2YJTD

Crystal structure of e. coli dead-box protein srmb bound to regulator of ribonuclease activity a (rraa)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
170
structure length
170
Chain Sequence
RKKIHQWYYRADDLEHKTALLVHLLKQPEATRSIVFVRKRERVHELANWLREAGINNCYLEGEMVQGKRNEAIKRLTEGRVNVLVATDVAARGIDIPDVSHVFNFDMPRSGDTYLHRIGRTARAGRKGTAISLVEAHDHLLLGKVGRYIEEPIKARVIDELRPKTRAPSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Potential Regulatory Interactions of Escherichia Coli Rraa Protein with Dead-Box Helicases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase inhibitor/hydrolase
molecule keywords REGULATOR OF RIBONUCLEASE ACTIVITY A
total genus 47
structure length 170
sequence length 170
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2011-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2yjtD00
1DO2A 4NE2A 4BFUA 4G5RA 4JL8A 1TPZA 1DELA 1AGPA 3QKUA 3CBQA 3MWYW 4BZPA 1FOEB 5BW8A 1AQUA 2H16A 2R44A 2C78A 5JWRA 2GEDA 3LX5A 2AR7A 2JLYA 5FBLB 1QDEA 4ACBA 3H2YA 2GDJA 1ESNA 5EZ6B 3B9PA 4ERNA 4DB2A 4FMBB 4LYFA 5JCPA 2ZVQX 3WYGA 3THYB 1XP8A 1CR1A 5L3VA 3MMPA 5CM8B 4PAMA 5HTKA 3M0EA 1R5OA 5DIFA 3A58B 2NO1A 4Y0AA 4LZZA 3LWNA 1Y3AA 3L2OB 2IW3A 5L3QA 3REFA 1Z3IX 3F0TA 3T35A 2ZAOA 4UNQA 2XSZD 4FIDA 2W0SA 3QXHA 4AKHA 1GDDA 1HA3A 3P26A 4JLPA 2VPPA 1RVDA 2JDID 2IC5A 4TSFD 1XCPA 2FJUA 4LV6A 1ZNXA 3EG5A 3L82B 3FGNA 4TLBA 2ZE5A 4C0AC 2YWGA 2D62A 1TUEA 2YV5A 1CIPA 1JXOA 2Z0MA 2VEDA 5FPTA 3B1ZA 1A2BA 2WV9A 4PHTA 4UNNA 1K5GA 1PUIA 1Z0DA 5KNCA 1MO5A 1TAGA 3EZ2A 2XJ9A 5FOVA 4DDUA 2ZR9A 3FOZA 1VYTA 5AR1A 4TYQA 5EP1A 1KGDA 4XIGS 4F7WA 2DPXA 3VNVA 3GEEA 1XJQA 4Q4AB 4Q1EA 4O2RA 1SULA 3SEAA 3AGPA 4Q47A 2N1BA 2RMKA 4FI3C 1DVRA 2JLRA 2ORIA 2W83A 2IUUA 5AJZA 3SU8A 4D0LB 5BQ5A 3AVQA 3BFKA 1E2HA 2NOAA 3GJ0A 2QTFA 1RJ9B 2BWJA 4DDWA 1ZNZA 4XD7A 1EWQA 1UKVY 1L4YA 3WNBA 4B3GA 1XBTA 4OL0A 3SQWA 1E94E 3AP3A 4IVQA 1XMSA 2XNDD 1WMSA 1HE8B 3QXXA 4YQFA 1DARA 2A5YB 2IK8A 4WZAE 4NPHA 2RGXA 3AVUA 2VTKA 4PC1A 1XXHB 1CJUC 1FP7A 1YZQA 5CM9C 2EFDB 2BCGY 2IXEA 1N2CE 4JL6A 1ZUHA 5FR2A 2G77B 3AB3A 2D74A 4MITA 2CDNA 1E1QD 4LYJA 1GAJA 1X6VA 3KB1A 1C1YA 1KNXA 2YVUA 1E2EA 1XJ0A 2IHBA 4Z8YA 1FX0B 3TH5A 3THWB 5JEDA 4P3YA 4I1SA 1XNJA 3K0EA 3OEHD 1OH5A 1E96A 2ERYA 3PEUA 2J1LA 1KI3A 4PX9A 3X1WA 3PCRB 3O8RA 2GJ8A 4Q02A 4QGAA 5CDFA 4G01B 2B8TA 1VECA 1RYFA 2PLFA 2FH5B 5JBQA 4FW9A 4AURA 3KB2A 1T9HA 2VLIA 3E1SA 5LB2A 2IYVA 3N2EA 5ANRB 4MGKR 4QNMA 2WSSD 1F60A 3GQBA 3A1TA 4GPTA 5DHFA 1SZPA 1W48A 1TNDA 1S1CA 4LHVA 4D81A 1LS6A 3EZFA 2P67A 3OEED 3TSOA 5SZJA 1KI9A 1YZUA 4QNRA 1SXJC 2HT6A 5B64A 3C14C 2RH5A 4QHTA 1XMIA 2V3CC 4Q9HA 4X8LA 1NBMD 1KI7A 2GXUA 2PT5A 3K8YA 2RGEA 1KI2A 3MJHA 1M8PA 3SC3A 3GLIE 4IFBA 2F3TA 2CJWA 2RGDA 4AY2A 4DLZA 3L8ZA 4NCHA 4Q7MB 1U99A 1VCNA 4LDJA 4TLAA 5FOSA 4M4SA 5DNYB 3QKSA 1W44A 2IYXA 2DB3A 1F2TB 1G8GA 2LWIA 3QVVA 1W2GA 1A82A 4NYJR 1IQPA 2HF9A 1Q1BA 4QRHA 4DSNA 1Q44A 1RYHA 4IXMA 4BE7B 1G3IA 2O8CB 3IIJA 1DAEA 2N46A 3L8YA 1R5BA 3EC1A 3AVXA 2WKRA 3MG9A 3HYTA 1E2PA 3QI2A 1DOAA 5JRJA 5LBIA 4B2PA 4QBIA 1BYUA 3U4QB 1AGRA 4B6EA 4OKSA 4U7DA 1SVIA 2A9KA 2J7PD 5H1YA 1CJMA 1VYUA 1J7KA 3RS2A 1U0LA 4WAUA 3DZ8A 5DISB 2QA5A 3NC0C 1LF0A 2WJHA 2ZYWX 3OE7A 2CL0X 1DADA 2QMEA 4KBFA 1R4AA 2UZ3A 4CT4B 3C15C 2G1JA 4US2R 4LX0A 2VYFA 1MABA 1YZTA 4R2HA 5GVRA 2ORWA 2QI9C 4A0FA 3Q8XB 3TLXA 5FBWB 3FFBA 4FMCB 4OI2A 4QXAA 3L43A 5FBVB 1AS3A 3JVVA 4PHGA 1KY3A 2ZJ5A 3U3MA 3FTQA 1NN0A 5GADl 2ZRHA 3RS4A 4DCVA 3TKLA 2BM1A 521PA 2VP2A 3BGWA 4JVLA 5DE3A 1HEIA 3RRNA 4ZKEA 4V0LA 3Q7PA 1G8FA 2HCBA 2D2EA 5TMPA 2Q9AA 1P5ZB 3QQ5A 3IO3A 8OHMA 3RS5A 2GF0A 2QMOA 3VR6A 3PIRA 3NBFA 1BOFA 3LAWA 2Z4SA 2V1UA 5DHAA 3UMFA 1II8A 2JLWA 5L3QB 2AN9A 2FPMA 5GJVC 2J9RA 2J41A 1Z47A 4RCZA 3U6KA 2X77A 3CIOA 2I3BA 4LJYA 2MSDB 4LRWA 4OQFA 3S1AB 2V7QA 3JZMA 3CM0A 1J8YF 2CNWD 3QXSA 1JNYA 2GBLA 3ZZ0A 1R0XA 2EQBA 1W0JD 4PSVA 2OM2A 4ZCIA 1RRPA 4AC9A 1P2SA 2WJVA 4A92A 1E99A 3OIYA 2ZUDA 3B82A 3AVPA 2FSIA 2XZOA 3CH4B 3EAQA 3CWQA 4M1KA 4P32A 3KQNA 1I2DA 3TRFA 4DB4A 4X8OA 1G7TA 3MCAA 1KOFA 3LH5A 1G7CA 4WA7A 2GEUA 4HI0E 4IXNA 2ZI4A 2CCKA 1HQCA 1R0WA 2VSFA 4M9SA 621PA 2Z83A 1U2RA 3O47A 1LY1A 5KDDA 2GILA 5CDFE 3E5HA 4DKXA 4V02A 5TXGA 4WIAA 3TSWA 4KODA 4EFNA 1OXVA 4BLQA 2QP4A 2ZR7A 4D82A 4Z54A 2HYIC 4P4TA 2HXYA 4QJ4A 4DLYA 3X1XA 4YXWD 3D8BA 4NDZA 2J5XA 4CYMA 4XWAA 1S3GA 4DEYA 4KU4A 1MO6A 5EUMA 4JKIA 1KSHA 3B1VA 4E5UA 1ODFA 4F38A 3U7GA 2AXPA 1NL3A 3U3KA 5KHOC 2JLSA 2QM7A 4G3XA 4DLWA 2HEIA 5AWFC 4RZXA 4DLUA 2EYQA 1N6IA 3DPUA 3MWJA 1GRQA 2O8BA 3TJZA 3IPXA 5AJVB 1TUIA 1G9XA 1IM2A 1QG4A 1M6NA 2E9SA 2Q6TA 4CF7A 3VKGA 1DBSA 1SXJE 1K8RA 4NYIQ 1NY5A 3TGPA 3UATA 4GOXA 1XTKA 1EFRD 6Q21A 3B2EA 2GNOA 2C96A 4CGZA 1PLLA 1QG2A 1G6OA 3CONA 3KFXA 1TU3A 2VP9A 3GLFB 1X3SA 1XDBA 4B3CA 4A9AA 2JAQA 4L8GA 4IDPA 4TZ0A 2CEAA 1W4CA 4AWXA 3Q7QA 5SZKB 4BWYA 1N6PA 4NYJQ 3Q5EA 4MRSA 5D3MA 3UK6A 3ADBA 1GITA 4PZYA 3R9XA 3EIHA 4LBZA 4A0RA 1M34E 1TEVA 2FEOA 3RS0A 3DEFA 1OXXK 2P5SA 2BKUA 1FUUA 1AIPA 1KHTA 3GD7A 1KK3A 3NBYC 4TQAA 3WBJA 3UG7A 2WKPA 4IVRA 3Q3JB 4NH0A 4HDCA 5JFGA 4NMMA 1RJ9A 4DSOA 1YQTA 1VIAA 2F6RA 2VHTA 1FTNA 2OAQ1 4TN1A 1GFIA 3A6PC 3QPVA 2AXNA 5CYOA 3VR3A 2O8EA 2H18A 1E9DA 2JLUA 4O0MA 1XXHE 3GFOA 4A2WA 2O8FA 2C5LA 2PX3A 3MGCA 5FUYA 4B33A 5FI1B 1CTQA 4W5HA 2H17A 1AA9A 3KKQA 1SKYE 2XAUA 2REOA 3LLUA 2DHRA 1KDTA 5B30A 1Y63A 3FKSA 2QAJA 3RDPA 3GFTA 1IN6A 2FSHA 5KDLA 4B74A 2WIBA 3WHKA 1UBEA 4PR0A 4RCYA 3GLGE 3VNUA 3QKRB 1F3OA 1LS1A 2Q0HA 3TK1A 1W4BA 2V8OA 1KSJA 3GLFA 3IHWA 3SJCA 2ZM5A 1Z2AA 3VX3A 2GZHA 5EE0A 1X86B 1CRPA 4OJQA 5L8VA 2CCJA 2FZLA 3RANA 2RCNA 1W4RA 3OEHA 4URWR 1KYIA 3GJ6A 3GLGB 5EP3A 3SJAA 3C8UA 2AD1A 4P31A 4DIDA 4OK3A 2J0QA 5FFMA 4ASUA 3W3ZB 2G0TA 3MWKA 4NKRA 2VA8A 2GA8A 1J90A 5LDDC 4QM7A 1YRAA 3ZIAA 1AKYA 3RVBA 5EE3A 1OIWA 1A7JA 3A8TA 3ZGXA 4HLUC 1QZXA 5SZIA 1RIFA 1W0KD 2RGNC 3NG1A 4AKEA 1G6HA 421PA 3HPRA 3NHBA 2VHUA 1GRRA 3WP1B 5DI3A 3LXRA 1IJFA 2NZ8A 4ITRC 4LYHA 1D9XA 2JJ2A 3BERA 2G6BA 4UJ5A 4CDGA 1ZNWA 2OCAA 4V0KA 4XTRA 4XJXA 3AUXA 3TW8B 1AQYA 4HB2A 2ZS9A 5CB6A 1Q3HA 3CPEA 1COWD 2QU8A 2R9VA 1RW4A 5JECA 3CNOA 3VR5A 3THXB 1PLKA 3CF0A 4MGIR 2Z4RA 1HURA 5AJXA 2MSCB 1NNEA 4EFLA 3FHCB 1I4TD 5DI9A 4BLSA 5E4FA 4RZ2A 5HCIA 4RKEA 3GEIA 1TQDA 2GJAA 3T5DA 1L2TA 3A4NA 3ZDQA 4BFVA 1MO3A 5K8IA 3CB4A 2DWPA 3ZIAD 3JZAA 1NRJB 3EX7C 3X1YA 3C4JA 2WWHA 5KTYA 1OB5A 3NDPA 4TMZA 1OXUA 4IOLA 1SVMA 2JA1A 2WJJA 3R7WB 4M9XA 3PG5A 2DWQA 1JI0A 1T0JB 4BLPA 1W36D 3X1DA 4Z1MA 1E0KA 3KJHA 4HLQB 2KSQA 3L0PA 3IILA 2GCOA 2E1RA 4LPKA 1HYQA 3UKDA 1SKYB 2ZS7A 4PPQA 4Q21A 3IKJA 1UAAA 2CCGA 4DWJA 1CULC 2ZSBA 3T1TA 3BBPA 3HR7A 2QTHA 2QGZA 3WNCA 3FFAA 3EZ7A 1U9IC 5IK2D 5AUOB 2QENA 2ZANA 3SNHA 1AKEA 4KFUA 2XB2A 3TR5A 1KMHB 1N6NA 4MYTA 4CZ2A 4YMTA 2BMJA 1Z6XA 4ZV4A 4CEIB 4EJSA 2IS2A 3A1SA 3KKPA 4TT3D 5UKDA 2XITA 3DL0A 5ELXA 4WVFA 3ASYA 1T5LA 4LBVA 4MQBA 4R9UC 1JR3A 3BFXA 3I5XA 1SQ5A 4DLSA 3QKTA 1NJFA 2AFHE 3Q72A 2FA9A 4BZXA 1TADA 3BS4A 1NN5A 1Z0JA 1P61B 1NP6A 1FUKA 2GEVA 3PUZA 1ZC4A 1W4AA 2B21A 3DOFA 3DO6A 3I4LA 2BJWA 3CF6R 5F98A 1NSTA 4IRUB 3KZ1E 1VCIA 2C77A 3UMRA 5L3RA 1IN4A 3KJGA 4G5OA 5CITA 1EK0A 2ZRCA 4PXAA 4ZPXA 1JR3D 3H84A 4MGZR 1F6BA 1QHIA 1XEXB 2SHKA 2VP5A 2ZJ8A 3ZVLA 1A1VA 1XCMA 2X2FA 1E2IA 5EXXA 3THYA 3E2IA 3VR2A 3UPUA 2BMDA 3OHMA 1F5NA 1D8TA 4B47A 4N1AA 1SHKA 4M1YA 2WMOB 5HCNA 1EESA 4HAWA 3D7MA 3K09C 1GL6A 4TLCA 1UEIA 1E2MA 1VHTA 1U81A 1ZVQA 3TUZC 1JBKA 4URUR 1ZMXA 2ZU6A 2Q3MA 1ZP6A 1E9FA 1PJRA 2FEMA 1E98A 2EU8A 3QBTA 4Z1MD 4TL7A 1E9BA 4ESHA 3FKQA 5J5CA 1KMQA 1K5DA 3KQKA 1EFTA 4MA4A 4EDHA 3I92A 4RZ3A 4D0GA 3QBVA 1E0AA 1WA5A 4MKGA 1DTSA 1YKSA 2O52A 4WOPA 3MRSA 4NP6A 4OQXA 3CZPA 2RGBA 3B8HA 3VAAA 4DIEA 3KX2A 1LFDB 2YOHA 3WBKA 2WOJA 4URYR 4GP7A 5D3MB 1OKKA 3KJIA 3A37A 4HLDA 1SHZA 3OAAD 2YNMA 3V00A 4M2LA 1E2FA 4GDFA 1JJVA 2ZUBA 1C4OA 5J4YA 1WDTA 4TLDA 3ZQ6A 3N70A 4IHQA 1KJWA 4C0KA 2X8AA 2A30A 2W2XA 3ZD6A 5D3QA 3OF5A 1KO8A 5DSZA 1CU1A 2ECKA 1KTVA 4Q18A 1KNQA 1G5PA 4XD7D 4LK2A 2FFAA 2ZYUX 1HH4A 3B7GA 4OQLA 4OHYA 2ZI3A 3B78A 2AFIE 2XNSA 4GMDA 4RD1A 2CLDX 4O2LA 1G3RA 1LNZA 2NGRA 3OZXA 2CHVA 3FHTA 1D9ZA 1ZM7A 4HUQA 3BFVA 4JSTA 1EGAA 3UIEA 2FDCA 4XOIA 5JSZB 2IEYA 2QBYA 1OYWA 2ATXA 2QMUA 3N2IA 3SBDA 3NH6A 3V4FA 4KVAA 2XOKD 1R0YA 2Z5FA 2HXSA 1ZU4A 2J7KA 1EX7A 1NJGA 2EFGA 3G5UA 3O8DA 4HAZA 4JLOA 4RFVA 5CB8A 5CYPA 4ASUD 4BPBA 1R2QA 3QG1A 3VR1A 4V0MA 2ZYVX 4U00A 1OJLA 2ZRGA 1N0VC 2XB4A 2ZI9A 1OLOA 1H8HD 1KIMA 1UDWA 2XTZA 2WOOA 5BXQC 5FPHA 1Z0KA 1OXTA 1ZNYA 1RRFA 3QVUA 1IJEA 3DKPA 3B85A 4WW0A 4TSFA 2OESA 2YC2C 4BFXA 4TQUS 5JEEA 5J4HA 1DAKA 1UBFA 4B6FA 2YWFA 4QFMA 2G1KA 2HT1A 5HZHA 2WWYA 3SI7A 3FWYA 1GVNB 2HLDD 1Z83A 4FN5A 3Q85A 4RFSB 4B73A 5K8LA 3Q9LA 3FB4A 3BC1A 2PJZA 3HWSA 4G5GA 4DCSA 1DO0A 3NC1C 2OG2A 2VL7A 1JJ7A 2HV8A 3DKVA 1LW7A 5FPSA 1CJKC 1LTQA 1NLFA 5DYIA 1MO4A 1ZM4A 1IY2A 3FKSD 3QF4B 2XXAA 2XNDA 5KNDA 5FR1A 2D06A 2AK3A 2QM8A 3KKOA 3OEEA 1MRNA 2Z6VA 4B44A 1RC8A 4MRNA 4KJZA 4A6XA 1N6RA 2P6RA 2C98A 1ZAKA 4JLVA 4YLGA 3T06B 2IF2A 1MRSA 2FNAA 2WPDD 4HZUA 2MMGA 1DE0A 2R8RA 2ZSAA 3AKYA 3ADKA 4EKDA 2A5DA 1G8PA 5A5GA 2F3RA 4EFMA 1UKEA 3I8SA 4LHZA 4TMKA 1VYVA 1IN8A 1X8KA 3KXLA 1YZKA 1CXZA 4TYYA 2FX3A 1YE8A 1XZPA 3ONWA 4B2LA 3LQRA 3ZLJA 2ZQ5A 1EXMA 1G8HA 1J99A 5KUTA 4TZ6A 4RY2A 3CUEF 3EASA 2LKDA 2OBMA 3QUSA 3RNLA 5KU1A 1X8JA 3TVTA 2PMDA 1YR9A 3LDAA 1KDOA 3NXSA 2JGNA 4O25A 4PC2A 4F92B 1NN1A 3FPAA 3U7HB 2F9LA 4E07A 5DI3B 5JZVA 2ZE6A 1EFRA 1QF9A 1YHNA 1AM4D 3MSXA 3NTUA 4LGMA 4YMVA 5FOWA 1P6XA 1Q22A 4LBYA 4DLTA 2DY1A 2WTUA 4PO8A 3B6EA 4ACAA 1GUAA 2WBLC 1IONA 3IPYA 3RHFA 3T61A 2H8KA 4IDNA 2GETA 4HAUA 4YMWA 2ZRFA 2WSSA 2BM0A 4Q1DA 1KI8A 3CNNA 4LI0A 2YOFA 3G0HA 2VIIA 2C2HA 2GWHA 4P4SB 1XRJA 4LV5B 4C9BA 4Q4HA 4C0QC 5FL3A 1R8SA 1VMAA 5KSZA 1WQ1R 3IEVA 3D6TB 2H1LA 1T6NA 1IY0A 2OCPA 3W3AA 4I1UA 3QXCA 2ZEJA 3FVQA 4MDEA 3OESA 4V0OA 1KKLA 5JHHB 5FTLA 2A5FA 3BORA 2O8EB 2BIFA 2W6JA 4Q1AA 1TF7A 4W5JA 4AYWA 4W9MC 1PZNA 2PZFA 4C0JA 4M1TA 2J59A 4ON9A 2OSBA 3ZZUA 5LD2B 1J70A 3DOEA 1S9DA 2JATA 4W5WA 3GCGA 1S96A 4PZZA 1RPZA 3WP0A 1JAHA 1EFCA 4XVQA 5DN6D 1SXJA 4US1R 4UXJA 4MKFA 4CVNA 2VF7A 1ZM2A 3RSLA 4QJ3A 2OT3B 2WIAA 2BHRA 1G5TA 1GNPA 2LKCA 1ESMA 4CW7A 3WMEA 1G1MA 4OHXA 4HATA 4XSHA 2EWWA 1F2UA 3GJ4A 3B9QA 5K8TA 3J81k 1E2LA 2A3RA 3AP2A 1TF2A 3CW2A 3LRPA 5CLQA 4B34A 4C0HA 1II8B 2W0MA 1OFUX 1XTIA 2GAAA 2OAP1 2VHQA 4Q03A 1ZUNB 4KFRA 5JJIA 5EXPA 1KZ7B 3ZVMA 4PSAA 1SVKA 5HE9A 5JHGB 5HKKA 4N0DA 4F4IA 2IL1A 2IT1A 2ZIAA 4FMCF 3GFPA 4A6PA 4LCBA 5L3SA 1D6JA 4ABYA 3I61A 1KI1A 2OFOA 2PBRA 4HDQB 3SHFA 1CJTC 3C16C 1FX0A 2J87A 4GOJA 4QBHA 4C30A 5FPKA 2Q9BA 4CRWB 2ZRAA 1OIXA 4Q1CA 4YMSA 4NBSA 2FV8A 4IEIA 4ESVA 2ZYTX 4PHFA 1Q1ZA 1RKBA 1HTWA 1JAIA 3KTAB 4JVNA 5CK5A 3IGFA 3LVRE 2GCOB 4K46A 3W5JA 2P6UA 1RRCA 2QAGB 2IEZA 1EWRA 4D4LA 2KI5A 3O8BA 1VG9B 5TDHA 1XD2A 1P60A 1WE2A 2QT1A 1TMKA 2VHJA 1OFTA 2YYZA 4GZLA 2ZTSA 5EZ5A 2R6GA 1MR3F 1CEEA 1E9EA 3R9IA 3FE2A 5GJBA 1ANKA 221PA 4A4DA 2J0SA 2XGJA 2IYZA 2RGCA 3EZ9A 3CX8A 4JZKA 4TL8A 1L4UA 4DCNA 3AQ4A 4QHYA 4G5QA 3CRVA 1W5SA 1KSGA 4O3MA 4PO9A 4JL5A 1A2KC 1SXJD 1X1RA 2ZSDA 1T3LA 1OYYA 3AF0A 2HUPA 3BWDD 4EPTA 5KYKA 4M21A 2GJSA 4PC3A 4PQRA 1ELOA 2VQSA 2QUZA 2ZU0C 2OZEA 2IWHA 5LPNA 4NCJA 1YRBA 3KTAA 4BFSA 3KL4A 2BBWA 3BOSA 2H92A 4A82A 3TUJC 3VU9B 3BB1A 3L0SA 3TBKA 3CNLA 4C3ZA 2B8WA 3ZH9B 3DM9B 4HYYA 1PV4A 3IQXA 2OFWA 2Y8EA 2PJRA 4N3NA 3VHLB 1JR6A 1SKQA 3ZYCA 3QPWA 2IYWA 4BFTA 5G3ZA 5J4LA 4M1WA 2GXQA 2UKDA 4Z51A 3GP8A 2GJ9A 2EW1A 1HUQA 1FNNA 4L15A 1OH8A 3MAAC 4IDOA 2CVHA 2O0KA 4MUBA 4ZDJA 4UNPA 1OHHA 2YKGA 4LV8B 3QNUA 1XB2A 3VR4A 3MJRA 1KI6B 1NMXA 3HU3A 5FOUA 3QG5A 1W46A 2QL6A 3PQCA 3HU2A 4BLRA 2GESA 4GI7A 4F91B 2WHXA 4GL2A 3A1UA 2W00A 3VTKA 4D25A 1XMVA 2R62A 2OXCA 5EXSA 2QSZA 3LX8A 4OHZA 2FWRA 2GCPA 3K09A 2PEYA 4FMDB 4NYMR 4TTQA 4RD6A 3IBGA 2FMXA 4B3BA 4S2EA 3ZD7A 5F9FA 4Q19A 1JB1A 3W9YA 1XPOA 2LCFA 2NO7A 1P9NA 4LJ7A 4UQOA 5AJWA 3RSOA 3GJ5A 4QKQA 721PA 3T1VA 1AZTA 1U90A 3R7WA 3ICQB 3CX7A 4AK9A 3TAHA 4DHEA 5J4KA 4R98A 5J4VA 1FL9A 1WF3A 2FSGA 2O8FB 3O8CA 2C9OA 2IYTA 4Q9IA 2QQEA 2KWIA 2JJ1D 2ZRMA 5FUXA 1H8ED 3I62A 2XTNA 4H1VA 4BQSA 2WWFA 3THXA 2B7CA 1AS0A 3I1FA 3CRQA 1T3SA 4HB0A 1UBGA 5FPYA 3AKEA 4LJ6A 2BEKA 3SYKA 1N0UA 1SVWA 3I73A 5B58C 1QRAA 2KB0A 3HR8A 1BO6A 2ZI6A 3R20A 1WB9A 2F7SA 1QHSA 2YINC 4BEBA 1W1WA 1DPFA 3VMFA 4EPVA 2ZVPX 4EIWA 1W2HA 2HF8A 2ZREA 3KUCA 4OJKA 4OQMA 3WRXC 2IUTA 4RD4A 3EPLA 2NMVA 4DLRA 2Q9CA 1KSFX 4MYUA 2ZJ2A 4P4UA 2ZJAA 4HAVA 2BBTA 2IF0A 1BIFA 3B60A 4D6PA 2J0UB 1N5KA 3EW9A 3PUVA 2O8CA 4GSYA 4WZBE 3GLIA 1Q1EA 2WAYA 2FE4A 3LY5A 1N5LA 3C5CA 5FBRB 1GP2A 4MYCA 5TARA 1W49A 4Q5IA 4Z8XA 3WMGA 2DCUA 4MDFA 4EAQA 2VH5R 3R8FA 3OFND 4KBGA 1JPNA 1N0WA 1TU4A 1ZRHA 2OEPA 1YVDA 4BRWA 1HQYE 1EG7A 4M0LA 5E7IA 2F1HA 3KUDA 3AGQA 4KI0A 2XJ4A 1K6MA 1G7RA 1TX4B 5FOTA 4PANA 4S35A 1DAFA 2C99A 2CMKA 4AD8A 1G21E 2VO1A 4NONA 5F9HA 1U0JA 3OIWA 4JLKA 3T1QA 4BZQA 3LLMA 1G20E 2QRZA 4KO8A 1Z63A 3R9WA 4EPRA 1D2NA 2XEXA 3QIAA 2C04A 4JLBA 1NIJA 2XX3A 2YHSA 3PITA 4QL3A 1Z6TA 5HKKD 1P3JA 4LPSA 5C18A 1W7AA 2R6DA 1XXHA 2PMKA 2WWIA 3GJ3A 1FMLA 1T91A 4IDHA 4A15A 1HY3A 3FMFA 4R71A 3DHWC 3LBIA 5FI0B 3IEUA 1XTRA 4BGDA 2V7QD 1G19A 3EIEA 1A5TA 1WCV1 4EUNA 4L16A 2W6ID 3BIFA 1R7RA 3SE0A 1UBCA 2J46A 1Q0UA 2IYLD 5FL7A 4MGYR 1MV5A 4GOKA 3RABA 3ZZTA 1NG9A 1YJ5A 1GNRA 2BMFA 2VBCA 5EQTA 3CO5A 3WYAA 4V0ME 1OKKD 2DYKA 4DSTA 2NIPA 1FPMA 2ORVA 3AF4A 4KSCA 5SZHB 4HAXA 1XD9A 5KO2A 2ZETA 4DDVA 4A0HA 1M2OB 4OHVA 1N6KA 4A2QA 2ZR0A 1E4YA 4PTLA 1G64A 1E69A 2CBZA 4Q66C 1GKIA 1IHUA 4D4JA 1PUJA 1W47A 2F1JA 1NLZA 1VPLA 2R6FA 4JT2A 4IVPA 1FQKA 2ZJBA 1D2EA 3F8TA 3GJ8A 4LUCA 4PSKA 2BJVA 1NLYA 1KK1A 2GRJA 2YZ2A 5FUWA 2IYRA 4RVCA 4GMXA 4E22A 2WWGA 2O8BB 1G17A 1R5NA 4EQ6B 2A5GA 4EPXA 2V6IA 2O8DA 1XFAA 4JLMA 1GNQA 4LHYA 4QGHA 2D2FA 2UVQA 2O8DB 1IAQA 4ILEA 4QBFA 5GJWC 3T5GA 2BDTA 1VG1A 1LB1B 5EE1A 2ODBA 3H4MA 1AS2A 1JQJC 3NBXX 4HAYA 4ZCLA 1M74A 2V9PA 5AUNB 4XTCS 1TL7C 2IWRA 2J0VA 1MABB 3CWZA 4KHZA 3TMKA 1Z08A 1V43A 1VHLA 4U5XA 4V03A 1OFIA 1ETUA 3PUYA 2HLDA 3LBHA 3PENA 1NVVQ 4C4PA 1R10A 2ZROA 2FN4A 3F3YA 3P32A 4KITB 2DBYA 2AWOA 2D7DA 2F43B 4A8JA 5BWMA 5FTJA 2JIZA 3LBNA 1E2JA 4OI0A 3ADCA 3KXKA 1LV7A 3AV0B 2REXB 3I3SR 1KO5A 4M1MA 3W34A 1GIAA 2AX4A 1N5JA 2WJGA 1US8B 2CE7A 4ZDWA 1E2GA 4LYAA 4JVSB 2MSEB 2DFKB 4I1VA 1P9WA 2I4IA 3T1OA 4EJSC 3TSZA 1II9A 1W0JA 1XTJA 1KAOA 1M1YE 5JSZA 4XVRA 1GZSA 2CNWA 4NTZA 2WPDA 4RFSA 3EPJA 2AKAB 2GZAA 1V5WA 1E79D 2CL7X 2D7CA 5KPDA 2ZJYA 3TW4A 1UF9A 4E09A 1DAIA 1XEFA 1GILA 2ONKA 1EFHA 3CR8A 3PFIA 4YDSA 3ND9A 3UMSA 2ODEA 2GAOA 4LSGA 3I32A 4US0R 4Q9LA 4AKIA 3U7EB 4PQYA 2A2ZA 3UANA 4Q7LA 2ZJOA 1CR0A 4B75A 4ZCMA 2WZQA 4KVGA 5IT5A 1NVWQ 5F3WB 2ANCA 5C46F 5IF9A 1VIYA 3ETLA 1XEWY 4NYIR 2EWVA 1S0UA 3A4MA 4A2PA 5JJKA 3HU1A 5FUVA 4URVR 3IHLA 2O0JA 1QHGA 3QOFA 5FH9A 5JCZA 3AF1A 2AD5A 3LD9A 3ZVRA 1YZNA 1CKEA 2G3YA 1E9CA 2NO6A 2ZRPA 4BECA 2ZRNA 4DJTA 4FINA 1O3YA 4ZI2A 4WBSA 3U6BA 1W36C 1OPXA 4XSGA 2TMKA 1ZCAA 3W90A 1FQJA 4B35A 4JYCA 4NCIA 2G83A 1MOZA 4TTPA 2GJKA 4WXRA 5CJPA 2REBA 1ZM9A 1IN7A 4KLNA 4DZZA 2WAXA 5A0FA 5C2JB 4L5BA 2QRNA 4TMTA 2EFCB 3KQLA 3M4YA 1HE1C 3GEHA 3BRWD 3K70C 3QXJA 3U5ZB 1H8HA 2RGNA 1VG8A 1KJZA 3GJXC 3VKHA 1J8MF 3SQXA 3NBZC 1NN3A 1T0HB 5JJLA 2F1IA 3EPHA 2XZPA 2IXFA 2RHMA 2VSOA 5IHPA 3FMOB 2QNRA 4UNRA 1OV4A 3KQHA 1NKTA 2RKOA 2B6HA 3TNFA 1Z29A 2P6NA 4PPFA 4DUGA 2YOGA 1AN0A 5KNBA 2QG6A 3RLFA 4HUTA 5C1BA 1JXMA 2PL3A 1GG2A 2OBNA 5C4MA 2O5VA 4KLZA 1DS6A 1EFUA 4RZUA 4UXHA 1YR8A 3KDSE 4LWZA 4H1UA 3SYNA 3IO5A 1YZGA 2NQ2C 3T12A 3VFDA 1ZD9A 5HPYB 4MYHA 3V4RA 1P4SA 4XH9B 3A1VA 3VHXA 1UKZA 2XZLA 2AK2A 2P65A 4Q01A 1FZQA 2ZPTX 3LXXA 3NKVA 2P3SA 1YR6A 3ND8A 1S3SA 2CK3A 2ODNA 4EPWA 3NWJA 3SDZA 1N6LA 4DRZA 5KDOA 4MRPA 2EYUA 3H0KA 4BASA 3ICEA 3IUYA 1AJEA 1N3BA 3IDQA 5LD2C 2ZE7A 4AIIA 1XJCA 1BMFD 3EZ6A 3OIUA 4Q9JA 4G5SA 4LHXA 1LVGA 4FWIB 2Q3FA 4DBLC 5EJEA 4B76A 3UWKA 2JEOA 4RJLA 4KAXA 5FTMA 3U7FB 1NKSA 1Q3TA 4L9SA 1U0HC 4G0NA 2JJ2D 3P1JA 5E7JA 5IK2A 2VF8A 4NHOA 4R7ZA 3RRYA 4P0TA 4B48A 3BK7A 4D2IA 4D4MA 1GTVA 3G82C 1P62B 1JECA 2JLVA 1Z8FA 4W7SA 1DAMA 1E79A 4ZDKA 1OFHA 2Z43A 3TIFA 1F2UB 1CRQA 2ZSFA 1XU4A 1P9RA 3BD9A 4OQNA 1P73A 1NI3A 1VCMA 3L0IB 4HEJA 4CT5A 4TYNA 3NDBB 2BV3A 2ZI5A 4M9QA 3DZDA 3EA5A 3KQUA 4Q7KA 3W8RA 2HJVA 1M7GA 2WSMA 4PC7A 3TR0A 4EJSB 2QP9X 2WICA 3VU9A 5AUPB 4IJMA 1E1QA 3X1ZA 4KYUA 3JVUA 4MH0R 5GJCA 3B1XA 3TE6A 3TQCA 2ZI7A 2IA5A 4Q4HB 2BOVA 3KXIA 4NYMQ 3D3QA 5TB5A 1E0SA 4Q7JB 3KKNA 1SVSA 2BCJQ 5KPJA 2W2TA 3NIBA 3EXAA 3QPUA 5BN4A 3AVYA 3IIKA 1Z2CA 1W36B 2EFEB 4LHWA 5FL7D 1KK0A 1KDRA 1Z06A 1E2KA 2OBLA 1W5TA 5E3HA 2QBYB 2CJWB 2R6CA 3RS7A 4V0NA 2CVFA 3EARA 1SVLA 2O0HA 1U94A 3PXGA 5GVSA 1CJVC 2XTMA 3RS3A 2IS6A 2PCJA 4D80A 1NSFA 1DAGA 2BBSA 2A7QA 3I72A 3K1JA 3SS8A 3AVWA 5FTKA 2ONJA 1G291 2ZRKA 1I4DD 1WRBA 5FTNA 3TQFA 1XPUA 2FFHA 2QAGC 2ANBA 2CK3D 3Q5DA 4JMPA 5DYGA 4ARZB 3N5CA 1J2JA 2OUKA 2AHOA 3GJ7A 3M1IA 3EWAA 2K5UA 3F5FA 1G16A 1E9SA 3SFVA 1Z22A 2PH1A 3CPHA 1UPTA 3LFUA 1L8QA 3E70C 1MKYA 1QHXA 2IS1A 1T8TA 2W58A 4FCWA 4DT1A 1QVRA 2GF9A 4FD2A 3W6PA 3K70B 2GZDA 2JDIA 2KJQA 3K0FB 4D0NA 4DLVA 3K70D 2WJYA 2BC9A 2UZIR 2ZJZA 4JBWA 1MT0A 2AL7A 2W2VA 1G3UA 2JCSA 1XWIA 3PR1A 1Z07A 2X19A 3WMFA 1HT1E 5B57C 1Q20A 2XOKA 3U44B 2VP6A 2BEJA 4OK6A 5DGXA 2GBLC 3CRMA 3GLHA 4BFZA 3AVOA 4XVUA 2QPOA 3AKDA 1T8UA 1P72A 2GK6A 3LO5A 4TMVA 4PC6A 3CR7A 2FPLA 1JEEA 2FU5C 4DT1B 2NO0A 1JR3E 4AG5A 3CPJB 5G41A 1NVXQ 3LW7A 2CLSA 4C0SA 4A1FA 1RZ3A 4ZKDA 1R8QA 3KJEA 2J0UA 1N6OA 2QP3A 1N25A 1CR4A 3I8XA 1C9KA 2GCNA 3MUFA 2Q3HA 4TMWA 3CZQA 4GRAA 5CK4A 3OIVA 1H8EA 1XZQA 2IYQA 4Q9KA 4HSEA 4NCKA 5LB4A 3SN6A 2QROA 3PV0A 1RE0A 1ZJ6A 2GKSA 4N0EA 5DH9A 5BN5A 3IBYA 5JI3E 1E2NA 4I1OA 3BE4A 1YU9A 4LBWA 4RKFA 1E1RD 5JRZA 1OIVA 4M1OA 1IXZA 1GKUB 2GK7A 1E2QA 3GMTA 1G4UR 2JJ8A 2PX0A 5TV2A 3SHWA 2X2EA 2R6AA 5JS7A 4UXIA 2AWNA 4AI6A 5KSOA 3A36A 1YR7A 2XSZA 3K0AA 4YC7A 3SBEA 4BRUA 3EPKA 4CEJB 3OFNA 1RRGA 1UDXA 1JQLB 3U44A 3X2SA 2GTPA 4MUAA 1KK2A 4CEHA 4AG6A 4DDTA 1FFHA 2ATVA 1CP2A 4HZIA 3AEZA 5E95A 2A78A 1D5CA 3HPQA 5J40A 3TUIC 4ZIRB 1KY2A 1VG0B 2IYUA 4I81A 2GXAA 4Q4JA 4C0BA 1WP9A 3RWMB 1KO4A 4PZLA 3UWOA 2QMHA 3D31A 2JIZD 1ZD1A 1OF1A 2KBEA 4DCTA 1GL7A 5BYJA 2QE7D 4B32A 3ZS9A 2GVZC 5IRCD 2F55A 3GLIB 1G3QA 3LQQA 2WMNB 1OB2A 4II7A 2N42A 4CEHB 1DEKA 2R65A 2CHQA 5JI2E 3WXMA 1FP6A 5F2EA 4QGFA 2WJIA 3NH9A 3BB3A 1Q21A 2ASEA 5FBQB 3DMNA 4I4LA 4IOJA 1M7BA 1NG1A 4AKGA 3MWLA 2KE5A 2D4HA 3LVQE 4URXR 3OAAA 3THWA 4CEIA 2H5EA 3KKMA 3DMDA 2PZEA 3HYRA 5KOYA 3GPLA 3AF3A 3HDTA 3I5YA 5HZKA 2IXGA 1ONBA 1ZU5A 4A0GA 1F2TA 1UEJA 1HT2E 2P0EA 1Z6GA 3H1TA 3HJNA 4F4CA 2YC4C 1KI4A 3SR0A 1FTSA 3V9PA 5KSYA 1QHHA 4GZMA 1ZIOA 4IDQA 4M22A 3P4XA 1JEDA 1KZGB 1QHHB 2IX3A 4QM6A 1TTTA 2BKEA 2DFLA 3UXMA 5TY0A 1BMFA 1TQ6A 4TLEA 1RFLA 2WKQA 3P27A 1L7VC 1UFQA 4PAQA 2E87A 4GNKA 4BEJA 3ZVNA 4Q4LA 1OHHD 1IOZA 2DFTA 2CE2X 2HDNB 1G41A 1S8FA 4YDHB 2B7BA 1XTSA 2C8VA 3AKCA 3KFVA 4PO1A 2KBFA 3SJBA 3M6AA 1U8AA 1G4AE 4MKIA 5KSPA 5FOXA 1B0UA 4HUQB 5CIWA 3THOA 4IFEA 3QE0A 1COWA 3C7KA 5EE5B 2QPAA 2OCYC 5EXTA 2JLZA 3WNDA 2F43A 2WM9B 2ZRJA 3BB4A 2NPIA 3ECCA 4PPGA 1EX6A 1E4VA 4H9GA 4JLAA 1VCOA 2JASA 4KV9A 2NG1A 2QE7A 5H70A 4UKDA 4GFDA 4B71A 4HB4A 2W6IA 1OE0A 3K0SA 2AKYA 5L3SB 1IBRA 2I1VB 1I4LD 1IY1A 2GHIA 2IYSA 5H68A 1GOTA 2FFQA 4BFWA 2C03A 4PAOA 3HP1A 3B13B 1GSIA 2FSFA 2QN6A 4HZUB 2QY9A 3U3RA 4ARZA 4AYTA 1CS4C 2FZ4A 3CF2A 1II0A 3PUWA 4OYHA 1QVAA 4M53A 4F4JA 4NL4H 2QORA 1XEWX 4RD2A 4JJZA 5JMTA 4L4UA 4TYPA 4XWKA 1E6CA 4JT4A 4HDOB 3SZRA 4RD3A 5C4GB 3K0AB 2ZRIA 3CX6A 4TYWA 3FHOA 1NF3A 3NEJA 1XF9A 3ZQJA 2EVWX 3CLVA 1OH7A 1P2TA 1UJ2A 5AJYA 4KXFB 4FMDF 4ZIRA 1OXSC 1P2UA 3GLHB 4KYIB 3U60B 1Q1QA 3QEJA 1WBDA 3B5JA 2QAGA 1T3HA 1DG1G 4DVGA 3LW8A 4PFSA 2P2LA 5TVKA 4K81B 4JYBA 4AYXA 4LJ4A 3AF2A 4BFYA 3PJRA 4IW3B 1IXRC 2VP4A 4DXAA 3EWSA 5G3YA 1FW6A 3ADDA 1IN5A 4IOKA 2QTVB 3BXZA 1VKJA 3BH7A 1VDZA 2HJGA 2RHDA 4FXPA 4JIMA 2NPFA 3LA6A 3SFZA 3BAFA 2ZSEA 821PA 4QOSA 1KI6A 4UNSA 1NY6A 5EUQB 4QC2A 3OE7D 1R6BX 4YONB 4TWZA 1M7HA 2RGGA 1TQ2A 1XEXA 2RGAA 4C0LA 4DSUA 1S1MA 5EE9A 4BLTA 2V54A 1XCGB 2WVJA 3EIQA 4LJAA 5AUQA 2FGJA 2RB4A 2OHFA 5G40A 4K8OA 2G9NA 1KJYA 3K0FA 1BH2A 3WY9A 4IOMA 3QSYA 2C9YA 4B3FX 4M1SA 2OLJA 2H7VA 3IIMA 1KMHA 4LOAA 4C7OB 1XX6A 5DN6A 1GKYA 2G0NA 2HCJB 5DLQC 3B1YA 4GT1A 3SOPA 1AK2A 1UKYA 2BVNA 4TTRA 2DR3A 5EP2A 4C2TA 1DAHA 3AVTA 2FOLA 3TVDA 4A8JC 1A4RA 3CRW1 4ZDIA 4HB3A 5CLLA 3NVAA 4M9ZA 2PT7A 2I1QA 1S9HA 3K0CA 4MKHA 4CIDA 4JLJA 4KFTA 1QBKC 5B2ZA 2L0XA 3LV8A 2QSYA 5JWHA 3BJIC 1KAGA 4A8JB 3A1WA 4D26A 2FFBA 3PUXA 1ZD8A 4C7OA 1AZSC 3QEOA 1BYIA 4ZO4A 4PPNA 1SVOA 3RC8A 1GRNA 4BUJA 5BN3A 2ERXA 1CF4A 1US8A 5K8UA 4X8MA 1TEXA 2JLQA 5M04A 1ZBDA 3QF7A 4JKYA 121PA 2YWHA 4TT3A 5AK0A 3U4QA 4P33A 4JBXA 2QT0A 4FCVA 1BKDR 1KO7A 1OSNA 1WBBA 1ZUIA 2EFHB 2ZRLA 4ZI3A 4E03A 3WRYC 2J3EA 4QHSA 3AP1A 1Z6AA 2CL6X 3NEYA 3PEVA 1NMYA 1ZC3A 2ZITA 3RAPR 2YWEA 3PEWA 2WWXA 1Z5ZA 3QJYA 1CLUA 1QHYA 3C5HA 1NIPA 1KDPA 1Z0IA 3TAUA 3RC3A 4JVMA 1P75A 1N6HA 1X1SA 3CH5A 4P4SA 1JPJA 3QY0A 4JBYA 2FF7A 3VQTA 3EA0A 4LJ9A 4UJ3A 1B23P 1TQ4A 2DWOA 1G5RA 4Q4AA 4QJ5A 3EC2A 4LY6A 4Q1FA 1H65A 4A36A 1DG3A 4MRRA 2WWWA 2P5TB 1NVVR 4Q48A 3BH6A 2D3WA 3K9NA 3U3JA 3H86A 4R2IA 4B2IA 2VHCA 5DO9A 2VRWA 2QPTA 2VSXA 3VX4A 5G53C 1BS1A 3PEYA 1U9IA 1E0JA 1IXSB 4DLXA 2Q21A 2IYYA 2NTYC 1GL9B 1R0ZA 3DVLA 1GM5A 3FMIA 4KFSA 4BLOA 5JLJA 1ZM3A 5HR5A 4QBGB 2OCBA 5A4JA 2IHYA 3PVSA 4TL6A 4U02A 1XPRA 1UADA 3SYLA 3L0OA 4RSGA 3SJZA 2X1VA 4PHHA 2BMEA 3W6NA 1LF5A 1Z0AA 2CXXA 3REGA 1S4QA 3GLFE 3R8CA 4LC0A 1SXJB 4QGGA 4NU0A 3K9LA 2QQ0A 1KO1A 2FG5A 2IS4A 3FMPB 2IUSA 4I99A 5CIQA 2V4ZA 3P20A 4QG7A 2J45A 1T4GA 2JJ1A 1NBME 3W8NA 4YXWA 2OXRA 1G8YA 1NMZA 4J0QA 4POAA 3ASZA 3ZS8A 2NZJA 2R2AA 1S2MA 2GXSA 5JS8A 4OI4A 4YMUA 1G7SA 5E7MA 1E3MA 2FPKA 1P2VA 1I2MA 3WHLA 2YJTD 3DM5A 2JLXA 1CBUA 2ODWA 4IKEA 4OBEA 4RD0A 4D4KA 4DUGD 1KKMA 4Q00A 2OV2A 3U3OA 5HE8A 4JLDA 3QKRA 4MRVA 4JSYA 1P7CA 1W0KA 2ZS8A 2IBMA 1SGWA 4PQFA 2VP0A 3S1AA 2PCLA 1UM8A 1NVUQ 2J7PA 1JALA 4LC1A 2RAPA 4Q1BA 1WXQA 1FMJA 3P4YA 4C2UA 3WYFA 2H57A 3W6OA 1YZLA 3DDCA 4EPYA 5EP4A 1G18A 1XD8A 4DC9A 1ZYUA 4IEEA 3U61B 1MH1A 3IQWA 4HLUA 1PLJA 4JJKA 2FGKA 4FWTA 5J47A 4GBMA 1O87A 1T5IA 2NO9A 5BYKA 2V6JA 4B3DA 3CRRA 4JS0A 2G88A 1G3MA 3FDIA 4Q4JB 4WXPA 2B92A 3W5IA 5JWOA 4URZR 2BBOA 3K0CC 2C9CA 2OFXA 5P21A 3MD0A 1XD2B 3MLEA 5IDVA 3RWOA 2DFNA 1U98A 2CHGA 1HV8A 4F93B 1OW3B 1N5IA 3MFYA 3AVVA 2ZE8A 2W6JD 4B43A 1E2DA 4WZ6A 2V55B 2F9MA 2OE2A 3K9GA 1NBMA 3VKWA 4TMXA 3K53A 4M8NE 3ZJYA 2ZXUA 1F48A 1Q12A 4FCTA 4XWOA 3GLGA 3CKLA 4OI1A 2ZAMA 1E9AA 4KSBA 1Z0FA 4EQ6A 4OK5A 1U8ZA 2F1RA 3U2QA 4OHWA 1FNMA 4KCGA 1GWNA 2C95A 1VTKA 3QF4A 2XXAB 1U8YA 1E9RA 2OILA 1Z6YA 2HYDA 2ZRDA 3NHAA 2OO7A 1ZINA 1QHNA 4CEJA 2OLKA 2QEQA 5CJ2A 4G1UC 2QGNA 4B3XA 1E32A 2PEZA 2V1XA 3UG6A 4JLNA 1Q57A 1X8LA 2CLCX 3K9HA 4NZYA 2GVDC 4DCUA 3BH0A 3RRMA 2A5JA 3T15A 2QZ4A 2PZGA 3GLHE 3RYTC 4DEXA 3QENA 3A4LA 4LJ5A 4NCNA 1OH6A 3AM1A 4X8HA 4L9WA 3T34A 1ZIPA 1ZW6A 1XMJA 1TF5A 2ZRBA 1ZCBA 1PVOA 3FYHA 3LNCA 4HLCA 1E1RA 3B1WA 1Z28A 4TL9A 5H8WA 4Y0VA 3RRZA 3QKSB 1CR2A 1OT3A 2MMCA 3AH8A 3AUYA 4TQ9A 1XTQA 2PLRA 3C41J 4LJ8A 4GP6A 1D2MA 2ZUCA
chains in the Genus database with same CATH superfamily
5T57A 1P8AA 2VTVA 3ZU3A 3UAWA 1ONNA 3C4QA 2YZGA 1F17A 4HNVA 2A86A 2I7DA 1QSGA 1I7NA 2D1QA 1YZHA 1X0XA 2Y1FA 3EEYA 3G0BA 3KELA 4UZSA 2A4MA 2Q8QA 1Q0SA 4EKNB 4P08A 1I80A 3IAS6 3QFRA 3ZNQA 1NHWA 1TW3A 2R44A 2GEDA 1X9HA 1XFDA 3H2JA 3L49A 4YCLA 2RHJA 1BMQA 5KYTA 5FRDA 4IIVA 2VVTA 5CVCA 1ESNA 5ALOA 5EZ6B 3RGGA 3NXKA 4X85A 4S0ZA 3L07A 1QB8A 2XVZA 5CFMA 1C7QA 3M6UA 1VI5A 5AXBA 2A57A 2O0MA 4LZZA 1D4OA 3B1JA 5F23A 2C1XA 3IS3A 3UNXA 3REFA 1Z3IX 1G8KA 3LDHA 4UNQA 1KA9H 2VRCA 3ROXA 1GZ6A 2NN3C 5F7JA 3V4VB 1BJTA 3TLKA 4ZAFA 4JLPA 4KQCA 4ZVTA 2YWRA 3BIJA 1Y5NA 2IC5A 4EOGA 4F6RB 1V9LA 2JVJA 2AFHB 3FGNA 2Q45A 2WF9A 2WKWA 4RQUA 4JUAA 4Q3AA 4Z3DA 3OTWA 1FLNA 4NU5A 3F3MA 2XQJA 2WV9A 4UNNA 3U19A 1IOWA 1NT4A 1XAGA 4O4JB 4ZICA 3L7DA 4O8CA 3JD0A 1O8BA 3GK3A 1TAGA 4LRYA 4BBPA 1V2HE 2GN4A 4G36A 4DDUA 2ZR9A 3JWJA 1CCWA 3GYBA 1WF6A 3CEHA 2VN8A 1I33A 2HHJA 3HU5A 1LBIA 3CT6A 3BL8A 1FX1A 3JALB 2QOEA 3OA0A 4XIGS 4ZWNA 4G23A 3SC2B 3SF8B 1GLGA 2JFQA 4YJGB 4QX6A 4TWAA 3I83A 4AUEA 1NXXA 5IZ4A 3U62A 4Q47A 3RBAA 2N1BA 3H1EA 4ALLA 1DVRA 2W83A 1OX6A 4D3YA 5A02A 1EKXA 5F7XA 2G08A 3ABIA 5BQ5A 5DCUA 1MW8X 3GL9A 2E5FA 1AUPA 3HKDA 3K70C 2X5NA 2F3QA 2W2KA 5KYWB 2H2IA 4YUYA 4DDWA 1ZNZA 3G9XA 4XCXA 1UKVY 1PGQA 3ZX5A 2PXAA 3O03A 1JQEA 1MFPA 1PEKE 3UXYA 1E94E 1RSZA 3RT9A 4BO2A 5D51S 4MS4A 4MW6A 4DRYA 1WMSA 5CUQA 3JV7A 2WTAA 4I4CA 5D7NA 4EA7A 4TV9F 1BHJA 4RDCA 2X22A 3KS9A 5IF3A 1YZQA 2QTRA 3JAKA 4B83A 4GR4A 2EFDB 2BCGY 2PXHA 4JL6A 1E66A 1NWCA 3R6GA 2Q3DA 3I8OA 5BNFA 3TTUA 3AERA 1P1FA 3CBGA 1RC1A 1KHHA 2E7ZA 2HMAA 5LU8A 1X7ZA 3BQNB 3RFUA 1PR1A 4UBKA 2QI9F 1C1YA 1VJCA 3F6CA 3LHDA 2YL2A 2YVUA 5DTMA 3JXEA 5IYZA 1XJ0A 3AILA 4NPAA 1A4IA 3WE7A 5FWXB 4Z8YA 4WY2A 4EF4A 4BYGA 1T26A 2P2YA 1XNJA 4AN1A 3EA4A 1GG8A 2QXTA 4M9CA 3D8RA 3DCIA 4P5DA 2V6BA 2WK1A 3PEUA 1AO3A 2J1LA 3DVRX 3FUWA 1T5OA 3PCRB 5DXJA 5HZGA 3DE6X 4DJDC 3NNNA 2CD7A 4Q02A 4QGAA 1E62A 3ISTA 5CDFA 4OKNA 3OLVA 3BRCA 2B8TA 2PLFA 2PQ2A 1RWXA 4WK2B 1WUHS 5HF8A 3QP9A 2DC1A 2K2WA 4AURA 3CZAA 4BO3A 4I36A 3LPMA 4QECA 2FI1A 3RJZA 3DTVA 3ZCPA 5HILA 2I8CA 2ZPUA 3IVAA 1EX9A 2EBUA 3R3VA 2UUCB 4EEXA 3RFFA 3RKSA 3A7DA 4GPTA 1EGQA 4HO1X 1VKRA 4IUDS 4ALNA 3OEED 4XWWA 1AD2A 1AKWA 1O9GA 2G76A 1JSRA 3WO0A 2NLOA 4QHTA 5EMHA 4Q9HA 4YCDA 1RQGA 4BN0A 1Y4SA 3CS3A 4TOIA 2I71A 3UFBA 3FOFC 2PT5A 2Y4NA 2AI2A 1UAYA 3MJHA 3GLIE 5LNK6 2Q1XA 1Y4AE 2Q1YA 3GUYA 4Q7MB 4MQEA 4RETA 5DMHA 2D5BA 4D9BA 3Q3GE 4FHGA 3Q9UA 4RE6A 1W52X 2Q6IA 2BKAA 5FOSA 5DNYB 1E2UA 2DB3A 5CA1A 3GDHA 3OQIA 1UXKA 1FYFA 2LWIA 3I42A 3ZUGA 1W2GA 3G8DA 1IQPA 4HBZA 3EDQA 2EZ4A 2PV7A 5CFOA 2NSJA 3LDUA 3SWWA 3UH0A 3EXHC 5LYJB 3IIJA 2O8CB 4ECAA 4MDHA 3KR2A 3MG9A 1VBMA 4O4HB 1UPAA 4OP1A 4GDMA 2R1VA 3QI2A 4WLNA 5JSHA 5LBIA 3NWEA 3R0ZA 1L7AA 1QUFA 3MTBA 1AGRA 3OCJA 4OKSA 2J7PD 1CJMA 4AO8A 3LCMA 1OWMA 4DIBA 1U0LA 3DZ8A 2B5VA 2ZATA 3EHDA 4FD3A 4HN2A 1LF0A 3RUFA 2R3SA 3IL2A 4Y9UA 2HBYA 3KAPA 3OE7A 4W9NA 6ABPA 1R4AA 4QULA 1DXYA 3RAGA 2HD4A 3FI0A 4LX0A 4WKCA 5E2AA 1I6WA 2VYFA 3TLGA 3PDCA 4R2HA 4G67A 2I9PA 3WL5A 1YT5A 1THTA 3EN0A 2G0AA 1TUBA 1ND5A 4EZBA 3HXTA 2Q1UA 1YJXA 3EUFA 1JFVA 3Q8XB 1D2HA 4EHHA 1Q0LA 1N75A 1XDWA 4FMCB 4X6LA 1FS5A 1NQAO 1T5DX 4IXTA 5JSUA 2DH5A 3KZVA 4FC7A 3WAGA 4G0YA 4P22A 4ETIA 1ZA2A 3PDIB 3FTQA 4DMGA 4W5RA 1NN0A 1NW5A 2VAVA 2ZRHA 3QPBA 3RRXA 5BQXA 2R8ZA 5FDFA 5IT9A 4FOPA 3HYNA 3TKLA 4L6IA 2EKPA 1WSAA 3BGWA 3PD0A 2JFGA 4DMMA 5AM4A 1SZCA 3ID6C 3AY7A 3JASA 1F6DA 4RKRA 5B36A 2H0QA 1QGUA 2HCBA 1HBJA 2R7NA 4JROA 3S2YA 8OHMA 4WKPA 4HEHA 4ML3A 2GF0A 2FG7C 2WLSA 1L5VA 3NBFA 5ILGA 1BOFA 3LAWA 2Z4SA 1HE4A 1U2DC 1EG2A 1LI7A 4YT8A 3UMFA 2JLWA 3DAGA 4AZ0A 5L3QB 3SVTA 5D6NA 5GJVC 1XDSA 5TS2A 4KAFA 1S02A 1Z47A 4MAAA 5CH5A 3ZGVA 3FMGA 2OC9A 4ZQIA 3CIOA 3I04M 3QIVA 3CG0A 4LJYA 4LRWA 2LBPA 2B1GA 2O6LA 3L92A 1X3LA 4E4YA 3JZMA 5HSGA 5TMBA 1DWQA 2AFVA 4GRDA 4XDGA 2CNWD 2GBLA 3TGWA 4EK9A 4UE6A 4OCZA 4BWVA 1Z2EA 2J9YB 2CJFA 5HRCA 4BZZA 2AKEA 4ZCIA 1W87A 1OXKB 4AC9A 1VLVA 2OBXA 3I2FA 4J1NA 3UAGA 4LEIA 4A92A 4ZYWA 2O07A 5IYZB 1EHIA 5HIIA 1VLJA 4X45A 1RLTA 3AVPA 4P32A 1TYAE 4TRMA 3CSDA 3E0QA 4EVQA 3O75A 2PSSA 2DSTA 3TRFA 4CMGA 3KQNA 1G7TA 3VZRA 3A2MA 1UFRA 5A03A 2FPRA 1G5HA 2C8LA 3MCAA 2H4HA 2OV3A 4MS3B 3UJ6A 1X14A 5IH3A 2Z83A 2CLOB 5JFOA 1G8JA 2GILA 2PT9A 5DPMA 3I9V1 3LUBA 4MAFA 4ZVQA 2E4XA 5BOVA 3IELA 1JJAA 4JLWA 5EJIA 3ZWOA 1UZLA 1TC1A 3VMMA 4P4TA 3K35A 3JSXA 3X1XA 3AUTA 4AM8A 1V8OA 3EDRA 3JAWA 3B5EA 4BVEA 1A9ZA 1B0ZA 1PGOA 4DEYA 1MO6A 2PN1A 4COOA 1K0UA 4E5UA 2ZB8A 1W5AA 4ARVA 3U3KA 1GRCA 3OA2A 5KHOC 4EB0A 2NU7B 2W22A 4R81A 2NT4A 3IKLA 5AWFC 5T6BA 3LVBA 2MYUA 1K6XA 2QNIA 1FDOA 2EYQA 4BP9A 1BOOA 3SIPA 2P3LA 3H1AA 5CLJA 1LDBA 1XA4A 3NTRA 2I76A 3H7IA 1IG0A 3AL2A 1M2EA 1TUIA 3N6VA 5B3KA 1C7IA 4G8BA 1ZOOA 1NLMA 3UFXB 1QG4A 2H2DA 4BVLA 1C2TA 1B8NA 4DA4A 2OK7A 3EDOA 3N2KA 2B1JA 4GVXA 2XDWA 3SKXA 3ZKWB 3AESA 4AS3A 3KBBA 2ZWIA 3PEEA 4L07A 1JFTA 1M83A 2BH9A 3B2EA 1Q84A 4UUBA 4C0XA 1VSBA 1ZN9A 3G7SA 4HH1A 4HDAA 1O89A 4CGZA 3PS9A 1VB5A 3B7WA 3BE8A 1X3SA 2SBTA 3OPQA 3PNMA 1CF9A 2QW1A 4IDPA 2J5QA 5G4KB 2XUZA 1SN7A 3VH4A 4PYKA 2HW8A 2NU6A 5AVOA 3ADBA 3QEMB 3HCAA 2ZYGA 4K1XA 1PTJA 5ITSA 2B4QA 4HQ0A 4OD0A 1Z36A 3D8NA 4O4JF 1KYZA 1WETA 2PMBA 1Z9BA 3LBYA 1J06A 2P5SA 3W8DA 2LNDA 3H83A 1FFEA 1UMBB 1RWVA 1KK3A 2HO5A 4BCBA 5AOCA 4ZYZA 1KBQA 5JFGA 2AYZA 4CF4A 4UM9B 1XA3A 4NMMA 1RJ9A 5J1TB 3K71B 4ZV9A 3WFJA 4EGJA 2XMGA 4GMKA 4RTLA 2OAQ1 5CT5A 3A6PC 4TRRA 1QTIA 5CYOA 1Z4QA 2C94A 4O2BA 2H31A 2O8EA 2H18A 3H6GA 3LIPA 3I4CA 2JLUA 4O0MA 1XXHE 5CPBA 2EFJA 5KQGA 1I01A 4GU5A 4KWHA 5F21A 5T4FA 1TD9A 3IX7A 2HJSA 4B33A 3H2KA 1CTQA 1I2CA 5GOTA 3SX4A 2H17A 3WWDA 1AA9A 4ZJUA 2H2AA 2P9ZA 2DHRA 1HSOA 1Y63A 2YIVX 3LVFO 2FSHA 5KDLA 4B74A 4X20A 2QLTA 2G4VA 3GEPA 2QVYX 1FFGA 3A6FA 1EXNA 1Y5IA 3QKRB 3PQ3A 2VZEA 4I1RA 3RPEA 4PLHA 4C88A 1LS1A 1JEQB 1SOWA 1LH0A 2FXIA 2FZEA 1F9AA 1EP3B 1EP1B 2JH3A 3P9NA 1KSJA 4LE1A 3AF5A 4EKGA 1DIOB 3IHWA 1Z4OA 2ZM5A 1Z2AA 1LLFA 1UPUA 2R1UA 5E6UB 2CHEA 4DQXA 3CXRA 5BWNA 2O1WA 2X3UA 4NH4A 4ZFNA 2CCJA 1AVTA 1NP7A 1CRPA 1VMIA 1W4RA 4URWR 5DW3A 4TS4A 4JI2B 2GM9A 2W6NA 1U5BA 2JZNA 4G37A 1SJ9A 4KLCA 5YASA 2HUNA 2QB5A 1U6IA 1UBKS 2YUTA 1HGXA 3OZIA 3RSCA 4FB5A 5GTDA 3MPOA 2ZTHA 3H5NA 1I51A 1C14A 1THZA 5FFMA 2BEVB 1BDMA 1JS1X 2G0TA 1ATIA 4BDTA 1P0IA 3O90A 2VA8A 1RMQA 4PBSA 3ZX4A 4JELA 2I99A 4WNAB 4RY8A 5LDDC 3ZDZB 2Z3WA 3UJ7A 1ILEA 3T7RA 5JXIA 1AKYA 2JANA 3RVBA 5EE3A 1EP9A 3ABRB 3EQ6A 3ZGXA 4WMLA 3G5AA 2FW8A 1WL8A 1QS0A 3KAQA 4W5NA 4AKEA 2Z2XA 2C58A 3NHBA 4N5HX 4IUCS 5A5DA 2VQ3A 5E0OA 5CD9A 1ZK4A 2AI1A 1DAPA 2Q5EA 4LYHA 4DF3A 1TCAA 1SKMA 3X0DA 2FSPA 1BQ3A 5IVDA 4IQGA 1WUYA 1UBOS 4CDGA 4NX2A 3MCTA 3OLWA 3UV6A 4F11A 3KP1A 2D4AA 5CB4B 1T4CA 1R4ZA 2VZ0A 4WDRA 3CPEA 4MWZA 1FFBA 1OLUB 4EY8A 3HKCB 3PWZA 2IU3A 4RM3A 3WZ2A 4ZYLA 3THXB 1J23A 3P0IA 5AJXA 4FLFA 4DILA 4DY4A 2YN2A 1VI6A 4OQQA 1I4TD 3CQ9A 4MQLA 4QNNA 4HF7A 4EDFA 1TLTA 3ZR4B 1NQ5A 1V11A 4YJHB 5J2TF 5JZSA 3U49A 2DXIA 5FWYB 2REQB 1Z5NA 5DGIA 4CM6A 5K8IA 3CB4A 1S7CA 2DWPA 2XI4A 3ZIAD 2ATIA 2HWWA 1NRJB 4QEKA 3C4JA 2WWHA 4GMFA 3GP5A 1SHLA 1Z33A 4A8HA 4U6QA 2WV7A 1OXUA 3NO4A 5DSTA 3ZD9A 1K7EB 1SVMA 3VAZA 3ZEIA 1SPBS 2EX0A 3PG5A 2DWQA 4M9XA 4EYKA 1GRVA 1L5GB 1T9GS 1PBNA 1RCFA 2KPOA 1W36D 2XUFA 3NU1A 3F97A 1Y9AA 3BMNA 3IILA 4RF2A 3IEKA 4Y2YA 2M6RA 4YAFA 3S8MA 4CG0A 2M2IA 4MPRA 4ZO9A 3EFOB 1IB6A 2ZS7A 1UAAA 3DLCA 3EOAI 2BAGA 4DWJA 4DCPA 1WV0A 4O63O 1K92A 1LI5A 2WPNA 2X0EA 5AUOB 4OFZA 4KVZA 3CNEA 5BUQA 4N3BA 1KMHB 3I2IA 4ZV4A 3H87A 2IS2A 3A1SA 3KKPA 3SKVA 3NR2A 2IQ5A 3AONB 3AFNA 3BSYA 1E63A 3ASYA 3BG5A 1UOPA 4ZOEA 4HEA1 4IDBA 1O4VA 3M9XA 3FCSB 3I5XA 4II3A 1WKBA 3ZC3A 1J49A 1K8QA 4M8KA 3LCUA 3PF9A 2Q2NA 3KL2A 3Q72A 2FA9A 1JYEA 1X0VA 1U1GA 2OZLB 3IE0A 4BZXA 4YPOA 4AQ7A 1MLDA 3OZGA 1UJ6A 1QP8A 5E2BA 1NP6A 3USES 3F7MA 4RPCA 3ZZNA 5K01A 3PUZA 2CC2A 4QJIA 2C2MA 2PVSA 1P17A 1QCYA 3NOQA 3G02A 3NP9A 4H0NA 5DP1A 1YQDA 1HYHA 3VM6A 5EHZA 1T25A 2OGTA 1E77A 5F2OA 1TTHA 4J8PA 1BJRE 2AZDA 3ONEA 2Q7DA 1PG5A 3VH3A 5HKAA 2AG0A 4ZPXA 1YMUA 1HDCA 1ZESA 3GXOA 2PH7A 3UTDA 3IDOA 4Z9AA 3ZVLA 1PNVA 3HH8A 1MHTA 3PE6A 1E2IA 1TZKA 3GI1A 3IEPA 3PI7A 4KXQA 1L1RA 1U02A 3RAJA 3THYA 3E2IA 3DB1A 4BAUA 3OHMA 2ZWOA 3ILHA 5NULA 1D8TA 3PQ6A 2JBHA 9ATCA 4M1YA 4MIKA 5ES3A 2PU7A 2VZ8A 3JWPA 3PQ7A 3ECSA 4CL8A 3D7MA 5DHQA 5HIJA 4MAMA 2X0IA 3WWEA 3ESCA 2FPOA 3K4HA 4LRTB 3ZK7A 5IJZA 2GD1O 4P3PA 1G8AA 2BFNA 3A2LA 1M8JA 4JBHA 3WBFA 5HM8A 1EJ0A 4Y3UA 1GSOA 3EC7A 4A23A 1IZYA 3EB9A 4XJVA 2FEMA 3U5ZB 2EU8A 1J2UA 4TKVB 4GF5A 2JIPA 5AYVA 4DNQA 1K8YB 2YY5A 4TL7A 4BVKA 4RHUA 2ZYHA 4Z4FA 1ONOA 3C5EA 3ABSB 3V9AA 2RBEA 2JARA 1KMQA 4IS2A 4P83A 4QPJC 3UKJA 3ELBA 1EFTA 3RIYA 4XM0A 4B3JA 4D0GA 3MINB 3I52A 1ZRNA 4MWSA 1DOZA 3S7ZA 4CMEA 3M4ZA 1GQFA 1QFYA 2BEUA 4J49A 2WG0A 4WWHA 3HE3A 1HFWA 1JP7A 3B8HA 3D1LA 4RVUA 1NBAA 1H2ZA 3DBLA 3MTJA 3PHGA 2VNAA 1JILA 1FFXB 1K3UB 2E1PA 2Y1GA 3KCQA 4J3FA 3EQ9A 4NMXB 4NARA 4WGFA 4ALMA 4I3GA 1OKKA 4HLDA 1ESEA 1N2XA 4F3NA 1ORDA 4ZAWA 3DH0A 1P1IA 3D3EA 2CBGA 3C87A 3K6KA 3O8QB 1C4OA 4PG4A 2CVPA 3BRQA 4FNMA 3TZBA 4MINA 3N70A 4YJ2F 4EMSA 4BJ3A 4QVKA 1N4DA 2NQ8A 4C03A 2X8AA 4IDCA 3SQOA 3MGBA 4PZCA 3FOEC 1CU1A 1PWYE 4KZPA 2NZWA 4ODIA 1G5PA 3OOSA 2EFYA 1EHYA 2WM3A 2ERCA 3EFEA 3LPAA 2ZYRA 1PK7A 2CHFA 5FA8A 4ARSA 1PEYA 1VHQA 1VJ5A 4GMDA 1D6NA 1RFGE 3H9CA 4ZYVA 1A2OA 1LUAA 3OZXA 4E1VA 3GWGA 3TPCA 4RPJA 1I4OA 2GH1A 4C4SA 4HUQA 1T1JA 5FCDA 1EDZA 1PU2A 4BNGA 1PR6A 1Q0ZA 4BZWA 3F2VA 1B41A 1XTPA 2OAGA 2Y9PB 3SBDA 4AW9A 1XQWA 2D0PB 3NH6A 3PIIA 3KO8A 2XOKD 1MC4A 3G5UA 2XUQA 4HQKA 2VXOA 2J7KA 4JLOA 4RFVA 4RSMA 3O8DA 1KFEB 3IEIA 4HAZA 2WM2A 5IUJC 3DTVB 4ASUD 3V2GA 1R2QA 4V0MA 2ZYVX 4U00A 1OJLA 1I3NA 2ZRGA 1V4NA 2WFLB 1RWQA 2R8XA 1RHKA 2ZI9A 1H8HD 1P1KA 2WNHA 2XTZA 4E30A 1WO8A 3AB8A 1Z0KA 1ZNYA 1Z62A 2P2NA 3WRXA 2BFBB 1G98A 4I8IA 4D4HA 5DM1A 2AJBA 1NW8A 4J75A 4COKA 4U6SA 4IJUA 3B85A 2I6QA 4WW0A 3EGDB 2Z6QA 2QTAA 2PTGA 1A9YA 2D59A 5J4HA 1A97A 1DAKA 1V1JA 1UT8A 5ENDA 1CHNA 4QFMA 4DL9A 3QBDA 2L69A 1RZVA 4L08A 5CT6A 1A88A 3MSCA 3GA0A 1GKKA 2NXEA 3PDWA 3SI7A 4FT4A 1ZGZA 2D2VA 1A5BB 1NOJA 3AU9A 3FPBA 3K05A 3Q85A 5DBGA 2MCFA 2ZIXB 2PUBA 3BC1A 5F73A 2JAHA 1J39A 3VHXB 2Z2IA 5ILOA 4HVTA 4G5GA 4XRRA 1Z82A 1I4WA 1SU8A 2HV8A 4EBFA 4GNRA 1Q1GA 1VSVA 5FYQA 3LUKA 5HFAA 2B1IA 2OM6A 1LTQA 3PWSA 5FEMA 3NWBA 1MO4A 1ZM4A 4EHNA 2RGYA 4O1IA 2OBBA 1QGYA 2XNDA 4R5MA 2D06A 4KK3A 1U8CB 2D1RA 1CUWA 3S44A 2X8WA 2Z6VA 1RHQA 2FZGA 8ATCA 2R00C 1D09A 1RC8A 5L3ZA 2P6RA 2JLBA 3AINA 5BV8A 3U09A 2Z6UA 4FFLA 3GIWA 4YLGA 5DYNA 3T06B 2XB9A 1ES9A 4HBGA 1MRSA 2V0CA 2WPDD 4HZUA 3WTCA 2OQIA 3LJKA 4ZJZA 3AKYA 3MWDA 3FBGA 1JVBA 1X1DA 4G8JA 2JGAA 2A5DA 1DO8A 2F17A 5A5GA 4JKOA 5HCUA 4HNHA 1IN8A 1QZ3A 4I7EA 3KXLA 1N1DA 4LFBB 1K3TA 1CQJA 8GPBA 4K6FA 4TXMA 1S8NA 2K7ZA 1MNAA 4U0KA 2SKDA 2Q2QA 3QI7A 3H19A 2HOQA 4KE8A 1ZMRA 3PUJA 1EXMA 2ZVJA 1NUPA 4TZ6A 5BVHA 1CB0A 2OBMA 4G8CA 1X8JA 5LWHA 1CUHA 1R88A 1BMTA 2WDZA 1IEVA 3LZDA 5CCDA 1YBHA 2I80A 4MW9A 4O25A 4NDAA 5KIAA 3KR0A 3ZV3A 3MWDB 4KAJA 3A9TA 3WQQA 3MMXA 5A9SA 4CTJA 1T4BA 4GI2A 4MWOA 4N0MA 3OSZA 4UM7A 3H8SA 2E5LB 2Q6KA 3MSXA 3NTUA 4LGMA 4MUFA 4DAEA 4MSUA 1Q22A 4TS1A 3AR8A 4R7TA 3U7IA 2WTUA 4PO8A 2WW8A 2YUIA 4FUTA 2WBLC 4CKWA 3QX3A 4J1SA 2Z3VA 2CY0A 4ES6A 4C4XA 4WXEA 3DBLB 2Y1KA 3QW4B 2MU1A 3RJMA 2GETA 5BN4B 4EUKA 3NTXA 4LYGA 5K2OA 4HAUA 5DFAA 5EUCA 2O4UX 4FB4A 3DFMA 3VZDA 2WSSA 3KEQA 5ITZA 1XF1A 2VPWA 1VPDA 4ZOQI 2VIIA 3DMHA 4LVNA 3OLYA 4KMOA 4QATA 2WMYA 2Y2VA 4MCHA 3V4PB 1ULSA 2CN1A 2GWHA 1QIKA 2HF7A 3HP7A 4LV5B 4C9BA 4Q4HA 3UB4A 1QCDA 4KWCA 1WQ1R 3D6TB 2DU8A 2WE8A 3LGAA 1GPKA 4MV4A 3IMFA 3W3AA 5AI5A 3SFTA 3WZLA 2C5AA 3QXCA 1UK8A 2MSLA 2P75A 3OESA 3LY8A 1G2IA 1ZQ1A 2GF2A 2A5FA 2GD6A 2YMQA 2O8EB 2YY6A 1CETA 1DV2A 4G81A 4MR8B 1UAGA 2BDEA 4W9MC 1QG0A 1WCIB 3KYCA 1EWKA 3DFIA 4YMGA 4RENA 4M1TA 1XTVA 3KJQA 1K9SA 4DMRA 2WJWA 1LCIA 4ON9A 3ZZUA 5LD2B 1MZVA 4C1BA 1ZK1A 2FQQA 3DOEA 2BF7A 1S96A 1FDUA 3QUTA 4BAGA 4KGZA 3RO7A 1LBTA 3LYLA 4XVQA 4QYXA 2WAAA 2F8LA 5DN6D 1TGYA 2H7YA 4YUAA 2BMAA 4FFMA 2Q46A 4RH3A 2R751 2VG8A 4D5GA 5C52B 1JLLB 3LPCA 1DAOA 3HL0A 3OICA 3LTNC 3GRPA 1CVRA 2BHRA 1LX6A 2DPYA 2OWDA 1ZOLA 3CIFA 3GEGA 3R7SA 1G5TA 2Y1EA 4RE5A 4OXXA 3OKCA 1E8DA 2JFFA 3A6KA 1G1MA 1K0FA 1MC1A 2FR1A 3HXLA 4HATA 1RT9A 1M1UA 2QXUA 4XSHA 1O77A 2GPYA 3FHJA 5EHGA 3R75A 3WGKA 2GM3A 1F2UA 4EVRA 2PXXA 3GJ4A 3R0QA 3B9QA 4YACA 5ILQA 3ZXSA 3I9V6 4QOJA 2X9VA 2XUKA 3J81k 2RIRA 1SD5A 2A3RA 3LRPA 4WXMA 3CW2A 4XUDA 1UMCA 4BOYA 5ALPA 3ZWKA 5EEHA 2FCAA 1M8GA 2OAP1 4Q03A 5FO0A 5CEFA 3PUIA 5EXPA 1KZ7B 3GVIA 3V1MA 4W5TA 2DTEA 2ZGVA 3O3NB 3U26A 3E9YA 2FWNA 2J3HA 5HM6A 1ADJA 2WSBA 5H0IA 4TT8A 4QLBA 4J0HA 4BLWA 3INYA 5KVQA 1SCKA 1D6JA 4EYQA 4LAFA 3I61A 1M2OA 4BKQA 1QTQA 4HDQB 3SHFA 3C16C 3W8FA 4QBHA 2B1RA 1JG7A 2IEDA 4JBNA 2ZRAA 4CRWB 2H4JA 3EFBA 4ESVA 3N86A 4LXTA 2NYVA 1RKBA 4JVNA 2GCOB 4K46A 3W5JA 3W4IA 1JWAB 2BDUA 1CQPA 2IEBA 4Y9SA 2J6BA 3AR6A 4KTVE 3BDIA 3C7AA 1L5MA 2Q1SA 2W6MA 2XPCA 1XD2A 1DJPA 3O8BA 4L3OA 4BQOA 5B6IA 1XJ5A 2VHJA 2PX6A 2YYZA 5CBKA 2H9IA 1U0SY 2ZTSA 2XB8A 2R6GA 1MR3F 3GVHA 3N2LA 4II2A 5EZ5A 5IXYA 2QW8A 2I7TA 3IV6A 4AZ0B 1JLLA 4UARA 1G21B 4P93A 3EF1A 5EHQA 5GJBA 1KEWA 3H2HA 1P2FA 4QU9A 4A4DA 4IGFA 4HEQA 5A5FA 1N7JA 1T2EA 3JQAD 1WZ2A 5EKTA 4IFIA 4WDQA 4Y1GA 3HBJA 1CPYA 1L4UA 4DCNA 1RWWA 1G66A 4QHYA 5HEKA 3Q41A 1X42A 1W5SA 1FXUA 5AJUA 1SXJD 2ZSDA 1OYYA 2G5CA 4ZOAA 5ESDA 4BMNA 1FYWA 3BD8A 5KYKA 1CRWG 2JHFA 4NU6A 4PC3A 5TNXA 3EEBA 2O7NA 3NPAA 4CJXA 4E6PA 3RT7A 5KREA 1OJ7A 2QUZA 1BX1A 1JIVA 1KFBB 2OZEA 5LPNA 2RI1A 3KTAA 1HWYA 3ZU5A 4FNOA 3KL4A 2PX5A 1XZAA 2BBWA 4PNZA 3TUJC 3OKAA 3EF0A 3VU9B 2I8AA 3IXQA 5IEJA 1C0PA 2B8WA 2FUG6 1M6VA 3ZH9B 2VXBA 3NFYA 4KQ1A 4M9UA 2Y8EA 5LQKA 4OFWA 4LMRA 4LDAA 4CM5A 5BSEA 2DGDA 1K2VN 3E22A 3OU6A 2FZWA 4RPIA 1SKQA 4MMYB 3W4KA 2O3SA 2VH1A 3QPWA 5G3ZA 3SZLA 4B4OA 2GJ4A 3BGOS 3GX1A 1XUOA 4HQOA 3U1VA 1FNNA 1FNSA 1L9KA 3U3XA 2JL1A 5EXDA 2QL9A 3QTBA 3T7DA 3WFZA 2O0KA 3SIXA 2V7TA 5JISA 1ZR4A 4WJZA 4ZDJA 5LN1A 3E7FA 3QNUA 2JI6A 4WX2B 1N4AA 3VR4A 4EWLA 3MWFA 1QIGA 1WUIS 3JQ7B 3PQFA 1MTZA 3QG5A 2VHEA 1YJ8A 4UM5A 5J3JA 3DL2A 4IJ6A 3OZWA 4JCOA 4WEOA 1E3WB 1QIJA 1QR6A 1O58A 2EZTA 3OY2A 1V47A 1ULHA 1OASA 3E9NA 3IDAA 4GL2A 4XDYA 5DX0A 1XMVA 4IMRA 4JIGA 4YJ2A 3ANYB 3FLEA 1PD1A 1TUBB 1R4MA 1POXA 3CLRD 4P35A 1JIJA 4ZEVA 2NNWB 1RU3A 2KLBA 2X42A 4CKCB 4R1UA 1D04A 1HT0A 2H1SA 3BMQA 3K09A 1AU9A 2PEYA 2YHIA 4B09A 2FMXA 3PNSA 2AQIA 1T2VA 4UCWA 5F9FA 1VE9A 2XGSA 3AHHA 2QE6A 4E5PA 2R00A 1P9NA 3GJ5A 2O6HA 3T1VA 4EI7A 4YR7A 5I4CA 2QHXA 3IAEA 1GUZA 5JXWA 2XOXA 4C3UA 4LRQA 4DHEA 4R98A 2VHWA 3VKVA 2QK4A 3C6BA 4L8WB 2ZRMA 2JJ1D 1K68A 5BW6B 1T3ZA 1YGPA 3HJAA 4H1VA 1GUDA 1L6IA 1VKHA 4O8ZA 4RK5A 4F06A 3THXA 3NAGA 2H7CA 3CRQA 1T3SA 1Y48E 1TFUA 1SB9A 1MJGM 2PLNA 2XR1A 3SYKA 5B58C 1GSHA 3I73A 4U39A 1I7QB 5LYJA 1QRAA 2KB0A 3BKXA 3R20A 4AZVA 1TD1A 1WB9A 2QUHA 1CZNA 2YINC 5BN5B 3VMFA 5JNVA 2WHEA 4EPVA 2Q5LA 1TAUA 4F8YA 4PYJA 2ZVPX 1E3TA 4JLSA 4EIWA 4I1PA 4C4RA 1JQAA 1SC9A 1W2HA 1UR5A 3KPUA 3U80A 4W5OA 2ZREA 3VDNB 3DLPX 5EPUA 4QE3A 3WRXC 2DM6A 4RD4A 3WFIA 1LBEA 2Q9CA 1WV1A 5K0TA 2VOEA 5IN5A 4JR1A 1RBQA 3KIPA 4D6PA 1EDEA 5JS2A 1JDZA 1CEQA 5C4IA 1N5RA 1NOIA 2OXEA 3NAMA 3PUVA 3CLSD 2W2QA 3VGJA 2FE4A 3V3TA 4CMIB 1NZJA 4ZOLB 2Y2UA 5BOSA 1JDPA 2BT4A 2FAXA 1FYEA 4H6XA 4N65A 4AMGA 2HLPA 1OV6A 1ECGA 4NMLA 2P4SA 2YXNA 3AEUA 4IQ4A 4CU5A 3EISA 4Q5IA 1FRFS 3BZBA 4Z8XA 3JVIA 2Y66A 3QUQA 2B3DA 2IHTA 1E5TA 2WLTA 3ICPA 2R97A 4KQIA 3TTTA 4DNFA 2AXQA 3QU5A 5T3UA 2EF1A 2AEJA 5JXHA 5F7OA 5LCXA 1JMYA 1UQRA 1TU4A 1ZRHA 4F5EA 4ZGBA 5AKKA 1HQYE 3ZHQA 3L40A 5E7IA 4KO4S 1LXCA 4UUNA 2F1HA 5INTA 4Q05A 2OHHA 2ZUFA 4KI0A 1YUNA 4LE0A 3VC1A 3IYLW 1TX4B 1WU7A 3HWWA 1IB0A 3HRKA 4PANA 5FOTA 2C0CA 1G21E 1L8OA 3ZWAA 4AL4A 2X8LA 4LJSA 5GP1A 3QVLA 4MW5A 2VAXA 1IUNA 4HSGA 4KO8A 1XTTA 3B20A 4DABA 3DAPA 1CZUA 1NIJA 2O2DA 2XKBA 4MS1B 4OGGA 4QTXA 5LC1A 1JG2A 2ZJ3A 4MDYA 1T4DA 4F97A 5IBRA 5LQCA 1AXGA 1YRWA 1KYWA 2C61A 2YVLA 1JBQA 1P3JA 3H3JA 4NV3A 1Z88A 5KYVA 5CX4A 1PZMA 4AJIA 1XXHA 2LRHA 5C18A 3EJWA 1T91A 4H1HA 2D00A 2O1EA 4DLKA 3KVYA 4A15A 1O6FA 3FMFA 3ZGYA 4KR7A 3DHWC 3LBIA 5FI0B 4B80A 4BGDA 2HGZA 2V7QD 3H7AA 5JH7F 1AA6A 1A7UA 1ADFA 1PUXA 2LD4A 2COUA 4L16A 3KQSA 3U17A 2AT1A 3TPFA 3BIFA 1KBZA 1NVMB 5KQLA 4UDOA 3VBEA 4DVJA 5EWJA 2PKWA 2R7LA 3K5WA 2AMLA 4P34A 5FL7A 4MGYR 5K0NA 3X1KA 2GM4A 2KW5A 3F1KA 4UXHA 4INZA 2EOAA 3P8ZA 1KXJA 3VVCA 4OGFA 2HGSA 2JGEA 3IB3A 3C45A 3QLVA 5EIBD 2XIQA 2RGUA 1GNRA 1WPGA 2BMFA 1DZ3A 1JFLA 3HO8A 3KAJA 4I5GA 1ZMOA 3WYAA 3ZCQA 3NHFA 2DYKA 2NIPA 1FPMA 2CSUA 2BYTA 3ZGOA 2GX6A 3LQ2A 3TBFA 1Y1TA 4RXTA 2IEAA 2KHZA 3ZQKA 1PT7A 1JDTA 1H6DA 4IYRA 4R6WA 5JH7A 5EHXA 1D03A 4A2QA 3JQBC 2CBZA 1JKFA 1RYYA 3R6WA 4CQMD 3L7BA 3T1HB 1IHUA 1PUJA 2C4MA 1UODA 1W47A 1Z34A 2F1JA 2I78A 2OKGA 2R6FA 4Q9AA 4R8KA 5E0KB 1K7XB 1ZN8A 1U8UA 4LUCA 4UW9A 3WK9A 5KYXA 5AI8A 4XLTA 2I4TA 4MHOA 4G4SP 2GRJA 2RHBA 2YZ2A 5FUWA 3TQRA 5J43A 2H07A 5U9CA 4WCVA 3D2CA 2B9VA 5LA6B 4E22A 3CUWA 1NUQA 3PBKA 3RYFA 1H4TA 3UJDA 1G17A 5LBUA 3ZJTA 4WFQA 3UW3A 1WTCA 1TU0A 2VZLA 4YAEA 4EPXA 6NULA 1HLDA 2O8DA 2K4MA 2HU7A 2FPXA 4JLMA 3AF6A 4OHPA 4QGHA 3EAGA 1NW4A 1NBHA 3N3AC 1MQ8B 2UVQA 3FJYA 3M70A 5GJWC 3AHFA 2O8DB 2A59A 5BSMA 5BMOA 2NXWA 1JQJC 5HIMA 4ZCLA 4KNVA 1QR2A 4RNCA 1TZJA 1TL7C 2VTDA 1THMA 2J0VA 3P94A 4KHZA 4U2EA 1R15A 1Z08A 2QT9A 4FE7A 1V43A 4L22A 5DLDA 5K8CA 2D5LA 2O8VA 1YVUA 3PUYA 2HLDA 4LNUA 3LBHA 5CGZA 3JAKB 5F77A 4AICA 3AR9A 2OXTA 3RJTA 4EB8A 4KITB 4WZAB 3I6MA 3LIIA 2F43B 4BCCA 2A7XA 3RH0A 1ZIDA 3TN7A 1MOSA 1LV7A 1NX9A 2CXNA 2REXB 3T52A 3DLBA 1AK1A 4BMPB 3P2IA 3H1BA 2Y77A 3WGZA 2AX4A 4KKXB 3X3HA 1BXRB 4ETNA 4ND2A 5KYUB 3ZKAA 5B4TA 3V2UA 3P9ZA 4RDHA 1ODKA 1T29A 2RI0A 3DOUA 3TLEA 3I01A 3IUNA 3K1ZA 1N2GA 3V7WA 2I4IA 3EDCA 3HJGA 4H16A 4EJSC 3TX2A 2I1LA 2PSHA 3NHMA 4IUYA 2XZTA 2GA9A 1W0JA 1D6SA 1JQKA 1XTJA 1RHRA 2FPUA