2YJKA

Structure of dps from microbacterium arborescens in the high iron form
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
149
structure length
149
Chain Sequence
ADPEVAAAAAQFLTPVVHKMQALVVNGKQAHWNVRGSNFIAIHELLDSVVAHAQDYADTAAERIVALGLPIDSRVSTMAEKTSTAVPAGFAQWQDEIKAIVSDIDAALVDLQAAIDGLDEVDLTSQDVAIEIKRGVDKDRWFLLAHLAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AFP
publication title Structure and Mechanism of Iron Translocation by a Dps Protein from Microbacterium Arborescens.
pubmed doi rcsb
molecule tags Metal binding protein
total genus 63
structure length 149
sequence length 149
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2011-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2yjkA00
4ZKWA 3SIDA 3Q4QA 1F30A 3R2OA 5D8SA 5D8YA 5D8OA 1MFRA 5LG8A 2ZA7A 1JKUA 3PWFA 4XKSA 1JREA 1DATA 4ZKXA 1J30A 4RC6A 1R03A 4DYXA 2Z5PA 1BCFA 3F39A 1JI5A 2V2IA 3E1QA 2YW7A 1S30A 1UVHA 2ZURX 3FI6A 3F37A 4ZMCA 3QB9A 1RCCA 1Z6OA 2OH3A 4IWJA 3GVYA 3KX9A 5JACA 5D8QA 5LG2A 4DZ0A 3RAVA 3KA8A 4M32A 1OTKA 5GN8A 1QYBA 4LYXA 3MPSA 2ZA6A 4DYUA 2HR5A 5E1UA 5LS9A 2XJOA 4AM2A 2V2JA 1YUXA 5GN8B 3IS7A 5CMQA 3EGMA 5FFDA 1JGCA 1TK6A 2F7NA 5JKMA 2CEIA 3F38A 2FZFA 1VLGA 4ML5A 1BFRA 2ZG7X 3WVUA 5J8SA 3RE7A 3E1LA 3F34A 1S3QA 2QF9A 4RC5B 4ZJKA 1Z6OM 1ZUJA 3QHBA 2JD80 4ZL6A 2FG4A 2UX1A 1DPSA 3QVDA 4ERUA 1IERA 3SH6A 4ZLWA 1NNQA 4ETRA 3AF8X 3T9JA 1GWGA 2ZA8A 4CYAA 3A68A 4REUA 4RC7B 2OC5A 1RCIA 2C41A 1VELA 2CN7A 2GS4A 2FG8A 2V2SA 2CHIA 3QHCA 2XKQA 3QD8A 4TOAA 4XGSA 3BT5A 2WLAA 5J93A 3R2LA 4ITTA 2V2LA 1SQ3A 3H7GA 3BVLA 5FFBA 2HTNA 3E1JA 4ISMA 2PYBA 5K52A 3HIUA 3VNXA 5K53A 3F35A 3AK8A 3PW1A 3PVTB 2BW1A 4CY9A 4XKTA 3NP0X 3A9QA 3UNOA 4LYUA 1BG7A 3PW1B 5HJFA 1H96A 3QZ3A 3O7RA 3AJOA 4CVTA 2CN6A 4M34A 1NF4A 1LKPA 2C2UA 4OYNA 3KA3A 4TOHA 1JKVA 3WNWA 4TODA 5GU3X 2IB0A 3SHXA 5JKMG 3E6RA 1AEWA 2VXIA 2CIHA 3ISEA 4IWKA 3KA9A 3PVRA 2VZBA 2BK6A 3AJPA 4M33A 3UOIA 3PVRB 4KVQA 2V2PA 3Q4NA 3AF7X 4DYYA 3PW8A 2V2RA 3PWQA 3BVIA 4CVPA 4RC8A 5GU1X 4Z5SA 4RC5A 3U90A 1L8IA 4MN9A 3KA6A 3EZ0A 5D8RA 3R2RA 1JYBA 2GYDA 2YJKA 3ES3A 3RD0A 3TA8A 3PW8C 5J8WA 3UOFA 3PWQC 5AXSA 5FEJA 3GE4A 3PVYB 4RC7A 5JKLA 2X170 3OGHA 3RBCA 2XJMA 2JD70 4DYZA 2V2MA 1RCEA 3O7SA 4LQVA 3ERZA 4LPJA 4TOBA 1TKOA 4PGKA 1LKMA 3FVBA 5ERKA 4II4B 3E1PA 2D5KA 4PG1A 2IU2A 5GU2X 3E1MA 4ITWA 4LPMA 5CZUA 2XGWA 5CMRA 2V15A 1N1QA 3E2CA 5J9VA 2V2OA 3PVTA 4CYBA 2Z5RA 3R2MA 3BVFA 1RCGA 4ISPA 2G4HA 2XJNA 4YKHA 4ZKHA 3GHQA 5HQOA 5D8PA 2FHAA 1O9IA 4EVDA 3IQ1A 4CMYA 3AK9A 3WVVA 3R2HA 4LQNA 2CHPA 2ITBA 3KWOA 1FHAA 1NFVA 4TOCA 4TO9A 5ERJA 3R2KA 2V2NA 3E1NA 3RGDA 3EZUA 1O9RA 2ZG8X 1QGHA 3F33A 4KVSA 1EUMA 4MUDA 5I4JA 2CLUA 2CF7A 3Q4RA 4QUWA 2FL0A 1UMNA 5FFEA 4TW3A 1HRSA 2C2FA 5JKLG 1ZS3A 1F33A 1Z4AA 1RYTA 3NOZX 4LQJA 2VXXA 5E2DA 1RCDA 1JIGA 1VJXA 5FFCA 1LKOA 1IESA 4EVBA 1KRQA 1XZ1A 2FKZA 4MY7A 4ZTTA 4P18A 1JTSA 3PZAA 4RC6B 3BKNA 4E6KA 2Z6MA 3PVYA 2YW6A 4Y08A 3F36A 2C2JA 4AM4A 2W0OA 4Z3BA 4KVRA 2ZG9X 3KA4A 3ISFA 3KXUA 1MOJA 3FSEA 4TOEA 4TOGA 3SE1A 3IS8A 4EVCA 2FFXJ 4DE6A 4DASA 4II4A 4U3GA 5D8XA 2QQYA 4TOFA 2JD60 2FJCA 2BJYA 4XKUA 4PG0A 1XZ3A 4CVSA 4CVRA 1DVBA 2Y3QA 4CMYV 4PGIA 1B71A 5GU0X 1LB3A 3F32A 2GYQA 4MJYA 3BVEA 1NF6A 1S2ZA 4MKUA 3WVWA 5IX6A 3HL1A 1JI4A 1YUZA 1YV1A 4A25A 4EVEA 2YJJA 2CLBA 2Z5QA 4AM5A 4DI0A 4R42A 5HJHA 1VEIA 3Q4OA 3AF9X 3R2SA 2RBDA 4ZL5A 4M35A 5FFAA 1VEQA 3OJ5A 5C6FA 3NP2X 4LPNA 3E6SA 2WLUA 1SOFA 2C6RA 3BVKA 4IXKA 1L8HA 2BKCA 5LBHA 1TJOA 5GOUA 1TKPA 4LQHA 2WTLA 3E1OA 2Z90A 2IY4A 3AJQA
chains in the Genus database with same CATH superfamily
4ZKWA 3SIDA 3Q4QA 1F30A 3R2OA 5D8SA 5D8YA 5D8OA 1MFRA 5LG8A 2ZA7A 1JKUA 3PWFA 4XKSA 1JREA 1DATA 4ZKXA 1J30A 4RC6A 1R03A 4DYXA 2Z5PA 1BCFA 3F39A 1JI5A 2V2IA 3E1QA 2YW7A 1S30A 1UVHA 2ZURX 3FI6A 3F37A 4ZMCA 3QB9A 1RCCA 1Z6OA 2OH3A 4IWJA 3GVYA 3KX9A 5JACA 2V8UA 5D8QA 5LG2A 3RAVA 4DZ0A 3KA8A 4M32A 1OTKA 5GN8A 1QYBA 4LYXA 3MPSA 2ZA6A 4DYUA 2HR5A 5E1UA 5LS9A 2N02A 2XJOA 4AM2A 2V2JA 1YUXA 5GN8B 3IS7A 5CMQA 2WWXB 3EGMA 5FFDA 1JGCA 1TK6A 2F7NA 5JKMA 2CEIA 3F38A 2FZFA 1VLGA 4ML5A 1BFRA 2ZG7X 3WVUA 5J8SA 3RE7A 3E1LA 3F34A 1S3QA 2QF9A 4RC5B 4ZJKA 1Z6OM 1ZUJA 3QHBA 2JD80 4ZL6A 2FG4A 2UX1A 3VV9A 1DPSA 3QVDA 4ERUA 3LKDA 1IERA 3SH6A 4ZLWA 1NNQA 4ETRA 3AF8X 3T9JA 1GWGA 2ZA8A 4CYAA 3A68A 4REUA 4RC7B 2OC5A 1RCIA 2C41A 1VELA 2OKCA 2CN7A 2GS4A 2FG8A 2V2SA 3QHCA 2CHIA 2XKQA 3QD8A 2G38B 4TOAA 4XGSA 3BT5A 2WLAA 4W4KB 5J93A 3R2LA 4ITTA 3DBYA 2V2LA 1SQ3A 3H7GA 3BVLA 5FFBA 2HTNA 3E1JA 4ISMA 2PYBA 5K52A 3HIUA 3VNXA 5K53A 3F35A 3AK8A 3PW1A 3PVTB 2BW1A 4CY9A 4XKTA 3NP0X 3A9QA 3UNOA 4LYUA 1BG7A 3PW1B 5HJFA 3KDQA 1H96A 5HU6D 3QZ3A 3O7RA 3AJOA 4CVTA 2CN6A 4M34A 1NF4A 1LKPA 2C2UA 4OYNA 3KA3A 4TOHA 1JKVA 3WNWA 4TODA 5GU3X 2IB0A 3SHXA 5JKMG 3E6RA 1AEWA 2VXIA 3C23A 2CIHA 3ISEA 3V3KB 4IWKA 3KA9A 3PVRA 2VZBA 2BK6A 3AJPA 2Y44A 2MGYA 4M33A 3UOIA 4YVZA 3PVRB 4KVQA 2V2PA 3Q4NA 3AF7X 4DYYA 3PW8A 2V2RA 3PWQA 3BVIA 4CVPA 4RC8A 5GU1X 4Z5SA 4RC5A 3JZ9A 3U90A 4E40A 1L8IA 4MN9A 3KA6A 3GGYA 3EZ0A 5D8RA 3R2RA 4YXJA 1JYBA 2GYDA 2YJKA 3ES3A 3RD0A 3TA8A 3C1YA 3PW8C 5J8WA 3UOFA 3PWQC 5AXSA 5FEJA 3GE4A 3PVYB 4RC7A 5JKLA 4W4LB 2X170 3FRRA 3OGHA 3RBCA 2XJMA 2JD70 4DYZA 2V2MA 1RCEA 3O7SA 4WJG4 4LQVA 3VVAA 3ERZA 4LPJA 4TOBA 1TKOA 4PGKA 1LKMA 3FVBA 5ERKA 4II4B 3E1PA 2D5KA 4PG1A 2IU2A 5GU2X 3E1MA 4ITWA 4LPMA 5CZUA 2XGWA 3UFBA 5CMRA 2V15A 1N1QA 3D19A 3E2CA 5J9VA 2V2OA 3PVTA 4CYBA 2Z5RA 3R2MA 3BVFA 1RCGA 3W54A 4ISPA 2G4HA 2XJNA 4YKHA 4ZKHA 3GHQA 5HQOA 5D8PA 2FHAA 1O9IA 4EVDA 3FRSA 3IQ1A 3C1ZA 4CMYA 3AK9A 2AR0A 3R2HA 3WVVA 3JZAB 4LQNA 3L0MA 2CHPA 2ITBA 3KWOA 1FHAA 1NFVA 4TOCA 4TO9A 5ERJA 3R2KA 2V2NA 3E1NA 3RGDA 3EZUA 1O9RA 2ZG8X 1QGHA 3F33A 4KVSA 1EUMA 4MUDA 5I4JA 2CLUA 2CF7A 3Q4RA 4QUWA 2FL0A 1UMNA 5JDOB 5FFEA 4TW3A 1HRSA 2C2FA 5JKLG 1ZS3A 1F33A 1Z4AA 4KXRB 1RYTA 3NOZX 4LQJA 2VXXA 5E2DA 1RCDA 1JIGA 1VJXA 5FFCA 1LKOA 1IESA 4EVBA 1KRQA 1XZ1A 2FKZA 4MY7A 4ZTTA 4P18A 1JTSA 3PZAA 3M6JA 4RC6B 3BKNA 4E6KA 2Z6MA 3PVYA 2YW6A 4Y08A 3F36A 2C2JA 4AM4A 2W0OA 3N6OA 4Z3BA 4KVRA 4X0JA 2ZG9X 3KA4A 3ISFA 3KXUA 1MOJA 3FSEA 4TOEA 4TOGA 3KHKA 3SE1A 3IS8A 4EVCA 2FFXJ 4DE6A 4DASA 4II4A 4U3GA 5D8XA 2QQYA 2V8TA 4TOFA 2JD60 2FJCA 2BJYA 4XKUA 4PG0A 1XZ3A 4CVSA 4CVRA 1DVBA 2Y3QA 4CMYV 4PGIA 1B71A 5GU0X 1LB3A 3F32A 2GYQA 4MJYA 3BVEA 1NF6A 1S2ZA 4MKUA 3WVWA 5IX6A 3HL1A 1JI4A 1YUZA 1YV1A 4A25A 4EVEA 2YJJA 4MXPA 2CLBA 2Z5QA 4AM5A 4DI0A 4R42A 5HJHA 1VEIA 3GGZA 3Q4OA 4YXMA 3AF9X 3R2SA 2RBDA 4ZL5A 4M35A 5FFAA 1VEQA 3OJ5A 5C6FA 3NP2X 4LPNA 3E6SA 2WLUA 1SOFA 2C6RA 3BVKA 4IXKA 2CWLA 1L8HA 2BKCA 5LBHA 1TJOA 3C21A 5GOUA 1TKPA 4LQHA 2WTLA 5JDOA 3E1OA 2Z90A 2IY4A 3AJQA
chains in the Genus database with same CATH topology
4ZKWA 3SIDA 3Q4QA 1F30A 3R2OA 5D8SA 5D8YA 5D8OA 1MFRA 5LG8A 2ZA7A 1JKUA 3PWFA 4XKSA 1JREA 1DATA 4ZKXA 1J30A 4RC6A 1R03A 4DYXA 2Z5PA 1BCFA 3F39A 1JI5A 2V2IA 3E1QA 2YW7A 1S30A 1UVHA 2ZURX 3FI6A 3F37A 4ZMCA 3QB9A 1RCCA 1Z6OA 2OH3A 4IWJA 3GVYA 3KX9A 5JACA 2V8UA 5D8QA 5LG2A 3RAVA 4DZ0A 3KA8A 4M32A 1OTKA 5GN8A 1QYBA 4LYXA 3MPSA 2ZA6A 4DYUA 2HR5A 5E1UA 5LS9A 2N02A 2XJOA 4AM2A 2V2JA 1YUXA 5GN8B 3IS7A 5CMQA 2WWXB 3EGMA 5FFDA 1JGCA 1TK6A 2F7NA 5JKMA 2CEIA 3F38A 2FZFA 1VLGA 4ML5A 1BFRA 2ZG7X 3WVUA 5J8SA 3RE7A 3E1LA 3F34A 1S3QA 2QF9A 4RC5B 4ZJKA 1Z6OM 1ZUJA 3QHBA 2JD80 4ZL6A 2FG4A 2UX1A 3VV9A 1DPSA 3QVDA 4ERUA 3LKDA 1IERA 3SH6A 4ZLWA 1NNQA 4ETRA 3AF8X 3T9JA 1GWGA 2ZA8A 4CYAA 3A68A 4REUA 4RC7B 2OC5A 1RCIA 2C41A 1VELA 2OKCA 2CN7A 2GS4A 2FG8A 2V2SA 3QHCA 2CHIA 2XKQA 3QD8A 2G38B 4TOAA 4XGSA 3BT5A 2WLAA 4W4KB 5J93A 3R2LA 4ITTA 3DBYA 2V2LA 1SQ3A 3H7GA 3BVLA 5FFBA 2HTNA 3E1JA 4ISMA 2PYBA 5K52A 3HIUA 3VNXA 5K53A 3F35A 3AK8A 3PW1A 3PVTB 2BW1A 4CY9A 4XKTA 3NP0X 3A9QA 3UNOA 4LYUA 1BG7A 3PW1B 5HJFA 3KDQA 1H96A 5HU6D 3QZ3A 3O7RA 3AJOA 4CVTA 2CN6A 4M34A 1NF4A 1LKPA 2C2UA 4OYNA 3KA3A 4TOHA 1JKVA 3WNWA 4TODA 5GU3X 2IB0A 3SHXA 5JKMG 3E6RA 1AEWA 2VXIA 3C23A 2CIHA 3ISEA 3V3KB 4IWKA 3KA9A 3PVRA 2VZBA 2BK6A 3AJPA 2Y44A 2MGYA 4M33A 3UOIA 4YVZA 3PVRB 4KVQA 2V2PA 3Q4NA 3AF7X 4DYYA 3PW8A 2V2RA 3PWQA 3BVIA 4CVPA 4RC8A 5GU1X 4Z5SA 4RC5A 3JZ9A 3U90A 4E40A 1L8IA 4MN9A 3KA6A 3GGYA 3EZ0A 5D8RA 3R2RA 4YXJA 1JYBA 2GYDA 2YJKA 3ES3A 3RD0A 3TA8A 3C1YA 3PW8C 5J8WA 3UOFA 3PWQC 5AXSA 5FEJA 3GE4A 3PVYB 4RC7A 5JKLA 4W4LB 2X170 3FRRA 3OGHA 3RBCA 2XJMA 2JD70 4DYZA 2V2MA 1RCEA 3O7SA 4WJG4 4LQVA 3VVAA 3ERZA 4LPJA 4TOBA 1TKOA 4PGKA 1LKMA 3FVBA 5ERKA 4II4B 3E1PA 2D5KA 4PG1A 2IU2A 5GU2X 3E1MA 4ITWA 4LPMA 5CZUA 2XGWA 3UFBA 5CMRA 2V15A 1N1QA 3D19A 3E2CA 5J9VA 2V2OA 3PVTA 4CYBA 2Z5RA 3R2MA 3BVFA 1RCGA 3W54A 4ISPA 2G4HA 2XJNA 4YKHA 4ZKHA 3GHQA 5HQOA 5D8PA 2FHAA 1O9IA 4EVDA 3FRSA 3IQ1A 3C1ZA 4CMYA 3AK9A 2AR0A 3R2HA 3WVVA 3JZAB 4LQNA 3L0MA 2CHPA 2ITBA 3KWOA 1FHAA 1NFVA 4TOCA 4TO9A 5ERJA 3R2KA 2V2NA 3E1NA 3RGDA 3EZUA 1O9RA 2ZG8X 1QGHA 3F33A 4KVSA 1EUMA 4MUDA 5I4JA 2CLUA 2CF7A 3Q4RA 4QUWA 2FL0A 1UMNA 5JDOB 5FFEA 4TW3A 1HRSA 2C2FA 5JKLG 1ZS3A 1F33A 1Z4AA 4KXRB 1RYTA 3NOZX 4LQJA 2VXXA 5E2DA 1RCDA 1JIGA 1VJXA 5FFCA 1LKOA 1IESA 4EVBA 1KRQA 1XZ1A 2FKZA 4MY7A 4ZTTA 4P18A 1JTSA 3PZAA 3M6JA 4RC6B 3BKNA 4E6KA 2Z6MA 3PVYA 2YW6A 4Y08A 3F36A 2C2JA 4AM4A 2W0OA 3N6OA 4Z3BA 4KVRA 4X0JA 2ZG9X 3KA4A 3ISFA 3KXUA 1MOJA 3FSEA 4TOEA 4TOGA 3KHKA 3SE1A 3IS8A 4EVCA 2FFXJ 4DE6A 4DASA 4II4A 4U3GA 5D8XA 2QQYA 2V8TA 4TOFA 2JD60 2FJCA 2BJYA 4XKUA 4PG0A 1XZ3A 4CVSA 4CVRA 1DVBA 2Y3QA 4CMYV 4PGIA 1B71A 5GU0X 1LB3A 3F32A 2GYQA 4MJYA 3BVEA 1NF6A 1S2ZA 4MKUA 3WVWA 5IX6A 3HL1A 1JI4A 1YUZA 1YV1A 4A25A 4EVEA 2YJJA 4MXPA 2CLBA 2Z5QA 4AM5A 4DI0A 4R42A 5HJHA 1VEIA 3GGZA 3Q4OA 4YXMA 3AF9X 3R2SA 2RBDA 4ZL5A 4M35A 5FFAA 1VEQA 3OJ5A 5C6FA 3NP2X 4LPNA 3E6SA 2WLUA 1SOFA 2C6RA 3BVKA 4IXKA 2CWLA 1L8HA 2BKCA 5LBHA 1TJOA 3C21A 5GOUA 1TKPA 4LQHA 2WTLA 5JDOA 3E1OA 2Z90A 2IY4A 3AJQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZKW A;  3SID A;  3Q4Q A;  1F30 A;  3R2O A;  5D8S A;  5D8Y A;  5D8O A;  1MFR A;  5LG8 A;  2ZA7 A;  1JKU A;  3PWF A;  4XKS A;  1JRE A;  1DAT A;  4ZKX A;  1J30 A;  4RC6 A;  1R03 A;  4DYX A;  2Z5P A;  1BCF A;  3F39 A;  1JI5 A;  2V2I A;  3E1Q A;  2YW7 A;  1S30 A;  1UVH A;  2ZUR X;  3FI6 A;  3F37 A;  4ZMC A;  3QB9 A;  1RCC A;  1Z6O A;  2OH3 A;  4IWJ A;  3GVY A;  3KX9 A;  5JAC A;  5D8Q A;  5LG2 A;  4DZ0 A;  3RAV A;  3KA8 A;  4M32 A;  1OTK A;  5GN8 A;  1QYB A;  4LYX A;  3MPS A;  2ZA6 A;  4DYU A;  2HR5 A;  5E1U A;  5LS9 A;  2XJO A;  4AM2 A;  2V2J A;  1YUX A;  5GN8 B;  3IS7 A;  5CMQ A;  3EGM A;  5FFD A;  1JGC A;  1TK6 A;  2F7N A;  5JKM A;  2CEI A;  3F38 A;  2FZF A;  1VLG A;  4ML5 A;  1BFR A;  2ZG7 X;  3WVU A;  5J8S A;  3RE7 A;  3E1L A;  3F34 A;  1S3Q A;  2QF9 A;  4RC5 B;  4ZJK A;  1Z6O M;  1ZUJ A;  3QHB A;  2JD8 0;  4ZL6 A;  2FG4 A;  2UX1 A;  1DPS A;  3QVD A;  4ERU A;  1IER A;  3SH6 A;  4ZLW A;  1NNQ A;  4ETR A;  3AF8 X;  3T9J A;  1GWG A;  2ZA8 A;  4CYA A;  3A68 A;  4REU A;  4RC7 B;  2OC5 A;  1RCI A;  2C41 A;  1VEL A;  2CN7 A;  2GS4 A;  2FG8 A;  2V2S A;  2CHI A;  3QHC A;  2XKQ A;  3QD8 A;  4TOA A;  4XGS A;  3BT5 A;  2WLA A;  5J93 A;  3R2L A;  4ITT A;  2V2L A;  1SQ3 A;  3H7G A;  3BVL A;  5FFB A;  2HTN A;  3E1J A;  4ISM A;  2PYB A;  5K52 A;  3HIU A;  3VNX A;  5K53 A;  3F35 A;  3AK8 A;  3PW1 A;  3PVT B;  2BW1 A;  4CY9 A;  4XKT A;  3NP0 X;  3A9Q A;  3UNO A;  4LYU A;  1BG7 A;  3PW1 B;  5HJF A;  1H96 A;  3QZ3 A;  3O7R A;  3AJO A;  4CVT A;  2CN6 A;  4M34 A;  1NF4 A;  1LKP A;  2C2U A;  4OYN A;  3KA3 A;  4TOH A;  1JKV A;  3WNW A;  4TOD A;  5GU3 X;  2IB0 A;  3SHX A;  5JKM G;  3E6R A;  1AEW A;  2VXI A;  2CIH A;  3ISE A;  4IWK A;  3KA9 A;  3PVR A;  2VZB A;  2BK6 A;  3AJP A;  4M33 A;  3UOI A;  3PVR B;  4KVQ A;  2V2P A;  3Q4N A;  3AF7 X;  4DYY A;  3PW8 A;  2V2R A;  3PWQ A;  3BVI A;  4CVP A;  4RC8 A;  5GU1 X;  4Z5S A;  4RC5 A;  3U90 A;  1L8I A;  4MN9 A;  3KA6 A;  3EZ0 A;  5D8R A;  3R2R A;  1JYB A;  2GYD A;  2YJK A;  3ES3 A;  3RD0 A;  3TA8 A;  3PW8 C;  5J8W A;  3UOF A;  3PWQ C;  5AXS A;  5FEJ A;  3GE4 A;  3PVY B;  4RC7 A;  5JKL A;  2X17 0;  3OGH A;  3RBC A;  2XJM A;  2JD7 0;  4DYZ A;  2V2M A;  1RCE A;  3O7S A;  4LQV A;  3ERZ A;  4LPJ A;  4TOB A;  1TKO A;  4PGK A;  1LKM A;  3FVB A;  5ERK A;  4II4 B;  3E1P A;  2D5K A;  4PG1 A;  2IU2 A;  5GU2 X;  3E1M A;  4ITW A;  4LPM A;  5CZU A;  2XGW A;  5CMR A;  2V15 A;  1N1Q A;  3E2C A;  5J9V A;  2V2O A;  3PVT A;  4CYB A;  2Z5R A;  3R2M A;  3BVF A;  1RCG A;  4ISP A;  2G4H A;  2XJN A;  4YKH A;  4ZKH A;  3GHQ A;  5HQO A;  5D8P A;  2FHA A;  1O9I A;  4EVD A;  3IQ1 A;  4CMY A;  3AK9 A;  3WVV A;  3R2H A;  4LQN A;  2CHP A;  2ITB A;  3KWO A;  1FHA A;  1NFV A;  4TOC A;  4TO9 A;  5ERJ A;  3R2K A;  2V2N A;  3E1N A;  3RGD A;  3EZU A;  1O9R A;  2ZG8 X;  1QGH A;  3F33 A;  4KVS A;  1EUM A;  4MUD A;  5I4J A;  2CLU A;  2CF7 A;  3Q4R A;  4QUW A;  2FL0 A;  1UMN A;  5FFE A;  4TW3 A;  1HRS A;  2C2F A;  5JKL G;  1ZS3 A;  1F33 A;  1Z4A A;  1RYT A;  3NOZ X;  4LQJ A;  2VXX A;  5E2D A;  1RCD A;  1JIG A;  1VJX A;  5FFC A;  1LKO A;  1IES A;  4EVB A;  1KRQ A;  1XZ1 A;  2FKZ A;  4MY7 A;  4ZTT A;  4P18 A;  1JTS A;  3PZA A;  4RC6 B;  3BKN A;  4E6K A;  2Z6M A;  3PVY A;  2YW6 A;  4Y08 A;  3F36 A;  2C2J A;  4AM4 A;  2W0O A;  4Z3B A;  4KVR A;  2ZG9 X;  3KA4 A;  3ISF A;  3KXU A;  1MOJ A;  3FSE A;  4TOE A;  4TOG A;  3SE1 A;  3IS8 A;  4EVC A;  2FFX J;  4DE6 A;  4DAS A;  4II4 A;  4U3G A;  5D8X A;  2QQY A;  4TOF A;  2JD6 0;  2FJC A;  2BJY A;  4XKU A;  4PG0 A;  1XZ3 A;  4CVS A;  4CVR A;  1DVB A;  2Y3Q A;  4CMY V;  4PGI A;  1B71 A;  5GU0 X;  1LB3 A;  3F32 A;  2GYQ A;  4MJY A;  3BVE A;  1NF6 A;  1S2Z A;  4MKU A;  3WVW A;  5IX6 A;  3HL1 A;  1JI4 A;  1YUZ A;  1YV1 A;  4A25 A;  4EVE A;  2YJJ A;  2CLB A;  2Z5Q A;  4AM5 A;  4DI0 A;  4R42 A;  5HJH A;  1VEI A;  3Q4O A;  3AF9 X;  3R2S A;  2RBD A;  4ZL5 A;  4M35 A;  5FFA A;  1VEQ A;  3OJ5 A;  5C6F A;  3NP2 X;  4LPN A;  3E6S A;  2WLU A;  1SOF A;  2C6R A;  3BVK A;  4IXK A;  1L8H A;  2BKC A;  5LBH A;  1TJO A;  5GOU A;  1TKP A;  4LQH A;  2WTL A;  3E1O A;  2Z90 A;  2IY4 A;  3AJQ A; 
#chains in the Genus database with same CATH topology
 4ZKW A;  3SID A;  3Q4Q A;  1F30 A;  3R2O A;  5D8S A;  5D8Y A;  5D8O A;  1MFR A;  5LG8 A;  2ZA7 A;  1JKU A;  3PWF A;  4XKS A;  1JRE A;  1DAT A;  4ZKX A;  1J30 A;  4RC6 A;  1R03 A;  4DYX A;  2Z5P A;  1BCF A;  3F39 A;  1JI5 A;  2V2I A;  3E1Q A;  2YW7 A;  1S30 A;  1UVH A;  2ZUR X;  3FI6 A;  3F37 A;  4ZMC A;  3QB9 A;  1RCC A;  1Z6O A;  2OH3 A;  4IWJ A;  3GVY A;  3KX9 A;  5JAC A;  2V8U A;  5D8Q A;  5LG2 A;  3RAV A;  4DZ0 A;  3KA8 A;  4M32 A;  1OTK A;  5GN8 A;  1QYB A;  4LYX A;  3MPS A;  2ZA6 A;  4DYU A;  2HR5 A;  5E1U A;  5LS9 A;  2N02 A;  2XJO A;  4AM2 A;  2V2J A;  1YUX A;  5GN8 B;  3IS7 A;  5CMQ A;  2WWX B;  3EGM A;  5FFD A;  1JGC A;  1TK6 A;  2F7N A;  5JKM A;  2CEI A;  3F38 A;  2FZF A;  1VLG A;  4ML5 A;  1BFR A;  2ZG7 X;  3WVU A;  5J8S A;  3RE7 A;  3E1L A;  3F34 A;  1S3Q A;  2QF9 A;  4RC5 B;  4ZJK A;  1Z6O M;  1ZUJ A;  3QHB A;  2JD8 0;  4ZL6 A;  2FG4 A;  2UX1 A;  3VV9 A;  1DPS A;  3QVD A;  4ERU A;  3LKD A;  1IER A;  3SH6 A;  4ZLW A;  1NNQ A;  4ETR A;  3AF8 X;  3T9J A;  1GWG A;  2ZA8 A;  4CYA A;  3A68 A;  4REU A;  4RC7 B;  2OC5 A;  1RCI A;  2C41 A;  1VEL A;  2OKC A;  2CN7 A;  2GS4 A;  2FG8 A;  2V2S A;  3QHC A;  2CHI A;  2XKQ A;  3QD8 A;  2G38 B;  4TOA A;  4XGS A;  3BT5 A;  2WLA A;  4W4K B;  5J93 A;  3R2L A;  4ITT A;  3DBY A;  2V2L A;  1SQ3 A;  3H7G A;  3BVL A;  5FFB A;  2HTN A;  3E1J A;  4ISM A;  2PYB A;  5K52 A;  3HIU A;  3VNX A;  5K53 A;  3F35 A;  3AK8 A;  3PW1 A;  3PVT B;  2BW1 A;  4CY9 A;  4XKT A;  3NP0 X;  3A9Q A;  3UNO A;  4LYU A;  1BG7 A;  3PW1 B;  5HJF A;  3KDQ A;  1H96 A;  5HU6 D;  3QZ3 A;  3O7R A;  3AJO A;  4CVT A;  2CN6 A;  4M34 A;  1NF4 A;  1LKP A;  2C2U A;  4OYN A;  3KA3 A;  4TOH A;  1JKV A;  3WNW A;  4TOD A;  5GU3 X;  2IB0 A;  3SHX A;  5JKM G;  3E6R A;  1AEW A;  2VXI A;  3C23 A;  2CIH A;  3ISE A;  3V3K B;  4IWK A;  3KA9 A;  3PVR A;  2VZB A;  2BK6 A;  3AJP A;  2Y44 A;  2MGY A;  4M33 A;  3UOI A;  4YVZ A;  3PVR B;  4KVQ A;  2V2P A;  3Q4N A;  3AF7 X;  4DYY A;  3PW8 A;  2V2R A;  3PWQ A;  3BVI A;  4CVP A;  4RC8 A;  5GU1 X;  4Z5S A;  4RC5 A;  3JZ9 A;  3U90 A;  4E40 A;  1L8I A;  4MN9 A;  3KA6 A;  3GGY A;  3EZ0 A;  5D8R A;  3R2R A;  4YXJ A;  1JYB A;  2GYD A;  2YJK A;  3ES3 A;  3RD0 A;  3TA8 A;  3C1Y A;  3PW8 C;  5J8W A;  3UOF A;  3PWQ C;  5AXS A;  5FEJ A;  3GE4 A;  3PVY B;  4RC7 A;  5JKL A;  4W4L B;  2X17 0;  3FRR A;  3OGH A;  3RBC A;  2XJM A;  2JD7 0;  4DYZ A;  2V2M A;  1RCE A;  3O7S A;  4WJG 4;  4LQV A;  3VVA A;  3ERZ A;  4LPJ A;  4TOB A;  1TKO A;  4PGK A;  1LKM A;  3FVB A;  5ERK A;  4II4 B;  3E1P A;  2D5K A;  4PG1 A;  2IU2 A;  5GU2 X;  3E1M A;  4ITW A;  4LPM A;  5CZU A;  2XGW A;  3UFB A;  5CMR A;  2V15 A;  1N1Q A;  3D19 A;  3E2C A;  5J9V A;  2V2O A;  3PVT A;  4CYB A;  2Z5R A;  3R2M A;  3BVF A;  1RCG A;  3W54 A;  4ISP A;  2G4H A;  2XJN A;  4YKH A;  4ZKH A;  3GHQ A;  5HQO A;  5D8P A;  2FHA A;  1O9I A;  4EVD A;  3FRS A;  3IQ1 A;  3C1Z A;  4CMY A;  3AK9 A;  2AR0 A;  3R2H A;  3WVV A;  3JZA B;  4LQN A;  3L0M A;  2CHP A;  2ITB A;  3KWO A;  1FHA A;  1NFV A;  4TOC A;  4TO9 A;  5ERJ A;  3R2K A;  2V2N A;  3E1N A;  3RGD A;  3EZU A;  1O9R A;  2ZG8 X;  1QGH A;  3F33 A;  4KVS A;  1EUM A;  4MUD A;  5I4J A;  2CLU A;  2CF7 A;  3Q4R A;  4QUW A;  2FL0 A;  1UMN A;  5JDO B;  5FFE A;  4TW3 A;  1HRS A;  2C2F A;  5JKL G;  1ZS3 A;  1F33 A;  1Z4A A;  4KXR B;  1RYT A;  3NOZ X;  4LQJ A;  2VXX A;  5E2D A;  1RCD A;  1JIG A;  1VJX A;  5FFC A;  1LKO A;  1IES A;  4EVB A;  1KRQ A;  1XZ1 A;  2FKZ A;  4MY7 A;  4ZTT A;  4P18 A;  1JTS A;  3PZA A;  3M6J A;  4RC6 B;  3BKN A;  4E6K A;  2Z6M A;  3PVY A;  2YW6 A;  4Y08 A;  3F36 A;  2C2J A;  4AM4 A;  2W0O A;  3N6O A;  4Z3B A;  4KVR A;  4X0J A;  2ZG9 X;  3KA4 A;  3ISF A;  3KXU A;  1MOJ A;  3FSE A;  4TOE A;  4TOG A;  3KHK A;  3SE1 A;  3IS8 A;  4EVC A;  2FFX J;  4DE6 A;  4DAS A;  4II4 A;  4U3G A;  5D8X A;  2QQY A;  2V8T A;  4TOF A;  2JD6 0;  2FJC A;  2BJY A;  4XKU A;  4PG0 A;  1XZ3 A;  4CVS A;  4CVR A;  1DVB A;  2Y3Q A;  4CMY V;  4PGI A;  1B71 A;  5GU0 X;  1LB3 A;  3F32 A;  2GYQ A;  4MJY A;  3BVE A;  1NF6 A;  1S2Z A;  4MKU A;  3WVW A;  5IX6 A;  3HL1 A;  1JI4 A;  1YUZ A;  1YV1 A;  4A25 A;  4EVE A;  2YJJ A;  4MXP A;  2CLB A;  2Z5Q A;  4AM5 A;  4DI0 A;  4R42 A;  5HJH A;  1VEI A;  3GGZ A;  3Q4O A;  4YXM A;  3AF9 X;  3R2S A;  2RBD A;  4ZL5 A;  4M35 A;  5FFA A;  1VEQ A;  3OJ5 A;  5C6F A;  3NP2 X;  4LPN A;  3E6S A;  2WLU A;  1SOF A;  2C6R A;  3BVK A;  4IXK A;  2CWL A;  1L8H A;  2BKC A;  5LBH A;  1TJO A;  3C21 A;  5GOU A;  1TKP A;  4LQH A;  2WTL A;  5JDO A;  3E1O A;  2Z90 A;  2IY4 A;  3AJQ A; 
#chains in the Genus database with same CATH homology
 4ZKW A;  3SID A;  3Q4Q A;  1F30 A;  3R2O A;  5D8S A;  5D8Y A;  5D8O A;  1MFR A;  5LG8 A;  2ZA7 A;  1JKU A;  3PWF A;  4XKS A;  1JRE A;  1DAT A;  4ZKX A;  1J30 A;  4RC6 A;  1R03 A;  4DYX A;  2Z5P A;  1BCF A;  3F39 A;  1JI5 A;  2V2I A;  3E1Q A;  2YW7 A;  1S30 A;  1UVH A;  2ZUR X;  3FI6 A;  3F37 A;  4ZMC A;  3QB9 A;  1RCC A;  1Z6O A;  2OH3 A;  4IWJ A;  3GVY A;  3KX9 A;  5JAC A;  2V8U A;  5D8Q A;  5LG2 A;  3RAV A;  4DZ0 A;  3KA8 A;  4M32 A;  1OTK A;  5GN8 A;  1QYB A;  4LYX A;  3MPS A;  2ZA6 A;  4DYU A;  2HR5 A;  5E1U A;  5LS9 A;  2N02 A;  2XJO A;  4AM2 A;  2V2J A;  1YUX A;  5GN8 B;  3IS7 A;  5CMQ A;  2WWX B;  3EGM A;  5FFD A;  1JGC A;  1TK6 A;  2F7N A;  5JKM A;  2CEI A;  3F38 A;  2FZF A;  1VLG A;  4ML5 A;  1BFR A;  2ZG7 X;  3WVU A;  5J8S A;  3RE7 A;  3E1L A;  3F34 A;  1S3Q A;  2QF9 A;  4RC5 B;  4ZJK A;  1Z6O M;  1ZUJ A;  3QHB A;  2JD8 0;  4ZL6 A;  2FG4 A;  2UX1 A;  3VV9 A;  1DPS A;  3QVD A;  4ERU A;  3LKD A;  1IER A;  3SH6 A;  4ZLW A;  1NNQ A;  4ETR A;  3AF8 X;  3T9J A;  1GWG A;  2ZA8 A;  4CYA A;  3A68 A;  4REU A;  4RC7 B;  2OC5 A;  1RCI A;  2C41 A;  1VEL A;  2OKC A;  2CN7 A;  2GS4 A;  2FG8 A;  2V2S A;  3QHC A;  2CHI A;  2XKQ A;  3QD8 A;  2G38 B;  4TOA A;  4XGS A;  3BT5 A;  2WLA A;  4W4K B;  5J93 A;  3R2L A;  4ITT A;  3DBY A;  2V2L A;  1SQ3 A;  3H7G A;  3BVL A;  5FFB A;  2HTN A;  3E1J A;  4ISM A;  2PYB A;  5K52 A;  3HIU A;  3VNX A;  5K53 A;  3F35 A;  3AK8 A;  3PW1 A;  3PVT B;  2BW1 A;  4CY9 A;  4XKT A;  3NP0 X;  3A9Q A;  3UNO A;  4LYU A;  1BG7 A;  3PW1 B;  5HJF A;  3KDQ A;  1H96 A;  5HU6 D;  3QZ3 A;  3O7R A;  3AJO A;  4CVT A;  2CN6 A;  4M34 A;  1NF4 A;  1LKP A;  2C2U A;  4OYN A;  3KA3 A;  4TOH A;  1JKV A;  3WNW A;  4TOD A;  5GU3 X;  2IB0 A;  3SHX A;  5JKM G;  3E6R A;  1AEW A;  2VXI A;  3C23 A;  2CIH A;  3ISE A;  3V3K B;  4IWK A;  3KA9 A;  3PVR A;  2VZB A;  2BK6 A;  3AJP A;  2Y44 A;  2MGY A;  4M33 A;  3UOI A;  4YVZ A;  3PVR B;  4KVQ A;  2V2P A;  3Q4N A;  3AF7 X;  4DYY A;  3PW8 A;  2V2R A;  3PWQ A;  3BVI A;  4CVP A;  4RC8 A;  5GU1 X;  4Z5S A;  4RC5 A;  3JZ9 A;  3U90 A;  4E40 A;  1L8I A;  4MN9 A;  3KA6 A;  3GGY A;  3EZ0 A;  5D8R A;  3R2R A;  4YXJ A;  1JYB A;  2GYD A;  2YJK A;  3ES3 A;  3RD0 A;  3TA8 A;  3C1Y A;  3PW8 C;  5J8W A;  3UOF A;  3PWQ C;  5AXS A;  5FEJ A;  3GE4 A;  3PVY B;  4RC7 A;  5JKL A;  4W4L B;  2X17 0;  3FRR A;  3OGH A;  3RBC A;  2XJM A;  2JD7 0;  4DYZ A;  2V2M A;  1RCE A;  3O7S A;  4WJG 4;  4LQV A;  3VVA A;  3ERZ A;  4LPJ A;  4TOB A;  1TKO A;  4PGK A;  1LKM A;  3FVB A;  5ERK A;  4II4 B;  3E1P A;  2D5K A;  4PG1 A;  2IU2 A;  5GU2 X;  3E1M A;  4ITW A;  4LPM A;  5CZU A;  2XGW A;  3UFB A;  5CMR A;  2V15 A;  1N1Q A;  3D19 A;  3E2C A;  5J9V A;  2V2O A;  3PVT A;  4CYB A;  2Z5R A;  3R2M A;  3BVF A;  1RCG A;  3W54 A;  4ISP A;  2G4H A;  2XJN A;  4YKH A;  4ZKH A;  3GHQ A;  5HQO A;  5D8P A;  2FHA A;  1O9I A;  4EVD A;  3FRS A;  3IQ1 A;  3C1Z A;  4CMY A;  3AK9 A;  2AR0 A;  3R2H A;  3WVV A;  3JZA B;  4LQN A;  3L0M A;  2CHP A;  2ITB A;  3KWO A;  1FHA A;  1NFV A;  4TOC A;  4TO9 A;  5ERJ A;  3R2K A;  2V2N A;  3E1N A;  3RGD A;  3EZU A;  1O9R A;  2ZG8 X;  1QGH A;  3F33 A;  4KVS A;  1EUM A;  4MUD A;  5I4J A;  2CLU A;  2CF7 A;  3Q4R A;  4QUW A;  2FL0 A;  1UMN A;  5JDO B;  5FFE A;  4TW3 A;  1HRS A;  2C2F A;  5JKL G;  1ZS3 A;  1F33 A;  1Z4A A;  4KXR B;  1RYT A;  3NOZ X;  4LQJ A;  2VXX A;  5E2D A;  1RCD A;  1JIG A;  1VJX A;  5FFC A;  1LKO A;  1IES A;  4EVB A;  1KRQ A;  1XZ1 A;  2FKZ A;  4MY7 A;  4ZTT A;  4P18 A;  1JTS A;  3PZA A;  3M6J A;  4RC6 B;  3BKN A;  4E6K A;  2Z6M A;  3PVY A;  2YW6 A;  4Y08 A;  3F36 A;  2C2J A;  4AM4 A;  2W0O A;  3N6O A;  4Z3B A;  4KVR A;  4X0J A;  2ZG9 X;  3KA4 A;  3ISF A;  3KXU A;  1MOJ A;  3FSE A;  4TOE A;  4TOG A;  3KHK A;  3SE1 A;  3IS8 A;  4EVC A;  2FFX J;  4DE6 A;  4DAS A;  4II4 A;  4U3G A;  5D8X A;  2QQY A;  2V8T A;  4TOF A;  2JD6 0;  2FJC A;  2BJY A;  4XKU A;  4PG0 A;  1XZ3 A;  4CVS A;  4CVR A;  1DVB A;  2Y3Q A;  4CMY V;  4PGI A;  1B71 A;  5GU0 X;  1LB3 A;  3F32 A;  2GYQ A;  4MJY A;  3BVE A;  1NF6 A;  1S2Z A;  4MKU A;  3WVW A;  5IX6 A;  3HL1 A;  1JI4 A;  1YUZ A;  1YV1 A;  4A25 A;  4EVE A;  2YJJ A;  4MXP A;  2CLB A;  2Z5Q A;  4AM5 A;  4DI0 A;  4R42 A;  5HJH A;  1VEI A;  3GGZ A;  3Q4O A;  4YXM A;  3AF9 X;  3R2S A;  2RBD A;  4ZL5 A;  4M35 A;  5FFA A;  1VEQ A;  3OJ5 A;  5C6F A;  3NP2 X;  4LPN A;  3E6S A;  2WLU A;  1SOF A;  2C6R A;  3BVK A;  4IXK A;  2CWL A;  1L8H A;  2BKC A;  5LBH A;  1TJO A;  3C21 A;  5GOU A;  1TKP A;  4LQH A;  2WTL A;  5JDO A;  3E1O A;  2Z90 A;  2IY4 A;  3AJQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...