCUA 1EZKA 1MDJA 1K0AA 4YAVA 3GX0A 1SK1A 4KW6A 5IMZA 2YJ7A 3ERGA 4TRXA 1YEXA 4K0NA 1O81A 2GQKA 1ERUA 5IO0A 5J5NA 2KP2A 3FHKA 3C71A 4MJEA 3IC4A 1ML6A 2H8LA 1K3LA 2CV4A 1RK4A 5ECOB 5GZZB 2DLXA 3H1NA 3Q19A 1M7TA 5F0GA 4OCFA 2OJLA 2IMEA 3ISOA 3FR6A 13GSA 2HRNA 3IE3A 4KAEA 4ML1A 5KN1A 1DBYA 2WULA 1X9WB 4L0UA 5HFGA 3UVTA 2H19A 1ABAA 4MABA 1OC8A 5JWOB 1QGVA 2H0HA 1Z7PA 2J9HA 2KOKA 3H93A 5HFKA 3WGDA 4BL7A 1GSDA 3GSTA 2TIRA 1TU7A 2YNXA 5H5RA 4K0GA 4DSSA 4BA7A 2ZCTA 3IOSA 3MIXA 5G5FA 2H71A 2TRXA 2IIYA 3G7IA 2VCXA 4OCEA 3UVHA 2FNOA 4HU7A 1SJIA 2M72A 3DVWA 3CRUA 5CP1A 3L78A 1V9WA 3IA1A 3LFLA 3VURA 4MZBA 3TRPA 2V1MA 4WKWA 1FB0A 4JR4A 4PQ1A 1H75A 4HUAA 4MH2A 4TKYA 4CDOA 3GNJA 2D2ZA 2WFCA 1SK2A 2XPEA 4OD7A 4ZL7A 3M9JA 2X8HA 1GL8A 4YQUA 4IVFA 2YWOA 2VCTA 2YN1A 1LU4A 3LXTA 1MTCA 1T4ZA 2PGTA 4IN0A 4ECBA 3QAGA 1VF2A 1R5PA 1B9YC 1GTUA 4DEJA 1NM3A 3R3EA 4EC0A 1VF4A 1B8XA 1FVKA 4IP6A 3APQA 2H73A 5E4WA 1T3BA 4BVYA 4HU9A 2A2RA 2A2SA 4ZIJA 3TKPA 1TI1A 3EINA 2OE0A 4NV5A 1RQMA 4MJAA 1K0CA 2H72A 2I81A 3BCIA 5DALB 1SL1B 2GTUA 4IW9A 2RLIA 4ZL8A 2OBKA 5H5QA 1K0BA 3HCZA 2F8FA 4ZL9A 3PR8A 2YOIA 5B8BA 2ON5A 3DGQA 3P8WA 2H74A 1T7PB 1TU8A 4IHUA 4BWSA 1V40A 4XTSA 4MF5A 1FHEA 1YZXA 1ACVA 3UJ1A 3EYTA 1SD9A 2AYTA 17GSA 2NPBA 1PKWA 5IIZA 5JCGA 3WGXA 3TJFA 3MDKA 1XW6A 5CREA 2YJHA 1X9MB 1S3DA 1EP8A 1GUMA 2IN3A 2H0IA 4KF9A 3D21A 4POLA 4MF7A 2IWTA 4Q5RA 3S9FA 3IPZA 4PQIA 2MBTA 2GT5A 3HHVA 4XS4B 2VM2A 2JZRA 1J0FA 3LORA 1AQVA 5B6MA 5D9VA 1KBNA 2IJYA 3EC3A 1FOVA 4CY8A 12GSA 2OADA 2HE3A 4EO3A 4MK3A 1ON4A 1QFNA 4KCEA 4KCAA 2PU9C 1J9BA 2LKUA 2DJ3A 2LUSA 2R37A 3PINA 4HEA2 3O76A 1DE1A 2AAWA 1FG4A 2C0FA 1FB6A 1ZYQB 2PVQA 1XXUA 5IMAA 2WJUA 4F82A 1ZYNA 4K6XA 3ZZXA 4MA9A 1EV4A 1DSBA 4EXJA 3F63A 3GKKA 1OYJA 2HZEA 4HOJA 4L0WA 5KOWA 2B5XA 2K6VA 4ACSA 5CAXA 1OE8A 5EPFA 3LQ7A 5DQYA 3VFIA 6GSVA 2AHEA 2X8GA 1ERWA 5IPHA 3QFAC 2L6CA 3KZQA 3D22A 2E0QA 3VWVA 5D96A 9GSSA 1THOA 4KDXA 1G7EA 1T1VA 4I5QA 2YZUA 1BAYA 1XOBA 3QAWA 1XWBA 3R2QA 2HRKA 5DCHA 5LNKe 4OFNA 2EIQA 1TRUA 4RQRA 2B5YA 4XHMA 3I9V2 1AUCA 3DKSA 1PN0A 3GV1A 4IQAA 5A4UA 3BBYA 1KTEA 3F4TA 4N0ZA 2IMFA 3ZFBA 4GWRA 3RHBA 4Z2UA 1FOHA 2BMXA 2WCIA 3FYGA 4ILFA 5IQYA 2AJQB 5J3RA 4PQHA 4IBPA 4K7OA 2OE1A 2LTKA 3FY7A 1VRSD 1M3IA 2KP1A 2I9HA 5KN2A 1O73A 5HQPA 1OE7A 2HSHA 4TVEA 4IJ3A 2LRTA 1A2LA 4G0LA 3DWVA 4CY6A 3HJMA 1PKZA 4KX4A 3ZL5A 1SYRA 5ENUA 1F37A 1KNGA 5DAKA 4ZBAA 1V2AA 4LLRA 2NTOA 1HD2A 4IS0A 3P90A 2N5BA
chains in the Genus database with same CATH topology
4J57E 1SENA 1NHYA 2C3TA 1JZWA 3KP8A 1K3YA 5AN1A 1YF1A 4JZQA 1USBA 4MF6A 4X43A 4A5PA 4OFMA 4L5LA 3GH9A 3I69A 1UVZA 3CBUA 4KB3A 1K0MA 1V57A 4HI7A 4Z2RA 1ERTA 4PNFA 5JWRB 2YZHA 4EIPA 3TJGA 5J9CA 2LJAA 1F6MC 1XVWA 4IGJA 4MLYA 3ZITA 2YWMA 1OC3A 2R2JA 5B6NA 2GDRA 3NZNA 5AIXA 5F07A 3TKRA 14GSA 2ZNMA 3M1GA 4I2UA 2GZZA 2B1LA 2YCDA 2UZ8A 3G9BA 1V98A 3F6FA 1NW2A 4ZBBA 8GSSA 3AY8A 3TKSC 3IAM2 3RPNA 3A2WA 4KH7A 3SBCA 1YKAA 3RHCA 2EIOA 5ECHB 2A4VA 1B4PA 1WOUA 2DJ0A 2RIIA 1HNAA 2VL2C 4GSNA 1TRSA 1Z7RA 1HNBA 3GURA 1B4QA 4RI7A 1BEDA 1XW5A 3HJOA 3HDCA 4BVXA 2H1DA 4ML6A 2HFDA 4KA0A 5HR3A 2WB9A 4K9ZA 1TRWA 3DRNA 2C3QA 1EWXA 1JZOA 2BTOT 3KTBA 2V32A 5ID2B 1EGRA 4PURA 4AJ8A 1FVJA 2WZ9A 3J7Yb 1EV9A 3I6AA 4WF4A 1Q4JA 2VD1A 3JCML 4TXOA 3C1SA 5J9BA 1TTZA 3G7YA 1F9MA 1GUHA 4K2DA 2X99A 4IQ1A 4NMUA 3FZ5A 3UMAA 2ES7A 4ID0A 3GRXA 5CRHA 4GQFA 4V2LA 3D5JA 3F4RA 5ECLB 2PN8A 3FR3A 4F9ZA 4ECIA 3UL3A 1GUKA 4JBBA 19GSA 4K8MA 4LL4B 4XS6A 3MAKA 3ME8A 1UN2A 4ICYA 3CSHA 3L4NA 1GSQA 3ZVJD 3KEBA 2DBCA 1NHOA 4MDCA 1XOAA 2VOCA 4MZWA 1SU9A 3A5IA 1SL2B 4G9HA 2V41A 2MMZA 1WE0A 2LNSA 3ZVJA 3C8EA 4EF0A 1XFLA 1G6YA 2DIZA 2VLTA 3N5OA 1G6WA 5J41A 4EKZA 2CX3A 2VAFA 2CX4A 3CSIA 4EDYA 3QD9A 2ZUPA 2RM5A 5CO3A 18GSA 3RDWA 1PL2A 4I2TA 4K5RA 2LEGA 2QA1A 4HQZA 4TOPA 3FZ4A 3E0UA 1R4WA 16GSA 2FHEA 4X4JA 4AJ7A 1QQ2A 3PPUA 1A2JA 4ECCA 2KLXA 7GSSA 5D93A 2DSAA 3LWAA 1SJZA 3HKRA 2MBSA 4E8HA 2PPTA 4RI6A 1B48A 2C8UA 1XW9A 4GRFA 1XIYA 2HRAA 1KEBA 5CYYA 2GT6A 2R0CA 5AIVA 3KCMA 1TK0B 2B7KA 1OVNA 1AQWA 2H6XA 4N11A 2PUKC 2FWEA 1EOHA 2FCHA 3D4TA 2C80A 1TP9A 1JZRA 1NSWA 2VCVA 3CYNA 3GTUB 1B9XC 1PMTA 3TOTA 2VCZA 3L9SA 2F8AA 4POKA 3ZRDA 3W8JA 3FRCA 4KNDA 4JU5A 1E2YA 1GLPA 1WWJA 3MSZA 3A2XA 1M9BA 4V1Ag 4PNGA 2LRNA 3HA9A 2PWJA 2L5LA 6GSSA 3SWLA 4XS4A 1AQXA 1F3AA 3DIEA 1K0NA 4CW9A 4DSQA 2M46A 2HT9A 2PVOC 2VCWA 3IDVA 3VLNA 5DJLA 3MNGA 4JEDA 3KP9A 5ECSA 3FMWA 1W4VA 3UBKA 1EEJA 2YV7A 4I6XA 4JR6A 3KM6A 5IM9A 3RAZA 2FGXA 3DXBA 5L71A 4WEYA 4WBJA 3ERWA 5J4UA 4D73A 4YQVA 4N0VA 1TJDA 4DSRA 1FAAA 3D0ZA 4DSSB 3FKFA 3O6TA 3GA4A 3L0HA 4I97A 1T8EB 2IFQA 3UOMA 3C73A 2R0GA 3GKNA 3C7MA 3HVSA 4J56E 1J08A 3UARA 6GSYA 3M8NA 2WDUA 1GULA 3DVXA 2GZYA 3EPTA 3Q18A 2GZPA 3DD3A 2AB6A 2CVBA 1AC1A 2I1UA 3VI5A 1MD4A 1HNCA 1FW1A 4OO4A 1TKDB 3HVXA 4GF0A 1PD21 2LS5A 4F2IA 2VO4A 1M0UA 1SKRB 3GH6A 1WPIA 5JCWA 2VD0A 5IMVA 1BG5A 2FA8A 5ECIB 3EU3A 3ZFLA 20GSA 1T00A 3LGCA 5INYA 1H4OA 5CRGA 4GCIA 2WGRA 4YQMA 3QAVA 3O3TA 4FYBA 3WT2A 1C72A 2R6KA 4MPGA 4TR1A 4G19A 2O87A 1ZGNA 4OO5A 2JADA 4O7HA 2ALBA 3KD0A 2TRCP 1VF1A 3H8QA 3N9JA 4PTSA 3A5WA 5G31A 2O89A 5ECPB 1SYXA 4BVYB 1TK8B 4NAXA 5KN3A 3FR9A 4NHZA 3EMPA 3WD6A 2XHFA 4HJ2A 5GAPD 5BRTA 3IAS2 1HYUA 3P2AA 1XWGA 3IC8A 2XPDA 4MJCA 2VL3A 4HJMA 2F9SA 5DVBA 3WT1A 2B6MA 3M9KA 5AGYA 4N10A 2E7PA 1A0RP 4HDEA 2VLUA 2R0PA 3HZ8A 4F0CA 2PBJA 1U3AA 2H6ZA 2YPMA 2C0GA 2QSIA 2C0EA 1OC9A 2P31A 1O7UA 3L9VA 4FIWA 4QQ7A 4NHWA 4LL1B 2JZTA 1ERVA 1GTIA 2GVPA 4XIHA 5G1LA 4P3YB 3RBTA 4TR4A 1Y6EA 3IR4A 3W6GA 1DE2A 5AISA 1F3BA 1A8LA 2H70A 1DUGA 1A2MA 3CTGA 1Q98A 3GKMA 5ELGA 2P5RA 2E2MA 2MMOA 3MYDA 4EVMA 1IYHA 4ULXA 4IJIA 1N8JA 2JL4A 3QR6A 2H1GA 2A2PA 1SK0A 2IMKA 1SKSB 3QCPA 5IMDA 5A4VA 3TKSE 5IOXA 1Z6MA 4FYUA 3ZMLA 3F8UA 2NVLA 3BCKA 2YV9A 1QXHA 1URMA 2FY6A 3Q74A 1ZMAA 3IBHA 4AGSA 3IHQA 4G0IA 2H1AA 4QL7A 2VUPA 1THXA 2X4AA 4GSSA 5LD0A 3FZAA 2OACA 2IMIA 3F3QA 2L57A 1X5CA 4MP4A 4TR0A 5IO2A 6GSXA 2M80A 5HR1A 4ZXGA 2HZEB 4F03A 3HD5A 1M99A 2FUG2 4HS1A 2FWHA 3CXGA 3P7XA 4YKFA 2HI7A 3DMLA 3GKXA 4G10A 3VWUA 3D6IA 4LA1A 5FHIA 4AF2A 4BWQA 4MZCA 3ZREA 3M0FA 3VI7A 2C3NA 2DJ1A 2H01A 2H1BA 2MMNA 2O8VB 4GTUA 4HQSA 5F05A 5ECNB 2HZFA 3F3RA 1A0FA 1IYIA 3BOAA 3UEMA 1YQ1A 1LJRA 3FZ9A 1ZL9A 4CHSA 4NXIA 4PUAA 2HSMA 4JE1A 1XBSA 1GNWA 5C00A 4FYCA 1ZYPA 2DJ2A 4MJBA 5H5SA 3GMFA 5IOWA 3KIJA 2IMDA 1A8YA 4I8BA 1PQNA 1PN9A 3ME7A 3VWWA 4NWYA 4POMA 5KOXA 5DBQA 2PERA 2GQLA 1GLQA 1X0RA 4IELA 1F2EA 1O8WA 2RM6A 2FWFA 3BJ5A 2QGVA 3E9JB 3C1RA 1MDIA 3LEFA 1T4YA 2MMAA 1V58A 3EURA 3QPMA 2L6DA 1JLWA 6GSWA 5KN0A 3QFBC 2LJKA 1SL0B 3TKSA 1GTAA 4KSMA 1VF3A 4MCUA 1K0DA 2CVKA 5DAKB 2H76A 2P5QA 1M9AA 1SD8A 3QDNA 4X0XA 3EVIA 2VL2A 3CTFA 2QC7A 2KHPA 1ZZYA 5ELAA 3HZ4A 2DMLA 2NBSA 2CZ3A 3RPPA 2C4JA 1O6JA 2VM1A 4L8EA 4PXOA 1VGLA 1W89A 5COHA 1N2AA 2FA4A 2CQ9A 2E2GA 3DEXA 2GSSA 2CZ2A 3IV4A 4ZBDA 2B3SA 4TN8A 1XVQA 2H30A 5EVOA 3KH9A 3IXRA 1U3IA 3HY2A 4AJ6A 2AV4A 4KSOA 5D9WA 1CQHA 4XRDA 5IPGA 3HJPA 2DJJA 2H66A 3LG6A 3TRXA 3QOUA 2XBQA 2CA8A 3VPTA 4Q5QA 2EC4A 4O5RA 4EUYA 5G2ZA 5JWQB 5ECMB 2LQQA 3IK7A 4K1FA 3F6DA 3A3TA 4TW5A 4J2FA 5A5KA 4KGIA 4BVXB 3G7JA 4RUVA 1XWCA 4GLTA 3IHGA 5DJMA 2K18A 1M2DA 5DALA 4V2MA 5G5EA 2QKEA 1CQGA 1QMVA 4OMVA 4WXTA 3WGEA 1AIUA 3GN3A 3HYPA 2C1YA 1WJKA 3H79A 4JRRA 4TXOB 1GSYA 4GQCA 4XCSA 1U88A 1AAZA 3GSSA 3KMOA 3I43A 4EE0A 4HZ4A 3UBLA 5CRDA 3H4KA 3TJBA 2V2GA 2HRFA 5D8IA 2FWGA 1WMJA 4Q5FA 3ZLPA 4WR5A 4RQXA 2F51A 2IL3A 3IK9A 3VK9A 2WS2A 2V6OA 2K9FA 5B7CA 2DKHA 1JHBA 3TDGA 1R7HA 4NPBA 4ISDA 2IPAA 5KEJA 2PMTA 3GL3A 2L4CA 2HNLA 2OE3A 2Z9SA 4L5OA 3UIWA 4H86A 3U6VA 1YKCA 4K5SA 3ZIVA 1GH2A 4K7IA 4V1Ap 3EWLA 1TW9A 1GSEA 3TUEA 2REMA 5F8BA 1MEKA 4WBRD 3NIVA 3TRQA 2VCQA 2DMMA 6GSTA 5EY6A 2G2QA 1EGOA 4KDUA 3HXSA 5LCZA 3K8NA 4Z2TA 2YP6A 4OWYA 4FO5A 4BL7B 1G0TA 2JSZA 4GXZA 1GSFA 5DDLA 3APOA 3F4SA 4V2NA 11GSA 1Y25A 4EIQA 3HVVA 1EEMA 2F3MA 4X1UA 4ZB6A 5FT3A 4IP1A 1PRXA 3EU4A 1WRYA 2X49A 5G1KA 3TJKA 1OKDA 2NDOA 3KJYA 1O85A 3GX8A 5ECQB 4E8EA 3UAPA 1UC7A 2DIYA 2JZSA 5G30A 1EOGA 4G0KA 4USSA 3LYPA 1AW9A 3LXZA 5DCGA 3CSJA 5HR0A 2B1KA 3VWXA 1UA5A 4ECJA 1SKWB 2FLSA 3QMXA 5CNWA 3ERFA 1FO5A 4PUFC 2KUCA 3KGKA 2L4QA 1TRVA 1G7OA 2O7KA 3BD2A 3GFKA 22GSA 2CAQA 1XZOA 3KTLA 4K7NA 3ZMKA 4XRAA 5GSSA 1I5GA 5D73A 1BJXA 2GGTA 2YWIA 3PGTA 3TGZA 10GSA 4FQUA 1GNEA 2MZCA 1GWCA 1YEPA 5E59A 1PGTA 5ECKB 2AUVA 2YWNA 2N5FA 4TR3A 1TXXA 1HQOA 2GSTA 2R4VA 3LJRA 1U6TA 4WR4A 4O32A 1Z9HA 2B7JA 3A2VA 5CRWA 2C0DA 2VIMA 4LMVA 2FD3A 1XWAA 2I4AA 2DKIA 2EIRA 3ED3A 4D73B 2R3XA 5ABRA 1YDKA 4LMWA 1EP7A 4EDZA 1R26A 3L9UA 1JZDA 2IFQB 4F0BA 4POBA 2BJXA 2H75A 4BPYA 1QK8A 1XCCA 2XC2A 3FEUA 3APSA 1GSSA 2YANA 1I9DA 1M2BA 2O85A 6GSUA 2A4HA 1AXDA 2LJRA 2L5OA 5FWGA 3FW2A 4Z7XA 5ECRB 2CT6A 2K8SA 1X5DA 1MDKA 4ZB8A 4GSTA 2VLVA 3LYKA 1BX9A 1M2AA 3F0IA 3MWHA 2H6YA 1GRXA 3W8SA 1GP1A 1OKTA 4O92A 2R5GA 4ZILA 4ZB9A 2CVDA 3KXOA 1TOFA 4NV2A 4TR1B 4YH2A 4WF5A 3TKQA 1MD3A 2OKAA 1R5AA 1PX7A 3Q6OA 1YY7A 2N5AA 3D4MA 3TB2A 4Q5NA 1ST9A 3TCOA 2JU5A 4KE3A 2LQOA 1LBKA 4XS1A 4QL9A 2HSYA 2X8CA 1PA3A 5DQSA 2QA2A 1OAZA 1WP0A 1SJ6A 4DVCA 3E3EA 3CMIA 4MMMA 1S3AA 1TDIA 5ID2A 2RUEA 2LNTA 1X9SB 4KUNA 2P0GA 4G2EA 2ON7A 3KH7A 1K0OA 3IRAA 3GHAA 1ILOA 1U87A 3WYWA 1ZOFA 1TI3A 3V1WA 1OC9B 1JLVA 4MPFA 5GAND 1BQ7A 1K3OA 3ZIJA 1QUWA 4IKHA 2MYGA 4KDYA 3VPQA 2K8VA 2B5EA 2J23A 1RW1A 1A23A 3GUSA 3OR5A 2HYXA 2GLRA 3EMXA 1Z5YE 3LW9A 4YAPA 3M3MA 5BMUA 4MH3A 2GS3A 3ZYWA 3J7Yk 1S3CA 5HFIA 1O8XA 1JFUA 2GSQA 2OA7A 2G0FA 2GSRA 2X64A 1YF0A 5F06A 1BYEA 4EL1A 2RUFA 3GYKA 3TJJA 1E6BA 3U5RE 1YJ6A 2XBIA 1PL1A 1XWKA 3PH9A 2JACA 2HLSA 3F9UA 5HR2A 2H0GA 5C04A 5B8AA 4MNNA 1Z6NA 4K2XA 1GSUA 2L59A 2VL9A 2OBIA 2DC5A 2LRCA 1ZYEA 1WIKA 1ZCPA 5EL8A 1A24A 2LV3A 2GQMA 3EE2A 4YKGA 1PX6A 2DJKA 2CAIA 5D9XA 1XPVA 1X5EA 1Z3EA 3LSZA 4N30A 5D9TA 1GTBA 1PSQA 3NOFA 2HXKA 3KMNA 4O5QA 5A4WA 5GSTA 3GL5A 3FK8A 4OFTA 4TXVA 4O5UA 5IMCA 3CRTA 3TOUA 2WRTA 2JSYA 3GIXA 4FH8A 3ZTLA 2LSTA 4PGTA 4PX1A 3GTUA 1TK5B 2V6KA 3DYRA 2I3YA 3US3A 5IMFA 4WETA 4HZ2A 5JCUA 1EZKA 1MDJA 1K0AA 4YAVA 3GX0A 1SK1A 4KW6A 5IMZA 2YJ7A 3ERGA 4TRXA 1YEXA 4K0NA 1O81A 2GQKA 1ERUA 5IO0A 5J5NA 2KP2A 3FHKA 3C71A 4MJEA 3IC4A 1ML6A 2H8LA 1K3LA 2CV4A 1RK4A 5ECOB 5GZZB 2DLXA 3H1NA 3Q19A 1M7TA 5F0GA 4OCFA 2OJLA 2IMEA 3ISOA 3FR6A 13GSA 2HRNA 3IE3A 4KAEA 4ML1A 5KN1A 1DBYA 2WULA 1X9WB 4L0UA 5HFGA 3UVTA 2H19A 1ABAA 4MABA 1OC8A 5JWOB 1QGVA 2H0HA 1Z7PA 2J9HA 2KOKA 3H93A 5HFKA 3WGDA 4BL7A 1GSDA 3GSTA 2TIRA 1TU7A 2YNXA 5H5RA 4K0GA 4DSSA 4BA7A 2ZCTA 3IOSA 3MIXA 5G5FA 2H71A 2TRXA 2IIYA 3G7IA 2VCXA 4OCEA 3UVHA 2FNOA 4HU7A 1SJIA 2M72A 3DVWA 3CRUA 5CP1A 3L78A 1V9WA 3IA1A 3LFLA 3VURA 4MZBA 3TRPA 2V1MA 4WKWA 1FB0A 4JR4A 4PQ1A 1H75A 4HUAA 4MH2A 4TKYA 4CDOA 3GNJA 2D2ZA 2WFCA 1SK2A 2XPEA 4OD7A 4ZL7A 3M9JA 2X8HA 1GL8A 4YQUA 4IVFA 2YWOA 2VCTA 2YN1A 1LU4A 3LXTA 1MTCA 1T4ZA 2PGTA 4IN0A 4ECBA 3QAGA 1VF2A 1R5PA 1B9YC 1GTUA 4DEJA 1NM3A 3R3EA 4EC0A 1VF4A 1B8XA 1FVKA 4IP6A 3APQA 2H73A 5E4WA 1T3BA 4BVYA 4HU9A 2A2RA 2A2SA 4ZIJA 3TKPA 1TI1A 3EINA 2OE0A 4NV5A 1RQMA 4MJAA 1K0CA 2H72A 2I81A 3BCIA 5DALB 1SL1B 2GTUA 4IW9A 2RLIA 4ZL8A 2OBKA 5H5QA 1K0BA 3HCZA 2F8FA 4ZL9A 3PR8A 2YOIA 5B8BA 2ON5A 3DGQA 3P8WA 2H74A 1T7PB 1TU8A 4IHUA 4BWSA 1V40A 4XTSA 4MF5A 1FHEA 1YZXA 1ACVA 3UJ1A 3EYTA 1SD9A 2AYTA 17GSA 2NPBA 1PKWA 5IIZA 5JCGA 3WGXA 3TJFA 3MDKA 1XW6A 5CREA 2YJHA 1X9MB 1S3DA 1EP8A 1GUMA 2IN3A 2H0IA 4KF9A 3D21A 4POLA 4MF7A 2IWTA 4Q5RA 3S9FA 3IPZA 4PQIA 2MBTA 2GT5A 3HHVA 4XS4B 2VM2A 2JZRA 1J0FA 3LORA 1AQVA 5B6MA 5D9VA 1KBNA 2IJYA 3EC3A 1FOVA 4CY8A 12GSA 2OADA 2HE3A 4EO3A 4MK3A 1ON4A 1QFNA 4KCEA 4KCAA 2PU9C 1J9BA 2LKUA 2DJ3A 2LUSA 2R37A 3PINA 4HEA2 3O76A 1DE1A 2AAWA 1FG4A 2C0FA 1FB6A 1ZYQB 2PVQA 1XXUA 5IMAA 2WJUA 4F82A 1ZYNA 4K6XA 3ZZXA 4MA9A 1EV4A 1DSBA 4EXJA 3F63A 3GKKA 1OYJA 2HZEA 4HOJA 4L0WA 5KOWA 2B5XA 2K6VA 4ACSA 5CAXA 1OE8A 5EPFA 3LQ7A 5DQYA 3VFIA 6GSVA 2AHEA 2X8GA 1ERWA 5IPHA 3QFAC 2L6CA 3KZQA 3D22A 2E0QA 3VWVA 5D96A 9GSSA 1THOA 4KDXA 1G7EA 1T1VA 4I5QA 2YZUA 1BAYA 1XOBA 3QAWA 1XWBA 3R2QA 2HRKA 5DCHA 5LNKe 4OFNA 2EIQA 1TRUA 4RQRA 2B5YA 4XHMA 3I9V2 1AUCA 3DKSA 1PN0A 3GV1A 4IQAA 5A4UA 3BBYA 1KTEA 3F4TA 4N0ZA 2IMFA 3ZFBA 4GWRA 3RHBA 4Z2UA 1FOHA 2BMXA 2WCIA 3FYGA 4ILFA 5IQYA 2AJQB 5J3RA 4PQHA 4IBPA 4K7OA 2OE1A 2LTKA 3FY7A 1VRSD 2KP1A 2I9HA 5KN2A 1O73A 5HQPA 1OE7A 2HSHA 4TVEA 4IJ3A 2LRTA 1A2LA 4G0LA 3DWVA 4CY6A 3HJMA 1PKZA 4KX4A 3ZL5A 1SYRA 5ENUA 1F37A 1KNGA 5DAKA 4ZBAA 1V2AA 4LLRA 2NTOA 1HD2A 4IS0A 3P90A 2N5BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J57 E;  1SEN A;  1NHY A;  2C3T A;  1JZW A;  3KP8 A;  1K3Y A;  5AN1 A;  1YF1 A;  4JZQ A;  1USB A;  4MF6 A;  4X43 A;  4OFM A;  4L5L A;  3GH9 A;  3I69 A;  1UVZ A;  3CBU A;  4KB3 A;  1K0M A;  1V57 A;  4HI7 A;  1ERT A;  4PNF A;  5JWR B;  2YZH A;  3TJG A;  5J9C A;  2LJA A;  1F6M C;  1XVW A;  4IGJ A;  4MLY A;  3ZIT A;  2YWM A;  1OC3 A;  2R2J A;  5B6N A;  2GDR A;  3NZN A;  5AIX A;  5F07 A;  3TKR A;  14GS A;  2ZNM A;  3M1G A;  4I2U A;  2GZZ A;  2B1L A;  2YCD A;  3G9B A;  1V98 A;  3F6F A;  1NW2 A;  4ZBB A;  8GSS A;  3AY8 A;  3TKS C;  3IAM 2;  3RPN A;  3A2W A;  4KH7 A;  3SBC A;  1YKA A;  3RHC A;  2EIO A;  5ECH B;  2A4V A;  1B4P A;  1WOU A;  2DJ0 A;  2RII A;  1HNA A;  2VL2 C;  4GSN A;  1TRS A;  1Z7R A;  1HNB A;  3GUR A;  1B4Q A;  4RI7 A;  1BED A;  1XW5 A;  3HJO A;  3HDC A;  4BVX A;  2H1D A;  4ML6 A;  2HFD A;  4KA0 A;  5HR3 A;  2WB9 A;  4K9Z A;  1TRW A;  3DRN A;  2C3Q A;  1EWX A;  1JZO A;  2BTO T;  3KTB A;  2V32 A;  5ID2 B;  1EGR A;  4PUR A;  4AJ8 A;  1FVJ A;  2WZ9 A;  3J7Y b;  1EV9 A;  3I6A A;  4WF4 A;  1Q4J A;  2VD1 A;  3JCM L;  4TXO A;  3C1S A;  5J9B A;  1TTZ A;  3G7Y A;  1F9M A;  1GUH A;  4K2D A;  2X99 A;  4IQ1 A;  4NMU A;  3FZ5 A;  3UMA A;  2ES7 A;  4ID0 A;  3GRX A;  5CRH A;  4GQF A;  4V2L A;  3D5J A;  3F4R A;  5ECL B;  2PN8 A;  3FR3 A;  4F9Z A;  4ECI A;  3UL3 A;  1GUK A;  4JBB A;  19GS A;  4K8M A;  4LL4 B;  4XS6 A;  3MAK A;  3ME8 A;  1UN2 A;  3CSH A;  3L4N A;  1GSQ A;  3ZVJ D;  3KEB A;  2DBC A;  1NHO A;  4MDC A;  1XOA A;  2VOC A;  4MZW A;  1SU9 A;  1SL2 B;  4G9H A;  2V41 A;  2MMZ A;  1WE0 A;  2LNS A;  3ZVJ A;  3C8E A;  4EF0 A;  1XFL A;  1G6Y A;  2DIZ A;  2VLT A;  3N5O A;  1G6W A;  5J41 A;  4EKZ A;  2CX3 A;  2VAF A;  2CX4 A;  3CSI A;  4EDY A;  3QD9 A;  2ZUP A;  2RM5 A;  5CO3 A;  18GS A;  3RDW A;  1PL2 A;  4I2T A;  2LEG A;  4HQZ A;  4TOP A;  3FZ4 A;  3E0U A;  1R4W A;  16GS A;  2FHE A;  4AJ7 A;  1QQ2 A;  1A2J A;  4ECC A;  2KLX A;  7GSS A;  5D93 A;  2DSA A;  3LWA A;  1SJZ A;  3HKR A;  2MBS A;  4E8H A;  2PPT A;  4RI6 A;  1B48 A;  2C8U A;  1XW9 A;  4GRF A;  1XIY A;  1KEB A;  5CYY A;  2GT6 A;  1TK0 B;  5AIV A;  3KCM A;  2B7K A;  1OVN A;  1AQW A;  2H6X A;  4N11 A;  2PUK C;  2FWE A;  1EOH A;  2FCH A;  3D4T A;  2C80 A;  1TP9 A;  1JZR A;  1NSW A;  2VCV A;  3CYN A;  3GTU B;  1B9X C;  1PMT A;  3TOT A;  2VCZ A;  3L9S A;  2F8A A;  4POK A;  3ZRD A;  3W8J A;  3FRC A;  4KND A;  4JU5 A;  1E2Y A;  1GLP A;  1WWJ A;  3MSZ A;  3A2X A;  1M9B A;  4V1A g;  4PNG A;  2LRN A;  3HA9 A;  2PWJ A;  2L5L A;  6GSS A;  3SWL A;  4XS4 A;  1AQX A;  1F3A A;  3DIE A;  1K0N A;  4CW9 A;  4DSQ A;  2M46 A;  2HT9 A;  2PVO C;  2VCW A;  3IDV A;  3VLN A;  5DJL A;  3MNG A;  4JED A;  3KP9 A;  5ECS A;  1W4V A;  3UBK A;  1EEJ A;  2YV7 A;  4I6X A;  4JR6 A;  3KM6 A;  5IM9 A;  3RAZ A;  2FGX A;  3DXB A;  5L71 A;  4WEY A;  4WBJ A;  3ERW A;  5J4U A;  4D73 A;  4YQV A;  4N0V A;  1TJD A;  4DSR A;  1FAA A;  3D0Z A;  4DSS B;  3FKF A;  3O6T A;  3GA4 A;  3L0H A;  4I97 A;  1T8E B;  2IFQ A;  3UOM A;  3C73 A;  3GKN A;  3C7M A;  3HVS A;  4J56 E;  1J08 A;  3UAR A;  6GSY A;  3M8N A;  2WDU A;  1GUL A;  3DVX A;  2GZY A;  3Q18 A;  2GZP A;  3DD3 A;  2AB6 A;  2CVB A;  1AC1 A;  2I1U A;  3VI5 A;  1MD4 A;  1HNC A;  1FW1 A;  4OO4 A;  1TKD B;  3HVX A;  4GF0 A;  1PD2 1;  2LS5 A;  4F2I A;  2VO4 A;  1M0U A;  1SKR B;  3GH6 A;  1WPI A;  5JCW A;  2VD0 A;  5IMV A;  1BG5 A;  2FA8 A;  5ECI B;  3EU3 A;  3ZFL A;  20GS A;  1T00 A;  3LGC A;  5INY A;  1H4O A;  5CRG A;  4GCI A;  2WGR A;  4YQM A;  3QAV A;  3O3T A;  4FYB A;  3WT2 A;  1C72 A;  2R6K A;  4MPG A;  4TR1 A;  4G19 A;  2O87 A;  1ZGN A;  4OO5 A;  2JAD A;  4O7H A;  2ALB A;  3KD0 A;  2TRC P;  1VF1 A;  3H8Q A;  3N9J A;  3A5W A;  5G31 A;  2O89 A;  5ECP B;  1SYX A;  1TK8 B;  4NAX A;  5KN3 A;  3FR9 A;  4NHZ A;  3EMP A;  3WD6 A;  2XHF A;  4HJ2 A;  5GAP D;  3IAS 2;  1HYU A;  3P2A A;  1XWG A;  2XPD A;  4MJC A;  2VL3 A;  4HJM A;  2F9S A;  5DVB A;  3WT1 A;  2B6M A;  3M9K A;  5AGY A;  4N10 A;  2E7P A;  1A0R P;  4HDE A;  2VLU A;  3HZ8 A;  4F0C A;  2PBJ A;  1U3A A;  2H6Z A;  2YPM A;  2C0G A;  2QSI A;  2C0E A;  1OC9 A;  2P31 A;  1O7U A;  3L9V A;  4FIW A;  4QQ7 A;  4NHW A;  4LL1 B;  2JZT A;  1ERV A;  1GTI A;  2GVP A;  4XIH A;  5G1L A;  4P3Y B;  3RBT A;  4TR4 A;  1Y6E A;  3IR4 A;  3W6G A;  1DE2 A;  5AIS A;  1F3B A;  1A8L A;  2H70 A;  1DUG A;  1A2M A;  3CTG A;  1Q98 A;  3GKM A;  5ELG A;  2P5R A;  2E2M A;  2MMO A;  4EVM A;  1IYH A;  4ULX A;  4IJI A;  1N8J A;  2JL4 A;  3QR6 A;  2H1G A;  1SK0 A;  2IMK A;  1SKS B;  3QCP A;  5IMD A;  5A4V A;  3TKS E;  5IOX A;  1Z6M A;  4FYU A;  3ZML A;  3F8U A;  2NVL A;  3BCK A;  2YV9 A;  1QXH A;  1URM A;  2FY6 A;  3Q74 A;  1ZMA A;  3IBH A;  4AGS A;  3IHQ A;  2H1A A;  4QL7 A;  2VUP A;  1THX A;  4GSS A;  5LD0 A;  3FZA A;  2OAC A;  2IMI A;  3F3Q A;  2L57 A;  1X5C A;  4MP4 A;  4TR0 A;  5IO2 A;  6GSX A;  2M80 A;  5HR1 A;  4ZXG A;  2HZE B;  4F03 A;  3HD5 A;  1M99 A;  2FUG 2;  4HS1 A;  2FWH A;  3CXG A;  3P7X A;  2HI7 A;  3DML A;  3GKX A;  4G10 A;  3VWU A;  3D6I A;  4LA1 A;  5FHI A;  4AF2 A;  4BWQ A;  4MZC A;  3ZRE A;  3M0F A;  3VI7 A;  2C3N A;  2DJ1 A;  2H01 A;  2H1B A;  2MMN A;  2O8V B;  4GTU A;  4HQS A;  5F05 A;  5ECN B;  2HZF A;  3F3R A;  1A0F A;  1IYI A;  3BOA A;  3UEM A;  1YQ1 A;  1LJR A;  3FZ9 A;  1ZL9 A;  4CHS A;  4NXI A;  4PUA A;  4JE1 A;  1XBS A;  1GNW A;  5C00 A;  4FYC A;  2DJ2 A;  4MJB A;  5H5S A;  3GMF A;  5IOW A;  3KIJ A;  2IMD A;  1A8Y A;  4I8B A;  1PQN A;  1PN9 A;  3ME7 A;  3VWW A;  4NWY A;  4POM A;  5DBQ A;  2PER A;  2GQL A;  1GLQ A;  1X0R A;  4IEL A;  1F2E A;  1O8W A;  2RM6 A;  2FWF A;  3BJ5 A;  2QGV A;  3E9J B;  3C1R A;  1MDI A;  3LEF A;  1T4Y A;  2MMA A;  1V58 A;  3EUR A;  3QPM A;  2L6D A;  1JLW A;  6GSW A;  5KN0 A;  3QFB C;  2LJK A;  1SL0 B;  3TKS A;  1GTA A;  4KSM A;  1VF3 A;  4MCU A;  1K0D A;  2CVK A;  5DAK B;  2H76 A;  2P5Q A;  1M9A A;  1SD8 A;  3QDN A;  4X0X A;  3EVI A;  2VL2 A;  3CTF A;  2QC7 A;  2KHP A;  1ZZY A;  5ELA A;  3HZ4 A;  2DML A;  2NBS A;  2CZ3 A;  3RPP A;  2C4J A;  1O6J A;  2VM1 A;  4L8E A;  4PXO A;  1VGL A;  1W89 A;  5COH A;  1N2A A;  2FA4 A;  2CQ9 A;  2E2G A;  3DEX A;  2GSS A;  2CZ2 A;  3IV4 A;  4ZBD A;  2B3S A;  4TN8 A;  1XVQ A;  2H30 A;  5EVO A;  3KH9 A;  3IXR A;  1U3I A;  3HY2 A;  4AJ6 A;  2AV4 A;  4KSO A;  5D9W A;  1CQH A;  4XRD A;  5IPG A;  3HJP A;  2DJJ A;  2H66 A;  3LG6 A;  3TRX A;  3QOU A;  2XBQ A;  2CA8 A;  3VPT A;  4Q5Q A;  2EC4 A;  4O5R A;  4EUY A;  5G2Z A;  5JWQ B;  5ECM B;  2LQQ A;  3IK7 A;  4K1F A;  3F6D A;  3A3T A;  4TW5 A;  4J2F A;  5A5K A;  4KGI A;  3G7J A;  4RUV A;  1XWC A;  4GLT A;  5DJM A;  2K18 A;  1M2D A;  5DAL A;  4V2M A;  5G5E A;  2QKE A;  1CQG A;  1QMV A;  4OMV A;  4WXT A;  3WGE A;  1AIU A;  3GN3 A;  3HYP A;  2C1Y A;  1WJK A;  3H79 A;  4JRR A;  4TXO B;  1GSY A;  4GQC A;  4XCS A;  1U88 A;  1AAZ A;  3GSS A;  3KMO A;  3I43 A;  4EE0 A;  4HZ4 A;  3UBL A;  5CRD A;  3H4K A;  3TJB A;  2V2G A;  2HRF A;  5D8I A;  2FWG A;  1WMJ A;  4Q5F A;  3ZLP A;  4WR5 A;  4RQX A;  2F51 A;  2IL3 A;  3IK9 A;  3VK9 A;  2WS2 A;  2V6O A;  2K9F A;  5B7C A;  1JHB A;  3TDG A;  1R7H A;  4NPB A;  4ISD A;  2IPA A;  5KEJ A;  2PMT A;  3GL3 A;  2L4C A;  2HNL A;  2OE3 A;  2Z9S A;  4L5O A;  3UIW A;  4H86 A;  3U6V A;  1YKC A;  3ZIV A;  1GH2 A;  4K7I A;  4V1A p;  3EWL A;  1TW9 A;  1GSE A;  3TUE A;  2REM A;  5F8B A;  1MEK A;  4WBR D;  3NIV A;  3TRQ A;  2VCQ A;  2DMM A;  6GST A;  5EY6 A;  2G2Q A;  1EGO A;  4KDU A;  3HXS A;  5LCZ A;  3K8N A;  2YP6 A;  4OWY A;  4FO5 A;  1G0T A;  2JSZ A;  4GXZ A;  1GSF A;  5DDL A;  3APO A;  3F4S A;  4V2N A;  11GS A;  1Y25 A;  3HVV A;  1EEM A;  2F3M A;  4X1U A;  4ZB6 A;  5FT3 A;  4IP1 A;  1PRX A;  3EU4 A;  1WRY A;  5G1K A;  3TJK A;  1OKD A;  2NDO A;  3KJY A;  1O85 A;  3GX8 A;  5ECQ B;  4E8E A;  3UAP A;  1UC7 A;  2DIY A;  2JZS A;  5G30 A;  1EOG A;  3LYP A;  1AW9 A;  3LXZ A;  5DCG A;  3CSJ A;  5HR0 A;  2B1K A;  3VWX A;  1UA5 A;  4ECJ A;  1SKW B;  2FLS A;  3QMX A;  5CNW A;  3ERF A;  1FO5 A;  4PUF C;  2KUC A;  3KGK A;  2L4Q A;  1TRV A;  1G7O A;  2O7K A;  3BD2 A;  3GFK A;  22GS A;  2CAQ A;  1XZO A;  3KTL A;  4K7N A;  3ZMK A;  4XRA A;  5GSS A;  1I5G A;  5D73 A;  1BJX A;  2GGT A;  2YWI A;  3PGT A;  3TGZ A;  10GS A;  1GNE A;  2MZC A;  1GWC A;  1YEP A;  5E59 A;  1PGT A;  5ECK B;  2AUV A;  2YWN A;  2N5F A;  4TR3 A;  1TXX A;  1HQO A;  2GST A;  2R4V A;  3LJR A;  1U6T A;  4WR4 A;  4O32 A;  1Z9H A;  2B7J A;  3A2V A;  5CRW A;  2C0D A;  2VIM A;  4LMV A;  2FD3 A;  1XWA A;  2I4A A;  2EIR A;  3ED3 A;  4D73 B;  2R3X A;  5ABR A;  1YDK A;  4LMW A;  1EP7 A;  4EDZ A;  1R26 A;  3L9U A;  1JZD A;  2IFQ B;  4F0B A;  4POB A;  2BJX A;  2H75 A;  4BPY A;  1QK8 A;  1XCC A;  2XC2 A;  3FEU A;  3APS A;  1GSS A;  2YAN A;  1I9D A;  1M2B A;  2O85 A;  6GSU A;  1AXD A;  2LJR A;  2L5O A;  5FWG A;  3FW2 A;  4Z7X A;  5ECR B;  2CT6 A;  2K8S A;  1X5D A;  1MDK A;  4ZB8 A;  4GST A;  2VLV A;  3LYK A;  1BX9 A;  1M2A A;  3F0I A;  3MWH A;  2H6Y A;  1GRX A;  3W8S A;  1GP1 A;  1OKT A;  4O92 A;  2R5G A;  4ZIL A;  4ZB9 A;  2CVD A;  3KXO A;  1TOF A;  4NV2 A;  4TR1 B;  4YH2 A;  4WF5 A;  3TKQ A;  1MD3 A;  2OKA A;  1R5A A;  1PX7 A;  3Q6O A;  1YY7 A;  2N5A A;  3D4M A;  3TB2 A;  4Q5N A;  1ST9 A;  3TCO A;  2JU5 A;  4KE3 A;  2LQO A;  1LBK A;  4XS1 A;  4QL9 A;  2HSY A;  2X8C A;  1PA3 A;  5DQS A;  1OAZ A;  1WP0 A;  1SJ6 A;  4DVC A;  3E3E A;  3CMI A;  4MMM A;  1S3A A;  1TDI A;  5ID2 A;  2RUE A;  2LNT A;  1X9S B;  4KUN A;  2P0G A;  4G2E A;  2ON7 A;  3KH7 A;  1K0O A;  3IRA A;  3GHA A;  1ILO A;  1U87 A;  3WYW A;  1ZOF A;  1TI3 A;  3V1W A;  1OC9 B;  1JLV A;  4MPF A;  5GAN D;  1BQ7 A;  1K3O A;  3ZIJ A;  1QUW A;  4IKH A;  2MYG A;  4KDY A;  3VPQ A;  2K8V A;  2B5E A;  2J23 A;  1RW1 A;  1A23 A;  3GUS A;  3OR5 A;  2HYX A;  2GLR A;  3EMX A;  1Z5Y E;  4YAP A;  3M3M A;  4MH3 A;  2GS3 A;  3ZYW A;  3J7Y k;  1S3C A;  5HFI A;  1O8X A;  1JFU A;  2GSQ A;  2OA7 A;  2G0F A;  2GSR A;  2X64 A;  1YF0 A;  5F06 A;  1BYE A;  4EL1 A;  2RUF A;  3GYK A;  3TJJ A;  1E6B A;  3U5R E;  1YJ6 A;  2XBI A;  1PL1 A;  1XWK A;  3PH9 A;  2JAC A;  2HLS A;  3F9U A;  5HR2 A;  2H0G A;  5C04 A;  5B8A A;  1Z6N A;  1GSU A;  2L59 A;  2VL9 A;  2OBI A;  2DC5 A;  2LRC A;  1ZYE A;  1WIK A;  1ZCP A;  5EL8 A;  1A24 A;  2LV3 A;  2GQM A;  3EE2 A;  1PX6 A;  2DJK A;  2CAI A;  5D9X A;  1XPV A;  1X5E A;  1Z3E A;  3LSZ A;  4N30 A;  5D9T A;  1GTB A;  1PSQ A;  3NOF A;  2HXK A;  3KMN A;  5A4W A;  5GST A;  3GL5 A;  3FK8 A;  4OFT A;  4TXV A;  5IMC A;  3CRT A;  3TOU A;  2WRT A;  2JSY A;  3GIX A;  4FH8 A;  3ZTL A;  2LST A;  4PGT A;  4PX1 A;  3GTU A;  1TK5 B;  2V6K A;  3DYR A;  2I3Y A;  3US3 A;  5IMF A;  4WET A;  4HZ2 A;  5JCU A;  1EZK A;  1MDJ A;  1K0A A;  4YAV A;  3GX0 A;  1SK1 A;  4KW6 A;  5IMZ A;  2YJ7 A;  3ERG A;  4TRX A;  1YEX A;  4K0N A;  1O81 A;  2GQK A;  1ERU A;  5IO0 A;  5J5N A;  2KP2 A;  3FHK A;  3C71 A;  4MJE A;  3IC4 A;  1ML6 A;  2H8L A;  1K3L A;  2CV4 A;  1RK4 A;  5ECO B;  5GZZ B;  2DLX A;  3H1N A;  3Q19 A;  1M7T A;  5F0G A;  4OCF A;  2OJL A;  2IME A;  3ISO A;  3FR6 A;  13GS A;  2HRN A;  3IE3 A;  4KAE A;  4ML1 A;  5KN1 A;  1DBY A;  2WUL A;  1X9W B;  4L0U A;  5HFG A;  3UVT A;  2H19 A;  1ABA A;  4MAB A;  1OC8 A;  5JWO B;  1QGV A;  2H0H A;  1Z7P A;  2J9H A;  2KOK A;  3H93 A;  5HFK A;  3WGD A;  4BL7 A;  1GSD A;  3GST A;  2TIR A;  1TU7 A;  2YNX A;  5H5R A;  4K0G A;  4DSS A;  4BA7 A;  2ZCT A;  3IOS A;  5G5F A;  2H71 A;  2TRX A;  2IIY A;  3G7I A;  2VCX A;  4OCE A;  3UVH A;  2FNO A;  4HU7 A;  1SJI A;  2M72 A;  3DVW A;  3CRU A;  5CP1 A;  3L78 A;  1V9W A;  3IA1 A;  3LFL A;  3VUR A;  4MZB A;  3TRP A;  2V1M A;  4WKW A;  1FB0 A;  4JR4 A;  4PQ1 A;  1H75 A;  4HUA A;  4MH2 A;  4TKY A;  4CDO A;  3GNJ A;  2D2Z A;  2WFC A;  1SK2 A;  2XPE A;  4OD7 A;  4ZL7 A;  3M9J A;  2X8H A;  1GL8 A;  4YQU A;  4IVF A;  2YWO A;  2VCT A;  2YN1 A;  1LU4 A;  3LXT A;  1MTC A;  1T4Z A;  2PGT A;  4IN0 A;  4ECB A;  3QAG A;  1VF2 A;  1R5P A;  1B9Y C;  1GTU A;  4DEJ A;  1NM3 A;  4EC0 A;  1VF4 A;  1B8X A;  1FVK A;  4IP6 A;  3APQ A;  2H73 A;  5E4W A;  1T3B A;  4BVY A;  4HU9 A;  2A2R A;  2A2S A;  4ZIJ A;  3TKP A;  1TI1 A;  3EIN A;  2OE0 A;  4NV5 A;  1RQM A;  4MJA A;  1K0C A;  2H72 A;  2I81 A;  3BCI A;  5DAL B;  1SL1 B;  2GTU A;  4IW9 A;  2RLI A;  4ZL8 A;  2OBK A;  5H5Q A;  1K0B A;  3HCZ A;  2F8F A;  4ZL9 A;  3PR8 A;  2YOI A;  5B8B A;  2ON5 A;  3DGQ A;  3P8W A;  2H74 A;  1T7P B;  1TU8 A;  4IHU A;  4BWS A;  1V40 A;  4XTS A;  4MF5 A;  1FHE A;  1YZX A;  1ACV A;  3UJ1 A;  3EYT A;  1SD9 A;  2AYT A;  17GS A;  2NPB A;  1PKW A;  5IIZ A;  5JCG A;  3WGX A;  3TJF A;  3MDK A;  1XW6 A;  5CRE A;  2YJH A;  1X9M B;  1S3D A;  1EP8 A;  1GUM A;  2IN3 A;  2H0I A;  3D21 A;  4POL A;  4MF7 A;  2IWT A;  4Q5R A;  3S9F A;  3IPZ A;  4PQI A;  2MBT A;  2GT5 A;  3HHV A;  4XS4 B;  2VM2 A;  2JZR A;  1J0F A;  3LOR A;  1AQV A;  5B6M A;  5D9V A;  1KBN A;  2IJY A;  3EC3 A;  1FOV A;  12GS A;  2OAD A;  2HE3 A;  4EO3 A;  4MK3 A;  1ON4 A;  1QFN A;  4KCE A;  4KCA A;  2PU9 C;  1J9B A;  2LKU A;  2DJ3 A;  2LUS A;  2R37 A;  3PIN A;  4HEA 2;  3O76 A;  1DE1 A;  2AAW A;  1FG4 A;  2C0F A;  1FB6 A;  1ZYQ B;  2PVQ A;  1XXU A;  5IMA A;  2WJU A;  4F82 A;  4K6X A;  3ZZX A;  4MA9 A;  1EV4 A;  1DSB A;  4EXJ A;  3F63 A;  3GKK A;  1OYJ A;  2HZE A;  4HOJ A;  4L0W A;  2B5X A;  2K6V A;  4ACS A;  5CAX A;  1OE8 A;  5EPF A;  5DQY A;  3LQ7 A;  3VFI A;  6GSV A;  2AHE A;  2X8G A;  1ERW A;  5IPH A;  3QFA C;  2L6C A;  3KZQ A;  3D22 A;  2E0Q A;  3VWV A;  5D96 A;  9GSS A;  1THO A;  4KDX A;  1G7E A;  1T1V A;  4I5Q A;  2YZU A;  1BAY A;  1XOB A;  3QAW A;  1XWB A;  3R2Q A;  5DCH A;  5LNK e;  4OFN A;  2EIQ A;  1TRU A;  4RQR A;  2B5Y A;  4XHM A;  3I9V 2;  1AUC A;  3DKS A;  3GV1 A;  4IQA A;  5A4U A;  3BBY A;  1KTE A;  3F4T A;  4N0Z A;  2IMF A;  3ZFB A;  4GWR A;  3RHB A;  2BMX A;  2WCI A;  3FYG A;  4ILF A;  5IQY A;  2AJQ B;  5J3R A;  4PQH A;  4IBP A;  4K7O A;  2OE1 A;  2LTK A;  3FY7 A;  1VRS D;  2KP1 A;  2I9H A;  5KN2 A;  1O73 A;  5HQP A;  1OE7 A;  2HSH A;  4TVE A;  4IJ3 A;  2LRT A;  1A2L A;  3DWV A;  3HJM A;  1PKZ A;  4KX4 A;  3ZL5 A;  1SYR A;  5ENU A;  1F37 A;  1KNG A;  5DAK A;  4ZBA A;  1V2A A;  4LLR A;  2NTO A;  1HD2 A;  4IS0 A;  3P90 A;  2N5B A; 
#chains in the Genus database with same CATH topology
 4J57 E;  1SEN A;  1NHY A;  2C3T A;  1JZW A;  3KP8 A;  1K3Y A;  5AN1 A;  1YF1 A;  4JZQ A;  1USB A;  4MF6 A;  4X43 A;  4A5P A;  4OFM A;  4L5L A;  3GH9 A;  3I69 A;  1UVZ A;  3CBU A;  4KB3 A;  1K0M A;  1V57 A;  4HI7 A;  4Z2R A;  1ERT A;  4PNF A;  5JWR B;  2YZH A;  4EIP A;  3TJG A;  5J9C A;  2LJA A;  1F6M C;  1XVW A;  4IGJ A;  4MLY A;  3ZIT A;  2YWM A;  1OC3 A;  2R2J A;  5B6N A;  2GDR A;  3NZN A;  5AIX A;  5F07 A;  3TKR A;  14GS A;  2ZNM A;  3M1G A;  4I2U A;  2GZZ A;  2B1L A;  2YCD A;  2UZ8 A;  3G9B A;  1V98 A;  3F6F A;  1NW2 A;  4ZBB A;  8GSS A;  3AY8 A;  3TKS C;  3IAM 2;  3RPN A;  3A2W A;  4KH7 A;  3SBC A;  1YKA A;  3RHC A;  2EIO A;  5ECH B;  2A4V A;  1B4P A;  1WOU A;  2DJ0 A;  2RII A;  1HNA A;  2VL2 C;  4GSN A;  1TRS A;  1Z7R A;  1HNB A;  3GUR A;  1B4Q A;  4RI7 A;  1BED A;  1XW5 A;  3HJO A;  3HDC A;  4BVX A;  2H1D A;  4ML6 A;  2HFD A;  4KA0 A;  5HR3 A;  2WB9 A;  4K9Z A;  1TRW A;  3DRN A;  2C3Q A;  1EWX A;  3HVN A;  1JZO A;  2BTO T;  3KTB A;  2V32 A;  5ID2 B;  1EGR A;  4PUR A;  4AJ8 A;  1FVJ A;  2WZ9 A;  3J7Y b;  1EV9 A;  3I6A A;  4WF4 A;  1Q4J A;  2VD1 A;  3JCM L;  4TXO A;  3C1S A;  5J9B A;  1TTZ A;  3G7Y A;  1F9M A;  1GUH A;  4K2D A;  2X99 A;  4IQ1 A;  4NMU A;  3FZ5 A;  3UMA A;  2ES7 A;  4ID0 A;  3GRX A;  5CRH A;  4GQF A;  4V2L A;  3D5J A;  3F4R A;  5ECL B;  2PN8 A;  3FR3 A;  4F9Z A;  4ECI A;  3UL3 A;  1GUK A;  4JBB A;  19GS A;  4K8M A;  4LL4 B;  4XS6 A;  3MAK A;  3ME8 A;  1UN2 A;  4ICY A;  3CSH A;  3L4N A;  1GSQ A;  3ZVJ D;  3KEB A;  2DBC A;  1NHO A;  4MDC A;  1XOA A;  2VOC A;  4MZW A;  1SU9 A;  3A5I A;  1SL2 B;  4G9H A;  2V41 A;  2MMZ A;  1WE0 A;  2LNS A;  3ZVJ A;  3C8E A;  4EF0 A;  1XFL A;  1G6Y A;  2DIZ A;  2VLT A;  3N5O A;  1G6W A;  5J41 A;  4EKZ A;  2CX3 A;  2VAF A;  2CX4 A;  3CSI A;  4EDY A;  3QD9 A;  2ZUP A;  2RM5 A;  5CO3 A;  18GS A;  3RDW A;  1PL2 A;  4I2T A;  4K5R A;  2LEG A;  2QA1 A;  4HQZ A;  4TOP A;  3FZ4 A;  3E0U A;  1R4W A;  16GS A;  2FHE A;  4X4J A;  4AJ7 A;  1QQ2 A;  3PPU A;  1A2J A;  4ECC A;  2KLX A;  7GSS A;  5D93 A;  2DSA A;  3LWA A;  1SJZ A;  3HKR A;  2MBS A;  4E8H A;  2PPT A;  4RI6 A;  1B48 A;  2C8U A;  1XW9 A;  4GRF A;  1XIY A;  2HRA A;  1KEB A;  5CYY A;  2GT6 A;  2R0C A;  5AIV A;  3KCM A;  1TK0 B;  2B7K A;  1OVN A;  1AQW A;  2H6X A;  4N11 A;  2PUK C;  2FWE A;  1EOH A;  2FCH A;  3D4T A;  2C80 A;  1TP9 A;  1JZR A;  1NSW A;  2VCV A;  3CYN A;  3GTU B;  1B9X C;  1PMT A;  3TOT A;  2VCZ A;  3L9S A;  2F8A A;  4POK A;  3ZRD A;  3W8J A;  3FRC A;  4KND A;  4JU5 A;  1E2Y A;  1GLP A;  1WWJ A;  3MSZ A;  3A2X A;  1M9B A;  4V1A g;  4PNG A;  2LRN A;  3HA9 A;  2PWJ A;  2L5L A;  4BIK A;  6GSS A;  3SWL A;  4XS4 A;  1AQX A;  1F3A A;  3DIE A;  1K0N A;  4CW9 A;  4DSQ A;  2M46 A;  2HT9 A;  2PVO C;  2VCW A;  3IDV A;  3VLN A;  5DJL A;  3MNG A;  4JED A;  3KP9 A;  5ECS A;  3FMW A;  1W4V A;  3UBK A;  1EEJ A;  2YV7 A;  4I6X A;  4JR6 A;  3KM6 A;  5IM9 A;  3RAZ A;  2FGX A;  3DXB A;  5L71 A;  4WEY A;  4WBJ A;  3ERW A;  5J4U A;  4D73 A;  4YQV A;  4N0V A;  1TJD A;  4DSR A;  1FAA A;  3D0Z A;  4DSS B;  3FKF A;  3O6T A;  3GA4 A;  3L0H A;  4I97 A;  1T8E B;  2IFQ A;  3UOM A;  3C73 A;  2R0G A;  3GKN A;  3C7M A;  3HVS A;  4J56 E;  1J08 A;  3UAR A;  6GSY A;  3M8N A;  2WDU A;  1GUL A;  3DVX A;  2GZY A;  3EPT A;  3Q18 A;  2GZP A;  3DD3 A;  2AB6 A;  2CVB A;  1AC1 A;  2I1U A;  3VI5 A;  1MD4 A;  1HNC A;  1FW1 A;  4OO4 A;  1TKD B;  3HVX A;  4GF0 A;  1PD2 1;  2LS5 A;  4F2I A;  2VO4 A;  1M0U A;  1SKR B;  3GH6 A;  1WPI A;  5JCW A;  2VD0 A;  5IMV A;  1BG5 A;  2FA8 A;  5ECI B;  3EU3 A;  3ZFL A;  20GS A;  1T00 A;  3LGC A;  5INY A;  1H4O A;  5CRG A;  4GCI A;  2WGR A;  4YQM A;  3QAV A;  3O3T A;  4FYB A;  3WT2 A;  1C72 A;  2R6K A;  4MPG A;  4TR1 A;  4G19 A;  2O87 A;  1ZGN A;  4OO5 A;  2JAD A;  4O7H A;  2ALB A;  3KD0 A;  2TRC P;  1VF1 A;  3H8Q A;  3N9J A;  4PTS A;  3A5W A;  5G31 A;  2O89 A;  5ECP B;  1SYX A;  4BVY B;  1TK8 B;  4NAX A;  5KN3 A;  3FR9 A;  4NHZ A;  3EMP A;  3WD6 A;  2XHF A;  4HJ2 A;  5GAP D;  5BRT A;  3IAS 2;  1HYU A;  3P2A A;  1XWG A;  3IC8 A;  2XPD A;  4MJC A;  2VL3 A;  4HJM A;  2F9S A;  5DVB A;  3WT1 A;  2B6M A;  3M9K A;  5AGY A;  4N10 A;  2E7P A;  1A0R P;  4HDE A;  2VLU A;  2R0P A;  3HZ8 A;  4F0C A;  2PBJ A;  1U3A A;  2H6Z A;  2YPM A;  2C0G A;  2QSI A;  2C0E A;  1OC9 A;  2P31 A;  1O7U A;  3L9V A;  4FIW A;  4QQ7 A;  4NHW A;  4LL1 B;  2JZT A;  1ERV A;  1GTI A;  2GVP A;  4XIH A;  5G1L A;  4P3Y B;  3RBT A;  4TR4 A;  1Y6E A;  3IR4 A;  3W6G A;  1DE2 A;  5AIS A;  1F3B A;  1A8L A;  2H70 A;  1DUG A;  1A2M A;  3CTG A;  1Q98 A;  3GKM A;  5ELG A;  2P5R A;  2E2M A;  2MMO A;  3MYD A;  4EVM A;  1IYH A;  4ULX A;  4IJI A;  1N8J A;  2JL4 A;  3QR6 A;  2H1G A;  2A2P A;  1SK0 A;  2IMK A;  1SKS B;  3QCP A;  5IMD A;  5A4V A;  3TKS E;  5IOX A;  1Z6M A;  4FYU A;  3ZML A;  3F8U A;  2NVL A;  3BCK A;  2YV9 A;  1QXH A;  1URM A;  2FY6 A;  3Q74 A;  1ZMA A;  3IBH A;  4AGS A;  3IHQ A;  4G0I A;  2H1A A;  4QL7 A;  2VUP A;  1THX A;  2X4A A;  4GSS A;  5LD0 A;  3FZA A;  2OAC A;  2IMI A;  3F3Q A;  2L57 A;  1X5C A;  4MP4 A;  4TR0 A;  5IO2 A;  6GSX A;  2M80 A;  5HR1 A;  4ZXG A;  2HZE B;  4F03 A;  3HD5 A;  1M99 A;  2FUG 2;  4HS1 A;  2FWH A;  3CXG A;  3P7X A;  4YKF A;  2HI7 A;  3DML A;  3GKX A;  4G10 A;  3VWU A;  3D6I A;  4LA1 A;  5FHI A;  4AF2 A;  4BWQ A;  4MZC A;  3ZRE A;  3M0F A;  3VI7 A;  2C3N A;  2DJ1 A;  2H01 A;  2H1B A;  2MMN A;  2O8V B;  4GTU A;  4HQS A;  5F05 A;  5ECN B;  2HZF A;  3F3R A;  1A0F A;  1IYI A;  3BOA A;  3UEM A;  1YQ1 A;  1LJR A;  3FZ9 A;  1ZL9 A;  4CHS A;  4NXI A;  4PUA A;  2HSM A;  4JE1 A;  1XBS A;  1GNW A;  5C00 A;  4FYC A;  1ZYP A;  2DJ2 A;  4MJB A;  5H5S A;  3GMF A;  5IOW A;  3KIJ A;  2IMD A;  1A8Y A;  4I8B A;  1PQN A;  1PN9 A;  3ME7 A;  3VWW A;  4NWY A;  4POM A;  5KOX A;  5DBQ A;  2PER A;  2GQL A;  1GLQ A;  1X0R A;  4IEL A;  1F2E A;  1O8W A;  2RM6 A;  2FWF A;  3BJ5 A;  2QGV A;  3E9J B;  3C1R A;  1MDI A;  3LEF A;  1T4Y A;  2MMA A;  1V58 A;  3EUR A;  3QPM A;  2L6D A;  1JLW A;  1XG8 A;  6GSW A;  5KN0 A;  3QFB C;  2LJK A;  1SL0 B;  3TKS A;  1GTA A;  4KSM A;  1VF3 A;  4MCU A;  1K0D A;  2CVK A;  5DAK B;  2H76 A;  2P5Q A;  1M9A A;  1SD8 A;  3QDN A;  4X0X A;  3EVI A;  2VL2 A;  3CTF A;  2QC7 A;  2KHP A;  1ZZY A;  5ELA A;  3HZ4 A;  2DML A;  2NBS A;  2CZ3 A;  3RPP A;  2C4J A;  1O6J A;  2VM1 A;  4L8E A;  4PXO A;  1VGL A;  1W89 A;  5COH A;  1N2A A;  2FA4 A;  2CQ9 A;  2E2G A;  3DEX A;  2GSS A;  2CZ2 A;  3IV4 A;  4ZBD A;  2B3S A;  4TN8 A;  1XVQ A;  2H30 A;  5EVO A;  3KH9 A;  3IXR A;  1U3I A;  3HY2 A;  4AJ6 A;  2AV4 A;  4KSO A;  5D9W A;  1CQH A;  4XRD A;  5IPG A;  3HJP A;  2DJJ A;  2H66 A;  3LG6 A;  3TRX A;  3QOU A;  1PFO A;  2XBQ A;  2CA8 A;  3VPT A;  4Q5Q A;  2EC4 A;  4O5R A;  4EUY A;  5G2Z A;  5JWQ B;  5ECM B;  2LQQ A;  3IK7 A;  4K1F A;  3F6D A;  3A3T A;  4TW5 A;  4J2F A;  5A5K A;  4KGI A;  4BVX B;  3G7J A;  4RUV A;  1XWC A;  4GLT A;  3IHG A;  5DJM A;  2K18 A;  1M2D A;  5DAL A;  4V2M A;  5G5E A;  2QKE A;  1CQG A;  1QMV A;  4OMV A;  4WXT A;  3WGE A;  1AIU A;  3GN3 A;  3HYP A;  2C1Y A;  1WJK A;  3H79 A;  4JRR A;  4TXO B;  1GSY A;  4GQC A;  4XCS A;  1U88 A;  1AAZ A;  3GSS A;  3KMO A;  3I43 A;  4EE0 A;  4HZ4 A;  3UBL A;  5CRD A;  3H4K A;  3TJB A;  2V2G A;  2HRF A;  5D8I A;  2FWG A;  1WMJ A;  4Q5F A;  3ZLP A;  4WR5 A;  4RQX A;  2F51 A;  2IL3 A;  3IK9 A;  3VK9 A;  2WS2 A;  2V6O A;  2K9F A;  5B7C A;  2DKH A;  1JHB A;  3TDG A;  1R7H A;  4NPB A;  4ISD A;  2IPA A;  5KEJ A;  2PMT A;  3GL3 A;  2L4C A;  2HNL A;  2OE3 A;  2Z9S A;  4L5O A;  3UIW A;  4H86 A;  3U6V A;  1YKC A;  4K5S A;  3ZIV A;  1GH2 A;  4K7I A;  4V1A p;  3EWL A;  1TW9 A;  1GSE A;  3TUE A;  2REM A;  5F8B A;  1MEK A;  4WBR D;  3NIV A;  3TRQ A;  2VCQ A;  2DMM A;  3CQF A;  6GST A;  5EY6 A;  2G2Q A;  1EGO A;  4KDU A;  3HXS A;  5LCZ A;  3K8N A;  4Z2T A;  2YP6 A;  4OWY A;  4FO5 A;  4BL7 B;  1G0T A;  2JSZ A;  4GXZ A;  1GSF A;  1S3R A;  5DDL A;  3APO A;  3F4S A;  4V2N A;  11GS A;  1Y25 A;  4EIQ A;  3HVV A;  1EEM A;  2F3M A;  4X1U A;  4ZB6 A;  5FT3 A;  4IP1 A;  1PRX A;  3EU4 A;  1WRY A;  2X49 A;  5G1K A;  3TJK A;  1OKD A;  2NDO A;  3KJY A;  1O85 A;  3GX8 A;  5ECQ B;  4E8E A;  3UAP A;  1UC7 A;  2DIY A;  2JZS A;  5G30 A;  1EOG A;  4G0K A;  4USS A;  3LYP A;  1AW9 A;  3LXZ A;  5DCG A;  3CSJ A;  5HR0 A;  2B1K A;  3VWX A;  1UA5 A;  4ECJ A;  1SKW B;  2FLS A;  3QMX A;  5CNW A;  3ERF A;  1FO5 A;  4PUF C;  2KUC A;  3KGK A;  2L4Q A;  1TRV A;  1G7O A;  2O7K A;  3BD2 A;  3GFK A;  1M3J A;  22GS A;  2CAQ A;  1XZO A;  3KTL A;  4K7N A;  3ZMK A;  4XRA A;  5GSS A;  1I5G A;  5D73 A;  1BJX A;  2GGT A;  2YWI A;  3PGT A;  3TGZ A;  10GS A;  4FQU A;  1GNE A;  2MZC A;  1GWC A;  1YEP A;  5E59 A;  1PGT A;  5ECK B;  2AUV A;  2YWN A;  2N5F A;  4TR3 A;  1TXX A;  1HQO A;  2GST A;  2R4V A;  3LJR A;  1U6T A;  4WR4 A;  4O32 A;  1Z9H A;  2B7J A;  3A2V A;  5CRW A;  2C0D A;  2VIM A;  4LMV A;  2FD3 A;  1XWA A;  2I4A A;  2DKI A;  2EIR A;  3ED3 A;  4D73 B;  2R3X A;  5ABR A;  1YDK A;  4LMW A;  1EP7 A;  4EDZ A;  1R26 A;  3L9U A;  1JZD A;  2IFQ B;  4F0B A;  4POB A;  2BJX A;  2H75 A;  4BPY A;  1QK8 A;  1XCC A;  2XC2 A;  3FEU A;  3APS A;  1GSS A;  2YAN A;  1I9D A;  1M2B A;  2O85 A;  6GSU A;  2A4H A;  1AXD A;  2LJR A;  2L5O A;  5FWG A;  3FW2 A;  4Z7X A;  5ECR B;  2CT6 A;  2K8S A;  1X5D A;  1MDK A;  4ZB8 A;  4GST A;  2VLV A;  3LYK A;  1BX9 A;  1M2A A;  3F0I A;  3MWH A;  2H6Y A;  1GRX A;  3W8S A;  1GP1 A;  1OKT A;  4O92 A;  2R5G A;  4ZIL A;  4ZB9 A;  2CVD A;  3KXO A;  1TOF A;  4NV2 A;  4TR1 B;  4YH2 A;  4WF5 A;  3TKQ A;  1MD3 A;  2OKA A;  1R5A A;  1PX7 A;  3Q6O A;  1YY7 A;  2N5A A;  3D4M A;  3TB2 A;  4Q5N A;  1ST9 A;  3TCO A;  2JU5 A;  4KE3 A;  2LQO A;  1LBK A;  4XS1 A;  4QL9 A;  2HSY A;  2X8C A;  1PA3 A;  5DQS A;  2QA2 A;  1OAZ A;  1WP0 A;  1SJ6 A;  4DVC A;  3E3E A;  3CMI A;  4MMM A;  1S3A A;  1TDI A;  5ID2 A;  2RUE A;  2LNT A;  1X9S B;  4KUN A;  2P0G A;  4G2E A;  2ON7 A;  3KH7 A;  1K0O A;  3IRA A;  3GHA A;  1ILO A;  1U87 A;  3WYW A;  1ZOF A;  1TI3 A;  3V1W A;  1OC9 B;  1JLV A;  4MPF A;  5GAN D;  1BQ7 A;  1K3O A;  3ZIJ A;  1QUW A;  4IKH A;  2MYG A;  4KDY A;  3VPQ A;  4HSC X;  2K8V A;  2B5E A;  2J23 A;  1RW1 A;  1A23 A;  3GUS A;  3OR5 A;  2HYX A;  2GLR A;  3EMX A;  1Z5Y E;  3LW9 A;  4YAP A;  3M3M A;  5BMU A;  4MH3 A;  2GS3 A;  3ZYW A;  3J7Y k;  1S3C A;  5HFI A;  1O8X A;  1JFU A;  2GSQ A;  2OA7 A;  2G0F A;  2GSR A;  2X64 A;  1YF0 A;  5F06 A;  1BYE A;  4EL1 A;  2RUF A;  3GYK A;  3TJJ A;  1E6B A;  3U5R E;  1YJ6 A;  2XBI A;  1PL1 A;  1XWK A;  3PH9 A;  2JAC A;  2HLS A;  3F9U A;  5HR2 A;  2H0G A;  5C04 A;  5B8A A;  4MNN A;  1Z6N A;  4K2X A;  1GSU A;  2L59 A;  2VL9 A;  2OBI A;  2DC5 A;  2LRC A;  1ZYE A;  1WIK A;  1ZCP A;  5EL8 A;  1A24 A;  2LV3 A;  2GQM A;  3EE2 A;  4YKG A;  1PX6 A;  2DJK A;  2CAI A;  5D9X A;  1XPV A;  1X5E A;  1Z3E A;  3LSZ A;  4N30 A;  5D9T A;  1GTB A;  1PSQ A;  3NOF A;  2HXK A;  3KMN A;  4O5Q A;  5A4W A;  5GST A;  3GL5 A;  3FK8 A;  4OFT A;  4TXV A;  4O5U A;  5IMC A;  3CRT A;  3TOU A;  2WRT A;  2JSY A;  3GIX A;  4FH8 A;  3ZTL A;  2LST A;  4PGT A;  4PX1 A;  3GTU A;  1TK5 B;  2V6K A;  3DYR A;  2I3Y A;  3US3 A;  5IMF A;  4WET A;  4HZ2 A;  5JCU A;  1EZK A;  1MDJ A;  1K0A A;  4YAV A;  3GX0 A;  1SK1 A;  4KW6 A;  5IMZ A;  2YJ7 A;  3ERG A;  4TRX A;  1YEX A;  4K0N A;  1O81 A;  2GQK A;  1ERU A;  5IO0 A;  5J5N A;  2KP2 A;  3FHK A;  3C71 A;  4MJE A;  3IC4 A;  1ML6 A;  2H8L A;  1K3L A;  2CV4 A;  1RK4 A;  5ECO B;  5GZZ B;  2DLX A;  3H1N A;  3Q19 A;  1M7T A;  5F0G A;  4OCF A;  2OJL A;  2IME A;  3ISO A;  3FR6 A;  13GS A;  2HRN A;  3IE3 A;  4KAE A;  4ML1 A;  5KN1 A;  1DBY A;  2WUL A;  1X9W B;  4L0U A;  5HFG A;  3UVT A;  2H19 A;  1ABA A;  4MAB A;  1OC8 A;  5JWO B;  1QGV A;  2H0H A;  1Z7P A;  2J9H A;  2KOK A;  3H93 A;  5HFK A;  3WGD A;  4BL7 A;  1GSD A;  3GST A;  2TIR A;  1TU7 A;  2YNX A;  5H5R A;  4K0G A;  4DSS A;  4BA7 A;  2ZCT A;  3IOS A;  3MIX A;  5G5F A;  2H71 A;  2TRX A;  2IIY A;  3G7I A;  2VCX A;  4OCE A;  3UVH A;  2FNO A;  4HU7 A;  1SJI A;  2M72 A;  3DVW A;  3CRU A;  5CP1 A;  3L78 A;  1V9W A;  3IA1 A;  3LFL A;  3VUR A;  4MZB A;  3TRP A;  2V1M A;  4WKW A;  1FB0 A;  4JR4 A;  4PQ1 A;  1H75 A;  4HUA A;  4MH2 A;  4TKY A;  4CDO A;  3GNJ A;  2D2Z A;  2WFC A;  1SK2 A;  2XPE A;  4OD7 A;  4ZL7 A;  3M9J A;  2X8H A;  1GL8 A;  4YQU A;  4IVF A;  2YWO A;  2VCT A;  2YN1 A;  1LU4 A;  3LXT A;  1MTC A;  1T4Z A;  2PGT A;  4IN0 A;  4ECB A;  3QAG A;  1VF2 A;  1R5P A;  1B9Y C;  1GTU A;  4DEJ A;  1NM3 A;  3R3E A;  4EC0 A;  1VF4 A;  1B8X A;  1FVK A;  4IP6 A;  3APQ A;  2H73 A;  5E4W A;  1T3B A;  4BVY A;  4HU9 A;  2A2R A;  2A2S A;  4ZIJ A;  3TKP A;  1TI1 A;  3EIN A;  2OE0 A;  4NV5 A;  1RQM A;  4MJA A;  1K0C A;  2H72 A;  2I81 A;  3BCI A;  5DAL B;  1SL1 B;  2GTU A;  4IW9 A;  2RLI A;  4ZL8 A;  2OBK A;  5H5Q A;  1K0B A;  3HCZ A;  2F8F A;  4ZL9 A;  3PR8 A;  2YOI A;  5B8B A;  2ON5 A;  3DGQ A;  3P8W A;  2H74 A;  1T7P B;  1TU8 A;  4IHU A;  4BWS A;  1V40 A;  4XTS A;  4MF5 A;  1FHE A;  1YZX A;  1ACV A;  3UJ1 A;  3EYT A;  1SD9 A;  2AYT A;  17GS A;  2NPB A;  1PKW A;  5IIZ A;  5JCG A;  3WGX A;  3TJF A;  3MDK A;  1XW6 A;  5CRE A;  2YJH A;  1X9M B;  1S3D A;  1EP8 A;  1GUM A;  2IN3 A;  2H0I A;  4KF9 A;  3D21 A;  4POL A;  4MF7 A;  2IWT A;  4Q5R A;  3S9F A;  3IPZ A;  4PQI A;  2MBT A;  2GT5 A;  3HHV A;  4XS4 B;  2VM2 A;  2JZR A;  1J0F A;  3LOR A;  1AQV A;  5B6M A;  5D9V A;  1KBN A;  2IJY A;  3EC3 A;  1FOV A;  4CY8 A;  12GS A;  2OAD A;  2HE3 A;  4EO3 A;  4MK3 A;  1ON4 A;  1QFN A;  4KCE A;  4KCA A;  2PU9 C;  1J9B A;  2LKU A;  2DJ3 A;  2LUS A;  2R37 A;  3PIN A;  4HEA 2;  3O76 A;  1DE1 A;  2AAW A;  1FG4 A;  2C0F A;  1FB6 A;  1ZYQ B;  2PVQ A;  1XXU A;  5IMA A;  2WJU A;  4F82 A;  1ZYN A;  4K6X A;  3ZZX A;  4MA9 A;  1EV4 A;  1DSB A;  4EXJ A;  3F63 A;  3GKK A;  1OYJ A;  2HZE A;  4HOJ A;  4L0W A;  5KOW A;  2B5X A;  2K6V A;  4ACS A;  5CAX A;  1OE8 A;  5EPF A;  3LQ7 A;  5DQY A;  3VFI A;  6GSV A;  2AHE A;  2X8G A;  1ERW A;  5IPH A;  3QFA C;  2L6C A;  3KZQ A;  3D22 A;  2E0Q A;  3VWV A;  5D96 A;  9GSS A;  1THO A;  4KDX A;  1G7E A;  1T1V A;  4I5Q A;  2YZU A;  1BAY A;  1XOB A;  3QAW A;  1XWB A;  3R2Q A;  2HRK A;  5DCH A;  5LNK e;  4OFN A;  2EIQ A;  1TRU A;  4RQR A;  2B5Y A;  4XHM A;  3I9V 2;  1AUC A;  3DKS A;  1PN0 A;  3GV1 A;  4IQA A;  5A4U A;  3BBY A;  1KTE A;  3F4T A;  4N0Z A;  2IMF A;  3ZFB A;  4GWR A;  3RHB A;  4Z2U A;  1FOH A;  2BMX A;  2WCI A;  3FYG A;  4ILF A;  5IQY A;  2AJQ B;  5J3R A;  4PQH A;  4IBP A;  4K7O A;  2OE1 A;  2LTK A;  3FY7 A;  1VRS D;  1M3I A;  2KP1 A;  2I9H A;  5KN2 A;  1O73 A;  5HQP A;  1OE7 A;  2HSH A;  4TVE A;  4IJ3 A;  2LRT A;  1A2L A;  4G0L A;  3DWV A;  4CY6 A;  3HJM A;  1PKZ A;  4KX4 A;  3ZL5 A;  1SYR A;  5ENU A;  1F37 A;  1KNG A;  5DAK A;  4ZBA A;  1V2A A;  4LLR A;  2NTO A;  1HD2 A;  4IS0 A;  3P90 A;  2N5B A; 
#chains in the Genus database with same CATH homology
 4J57 E;  1SEN A;  1NHY A;  2C3T A;  1JZW A;  3KP8 A;  1K3Y A;  5AN1 A;  1YF1 A;  4JZQ A;  1USB A;  4MF6 A;  4X43 A;  4A5P A;  4OFM A;  4L5L A;  3GH9 A;  3I69 A;  1UVZ A;  3CBU A;  4KB3 A;  1K0M A;  1V57 A;  4HI7 A;  4Z2R A;  1ERT A;  4PNF A;  5JWR B;  2YZH A;  4EIP A;  3TJG A;  5J9C A;  2LJA A;  1F6M C;  1XVW A;  4IGJ A;  4MLY A;  3ZIT A;  2YWM A;  1OC3 A;  2R2J A;  5B6N A;  2GDR A;  3NZN A;  5AIX A;  5F07 A;  3TKR A;  14GS A;  2ZNM A;  3M1G A;  4I2U A;  2GZZ A;  2B1L A;  2YCD A;  2UZ8 A;  3G9B A;  1V98 A;  3F6F A;  1NW2 A;  4ZBB A;  8GSS A;  3AY8 A;  3TKS C;  3IAM 2;  3RPN A;  3A2W A;  4KH7 A;  3SBC A;  1YKA A;  3RHC A;  2EIO A;  5ECH B;  2A4V A;  1B4P A;  1WOU A;  2DJ0 A;  2RII A;  1HNA A;  2VL2 C;  4GSN A;  1TRS A;  1Z7R A;  1HNB A;  3GUR A;  1B4Q A;  4RI7 A;  1BED A;  1XW5 A;  3HJO A;  3HDC A;  4BVX A;  2H1D A;  4ML6 A;  2HFD A;  4KA0 A;  5HR3 A;  2WB9 A;  4K9Z A;  1TRW A;  3DRN A;  2C3Q A;  1EWX A;  1JZO A;  2BTO T;  3KTB A;  2V32 A;  5ID2 B;  1EGR A;  4PUR A;  4AJ8 A;  1FVJ A;  2WZ9 A;  3J7Y b;  1EV9 A;  3I6A A;  4WF4 A;  1Q4J A;  2VD1 A;  3JCM L;  4TXO A;  3C1S A;  5J9B A;  1TTZ A;  3G7Y A;  1F9M A;  1GUH A;  4K2D A;  2X99 A;  4IQ1 A;  4NMU A;  3FZ5 A;  3UMA A;  2ES7 A;  4ID0 A;  3GRX A;  5CRH A;  4GQF A;  4V2L A;  3D5J A;  3F4R A;  5ECL B;  2PN8 A;  3FR3 A;  4F9Z A;  4ECI A;  3UL3 A;  1GUK A;  4JBB A;  19GS A;  4K8M A;  4LL4 B;  4XS6 A;  3MAK A;  3ME8 A;  1UN2 A;  4ICY A;  3CSH A;  3L4N A;  1GSQ A;  3ZVJ D;  3KEB A;  2DBC A;  1NHO A;  4MDC A;  1XOA A;  2VOC A;  4MZW A;  1SU9 A;  3A5I A;  1SL2 B;  4G9H A;  2V41 A;  2MMZ A;  1WE0 A;  2LNS A;  3ZVJ A;  3C8E A;  4EF0 A;  1XFL A;  1G6Y A;  2DIZ A;  2VLT A;  3N5O A;  1G6W A;  5J41 A;  4EKZ A;  2CX3 A;  2VAF A;  2CX4 A;  3CSI A;  4EDY A;  3QD9 A;  2ZUP A;  2RM5 A;  5CO3 A;  18GS A;  3RDW A;  1PL2 A;  4I2T A;  4K5R A;  2LEG A;  2QA1 A;  4HQZ A;  4TOP A;  3FZ4 A;  3E0U A;  1R4W A;  16GS A;  2FHE A;  4X4J A;  4AJ7 A;  1QQ2 A;  3PPU A;  1A2J A;  4ECC A;  2KLX A;  7GSS A;  5D93 A;  2DSA A;  3LWA A;  1SJZ A;  3HKR A;  2MBS A;  4E8H A;  2PPT A;  4RI6 A;  1B48 A;  2C8U A;  1XW9 A;  4GRF A;  1XIY A;  2HRA A;  1KEB A;  5CYY A;  2GT6 A;  2R0C A;  5AIV A;  3KCM A;  1TK0 B;  2B7K A;  1OVN A;  1AQW A;  2H6X A;  4N11 A;  2PUK C;  2FWE A;  1EOH A;  2FCH A;  3D4T A;  2C80 A;  1TP9 A;  1JZR A;  1NSW A;  2VCV A;  3CYN A;  3GTU B;  1B9X C;  1PMT A;  3TOT A;  2VCZ A;  3L9S A;  2F8A A;  4POK A;  3ZRD A;  3W8J A;  3FRC A;  4KND A;  4JU5 A;  1E2Y A;  1GLP A;  1WWJ A;  3MSZ A;  3A2X A;  1M9B A;  4V1A g;  4PNG A;  2LRN A;  3HA9 A;  2PWJ A;  2L5L A;  6GSS A;  3SWL A;  4XS4 A;  1AQX A;  1F3A A;  3DIE A;  1K0N A;  4CW9 A;  4DSQ A;  2M46 A;  2HT9 A;  2PVO C;  2VCW A;  3IDV A;  3VLN A;  5DJL A;  3MNG A;  4JED A;  3KP9 A;  5ECS A;  3FMW A;  1W4V A;  3UBK A;  1EEJ A;  2YV7 A;  4I6X A;  4JR6 A;  3KM6 A;  5IM9 A;  3RAZ A;  2FGX A;  3DXB A;  5L71 A;  4WEY A;  4WBJ A;  3ERW A;  5J4U A;  4D73 A;  4YQV A;  4N0V A;  1TJD A;  4DSR A;  1FAA A;  3D0Z A;  4DSS B;  3FKF A;  3O6T A;  3GA4 A;  3L0H A;  4I97 A;  1T8E B;  2IFQ A;  3UOM A;  3C73 A;  2R0G A;  3GKN A;  3C7M A;  3HVS A;  4J56 E;  1J08 A;  3UAR A;  6GSY A;  3M8N A;  2WDU A;  1GUL A;  3DVX A;  2GZY A;  3EPT A;  3Q18 A;  2GZP A;  3DD3 A;  2AB6 A;  2CVB A;  1AC1 A;  2I1U A;  3VI5 A;  1MD4 A;  1HNC A;  1FW1 A;  4OO4 A;  1TKD B;  3HVX A;  4GF0 A;  1PD2 1;  2LS5 A;  4F2I A;  2VO4 A;  1M0U A;  1SKR B;  3GH6 A;  1WPI A;  5JCW A;  2VD0 A;  5IMV A;  1BG5 A;  2FA8 A;  5ECI B;  3EU3 A;  3ZFL A;  20GS A;  1T00 A;  3LGC A;  5INY A;  1H4O A;  5CRG A;  4GCI A;  2WGR A;  4YQM A;  3QAV A;  3O3T A;  4FYB A;  3WT2 A;  1C72 A;  2R6K A;  4MPG A;  4TR1 A;  4G19 A;  2O87 A;  1ZGN A;  4OO5 A;  2JAD A;  4O7H A;  2ALB A;  3KD0 A;  2TRC P;  1VF1 A;  3H8Q A;  3N9J A;  4PTS A;  3A5W A;  5G31 A;  2O89 A;  5ECP B;  1SYX A;  4BVY B;  1TK8 B;  4NAX A;  5KN3 A;  3FR9 A;  4NHZ A;  3EMP A;  3WD6 A;  2XHF A;  4HJ2 A;  5GAP D;  5BRT A;  3IAS 2;  1HYU A;  3P2A A;  1XWG A;  3IC8 A;  2XPD A;  4MJC A;  2VL3 A;  4HJM A;  2F9S A;  5DVB A;  3WT1 A;  2B6M A;  3M9K A;  5AGY A;  4N10 A;  2E7P A;  1A0R P;  4HDE A;  2VLU A;  2R0P A;  3HZ8 A;  4F0C A;  2PBJ A;  1U3A A;  2H6Z A;  2YPM A;  2C0G A;  2QSI A;  2C0E A;  1OC9 A;  2P31 A;  1O7U A;  3L9V A;  4FIW A;  4QQ7 A;  4NHW A;  4LL1 B;  2JZT A;  1ERV A;  1GTI A;  2GVP A;  4XIH A;  5G1L A;  4P3Y B;  3RBT A;  4TR4 A;  1Y6E A;  3IR4 A;  3W6G A;  1DE2 A;  5AIS A;  1F3B A;  1A8L A;  2H70 A;  1DUG A;  1A2M A;  3CTG A;  1Q98 A;  3GKM A;  5ELG A;  2P5R A;  2E2M A;  2MMO A;  3MYD A;  4EVM A;  1IYH A;  4ULX A;  4IJI A;  1N8J A;  2JL4 A;  3QR6 A;  2H1G A;  2A2P A;  1SK0 A;  2IMK A;  1SKS B;  3QCP A;  5IMD A;  5A4V A;  3TKS E;  5IOX A;  1Z6M A;  4FYU A;  3ZML A;  3F8U A;  2NVL A;  3BCK A;  2YV9 A;  1QXH A;  1URM A;  2FY6 A;  3Q74 A;  1ZMA A;  3IBH A;  4AGS A;  3IHQ A;  4G0I A;  2H1A A;  4QL7 A;  2VUP A;  1THX A;  2X4A A;  4GSS A;  5LD0 A;  3FZA A;  2OAC A;  2IMI A;  3F3Q A;  2L57 A;  1X5C A;  4MP4 A;  4TR0 A;  5IO2 A;  6GSX A;  2M80 A;  5HR1 A;  4ZXG A;  2HZE B;  4F03 A;  3HD5 A;  1M99 A;  2FUG 2;  4HS1 A;  2FWH A;  3CXG A;  3P7X A;  4YKF A;  2HI7 A;  3DML A;  3GKX A;  4G10 A;  3VWU A;  3D6I A;  4LA1 A;  5FHI A;  4AF2 A;  4BWQ A;  4MZC A;  3ZRE A;  3M0F A;  3VI7 A;  2C3N A;  2DJ1 A;  2H01 A;  2H1B A;  2MMN A;  2O8V B;  4GTU A;  4HQS A;  5F05 A;  5ECN B;  2HZF A;  3F3R A;  1A0F A;  1IYI A;  3BOA A;  3UEM A;  1YQ1 A;  1LJR A;  3FZ9 A;  1ZL9 A;  4CHS A;  4NXI A;  4PUA A;  2HSM A;  4JE1 A;  1XBS A;  1GNW A;  5C00 A;  4FYC A;  1ZYP A;  2DJ2 A;  4MJB A;  5H5S A;  3GMF A;  5IOW A;  3KIJ A;  2IMD A;  1A8Y A;  4I8B A;  1PQN A;  1PN9 A;  3ME7 A;  3VWW A;  4NWY A;  4POM A;  5KOX A;  5DBQ A;  2PER A;  2GQL A;  1GLQ A;  1X0R A;  4IEL A;  1F2E A;  1O8W A;  2RM6 A;  2FWF A;  3BJ5 A;  2QGV A;  3E9J B;  3C1R A;  1MDI A;  3LEF A;  1T4Y A;  2MMA A;  1V58 A;  3EUR A;  3QPM A;  2L6D A;  1JLW A;  6GSW A;  5KN0 A;  3QFB C;  2LJK A;  1SL0 B;  3TKS A;  1GTA A;  4KSM A;  1VF3 A;  4MCU A;  1K0D A;  2CVK A;  5DAK B;  2H76 A;  2P5Q A;  1M9A A;  1SD8 A;  3QDN A;  4X0X A;  3EVI A;  2VL2 A;  3CTF A;  2QC7 A;  2KHP A;  1ZZY A;  5ELA A;  3HZ4 A;  2DML A;  2NBS A;  2CZ3 A;  3RPP A;  2C4J A;  1O6J A;  2VM1 A;  4L8E A;  4PXO A;  1VGL A;  1W89 A;  5COH A;  1N2A A;  2FA4 A;  2CQ9 A;  2E2G A;  3DEX A;  2GSS A;  2CZ2 A;  3IV4 A;  4ZBD A;  2B3S A;  4TN8 A;  1XVQ A;  2H30 A;  5EVO A;  3KH9 A;  3IXR A;  1U3I A;  3HY2 A;  4AJ6 A;  2AV4 A;  4KSO A;  5D9W A;  1CQH A;  4XRD A;  5IPG A;  3HJP A;  2DJJ A;  2H66 A;  3LG6 A;  3TRX A;  3QOU A;  2XBQ A;  2CA8 A;  3VPT A;  4Q5Q A;  2EC4 A;  4O5R A;  4EUY A;  5G2Z A;  5JWQ B;  5ECM B;  2LQQ A;  3IK7 A;  4K1F A;  3F6D A;  3A3T A;  4TW5 A;  4J2F A;  5A5K A;  4KGI A;  4BVX B;  3G7J A;  4RUV A;  1XWC A;  4GLT A;  3IHG A;  5DJM A;  2K18 A;  1M2D A;  5DAL A;  4V2M A;  5G5E A;  2QKE A;  1CQG A;  1QMV A;  4OMV A;  4WXT A;  3WGE A;  1AIU A;  3GN3 A;  3HYP A;  2C1Y A;  1WJK A;  3H79 A;  4JRR A;  4TXO B;  1GSY A;  4GQC A;  4XCS A;  1U88 A;  1AAZ A;  3GSS A;  3KMO A;  3I43 A;  4EE0 A;  4HZ4 A;  3UBL A;  5CRD A;  3H4K A;  3TJB A;  2V2G A;  2HRF A;  5D8I A;  2FWG A;  1WMJ A;  4Q5F A;  3ZLP A;  4WR5 A;  4RQX A;  2F51 A;  2IL3 A;  3IK9 A;  3VK9 A;  2WS2 A;  2V6O A;  2K9F A;  5B7C A;  2DKH A;  1JHB A;  3TDG A;  1R7H A;  4NPB A;  4ISD A;  2IPA A;  5KEJ A;  2PMT A;  3GL3 A;  2L4C A;  2HNL A;  2OE3 A;  2Z9S A;  4L5O A;  3UIW A;  4H86 A;  3U6V A;  1YKC A;  4K5S A;  3ZIV A;  1GH2 A;  4K7I A;  4V1A p;  3EWL A;  1TW9 A;  1GSE A;  3TUE A;  2REM A;  5F8B A;  1MEK A;  4WBR D;  3NIV A;  3TRQ A;  2VCQ A;  2DMM A;  6GST A;  5EY6 A;  2G2Q A;  1EGO A;  4KDU A;  3HXS A;  5LCZ A;  3K8N A;  4Z2T A;  2YP6 A;  4OWY A;  4FO5 A;  4BL7 B;  1G0T A;  2JSZ A;  4GXZ A;  1GSF A;  5DDL A;  3APO A;  3F4S A;  4V2N A;  11GS A;  1Y25 A;  4EIQ A;  3HVV A;  1EEM A;  2F3M A;  4X1U A;  4ZB6 A;  5FT3 A;  4IP1 A;  1PRX A;  3EU4 A;  1WRY A;  2X49 A;  5G1K A;  3TJK A;  1OKD A;  2NDO A;  3KJY A;  1O85 A;  3GX8 A;  5ECQ B;  4E8E A;  3UAP A;  1UC7 A;  2DIY A;  2JZS A;  5G30 A;  1EOG A;  4G0K A;  4USS A;  3LYP A;  1AW9 A;  3LXZ A;  5DCG A;  3CSJ A;  5HR0 A;  2B1K A;  3VWX A;  1UA5 A;  4ECJ A;  1SKW B;  2FLS A;  3QMX A;  5CNW A;  3ERF A;  1FO5 A;  4PUF C;  2KUC A;  3KGK A;  2L4Q A;  1TRV A;  1G7O A;  2O7K A;  3BD2 A;  3GFK A;  22GS A;  2CAQ A;  1XZO A;  3KTL A;  4K7N A;  3ZMK A;  4XRA A;  5GSS A;  1I5G A;  5D73 A;  1BJX A;  2GGT A;  2YWI A;  3PGT A;  3TGZ A;  10GS A;  4FQU A;  1GNE A;  2MZC A;  1GWC A;  1YEP A;  5E59 A;  1PGT A;  5ECK B;  2AUV A;  2YWN A;  2N5F A;  4TR3 A;  1TXX A;  1HQO A;  2GST A;  2R4V A;  3LJR A;  1U6T A;  4WR4 A;  4O32 A;  1Z9H A;  2B7J A;  3A2V A;  5CRW A;  2C0D A;  2VIM A;  4LMV A;  2FD3 A;  1XWA A;  2I4A A;  2DKI A;  2EIR A;  3ED3 A;  4D73 B;  2R3X A;  5ABR A;  1YDK A;  4LMW A;  1EP7 A;  4EDZ A;  1R26 A;  3L9U A;  1JZD A;  2IFQ B;  4F0B A;  4POB A;  2BJX A;  2H75 A;  4BPY A;  1QK8 A;  1XCC A;  2XC2 A;  3FEU A;  3APS A;  1GSS A;  2YAN A;  1I9D A;  1M2B A;  2O85 A;  6GSU A;  2A4H A;  1AXD A;  2LJR A;  2L5O A;  5FWG A;  3FW2 A;  4Z7X A;  5ECR B;  2CT6 A;  2K8S A;  1X5D A;  1MDK A;  4ZB8 A;  4GST A;  2VLV A;  3LYK A;  1BX9 A;  1M2A A;  3F0I A;  3MWH A;  2H6Y A;  1GRX A;  3W8S A;  1GP1 A;  1OKT A;  4O92 A;  2R5G A;  4ZIL A;  4ZB9 A;  2CVD A;  3KXO A;  1TOF A;  4NV2 A;  4TR1 B;  4YH2 A;  4WF5 A;  3TKQ A;  1MD3 A;  2OKA A;  1R5A A;  1PX7 A;  3Q6O A;  1YY7 A;  2N5A A;  3D4M A;  3TB2 A;  4Q5N A;  1ST9 A;  3TCO A;  2JU5 A;  4KE3 A;  2LQO A;  1LBK A;  4XS1 A;  4QL9 A;  2HSY A;  2X8C A;  1PA3 A;  5DQS A;  2QA2 A;  1OAZ A;  1WP0 A;  1SJ6 A;  4DVC A;  3E3E A;  3CMI A;  4MMM A;  1S3A A;  1TDI A;  5ID2 A;  2RUE A;  2LNT A;  1X9S B;  4KUN A;  2P0G A;  4G2E A;  2ON7 A;  3KH7 A;  1K0O A;  3IRA A;  3GHA A;  1ILO A;  1U87 A;  3WYW A;  1ZOF A;  1TI3 A;  3V1W A;  1OC9 B;  1JLV A;  4MPF A;  5GAN D;  1BQ7 A;  1K3O A;  3ZIJ A;  1QUW A;  4IKH A;  2MYG A;  4KDY A;  3VPQ A;  2K8V A;  2B5E A;  2J23 A;  1RW1 A;  1A23 A;  3GUS A;  3OR5 A;  2HYX A;  2GLR A;  3EMX A;  1Z5Y E;  3LW9 A;  4YAP A;  3M3M A;  5BMU A;  4MH3 A;  2GS3 A;  3ZYW A;  3J7Y k;  1S3C A;  5HFI A;  1O8X A;  1JFU A;  2GSQ A;  2OA7 A;  2G0F A;  2GSR A;  2X64 A;  1YF0 A;  5F06 A;  1BYE A;  4EL1 A;  2RUF A;  3GYK A;  3TJJ A;  1E6B A;  3U5R E;  1YJ6 A;  2XBI A;  1PL1 A;  1XWK A;  3PH9 A;  2JAC A;  2HLS A;  3F9U A;  5HR2 A;  2H0G A;  5C04 A;  5B8A A;  4MNN A;  1Z6N A;  4K2X A;  1GSU A;  2L59 A;  2VL9 A;  2OBI A;  2DC5 A;  2LRC A;  1ZYE A;  1WIK A;  1ZCP A;  5EL8 A;  1A24 A;  2LV3 A;  2GQM A;  3EE2 A;  4YKG A;  1PX6 A;  2DJK A;  2CAI A;  5D9X A;  1XPV A;  1X5E A;  1Z3E A;  3LSZ A;  4N30 A;  5D9T A;  1GTB A;  1PSQ A;  3NOF A;  2HXK A;  3KMN A;  4O5Q A;  5A4W A;  5GST A;  3GL5 A;  3FK8 A;  4OFT A;  4TXV A;  4O5U A;  5IMC A;  3CRT A;  3TOU A;  2WRT A;  2JSY A;  3GIX A;  4FH8 A;  3ZTL A;  2LST A;  4PGT A;  4PX1 A;  3GTU A;  1TK5 B;  2V6K A;  3DYR A;  2I3Y A;  3US3 A;  5IMF A;  4WET A;  4HZ2 A;  5JCU A;  1EZK A;  1MDJ A;  1K0A A;  4YAV A;  3GX0 A;  1SK1 A;  4KW6 A;  5IMZ A;  2YJ7 A;  3ERG A;  4TRX A;  1YEX A;  4K0N A;  1O81 A;  2GQK A;  1ERU A;  5IO0 A;  5J5N A;  2KP2 A;  3FHK A;  3C71 A;  4MJE A;  3IC4 A;  1ML6 A;  2H8L A;  1K3L A;  2CV4 A;  1RK4 A;  5ECO B;  5GZZ B;  2DLX A;  3H1N A;  3Q19 A;  1M7T A;  5F0G A;  4OCF A;  2OJL A;  2IME A;  3ISO A;  3FR6 A;  13GS A;  2HRN A;  3IE3 A;  4KAE A;  4ML1 A;  5KN1 A;  1DBY A;  2WUL A;  1X9W B;  4L0U A;  5HFG A;  3UVT A;  2H19 A;  1ABA A;  4MAB A;  1OC8 A;  5JWO B;  1QGV A;  2H0H A;  1Z7P A;  2J9H A;  2KOK A;  3H93 A;  5HFK A;  3WGD A;  4BL7 A;  1GSD A;  3GST A;  2TIR A;  1TU7 A;  2YNX A;  5H5R A;  4K0G A;  4DSS A;  4BA7 A;  2ZCT A;  3IOS A;  3MIX A;  5G5F A;  2H71 A;  2TRX A;  2IIY A;  3G7I A;  2VCX A;  4OCE A;  3UVH A;  2FNO A;  4HU7 A;  1SJI A;  2M72 A;  3DVW A;  3CRU A;  5CP1 A;  3L78 A;  1V9W A;  3IA1 A;  3LFL A;  3VUR A;  4MZB A;  3TRP A;  2V1M A;  4WKW A;  1FB0 A;  4JR4 A;  4PQ1 A;  1H75 A;  4HUA A;  4MH2 A;  4TKY A;  4CDO A;  3GNJ A;  2D2Z A;  2WFC A;  1SK2 A;  2XPE A;  4OD7 A;  4ZL7 A;  3M9J A;  2X8H A;  1GL8 A;  4YQU A;  4IVF A;  2YWO A;  2VCT A;  2YN1 A;  1LU4 A;  3LXT A;  1MTC A;  1T4Z A;  2PGT A;  4IN0 A;  4ECB A;  3QAG A;  1VF2 A;  1R5P A;  1B9Y C;  1GTU A;  4DEJ A;  1NM3 A;  3R3E A;  4EC0 A;  1VF4 A;  1B8X A;  1FVK A;  4IP6 A;  3APQ A;  2H73 A;  5E4W A;  1T3B A;  4BVY A;  4HU9 A;  2A2R A;  2A2S A;  4ZIJ A;  3TKP A;  1TI1 A;  3EIN A;  2OE0 A;  4NV5 A;  1RQM A;  4MJA A;  1K0C A;  2H72 A;  2I81 A;  3BCI A;  5DAL B;  1SL1 B;  2GTU A;  4IW9 A;  2RLI A;  4ZL8 A;  2OBK A;  5H5Q A;  1K0B A;  3HCZ A;  2F8F A;  4ZL9 A;  3PR8 A;  2YOI A;  5B8B A;  2ON5 A;  3DGQ A;  3P8W A;  2H74 A;  1T7P B;  1TU8 A;  4IHU A;  4BWS A;  1V40 A;  4XTS A;  4MF5 A;  1FHE A;  1YZX A;  1ACV A;  3UJ1 A;  3EYT A;  1SD9 A;  2AYT A;  17GS A;  2NPB A;  1PKW A;  5IIZ A;  5JCG A;  3WGX A;  3TJF A;  3MDK A;  1XW6 A;  5CRE A;  2YJH A;  1X9M B;  1S3D A;  1EP8 A;  1GUM A;  2IN3 A;  2H0I A;  4KF9 A;  3D21 A;  4POL A;  4MF7 A;  2IWT A;  4Q5R A;  3S9F A;  3IPZ A;  4PQI A;  2MBT A;  2GT5 A;  3HHV A;  4XS4 B;  2VM2 A;  2JZR A;  1J0F A;  3LOR A;  1AQV A;  5B6M A;  5D9V A;  1KBN A;  2IJY A;  3EC3 A;  1FOV A;  4CY8 A;  12GS A;  2OAD A;  2HE3 A;  4EO3 A;  4MK3 A;  1ON4 A;  1QFN A;  4KCE A;  4KCA A;  2PU9 C;  1J9B A;  2LKU A;  2DJ3 A;  2LUS A;  2R37 A;  3PIN A;  4HEA 2;  3O76 A;  1DE1 A;  2AAW A;  1FG4 A;  2C0F A;  1FB6 A;  1ZYQ B;  2PVQ A;  1XXU A;  5IMA A;  2WJU A;  4F82 A;  1ZYN A;  4K6X A;  3ZZX A;  4MA9 A;  1EV4 A;  1DSB A;  4EXJ A;  3F63 A;  3GKK A;  1OYJ A;  2HZE A;  4HOJ A;  4L0W A;  5KOW A;  2B5X A;  2K6V A;  4ACS A;  5CAX A;  1OE8 A;  5EPF A;  3LQ7 A;  5DQY A;  3VFI A;  6GSV A;  2AHE A;  2X8G A;  1ERW A;  5IPH A;  3QFA C;  2L6C A;  3KZQ A;  3D22 A;  2E0Q A;  3VWV A;  5D96 A;  9GSS A;  1THO A;  4KDX A;  1G7E A;  1T1V A;  4I5Q A;  2YZU A;  1BAY A;  1XOB A;  3QAW A;  1XWB A;  3R2Q A;  2HRK A;  5DCH A;  5LNK e;  4OFN A;  2EIQ A;  1TRU A;  4RQR A;  2B5Y A;  4XHM A;  3I9V 2;  1AUC A;  3DKS A;  1PN0 A;  3GV1 A;  4IQA A;  5A4U A;  3BBY A;  1KTE A;  3F4T A;  4N0Z A;  2IMF A;  3ZFB A;  4GWR A;  3RHB A;  4Z2U A;  1FOH A;  2BMX A;  2WCI A;  3FYG A;  4ILF A;  5IQY A;  2AJQ B;  5J3R A;  4PQH A;  4IBP A;  4K7O A;  2OE1 A;  2LTK A;  3FY7 A;  1VRS D;  2KP1 A;  2I9H A;  5KN2 A;  1O73 A;  5HQP A;  1OE7 A;  2HSH A;  4TVE A;  4IJ3 A;  2LRT A;  1A2L A;  4G0L A;  3DWV A;  4CY6 A;  3HJM A;  1PKZ A;  4KX4 A;  3ZL5 A;  1SYR A;  5ENU A;  1F37 A;  1KNG A;  5DAK A;  4ZBA A;  1V2A A;  4LLR A;  2NTO A;  1HD2 A;  4IS0 A;  3P90 A;  2N5B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...