2YJZA

Rat steap4 oxidoreductase domain complexed with nadp
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
177
structure length
174
Chain Sequence
QGVVCIFGTGDFGKSLGLKMLQCGYSVVFGSRNPQVSSLLPRGAEVLCYSEAASRSDVIVLAVHREHYDFLAELADSLKGRVLIDVSNNQKMNQYPESNAEYLAQLVPGAHVVKAFNTISAWALQSGTSRQVFVCGNDSKAKDRVMDIARTLGLTPLDQGSLVAAKEIENYPLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Six-Transmembrane Epithelial Antigen of the Prostate 4 (Steap4), a Ferri/Cuprireductase, Suggests a Novel Interdomain Flavin-Binding Site.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
molecule keywords METALLOREDUCTASE STEAP4
total genus 60
structure length 174
sequence length 177
chains with identical sequence B, C, D
ec nomenclature ec 1.16.1.9: Ferric-chelate reductase (NADPH).
pdb deposition date 2011-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2yjzA00
5KTKA 3RI3A 2B69A 2HSDA 4KWIA 1B0AA 1U28A 4N54A 3C7DB 4ZA2A 4DMMA 3PYMA 1OFGA 1U2GA 1Q7CA 1U7TA 3CINA 2ZJ0A 4ZRNA 2YY7A 2H9IA 3SX2A 2QYTA 4J91A 4Z9FA 1GFSA 4FFRA 5EQFA 4I5DA 1W6UA 3ABIA 5KJEA 4AJKA 3ROQA 1F12A 2ZCUA 2HMSA 4IIVA 4FB5A 2GSDA 2Y99A 1SOVA 1PS0A 4C7KA 4N18A 1FDWA 4M8SA 4U7WA 1PZEA 4XA8A 2AQIA 3TRIA 4YJDA 2CF5A 4N5NA 4ZN6A 5KCZA 1E7WA 3IS3A 1VLLA 5K6AA 5IN5A 3R0IA 3JYPA 1DC6A 1P3DA 2GLXA 3A06A 4F3YA 3GMDA 3P19A 4O59O 3VPHA 4JK3A 1UDCA 3V2GA 4YAEA 3QWBA 4U5QA 1GD1O 5TLSA 5ITVA 1KVRA 3LU1A 5ICMA 3GQVA 1FF9A 3GGPA 3K6JA 4WLFA 2JL1A 1XWFA 3AK4A 4IGEA 1GYPA 2Y0DA 3M2PA 3C1AA 3H8VA 2VNSA 1HDGO 1E7MA 4UEKA 1H2HA 4BQRA 4H3VA 4HFJA 2WTBA 4BQPA 4NIMA 2AEFA 1LDNA 4HX5A 4IQ0A 1TEHA 3PXXA 4EW6A 5DCUA 1A4UA 2HRZA 4M49A 4HKTA 1LRKA 1YL6A 3TFOA 1WP4A 5J23A 3WGTA 2YJZA 5JO0A 1JQBA 3GPDG 4JNKA 1PWXA 1WDKA 2JJYA 5DDIP 3GRKA 3N58A 2J5QA 1YVEI 3EYWA 2G76A 2NU8A 3EZYA 1HF3A 3LLSA 2AG5A 1DRVA 3GAZA 1SBYA 3DZHA 1GAEO 4F45A 4BV9A 2F00A 2CF6A 5JFOA 3WFJA 5CFZA 2GR9A 3O9ZA 4DGSA 1PTJA 5FWNA 4A7PA 2Q1WA 1Y9EA 4A10A 3LC7O 3OJEA 2X9NA 4RPHA 3CMCO 2Q2QA 1R16A 4D3DA 4Z0PA 1ZZEA 3TZQA 1GPDG 1NXQA 1YB5A 4IDBA 4DA9A 2NUAA 1JU9A 2P4HX 5A9SB 4XCVA 3A9WA 4PG7A 1V3TA 1K6IA 1Z7BA 1PX0A 4FJ2A 4CMKA 4UVIA 3VZQA 2D5CA 1A71A 3RAJA 2EG9A 3VPXA 2X0JA 4NFHA 1M76A 5IG2A 3WYBA 2X8LA 4Q3AA 1AN9A 1QLHA 1P74A 1VPDA 2VZ0A 3WBBA 4DQXA 4HFRA 4R1SA 3U62A 4DIFA 2WEKA 1BRMA 1PGOA 4GWKA 2VUTA 3QV1A 1MC5A 1K89A 4HADA 1E3IA 4GLLA 4DLAA 4YEDA 5L7TA 4M54A 4RDIA 3JYOA 5DNAA 1ZBQA 4ZGWA 4S3MA 1CQJA 4FS3A 4R5HA 5BNIA 1U4OA 5DULA 1N1EA 1JAXA 1LU9A 2CD9A 2J8ZA 2HJSA 4OSOA 1YJQA 2P4QA 3GMSA 4XDYA 3SC4A 4KMSA 4YQYA 4CQMB 2UV8A 3VH2A 2ZCVA 4EYEA 4D3FA 1NYTA 4QFCA 3L4BC 1C3VA 3ZHBA 1KVSA 1G0NA 3GDGA 3D1LA 3IC5A 4RPGA 2GN9A 3H2ZA 3WLFA 4OXNA 1EFKA 1PZFA 2HCTA 5K0ZA 1KERA 4H15A 1V6AA 4W99A 2I67A 4IQGA 2VN8A 2X0NA 4NJMA 4QO7A 4YRAA 3ANLA 3U0BA 4YJFB 2V65A 1HLDA 2YFQA 4L75A 2VYNA 4S1VA 5JS6A 4EBFA 2Y1OA 1OAAA 3JQEA 4OOEA 4CMHA 1T1RA 4KUEA 1XU7A 3KEQA 3JQ9C 1LLUA 3I5MA 2WJPA 1VC2A 1R4NB 3Q11A 3MJCA 3QA9A 2VOEA 1CDOA 4RV9A 2FSVA 3F47A 1Z45A 4L4XA 2H63A 3P5SA 3B70A 1R4NA 3C7AA 1PJQA 4Z0HO 5KJ6A 1MG5A 1I30A 1LRJA 1JVSA 4XGIA 3CXRA 3RU7A 5I9LA 3WGQA 4B3IA 5JPIA 1T2FA 3UF0A 4LK3A 5KKCA 2FR8A 3JV7A 1D1SA 5COBA 3QVSA 4NG5A 3STHA 5BR7A 1YOVA 4BB5A 1NFQA 3ANMA 4E5MA 1P1HA 5KVVA 2IODA 1IUKA 1DFGA 1MA0A 1BDMA 3AM3A 3DHYA 1YBVA 4MVJM 5DOVA 5FI3A 5TT0A 3X2FA 1L7DA 3A14A 3JQ7A 4LRSB 3MOIA 2VHZA 4UVDA 3VHRA 1UP4A 3HB5X 3NDJA 4XJTA 1E3SA 3GLQA 3RC1A 3FWNA 1H94A 3QLJA 3KSUA 1Q0QA 4PFJA 4WGGA 4WASA 5KJFA 1DSSG 3AY3A 1ZH8A 3K2BA 4KWHA 3U49A 3HADA 1LTHR 4MKZA 4D0SA 5JCXA 4EEXA 3I3OA 2Q49A 1OMOA 1XYGA 4E6PA 2B35A 2X7HA 4FGWA 2Y1FA 5DP2A 3SXPA 1QR6A 1I10A 1PJLA 1RKXA 1X0XA 3HWRA 1K5HA 3H9JA 5F3RA 4BO7A 2FY8A 3DAGA 3LC2O 1GUFA 1IOLA 3OJOA 4KP7A 3WG9A 4YJGB 4GAEA 4BKOA 3IOYA 1M75A 5TSDA 4MVJD 4L74A 1TVEA 5IJZA 1ENZA 4JX8A 1O6ZA 3E8XA 1Y8QA 4NMHA 4DC1A 4M87A 4BV8A 2O2SA 4RGBA 2C0CA 2YDXA 4WOJA 1ZJZA 3VAZA 4MIEA 5BNTA 5G0VA 1E5LA 4FQ8A 3K8ZA 3RJ9A 4UREA 1X0VA 4WLOA 1H6DA 5JE8A 2GCGA 4CMIB 1D7OA 1PGQA 2VNAA 5A04A 1Z82A 4RVDA 3NTOA 2ZB4A 4ZVVA 1NHWA 2BRUA 3WR5A 3PIDA 2VHYA 5HWSA 1V0JA 1U8FO 5DT9A 2QHXA 4J1NA 4LISA 3GG2A 4BO5A 2E6UX 1ZW1A 3KV3O 3EGOA 4QTZA 4XRRA 5L40A 5GZ3A 1CYDA 3PWSA 2B4TO 5L7YA 4I9UA 5C37A 2V6MA 1PZGA 2DBZA 2JFFA 4ND4A 1R0LA 4B8ZA 1Y81A 3TZHA 4DIBA 2VHWA 4Q3BA 4MOWA 2GDZA 1Q7GA 4LVUA 3BMQB 2WWRA 3L4BA 4CMAA 3FTPA 1NVMB 5GZ1A 8ADHA 1ZSYA 2CFCA 1UH5A 4UUNA 2C82A 3V2HA 4FBGA 3VDQA 3RUFA 4EI2A 2OBNA 4EEZA 2YV3A 1ONPA 2FHSA 2EXXA 4NFYA 4NR0A 4IDDA 4CM8B 4FIZA 2PTGA 1AUPA 5I7EA 1LDYA 3D3EA 2NQ8A 5EL0A 1A5ZA 1H6BA 4CM8A 1CJCA 2NSDA 3PJFA 3NT4A 3ST7A 3H2SA 4MVJA 4ROSA 3IP3A 4O63O 3IAHA 2EW8A 2H5LA 2ZATA 4XRGA 1DIRA 1NM5A 1I0ZA 1U5AA 4J7CA 4XIJA 1DBVO 4CLRA 2O3QA 3FI9A 3TZCA 3LF2A 3ORFA 4FN4A 3UCXA 4Y6RA 3JQFA 1R0SA 2YDYA 1VM6A 1NQ5A 1ZFNA 1GPJA 3K30A 4A0SA 1U9JA 3T7CA 2WDZA 1KC1A 4K9DA 3IKTA 3HE3A 1YJ8A 2YUTA 1KBZA 3TZKA 1DC3A 5CDGA 5KKAA 3LQFA 1SB9A 2IXBA 1P33A 3GAFA 3JD2A 3O4RA 4CMEC 1CEQA 3PHIA 2EIHA 2NWQA 3U4DA 3I9MA 4IXTA 2YQ4A 3GVXA 2EKPA 4J0EA 1Y6JA 4D0RA 4ZD6A 4RF3A 1P9LA 4Y9DA 1S7CA 1ZK3A 2AEMA 4XGKA 3QSGA 3RWBA 4Q3EA 2WM3A 4I1IA 2UVDA 2FMUA 2OBYA 5T64A 5JNLA 3GK3A 4FR5A 3HG7A 3LK7A 1YS4A 2YQ5A 4B4VA 1BMDA 3ZHXA 4AICA 3HZZA 1Y9AA 3G17A 3U9LA 6ADHA 1SEPA 1VJ1A 1UXKA 4R9SA 3WICA 4R68A 1B3BA 3F5QA 3I6QA 1C0LA 5A05A 4INAA 3FNFA 4WPGA 4RPJA 5GZ6A 2NACA 4J1SA 2NTNA 3GDOA 4QUKA 2NLOA 4PG5A 1NWHA 4WOKA 2P68A 1ZJYA 3K5PA 1ULSA 4FOOA 4AJEA 4D45A 4GGOA 3Q9UA 3RIHA 3JQ6A 1N8KA 3QW2A 2VZ8A 1FDSA 1VKNA 4AJ1A 5JYDA 2D59A 3GUYA 1B14A 2PKQO 1GR0A 7ADHA 2B5WA 4E3ZA 2F1KA 2EW2A 4IDGA 1HTBA 1HYEA 2PK3A 4F46A 4UUMA 2RH4A 3AM4A 3W8DA 2C2XA 5I8WA 4E4YA 4R51A 1K6XA 4XR4A 3GN2A 4WNIA 1V8BA 3AI1A 2QRJA 1N1GA 4UVHA 2GN4A 2XXJA 1LBEA 1VL6A 3AU8A 4BOYA 2TMGA 4E0BA 3DC2A 4AJPA 4ZQHA 5L4LA 3B1JA 3OA0A 3BAZA 4NZ9A 5TIIA 2Y1CA 2IYOA 1G6KA 5EESA 3I9JA 1SO8A 4O6VA 3DTYA 1O5IA 5DN9A 4GL4A 1GZ6A 2HMUA 2EHDA 3BMOA 4BNKA 1PQUA 3COSA 1R12A 3FCOA 5H82A 3G1UA 4JBHA 1ONOA 4IUYA 3BMOB 4CMBA 2PH5A 1DAPA 3H9UA 4BO6A 1UAYA 1XCBA 4U0JA 1H93A 3FPCA 1PJSA 2X23A 5KOIA 1R66A 3RVDA 1O95A 2Y1GA 1I24A 5AQ1A 1H9AA 2IYPA 4PG4A 4OKIA 3DBLA 3TQHA 2Q4BA 4G5HA 4O5OA 4RVGA 4QECA 5H81A 3WIEA 3DBLB 4XDZA 3GDFA 3OIFA 3V1UA 3EDMA 3UGKA 2W2KA 1SOWA 1YQXA 4YR9A 4YJHB 1H6CA 2CDBA 4Q3NA 3VTZA 3O8QA 1RJWA 4J7XA 3ZU5A 4EZBA 5ER9A 1TT5A 3FWZA 3PZBA 2VHXA 3R3SA 2NU9A 4BS9A 1E3JA 3ZNNA 2Y66A 1XG5A 3PYLA 1WLYA 3JQ8B 4DTIA 5I7SA 4BNGA 4GX0A 3TFQA 4XYLA 5A5FA 1WMAA 3NDIA 2I3AA 2P5UA 1UUFA 4LW8A 4OYRA 4RF5A 3PK0A 2X86A 5L4NA 3OETA 3HFGA 1E1MA 1XLTA 4FCCA 2XOXA 3TDKA 1M67A 3WB9A 1G1AA 5BQFA 2NVBA 3GG9A 1HZJA 1B16A 3IP1A 1A7KA 4CL3A 3NGXA 3RCBA 1T1SA 1I33A 1IPFA 2AW5A 3H4VA 4NFSA 1EK6A 3TJRA 3X2EA 2P9CA 2YHUA 3KO8A 2Y0EA 3RKRA 4N5MA 1FDTA 1GL3A 1T4BA 2J3KA 5JAMA 4W7IA 4XEHA 1GCUA 1RM3A 1XQ1A 1LSJA 3OF2A 2X5OA 4N7RA 4RPLA 1E1NA 1GEEA 2DQ4A 4UUPA 3DFUA 4HXYA 4YT2A 3JD4A 3BTOA 3DBHA 4MVJH 2ZQZA 3PFFA 3BXXA 3UH1A 1P1IA 2J5KA 4E13A 2HJRA 1JVBA 1IY8A 5ES3A 4EUFA 1SAYA 4NU6A 3PGXA 1HSZA 1OBFO 4ALMA 3KUXA 5JLAA 2JCXA 4BGVA 2OOSA 3JQBC 5EMHA 4TVBA 2YV1A 2E4AA 3E1KA 3QP9A 4JLWA 4WLNA 2H6EA 2DFDA 2GD1O 4JGBA 5I9MA 4DUPA 1EVYA 4JJFA 1E3EA 1T2AA 4OIMA 2BF7A 3MTJA 4ND3A 2CVQA 4CMJA 1VRWA 1IULA 1EDOA 3Q0EA 5EIOA 2D8AA 5FEUA 2DM6A 3LC1O 4BHTA 2O50A 4BL5A 4IS3A 1UZLA 2DUUA 4R1TA 2HLPA 4GH5A 3AOEC 3NJ4A 4II2A 3WYEA 4PLHA 2FWMX 1GYQA 2X0RA 3RC9A 2DTDA 3I83A 3DZFA 5HA5A 1RYDA 1UDBA 3IUSA 4GX2A 1Y1PA 4IMPA 5DBIA 4RLHA 2CUKA 3FRJA 3V2UA 4CM7A 4JQCA 3W1VA 3DBRA 4MP6A 4XX0A 2NVUB 1C0IA 1O8CA 4KUHA 4EUHA 3FPLA 5T57A 3S8MA 2ILTA 3KBOA 3S2IA 1JTVA 1L7EA 1LDEA 1YQDA 1EUCA 1GQ2A 1BTOA 3QWFA 1NHGA 3GFBA 3BHIA 3PYXA 2VQ3A 1V3UA 3PDUA 2B0JA 4Y8VA 2D5AA 1Y7TA 3DBVO 1FMCA 3ONFA 3GVIA 2Y1DA 2R00A 4JN6B 1GV0A 3HDHA 3ZV5A 4AJ2A 2J6IA 5THQA 3T4EA 2DLDA 4J4HA 5F1OA 4BNTA 4D3SA 4YAKA 1N5DA 1BVUA 2NVWA 3NV9A 1E0DA 2B4QA 4CL8A 2XAAA 4UAGA 2BFAA 4L0QA 1B8UA 3WWZA 4E2XA 4EJMA 1KIFA 5C3MA 4LVCA 5G0UA 2DKNA 1HDZA 1W73A 4B7UA 2VTDA 2B37A 4ZICA 5JAIA 3P2YA 2HRBA 3QVWA 2GF2A 4MJLA 4Z0TA 3E48A 2VRBA 4DREA 1GV1A 3RU9A 2PLAA 1QYVA 5HM8A 4BO2A 3F4BA 3INTA 4JJIA 5ENDA 2HKIA 4E5NA 1Q2XA 1P1FA 5KJ1A 3PHGA 2PNFA 3RFTA 1KY4A 5TT1A 4EJ6A 3UW3A 3CSDA 3LT1A 5JO9A 4TROA 3F5SA 5DCYA 3GVPA 4BMSA 2WYWA 3L77A 1DJQA 2P5YA 4I9HA 5ADHA 1NVGA 2D2IA 4Y6SA 3RUCA 1HWYA 4FFNA 3PJGA 2Q99A 5I8ZA 3B6ZA 1HYHA 3ZV4A 4ALLA 3DMYA 1DLIA 1DFIA 2EERA 5C7OO 2AA3A 2P91A 4PLVA 3RASA 5ICSA 2ZB3A 3ENKA 4JBIA 4A26A 5A9SA 3F3SA 3JTMA 3PTZA 1A72A 1R15A 1YXMA 3NUGA 5JCJA 3M2TA 1HEUA 3K2EA 1QSGA 2X58A 2AQ8A 3RUEA 4JXKA 4IDAA 3A28A 1X13A 2VZ9A 4FFLA 1B7GO 2CMDA 4R9RA 3FSRA 4UVGA 4BNHA 1LUAA 1EBFA 1WPQA 3KRTA 3U09A 2EJWA 1PZHA 4MP8A 4PGFA 5DZSA 2VWGA 3P7MA 4J9UE 1GQQA 3OQBA 3I9OA 2Y68A 2I9PA 2WYVA 1GTMA 2EP7A 4D44A 3HB4X 5KWEA 1G0OA 5ILOA 3DMTC 3PQFA 1VI2A 4WKGA 4XB1A 3E9QA 3Q6IA 1TT7A 5A4DA 1CERA 3H9GA 4NDNE 2I6TA 3QHAA 1DB3A 3P2OA 4XR9A 1N92A 3D3WA 3ETGA 3VPFA 2Y0CA 1XQ6A 4RVHA 3DOOA 4XWYA 4BNNA 2QZZA 1RM4A 1WZEA 3JQBA 3D3WB 1WXDA 4C7JA 1M6HA 4W9NA 5TNXA 4PZDA 3NGLA 1R6DA 2Z95A 3DZGA 1NPDA 1NTOA 2ZTLA 4HNHA 2NTJA 4HNGA 4BNMA 5KIAA 3VPGA 4BNXA 3GN1A 1PQPA 1E6EA 1OC4A 3EVTA 1I2ZA 1YDWA 2OMEA 4A5OA 3PHJA 2BHLA 4FDAA 4GBJA 4W9NC 1KY5A 3KZVA 4NJMB 1SNYA 1GY8A 4CM6A 2YZ7A 3R3JA 3GZ4A 4K1LA 1EUDA 4FJ1A 1PWZA 3ADOA 3K96A 3QQPA 5CG1A 5ER6A 4MPDA 4XYEA 4OL9A 4Y98A 3H5RA 4E12A 1ADGA 4R01A 2C20A 1BG6A 4WNCA 2PFGA 2O4UX 3D4NA 1TA4A 3DL2A 1K3TA 4BO0A 3C24A 4G65A 4R1NA 3WGIA 2G17A 3E6AA 2XF8A 1T2CA 5B1YA 4AJIA 3D7LA 3IMFA 3L0DA 3PLNA 4DC0A 5CEJA 3PGJA 4WJZA 4DYVA 4DBVO 1U8XX 1YOVB 4WE3A 4TKMA 1NR7A 3RBXA 5B4TA 2FPIA 4M89A 3WWYA 1EDZA 3GEDA 5COQA 4CLXA 1GCOA 3PWZA 9LDTA 1ADFA 5IXSA 3JQ7B 1KYQA 3FNHA 2ZTMA 4IBOA 1PL8A 4U0KA 2OORA 3WTCA 4AJJA 4D42A 1V3VA 3WS7A 3GGGA 3LYLA 3QVXA 2VWQA 5HS6A 3TOZA 3WBFA 1P77A 3RFXA 5LDGA 2DPGA 1DDOA 3OMLA 4TZTA 4AJOA 4DWVA 5IF3A 1PJTA 3MJSA 5JBIA 3ZWOA 4ND5A 1OZAA 2H1SA 3C1TA 3RJ5A 4U6QA 3NT5A 5IZCC 3EVNA 3VC7A 3E9MA 4ND1A 1BSVA 2GASA 3UAGA 3NEPX 4W6ZA 3SBOA 5TJHA 3IQDB 4AJHA 4OQYA 3ZU3A 2I66A 3BMCB 1ZSVA 1KVTA 3AUAA 3ZN2A 3UICA 4AFNA 2J3JA 3CEAA 3JD1A 1N9GA 1VJ0A 1E6WA 4GLOA 4O1MA 2GO1A 1FDVA 1MLDA 1YE3A 4CM1A 1N9GB 3GOHA 1EZ4A 3DZBA 4IMRA 1P31A 2UDPA 3UOGA 3DFZA 1Y8QB 3NRCA 4BNWA 4ZU3A 3BTVA 3GR6A 2Q4EA 3H65A 5G0TA 4D7AA 2W2KB 1VKOA 1H2BA 2RBEA 3O03A 3D64A 3LF1A 5JMPA 5ITWA 4JIGA 3U5TA 1LDMA 3M1LA 3Q2IA 1BXGA 1BW9B 3TPCA 4CJXA 2Z5LA 5LDHA 2WYUA 1LRLA 1R0KA 3RC7A 1SEVA 3ZZNA 2ZYAA 4C4OA 3TL2A 3TN7A 3S1LA 4B4OA 4CUJA 1T25A 1C1XA 1I2BA 1QLJA 1NQAO 5T8KC 5F1PA 1ISIA 3OFSA 4MDHA 1P44A 4NBWA 3JQCA 2W8ZA 2E37A 3AY7A 2YV2A 4RJTA 3GHYA 4URFA 5DCWA 1ZMTA 1IZ9A 3AFNA 1V9LA 5DP1A 5KVQA 3ETEA 2GZ1A 1ENPA 5FFFA 1ARZA 3C1OA 1CWUA 3MJ4A 2DC1A 1KEVA 4K6CA 3FTNA 3ZWYA 1DC4A 4LN1A 5KVCA 2C29D 3I9NA 4NNJA 5IDQA 4YACA 1ZCJA 4YCAA 4B4WA 3LDHA 4E5PA 1VJTA 3TWOA 2FR1A 1U5CA 4CQLA 5BSFA 1JKIA 5IDYA 1EVJA 3I4CA 3VKUA 1UXGA 4BNJA 4CQLB 4BO8A 4MVJE 3UCFA 3HUDA 3VZPA 4E2WA 4OQZA 3NAQA 3QIVA 1GYRA 4WCFC 3WQSB 4CLOB 3AI2A 1E92A 4J1QA 4E5KA 3D5QA 3D5TA 2PGDA 2Q1TA 3S55A 9LDBA 1AHHA 2IXAA 1AGNA 4I5GA 3AFMA 3GC6A 4GSKA 4TQGA 2AXQA 1YO6A 4TKLA 2BGLA 2WD7B 3RFVA 2EV9A 1CQIA 3AJRA 3AUUA 3HFSA 4D41A 2BH9A 5CDTA 3SLGA 4XQGA 5ENVA 2HO5A 4HFMA 2V7PA 3U3XA 4FOSA 1GU7A 4ZQGA 1R4MB 3GT0A 4PZEA 1NFFA 4IINA 1ISMA 1JN0A 3OJ0A 4XIYA 3BA1A 2OFPA 2GN6A 2Y93A 5IZ4A 5B4UA 2WMDA 4J90A 3M1AA 3NDRA 1WZIA 1U4SA 1DHTA 5F5LA 3ZWBA 4CV0A 3JQGB 2FPPA 1O89A 4OH1A 5ILGA 3D0OA 5TGDA 4DL9A 2QZ9A 4ZJUA 2BFMA 1MX3A 2C2YA 3GZNA 2QRKA 2ZIZA 3UVEA 4CLHA 3GZNB 4W7HA 5CDSA 2NVUA 5A03A 2W90A 2A35A 2GZ3A 4R54A 3ZWXA 4YAIA 4PN3A 1LNQA 4ZQEA 4MIOA 5IZCA 3W8EA 2QYSA 5T6BA 1HSOA 3OQ1A 3E5MA 3PIIA 2BFOA 3G79A 4PLPA 2PD6A 1KC3A 3O26A 3ZWVA 1UAGA 3VH4A 2D4AA 4Q39A 5CDYA 3R6DA 1O9BA 5CG2A 4CR6A 1J4AA 1MC4A 1YQGA 2E49A 3KVOA 1MGOA 1DIBA 1XR3A 1YBMA 3H7AA 1I5RA 1KVQA 3EK2A 1Z6ZA 3Q2KA 1NQTA 4RQTA 3F4LA 5FYDA 1I32A 4KTVE 4HY3A 4N5LA 2G5CA 1UP6A 5DBGA 4CM3A 4NPCA 1U7HA 2X4GA 4AVYA 1NFRA 2VWPA 3C7CB 4IJUA 1PGNA 1YRLA 1ZEMA 3ON5A 1ZSNA 1H6AA 4II3A 1NPYA 3FBGA 1ISFA 1P1KA 3WTBA 3WXBA 4ZHSA 3L9XA 5L9AA 1LQUA 3E03A 1U3UA 5JC1A 1ZO8A 1LJ8A 2DU8A 4PLTA 4M1QA 4E33A 3ZGYA 1ZK0A 3PEFA 4CM4A 3TZ6A 5G4LA 4JP2A 3GVHA 2LDBA 5KJCA 1U2DA 4XJSA 4CM4B 4GWGA 1I3KA 5JMWA 2DTXA 5F21A 5K9ZA 3QY9A 4Z9XA 2OP1A 4FW8A 3JQAD 2B36A 4HP8A 5EPOA 3ROKA 3ZWWA 1ZK1A 4B3HA 3PHLA 3VVBA 2JFGA 1QKIA 1T2EA 2NU7A 3RUHA 3DO5A 4LCEA 3INRA 3HN2A 2B83A 2LDXA 4BO9A 1PJ4A 1WVGA 4XGNA 4ILKA 3OEWA 4XD2A 2FP4A 4TRNA 4J7UA 4PLWA 4E2YA 4BNVA 1JWAB 3AWDA 2Q1SA 4RZHA 4ID9A 1VSVA 4FFOA 3ZNOA 2HK9A 5B4VA 5IDWA 2OL4A 1ZNQO 4DYDA 1CF2O 2PH3A 3BYZA 4R3NA 4E21A 2VUUA 5CHEA 1LSSA 1XA0A 4P8RA 3C8MA 2E48A 1QV7A 1TT5B 4YQZA 4CM5A 3DHEA 3CTMA 1JAYA 1M66A 3W8FA 4CQMA 4OXYA 4YVFA 1U1IA 2OP0A 1C14A 3I4FA 4FGSA 3JQ8A 1EFLA 1HXHA 1ORRA 2VYND 1NX6A 3RUIA 1LEHA 2DFVA 3DAFA 2JAPA 1I36A 1K6JA 2I3GA 3KLMX 3KYBA 3PWKA 4YT5A 4LCJA 4RDHA 1F0YA 1YBAA 4IZIA 3DONA 5LC1A 1BVRA 3WDSA 2C7GA 2BLLA 3JYQA 1ZUD1 4Z6KA 1GZ3A 4ZRMA 3ZW8A 3U4HA 1HDXA 5FI5A 2Q3EA 4RQUA 1T24A 4YBZA 4YXFA 1JKFA 3BMNB 1J49A 2X0IA 1LLDA 2HK8A 3H9QA 3WLEA 4J1TA 1B8VA 2NM0A 5L95A 3BMNA 4NBTA 1X7GA 1PR3A 5TC4A 1EE9A 3D4OA 2FR0A 4CLEA 2PZKA 4A2CA 1LI4A 1PS8A 1WW8A 4FPXA 1DLJA 3OICA 4L73A 2X5JO 1X7HA 3ICCA 3JQFC 1HE2A 4YT4A 1VE9A 1FXSA 1OC2A 2ZK7A 1E7QA 3MJVA 3RC2A 3DBHB 3EW7A 3JQ9A 2PA3A 4BO4A 3NTRA 4BGIA 4PG8A 3IJPA 3GPIA 1A9YA 3WOHA 1JW9B 3G1TA 2B5VA 3DR3A 3Q3CA 5A9TA 2FN7A 4AG3A 2FZEA 3DZJA 2UUPA 3EUWA 4CMEA 4IIUA 3F6YA 1XKQA 3H5AA 1UXHA 2O7QA 2NTVA 3OBBA 1RWBA 2IZ0A 4GI2A 3IJRA 2WSBA 3BTSA 4M86A 4RO0A 1P0CA 3UKOA 2YFHA 2DAPA 1EQ2A 4PLFA 4IDCA 4JJGA 2C54A 2BD0A 2I5PO 2G82A 3KYCA 1PJCA 5HS4A 2CDAA 3H3FA 3W6ZA 1A9ZA 1ZK4A 4R4JA 3DXFA 3PRJA 4MO2A 3KYCB 3R1IA 3I23A 1QXSA 3OHSX 4XYGA 2PD4A 2Z1MA 1E7YA 1SMKA 2VOJA 4R1UA 2R6JA 4NH4A 5AXAA 3AW9A 5B12A 3H6KA 3WX0A 2VRCD 2VT3A 3DB2A 3HQ4O 3L6OO 4NBVA 1EVZA 2UUOA 3TL3A 1RYEA 4YRBA 1IHYA 4XB2A 1H9BA 4K28A 1ZXBA 2FPGA 2NV6A 2R2GA 1H0KA 1HT0A 4LGVA 4FFPA 1J0XO 1XDWA 2DUWA 4TRJA 3AM5A 3ZNQA 4WEOA 2B4RO 1NAHA 1V35A 4YJGA 2PR2A 3WGZA 2PWZA 4CV2A 1VL8A 2CNBA 1DHRA 2DPHA 3TOXA 1FK8A 3E18A 1XU9A 3ZWNA 5U9CA 1D8AA 5FF9A 1E5QA 5COAA 5JAQA 2O3UA 2O23A 3GVCA 3HDJA 4GKVA 3C85A 3AOGA 3JQDA 1I8TA 1WNTA 4CMIA 1XELA 1DRWA 3FD8A 4QXMA 2AMFA 2WE7A 2GERA 1J5PA 3VDRA 1E3LA 1EE2A 4GVLA 1BXGB 4I9NA 4BGEA 2WE8A 4H16A 1CIVA 2CVOA 5TS3A 2CDCA 5CP8A 2ZB8A 4Z3DA 3RBVA 1ZXLA 2FOIA 3GEGA 5EERA 1E6UA 4PLCA 1W8DA 1T4DA 4TRMA 2V6FA 1JLLA 4DPKA 2ZQYA 3WGHA 1GADO 2HU2A 3BHJA 2G0TA 4F6CA 1IPEA 3FR8A 5A9RA 4RF2A 4MIYA 4W82A 2HK7A 3VTFA 1UDAA 1I3LA 5HRUA 2NQTA 2JFHA 3MJEA 4QEDA 5A06A 4GQAA 1ULUA 4QSMA 3PZRA 3SJ7A 1D4FA 1KEUA 1NBOA 3KM0A 3B1KA 3ZU4A 2IDZA 4PCVA 4PIVA 3DHNA 1Q1NA 3H5NA 4MKXA 4F6LA 1WWKA 5G2OA 1C1DB 3FNGA 3SLKA 3BMQA 1NP3A 3F9IA 3KLPX 4JCOA 3WNQA 3ZW9A 3IIEA 1C1DA 1A27A 3QWIA 2VRCA 1ENOA 1ZIDA 1IHXA 4XKJA 3VZRA 4AJNA 4Z3KA 3NX4A 4OMUA 3G3EA 1ISHA 1HL3A 3B20A 3OSUA 5U4QA 4BNZA 2W2LD 1MB4A 3WNVA 4DRYA 2RHCA 1PS9A 3L9WA 3IDSA 3OP4A 4TSKA 1GUZA 3DAPA 3MEQA 1GEGA 2VWHA 4O0LA 1B2LA 2GZ2A 2J5RA 5A5EA 4PLGA 1YONA 1D3AA 2D1YA 4B8WA 4CLRB 2DTEA 3CUKA 4JP3A 1NQOA 4D79A 4WCFB 4K26A 2VUSA 4YT8A 4FD3A 4D43A 3WJAA 2O4CA 3GNSA 2POQX 2A92A 5BSEA 3CE6A 3JSAA 3CPSA 3VH3A 4GSLA 5AYVA 1YDEA 1NPTO 2DVMA 4J49A 4BNFA 1ZK2A 4A03A 3KTDA 3F1LA 3RSHA 3L6EA 5I9NA 3JQAA 1E3WA 1K0UA 2DBRA 2X22A 1HE3A 2DT5A 3PI7A 3I9LA 5CEEA 3WMWA 4BKQA 1MXHA 4L9RA 1E3WB 1YB1A 3A1NA 3JQGA 1KEPA 3GH3A 5JY1A 3RROA 3UFXA 2GNAA 3GY0A 1PU2A 1JA9A 4RF4A 3WSVA 4KTTE 5EN4A 7MDHA 3ZHZA 1B3RA 4YYZA 4GMFA 1HDCA 4RLSA 4P22A 2NU6A 5A3JA 2IEDA 1HE5A 1KVUA 4Q3DA 3KHUA 3VKVA 4BIIA 4GX1A 1DFHA 4WLVA 3ANNA 1EK5A 1LC0A 1T2DA 2ZTUA 4RCVA 1LC3A 3HJAA 2BELA 4B79A 1DIGA 2PD3A 3W4JA 4TRRA 1T26A 5HTOA 3I1JA 1P0FA 1PSDA 4NHEA 3OA2A 3E82A 3PDJA 3PVZA 1N2SA 1ADBA 4UULA 1Z73A 3AI3A 3LT4A 4CR7A 2EEZA 4RVSA 2YYYA 3MWEB 3N74A 2JD2A 5AVOA 4MVJF 2HUNA 1UZMA 4GKBA 3KETA 1HRDA 4BMNA 4CV1A 3I6IA 3OJLA 4BKPA 3UN1A 2V6BA 3C3XA 4QT0A 3W4KA 2RH8A 4A73A 2EJVA 4NJOA 4QX6A 1PGJA 2EGHA 4NBRA 3IL2A 1UXJA 2HMVA 4WLEA 1F17A 3GRPA 4X54A 4PRLA 1GQYA 3GNTA 4B7XA 3TF5A 1E1KA 2IE0A 3ETDA 3RUDA 1H5QA 4UVEA 3UHAA 3ULKA 4B4UA 2I65A 3ITKA 4MINA 3PQDA 3BHMA 3TNLA 1E7RA 2E82A 3V8BA 4NI5A 1ZEJA 2WD8A 3AUTA 3GUCA 5EQDA 5G0SA 5JAZA 2C5EA 1UJMA 1NR1A 4YDRA 4OSPA 3ZWPA 1DIAA 4ZQBA 1YH3A 2XXBA 1Y8RB 4DQVA 2O3RA 1I3MA 5TF4A 4H7PA 3O38A 1EQUA 1ADCA 3MJTA 2AHRA 2EKQA 4MKRA 2R00C 3K73O 5BNFA 4BNLA 1FDUA 3GFGA 1AXEA 3SJUA 1Y5RA 2C7VA 3W6UA 2JAHA 3LSYA 4L76A 5AXBA 1BHSA 1OOEA 3SC6A 4DVJA 3DWFA 2O3TA 3F1KA 4L4RA 2JKVA 1DXYA 2I76A 2Y67A 1YKFA 1KETA 3KXDA 4OO3A 1KEWA 3N7UA 4NK5A 2BMAA 1L1FA 4LSWA 1Z7EA 4KQXA 4Q3CA 3JYLA 3ADPA 1EUZA 1DAOA 4YPOA 4IPTA 1WDLA 4OHUA 2QW8A 3FR7A 3O8QB 2GN8A 3OIGA 1F06A 4E2ZA 1DEHA 3VPSA 4XYBA 2BFPA 3WQRA 2OO5A 4GPD1 4ALKA 3MTGA 1Z75A 1QG6A 2CSUA 4YB8A 3ZU2A 1B8PA 1C1XB 1DC5A 2GYYA 3K9QO 3L07A 3ASVA 4M55A 3UUWA 1LA2A 3LT0A 4PLYA 1W0CA 1CRWG 3OIDA 5JDCA 3FHLA 3KSZO 3WYCA 4BKRA 4YRDA 1QP8A 5DOZA 1KOLA 3Q1LA 4DIOA 1GDHA 3CZMA 3ICPA 5CDUA 3ZWCA 4NK4A 4IJVA 3HHPA 4ALJA 2JCVA 2JHFA 4BO1A 3FF4A 4EUEA 3PP8A 2NADA 5DBFA 4HUJA 5JDCC 3MWDB 1TB4A 5L51A 3QWHA 2X1HA 2ZB7A 3NKLA 4IY1A 4CQMD 5A02A 4XQ9A 2IZ1A 3V5NA 2C07A 3PQEA 2UAGA 2EP5A 4YA6A 4NU5A 1K2WA 2C59A 3L4SO 2PKRA 4KZPA 2IEBA 2W4QA 4PVDA 4YAGA 1CETA 3T4XA 5L45A 1SZJG 4G81A 2BI7A 1O0SA 1LLCA 1QRRA 5BT9A 3GEMA 5BSGA 2JD1A 1PL6A 1XHLA 3EMKA 1PEDA 1YL5A 3OM9A 4R41A 4DMLA 2PGLA 2CZCA 1MFZA 1PQWA 3IUPA 3H9EO 4B3JA 5IFLA 1DJNA 2HMWA 1DOHA 2ZTVA 2OZPA 4RVUA 4CV3A 1QMGA 4IGFA 1N7HA 4L8VA 2RCYA 4I8XA 4E5YA 1BWSA 1ISJA 1XEAA 1E77A 3INGA 4U6SA 3FNEA 5JC8A 3KEOA 1O94A 4OAQA 1GUYA 2CY0A 3AU9A 4OGWA 2O3JA 1PR9A 1YB4A 3GA0A 3BTUA 3IKVA 1P1JA 3EC7A 2OUIA 5TJ9A 3A4VA 5CEFA 1SPXA 1A4IA 2A94A 4J0FA 5L4SA 2NNLD 1F14A 1R4MA 3BIOA 4G2NA 1U3TA 4CM9A 2VYVA 4ALNA 4L4SA 4EGFA 2X5KO 2W98A 4OM8A 4WECA 3ZCXA 5L7WA 3VZSA 1AE1A 1IE3A 2IRWA 4R3WA 4RPKA 5EJ2A 1HYGA 5CAEA 4XQEA 3RUAA 2ZYGA 1UP7A 3ITDA 1P45A 3V1TC 4CMGA 2YHIB 4FC7A 1NAIA 4ND2A 1BXZA 3DBRB 2BGKA 4MP3A 4PLZA 2FSSA 2YHIA 1QORA 5CPBA 1X7DA 1IL0A 3U4IA 5AXDA 3QE3A 2AG8A 3LT2A 3WJ7A 4J4BA 5EINA 3ZV3A 5I7FA 2O2YA 3OH8A 1B15A 4AJ4A 2VT2A 2X9GA 5IXYA 2Y1EA 1UXIA 4P4NA 4CODB 1QYCA 4NBUA 5TQVA 2OGUA 4BMVA 4XZ3A 3ENNA 1ONNA 4IM7A 2HQ1A 3KB6A 5JW6A 3ZWMA 1NWCA 2EKLA 4TVOA 1EBUA 4UUOA 5H83A 3NYWA 3VVCA 2AQHA 2PGJA 2Q1UA 4LRTB 1QYDA 1WMBA 1P1RA 3GF4A 2XPCA 4LMRA 3EHEA 2ZYDA 4GGPA 3G0OA 3HN7A 4DXHA 4TZKA 3RKUA 2W2LA 4HFNA 3GHHA 3ZI0A 1BGVA 3TSCA 3VOSA 2J3IA 3DOJA 4BVAA 2PY6A 1XIVA 1HE4A 1AHIA 4PVCA 1PJ2A 3S2GA 4B7CA 4E32A 4QFDA 1ML3A 2AEJA 3KOUA 1TXGA 4U8GA 4J6FA 4JBGA 3DOCA 4KDFA 4PZCA 2PZJA 3DZIA 2OXIA 3EY4A 2FZWA 3WQQA 1RPNA 3ZV6A 4CR8A 3SVTA 1U3VA 4WLUA 1M2WA 3RQSA 2P9GA 1XGKA 1MP0A 5MGBA 3WGYA 1NNUA 1SB8A 3CIFA 4IQ8A 4WK6A 5BSHA 1J6UA 1Q7BA 5THKA 3JYNA 1HDYA 4IXWA 3CZRA 4D46A 5AXCA 2VCYA 3PFWO 4IJKA 2AE2A 2EWMA 3QRWA 4FC6A 5JXWA 1PJ3A 2BGMA 2BI8A 2X6TA 1IZ0A 2VHVA 3WMXA 1UZNA 3D4PA 2A4KA 4J43A 3UXYA 3OEYA 5I7VA 1E1LA 1X14A 4P4LA 1QYXA 1R37A 4QO8A 4IZHA 1W4ZA 6LDHA 1KS9A 3S2EA 3PHHA 5L53A 1QV6A 4GVXA 4IJWA 4I5EA 4DPMA 1YGYA 2D3TA 4CLDA 3AUSA 4I5FA 2GPTA 3ONEA 5A3VA 5T8KA 3BZUA 4CMCA 3CH6A 1N7GA 5CPFA 4BGUA 1DO8A 1I01A 3HNPA 3LZ6A 3F46A 3QWAA 1Q0HA 4Y67A 2HAEA 1MUUA 3DEYX 5JCJD 1BXKA 3JQAB 1HLPA 4PRKA 1C0KA 4DPLA 4FSHA 4Z9YA 4ESOA 4WEQA 2V6GA 3B1FA 4J4TA 4FJ0A 3HDYA 2GRAA 3K31A 3T7EA 2SCUA 3MZ0A 4R69A 3U4CA 1ENYA 3LVFO 1M6WA 4RL6A 1BDBA 3S2FA 2BKAA 3UCEA 1TI7A 1ID1A 2O3SA 1FJHA 5C7IO 3NJ8A 1RM5A 1X1TA 5JYEA 1F8FA 3PPIA 4LSMA 1ZVMA 2QX7A 3RBZA 3KYDB 1PIWA 1XSEA 1ZMOA 3JD0A 5C7LO 8LDHA 4HWKA 3KYDA 4YJFA 4EJ0A 3AOEA 5GY7A 4BNYA 4J16A 4XQCA 1MXFA 1DPGA 2ET6A 2A9FA 4RORA 2HDHA 2Q45A 5GMOA 4A27A 1TLTA 2C5AA 2PKQP 4Y6PA 1YL7A 1I2CA 4ZQFA 4KDEA 1MV8A 1F8GA 3MOGA 1EVIA 5TX7A 1U3WA 3RD5A 1I3NA 1C0PA 1ZKMA 5KVSA 3JD3A 4EDFA 4BKUA 3JCZA 5L3ZA 1LXCA 4P38A 3L6DA 3QJ5A 1DRUA 4I08A 3ZH2A 4CUKA 1PJBA 4TMFA 1VSUA 3FBTA 1VL0A 4E30A 1SCUA 1Q0LA 3GGOA 5B37A 2ZJ1A 4MVJG 4DBZA 1JWBB 2ZKLA 2Q50A 3I52A 4R16A 5F5NA 2PV7A 2UYYA 4YWJA 2AQKA 4BNUA 2P9EA 1LSOA 1OI7A 2GGSA 2PZLA 3EAGA 2Y05A 2G1UA 3LLVA 4KQWA 4OOFA 5K6AC 4IS2A 4Q9NA 4WCDA 2HMTA 3CMMA 3EZLA 4DLBA 3NTQA 5G0WA 1MG0A 1D1TA 3E9NA 4DLLA 1LX6A 2D0IA 2JCYA 2X9VA 5JY6A 1YWGO 4W4TA 4CM9D 3DDNA 1DIHA 3W4IA 4J9VA 2RAFA 1LDBA 1Y8RA 4MVJI 4GMGA 5AOVA 4CUZA 1LSUA 4QQRA 2Z1NA 2YW9A 3K92A 5JDIA 4NQZA 3HSKA 3BMCA 3GNQA 5MDHA 4UEOA 4OXKA 2AE1A 4RVFA 3WGGA 3WGOA 2Q2VA 4MVJP 4E31A 3SEFA 3ONDA 1SC6A 1Y5MA 3CKYA 3WSWA 5JDIC 1NASA 1LDGA 2EGGA 3E5RA 5IN4A 1JDJA 5T67A 3NT2A 4J2OA 3M6IA 4HV4A 2O48X 5TRTA 1QYWA 3DQPA 4YJHA 5JSFA 4P4GA 5T5QA 2DBVO 2VYVD 4KOAA 4YTEA 1BW9A 3V1YA 1HKUA 2RHRA 4RZIA 3DTTA 3OECA 3ZWAA 4BNIA 2CVZA 3I9KA 3MCVA 4EITA 1AXGA 2P2SA 5LCXA 3Q9NA 1MFPA 2JHGA 3HDQA 4HBGA 1S6YA 1HETA 1LLQA 1PGPA 2FRDA 5KNLA 1HZZA 4UEJA 4DQUA 3ROMA 1HDOA 1X1EA 4JROA 4BB6A 3DMTA 4IDFA 3OQ6A 4ITUA 4K6FA 5IDXA 1EEHA 4GX5A 3WFIA 2QQ5A 2Q2WA 4OKNA 2EF1A 2QG4A 5F1KA 1IB6A 3ZHYA 5C5IA 3AY6A 4FFMA 3PLRA 1Z74A 1GZ4A 3PJDA 4PG6A 1EMDA 2GUGA 2DBQA 2PZMA 3QVOA 2JD0A 1PL7A 2QIOA 4LMPA 1IYZA 4TWRA 3KSDO 4BO3A 1JKJA 2I99A 3H3JA 4IDEA 4R5MA 4CPDA 2RIRA 2VTEA 3ROPA 3DZKA 1RM0A 3ZDFA 4BUCA 2OHXA 1HDRA 3PJEA 5DF1A 4J3FA 4WUVA 2O7SA 4AJLA 5G4KB 2Q46A 3ASUA 4J2HA 2TMDA 4YAJA 1WAMA 4XYMA 1A7AA 1E7SA 4ALIA 3G49A 3ZNPA 5G4KA 1X15A 3WIDA 4AL4A 3FN4A 1ISGA 1WDMA 4KUGA 1UR5A 1B26A 1NVTA 4CLOA 2WD7A 4OJNA 2QRLA 5HBRA 2IZZA 3QVTA 5A1TA 5U1PA 2J3HA 3OJFA 5IAAA 4WCFA 1LQTA 4ONEA 3VH1A
chains in the Genus database with same CATH superfamily
2BEWB 2IYSA 2ORED 4JKYA 1OY1A 1UDRA 4U2EA 3VTAA 1ABBA 2HSDA 1G2PA 2I55A 3D0KA 4TKUA 3IILA 3CJRA 4L1KA 3IHWA 5EXPA 4YREA 5SYNA 4UXJA 1OFGA 5KNDH 1W4BA 4O3MA 1U7TA 3DE7X 1MQ9A 4ZRNA 3NBAA 3O7MA 3CS3A 5HHTA 2H9IA 4J91A 4M76B 4FFRA 2PQ0A 5EQFA 4I5DA 1W6UA 3GUZA 5KJEA 2KE5A 1Z2PX 4A36A 2Z83A 1YCGA 3ROQA 1TU0A 1E18A 1F12A 1SUPA 2HMSA 4NXNB 3NHZA 4I99A 4M8SA 1XQXA 4HBZA 1PZEA 3WGNA 4XA8A 1E2FA 1GA4A 2FQYA 3O3CA 2BKEA 1V1JA 2FWIA 2XRMA 3UXMA 5B64A 3IS3A 1IXSB 5IN5A 4MB2A 3JYPA 4WN9A 3BRWA 1QE3A 2X1MA 4LPKA 4CNQA 4OQMA 4MV9A 2GLXA 1MW9X 1S3IA 4WSOA 3VMFA 3VU8A 4GQIA 3PE3A 1KZ9A 4INOA 2I2BA 2PWBA 5FPHA 5H3CA 1U2TA 3I0MA 3R7DA 3VPHA 4ZHQB 3OZUA 3V2GA 4V02A 2WZDA 4U5QA 1GD1O 1OWNA 4YAEA 3I05A 5ITVA 4HNAB 5C8YF 2IU6A 3B2NA 1TZ2A 2ZFUA 3SOPA 3F6SA 2OOKA 2OQRA 3AK4A 3E3NA 3EPHA 2B6HA 4D1YA 4MIKA 1QHNA 3BDVA 1GYPA 2Y0DA 3IOMA 1FX0A 2I4OA 2WDPA 3FMVA 1YHZA 2BFBB 1LBSA 4I4NA 2ZRCA 3MLBA 3UANA 3C1AA 3H8VA 4M9UA 5DN6A 1FX0B 4UEKA 4X65B 4RHYA 1Z07A 2FOLA 2PUVA 3FUCA 1D0IA 4ZRDA 1C4KA 1T5BA 3K70D 2B78A 2WHQA 2VCEA 2JI9A 3UENA 4A4DA 2XUQA 4RD3A 4GRDA 2V3CC 4WERA 1YVPA 2IV7A 2HRZA 4CE6A 3L7IA 1YL6A 1KWGA 4RK0A 3ZDZB 3GPDG 4JNKA 421PA 5JO0A 1WDKA 4KEAA 2JJYA 1QZTA 2NNWB 3NB0A 3PKIA 4B6EA 5HEKA 3FB1A 3N2EA 2XT0A 3R7SA 1YVEI 2XD9A 2G76A 3CZQA 1HNNA 1GU1A 3HGTA 2OXRA 3R6WA 5IDVA 1OW3B 1M72A 5BW4A 5F51A 3RG8A 2AH5A 1GITA 2PMFA 2G6BA 3GAZA 3ZH2A 3B1YA 1RBMA 1GAEO 4MCJA 1IK6A 5K1ZA 4OX9Y 4QTUB 1E9AA 3IP8A 3RS9A 4BV9A 1NNEA 4B3RB 2ZU0C 3BGIA 1T1GA 5JFOA 4KIWA 2ZWOA 1P4GA 1FVOA 4DILA 3RVSA 1PTJA 3VYWA 1P18A 4OATA 2Q1WA 1XZNA 4PXSA 4HN9A 1K97A 1G4AE 3MTDA 3STUA 4A10A 4ARAA 3Q7SA 4E94A 1QIGA 5IFKA 3JW8A 1ISRA 3UWDA 4Q7JB 5CFNA 1WW2A 3IPRA 2GEBA 3NCTA 2Q2QA 1WOYA 1XROA 3NCHA 4G4SP 4Z0PA 4C21A 1CY0A 1SELA 1ZZEA 4JBXA 3TZQA 1L9XA 1XE3A 1G3QA 3C3JA 5E3JA 1SGWA 2GPBA 2OZLA 2QN1A 1ESMA 3RRNA 2O8FB 2BGJA 3A9WA 1VJDA 1YZLA 2G8NA 2QB5A 3L7OA 4CMKA 1Z2AA 2IIVA 2Y2UA 4UVIA 3AESA 4PZUA 4IJ6A 1A71A 2YVLA 2ZRHA 3VPXA 2HSZA 2GA8A 1L7XA 1SCKA 5CFRA 2BTEA 1EESA 5IG2A 3GP5A 5F4BA 3OWOA 1IDN1 4O4LF 4X44A 5JZ9A 1AN9A 1VPDA 4WDRA 2WTMA 3WLQA 2W2NA 3EZGA 4W6QA 4DQXA 4DSOA 4HFRA 4Q1CA 1SCNE 3U62A 1XVLA 4R2XA 5EQJB 4DIFA 2VPTA 1JR3A 5C8XA 4DZZA 2VUTA 2O5RA 4J0GA 1MC5A 4BJHB 2ZIGA 4HADA 4GLLA 4C2AA 4QLBA 1U7PA 4RMIA 5L7TA 2FPWA 4RDIA 1ZW6A 1ZBQA 1ZP6A 1VP3A 5LYJA 1M2HA 2ID9A 2QRHA 3M3DA 5IKXA 5BNIA 3ZHRA 5CMLA 4RM3A 1SXJA 2YWEA 4OQEA 1JAXA 2J8ZA 3QPVA 4HGNA 4E70A 4WL0A 1USWA 1JP7A 4MGKR 4DMFA 4YQYA 5ESDA 1GTVA 2BKXA 4KYUA 1NUSA 3R7FA 3DP9A 2E87A 5BR1A 1XP5A 3A6EA 2IXEA 3E22B 2J3LA 2C2GA 3H4IA 1KVSA 1U2QA 1US8A 4GZ3A 3IC5A 4OJMX 1EGVB 5LOVF 3WLFA 4OXNA 5AM5A 3BZWA 1GT91 1IN4A 521PA 4H15A 2PZ8A 2P1ZA 4IXMA 3C16C 4K2AA 5IUKC 1RCFA 1OU0A 1L5SA 3GRRA 4IVNA 2Q29A 4YC7A 3ANLA 1QOPB 3MWDA 1QHFA 2GM3A 2V65A 1OLUA 1C3LA 1TDJA 1HLDA 3BBLA 3IQWA 2Y1OA 4BQSA 5C5CA 3ZS8A 3DUFB 3A4YA 4M83A 4UAVA 4CXMA 2X42A 3I5MA 3JQ9C 4EI8A 5AESA 1VC2A 3FNIA 3Q11A 3MJCA 2VOEA 3Q5EA 4OY3A 1M9NA 4RLQA 4V2IA 1VG8A 2H63A 4L4XA 1KP3A 1MR3F 3P5SA 5GIPE 2F55A 2IYVA 3IR6A 5KJ6A 2RJOA 1O7JA 3CPJB 4B2YA 4EY3A 2X8JA 3LZDA 5CHYA 4Y2UA 1LRJA 1JVSA 1GRCA 4QGFA 4XGIA 3FWKA 1VMDA 4B3IA 1UMBB 3UF0A 4KAJA 4OHFA 1VBFA 1YULA 4L02A 4UNNA 3M0EA 2IHYA 2I7TA 1VIMA 4Q1BA 2P7HA 1OWMA 3CFYA 3J81A 4MZXA 2ZRIA 3QVSA 3SN6A 1SVUA 4D9GA 4XWOA 5IJWA 3GLIA 1JZTA 2FRVA 3P27A 2XKKA 4P35A 4AUNA 2IODA 4Z7QB 1DFGA 5KVVA 3A1TA 3DHYA 4DV7B 1NU6A 3CU5A 5DOVA 5HILA 1DQYA 4KGVA 1VCOA 1JG4A 1QG4A 1V8ZA 3GLHE 2Y2VA 4KRYA 2RGGA 3KXPA 2JHCA 3F6PA 4HWPA 4XJTA 4ZEMA 2ASEA 3R6LA 2WAYA 3LDUA 3ADKA 5J4KA 1UBLS 3PV0A 5DYYA 3KSUA 1V7PC 3PNMA 1CB0A 4TL9A 4WA7A 4YJ2A 3TR6A 3QX8A 2V7WA 5KKNB 3LW7A 1WA5A 2GEKA 3AY3A 1I7DA 4QQKA 3AETB 4G5SA 1VYUA 3CB2A 1CR4A 1ZH8A 2OWEA 3K2BA 4YJ2B 5E4FA 5G53C 5B1SA 3RS7A 1QB8A 2XIQA 1WZNA 3NQ41 1IN7A 3IRVA 4RJLA 4V39A 5HIMA 3EUEA 3K20A 3QFHA 4EEXA 3I3OA 1VJRA 1X42A 2Q49A 3AEUA 4HRVA 1NUUA 3O1LA 1WPXA 4EKDA 1AMNA 2GAOA 4ZYTA 1PJLA 1RKXA 1X0XA 5BMVF 3NKVA 4M9ZA 1QPZA 3L4JA 1MRSA 5A5GA 3HACA 3QLUA 5TARA 4TLBA 1ODSA 3O47A 2EZ9A 3EXFA 3OJOA 2R25B 5FTNA 4M21A 5IVPA 3IOYA 1UIMA 2HWXA 4GVPA 2H4XA 3OO0A 2OZVA 1TVEA 4GYYA 4JEUA 4Q0MA 2PT6A 3T5BA 2XXAA 1ENZA 1O6ZA 1N3IA 4RGVA 4KPYA 4C20A 2ZRNA 2EX0A 1DZIA 2WNSA 4JVOA 3RWMB 3ZXUB 3KQLA 1EGHA 2B8EA 1W52X 1O54A 2YJGA 3KXLA 1SCBA 3QPDA 4K7JA 4CCSA 4KZKA 2YDXA 4WOJA 5DI3B 1ZJZA 1OZ0A 3OQIB 4MIEA 5BNTA 2V8BA 2ZJ4A 4URYR 2PT5A 5IVIA 5KTYA 4LNAA 3F4KA 3OP1A 3M70A 1Z2EA 1NN5A 5DW0A 3RJ9A 2RGYA 4UREA 4O8ZA 1H6DA 1MORA 1W9MA 3D3QA 1U3DA 1X8KA 2J5XA 1E2GA 2J9ZB 5FHQA 1DAEA 2VHEA 4Z4QA 1UT8A 4RY8A 1VGRA 3NTOA 3RVPA 1QFZA 2IPLA 4OGFA 2ZM5A 1AUOA 3TTWA 5KC9A 5J1TB 5IAJA 3PIDA 1XRJA 2CHQA 1U9IC 3HU1A 1U8FO 3E9ZA 4FFSA 5AHKA 3GW8A 3DZCA 3D6AA 3GG2A 1HEYA 2C42A 1DG9A 2Z2KA 3G5LA 1ZW1A 4O4JF 3KV3O 2GEUA 2VLIA 4K9NA 4ZC8A 3UWPA 3HPRA 2NXJA 3GLFB 1E20A 4KYTA 5L40A 3IIMA 2BTQA 5GZ3A 3ZJVA 3BJRA 4YAJA 3G1WA 4MUFA 1OGIA 2ZUTA 5ALJA 4FIDA 4EHFA 1XT6A 2RHHA 3AF3A 3R3YA 1XXHE 2QMQA 2FN3A 2WKWA 2R11A 3EIFA 1ONBA 2ID7A 5FKJA 1NJ2A 2ZZMA 5DHAA 1T4CA 3LK6A 4MOWA 2GDZA 5DTRA 3M5DA 1TCUA 1ST3A 1Z5PA 4MR8A 1T6NA 3EXEA 4YFVA 5AKZA 3TBHA 5JWRA 2WWRA 1T4CB 4HMPA 3IMCA 1EFTA 2XRFA 3BREA 1Z5VA 4KB5A 4LDNA 4QPJC 2CFCA 1UH5A 4UUNA 1AB5A 4KK3A 3VDQA 4BNDA 3NWOA 1HE1C 4KLRA 1HT2E 2VRNA 3TTXA 3BSWA 2XE8A 1MJGA 2WJYA 1CQXA 1NM5C 4K9KA 4NFYA 3FTEA 3PB3A 4FIZA 2PTGA 4Q18A 1N2GA 1AUPA 1WDWB 1ZY2A 2XTMA 4HCJA 4QDTA 3MT9A 4WVLA 3D3EA 5ERGB 1UKCA 5I7EA 4INPA 3FJYA 5MN6A 1UPXA 5AKEA 3AZPA 3BWYA 3MFQA 3NNSA 3NT4A 4WFQA 2H8GA 1QFXA 5DASA 3GJ5A 4BIMA 4KPGA 2H5LA 1FS5A 1UJ5A 4J7CA 3N0RA 4AIRA 1DBVO 3R3UA 2ZWIA 4IV0A 4CLRA 2GN0A 3RT9A 3DEAA 3PFCA 3FHJA 3FXAA 1MENA 1JPNA 3FI9A 2LIPA 3I3SR 3AVXA 4MRPA 4YUWA 1KYXA 2W5UA 1R0SA 2HU7A 3ZZTA 2YDYA 3T1NA 1VM6A 3K0AA 3THRA 1O8BA 1U0JA 2ECOA 1ILEA 1NQ5A 1AKTA 1KO1A 4YBRA 5BVHB 4I36A 2ENUA 1P2TA 4YS6A 1NMEA 4O4IB 1PSZA 5FJJA 1WPRA 2G08A 3GWZA 4XUDA 5E1OA 1USKA 5EZYB 5KKAA 2CVHA 1DTSA 3EXG1 1XVAA 1SB9A 2IXBA 1P33A 3JD2A 2Q6KA 1PJ8A 3JRXA 4CMEC 3OLQA 2QVBA 3QELB 3IT3A 1DNPA 2XWJI 1ZAYA 1Y6JA 3ZY6A 1Y3AA 4D0RA 4RFSB 2ZU6A 1TO1E 1S7CA 2G25A 4L6IA 4PNZA 3QELA 4Y2PA 3QSGA 4R1OA 3RWBA 3ZTWA 3ZOZA 2A5LA 2R5FA 3NEJA 4GM1A 3ICQB 1KKUA 2ZREA 3BWBA 4IRXA 3VV3A 5JNLA 1U1CA 3TZLA 2VXOA 1G21B 2G09A 2H18A 1D0VA 1Z4JA 4RNDB 3TX6A 1FRFS 3HZZA 2FX5A 3UT6A 4AICA 5HRCA 4D25A 3VOAA 1UBTS 1YIOA 2WHYA 3GRVA 4HD8A 4C2BA 1UFRA 5CBPA 6ADHA 3BIJA 2VSOA 3K5IA 4R9SA 5FV4A 1NBAA 2NU6B 3E05A 1ODIA 1G291 3FNFA 4IHAA 2VDRB 4WH0A 3LPCA 2BJWA 1QGUA 4R8MA 5DSZA 3S29A 4C3OB 3SHWA 3RHZA 4HNUA 2NLOA 4PG5A 2NO7A 4LMAA 1PR2A 4J0DA 1EVKA 3RYIA 3K5PA 2AUMA 4ZYWA 13PKA 1IRXA 1YDFA 4IP0A 4CZ2A 1Q3TA 4OFZA 4DCOA 3ZZUA 3DVAB 2VZ8A 1YAHA 4QAQA 4DR5B 3M1IA 3D5EA 5FQNA 1VKNA 4AJ1A 3SDSA 2ODAA 2D59A 3GUYA 1IRIA 5JYDA 2ATVA 4ITVA 3BC1A 1M34B 3USZA 2WJIA 4L4UA 3V6LA 1H4QA 4MUYA 4OPMA 4CL2A 3AM4A 4NCIA 2FWAA 2AYXA 5L3RA 2C2XA 3W8DA 5M34A 5HDQA 2QTFA 1KPGA 1K6XA 4E5DA 1NW4A 4B6OA 4RS4A 4WFIA 3SF8A 1IONA 3M9XA 1N1GA 1RWWA 5JS1A 1IHOA 5I9SA 1NJ8A 4PC6A 4RSRA 4ZT3A 3IEMA 2JEOA 4UCFA 3U1BA 3H2IA 1UKYA 4AJPA 4POOA 1P7ZA 2J5BA 2VQSA 3C14C 3JQQA 3MS7A 4IDNA 4B46A 1J07A 2AUTA 3B1JA 4ER6A 5L4LA 1CE8B 4NZ9A 4KOEC 5TIIA 4A8PA 1I7LA 2HEGA 2J9FB 2Y1CA 5BN4B 2OXTA 4CF6A 2IYOA 1ZITA 3GZJA 3BOSA 2OQ2A 2TS1A 2AJBA 1WSDA 4IG9A 5BN4A 3UAVA 3DTYA 3V3TA 4GL4A 5HIKA 3EEIA 1N6KA 2ZJOA 4BNKA 1J1UA 2EYQA 2IFTA 4AKIA 1R12A 1QYIA 4D2IA 1E6MA 3G1UA 3M4ZA 3FVTA 3L7LA 4JBHA 2QM0A 1DAPA 5CNMA 3FIUA 4RSMA 3I9V1 1VLVA 4A8TA 3KL4A 3IIKA 3LQYA 2PX0A 3BD8A 2CL7X 2R86A 1CBUA 5I6DA 4P53A 3FDZB 1SKUA 1K6EA 2X23A 3NHRA 3H0EA 1R66A 1R18A 3P9QA 3TQIA 1O95A 3DMFA 4QJ3A 5AQ1A 4H7DA 2IYPA 3PNOA 4FBLA 4OKIA 3TQHA 1YQWA 2CUTA 3IPAA 1ZESA 2VF2A 4O5OA 4RVGA 5H81A 3RWOA 3P5BA 3VC3A 1ZM9A 1WHTB 2AK3A 1A8HA 1OJLA 3H99A 4IO0A 1C3OB 4X95A 3DBLB 1VECA 2XTAA 3WIEA 4B44A 2WF5A 1K5DA 3F5DA 3F96A 3QMPA 4GP6A 3KSBC 3ESRA 2EFYA 2W2KA 1YQXA 5FTKA 5DMHA 3GJYA 2PS9A 3REGA 2DUMA 2BM0A 3QZUA 2KBFA 3T5MA 4DARA 1WNFA 1TYBE 2WG2A 5ELMA 4EX6A 3C3EA 4Q6BA 1RKUA 4H08A 2GB4A 4EZBA 4QREA 5CURA 5JNUA 1DIOB 3PR1A 3I1YA 4DBLE 1G3RA 4ER5A 2VHXA 3R3SA 4F6RA 4LF5B 1E3JA 4QGAA 1UK6A 4IOJA 2J9GA 3JQ8B 3H7IA 5JWOA 5EUCA 1M83A 2QP9X 3NDIA 2Q5LA 2I2XB 4Q1FA 2O5VA 3IDOA 4XVHA 1WMEA 2O2ZA 2DCMA 5L4NA 3CH4B 3PK0A 3VM6A 1L4NA 4LGYA 4QG7A 2OD2A 4OFXA 4MNTA 1O08A 3CLSC 4FE4A 2ZPAA 3AB8A 4O2BB 4WADA 3WB9A 1B42A 3WLAA 5BN1A 4URWR 3T0FA 5BQFA 3R3VA 2XDQB 3CNNA 2ZGVA 3ZCPA 5IJXA 3KU4A 3WYAA 4KXXA 2DFLA 4FK8A 4ZV7A 1HLFA 5ALTA 3W34A 2C88A 3WJ1A 3A4NA 1WF6A 3NGXA 3ELYA 4RGYA 1N2CE 1T1SA 5ECDA 3CURA 4P7KA 3RCBA 1IPFA 3H4VA 4HXFB 3TJRA 4EBBA 3SSNA 4QWMA 2P9CA 1O3YA 2MSKA 1NUAA 3KO8A 5DNWA 2QMEA 1Z0UA 4BU0A 1BN6A 2AZ4A 3RKRA 1JBQA 4J0JA 1FDTA 1Q1BA 1KYZA 2DETA 5JAMA 4M9CA 3H2YA 3OF2A 3I12A 3DWGA 1A2OA 1E1NA 1EXNA 2DQ4A 1OJ7A 3GFFA 4HEHA 4CW7A 1KAMA 1NLUA 3U7EB 1PW7A 2VA8A 2ZRAA 4RK1A 4HZIA 4QUEA 4CKEA 4XD7D 3CKKA 3ND8A 4RLFA 1NA5A 4WJKB 1O94C 3UH1A 4D81A 3ERCA 2ATCA 2J5KA 3J7TA 3NGMA 3OLYA 1OROA 1SIUA 10MHA 1GGMA 3C74A 5ES3A 2MSCB 2OHVA 3FWHA 5FI1B 3LL7A 5CVEA 4G0YA 1B6GA 3ETNA 3IDAA 4NAHA 5FOUA 1P9NA 3DUWA 4YV7A 3PXCX 4PO3X 1RPTA 2I4TA 4EB6B 4JJZA 1NI3A 2XYQA 1BYIA 3LQKA 4BGVA 2GAAA 4TVBA 2YV1A 1CHDA 4B34A 1PX2A 1RMYA 4DHEA 2FN4A 3E1KA 4WLNA 3ETCA 1P81A 5AVRA 5I9MA 4DUPA 5CB8A 1WMFA 1EVYA 2IUEA 2QRVA 3MPUA 2A14A 3MTJA 3I2JA 1USGA 3RTDA 2CVQA 3H1TA 1FTYA 3QX9A 4M1TA 4GO1A 4B8YA 2JLZA 3BGVA 1EDOA 3RT7A 4ZVKA 5FEUA 1FVHA 4NF2A 3JAWB 3PTLA 5K8JB 3JASB 3MVEA 1VTKA 3EEFA 3LC1O 5DLDA 4FILA 1FA9A 1UZLA 2DUUA 1T91A 4B2LA 1CNMA 1A2BA 1PG5A 5C8ZA 1L8OA 3L6BA 2NO0A 3PNSA 3NJ4A 2R0QC 1U8CB 4II2A 1G64A 2FWMX 1GYQA 3JS5A 1L5VA 2ZYRA 4MS1A 4X8HA 2DTDA 3I83A 1RZRA 4R8RA 1E4VA 5HA5A 5IUNC 1YJXA 3ZIAA 4DY4A 4RLHA 3FRJA 1S3SA 4MS1B 1RWVA 3FVQA 3V2UA 5AK3A 1N6NA 3L43A 3K53A 1N0IA 4CM7A 4WBNF 3W1VA 3HUFA 2GM5A 4XX0A 5EXDA 4ND8A 3RJZA 3ZHOA 2XCTB 2D1FA 1O8CA 3WK5A 3D2AA 3FPLA 5T57A 2OC4A 3T54A 1PNRA 1NBWB 1T4GA 1JBEA 1JTVA 1L7EA 3W77A 5FNVB 5BP7A 1QO9A 2QZSA 1SVKA 3S40A 3SMVA 2GVZC 3LBAA 1NHGA 3HJBA 3GFBA 5CD9A 4M9SA 2CK3A 1JHXA 3PYXA 3MERA 3PBKA 2I80A 1VL5A 2ZVQX 3WYNA 3ER9A 1QG0A 2D5AA 4EW3A 3DBVO 4LJ4A 3UK0A 1FMCA 3FDFA 1CVIA 2EQAA 3B60A 3GVIA 4X7MA 1OBCA 3ZV5A 5E1DA 1V1RB 2MSWA 4LXUA 4UQPA 1EVQA 4AJ2A 4C01A 5THQA 3SXJA 1Y9ZA 5F1OA 2PU5A 4YAKA 2W2VA 3D8BA 3RIYA 3EVDA 1N5DA 3NV9A 1RAIA 3BQMB 5E7IA 1HNWB 4I7EA 1HO3A 3LCRA 3WBKA 1E96A 1EB8A 1YE8A 1IN1A 4QU9A 3ENWA 3WWZA 4E2XA 1V5IA 4EJMA 4EMSA 3CX3A 1T9BA 3EZ7A 5SY9A 4AKTA 5C3MA 3LOPA 1XRRA 4LVCA 4BQIA 1KDYA 2DKNA 1W73A 4LK2A 3RV3A 1HQCA 1T43A 1TQ2A 5DE3A 5AHOA 3P2YA 2HRBA 4MJLA 2GF2A 5EWJA 4QXOA 4Z0TA 2FF7A 5CDFA 5KX5F 1PG2A 3E48A 3OTIA 4Y0NA 4ZCLA 3RU9A 4K0RA 1QYVA 4NDAA 4PAWA 5REQB 1NVFA 5TB5A 1TMKA 3F8TA 2OT3B 4JJIA 5TGTA 5AVWA 3VISA 4UEQA 2W0SA 4LDRA 4MWGA 3AB3A 2PNFA 5EE0A 5KBYA 4LOAA 4R1MA 4EJ6A 1D7AA 1EEXB 1TLFA 3DE4X 4QXRA 1E99A 4ARVA 2FJ0A 4EGAA 3OY2A 2MTBA 3I64A 3KQHA 5CIQA 3F7TA 4N6NA 4BMSA 3ZLTA 5ALDA 3K3PA 1P73A 2P5YA 4REQB 4UDNA 5BV2P 4AM8A 1W93A 1WXQA 4RHTA 1QCYA 3DLTA 3IO5A 4M8IA 3SZOA 5EHXA 2V0GA 4ALLA 2OAGA 2EERA 1DFIA 2ZBGA 1UQUA 2P91A 5BUQA 3RASA 3VOTA 5JVDF 4NCHA 1DTWA 3LA6A 1FMFA 2IX3A 1R15A 1YXMA 5JCJA 5D85A 1Q6ZA 5CLQA 1HEUA 4CFZA 1RTKA 2X58A 5EZ6B 5KNCD 1C2YA 1QE0A 4J76A 2BY4A 1TC2A 3BFPA 4JXKA 4RA6B 2YIVX 4ZVSA 3TD9A 2XECA 4PBRA 3H2BA 5EZSA 5ALRA 5LZ4A 1S8NA 1FFXB 3IKLA 4YDSA 3FTCA 1LPSA 1TW3A 3KSMA 1Q0ZA 3OCXA 1Z34A 1LUAA 4AW9A 3WAGA 4NCBA 2EJWA 3DULA 3WIBA 3GU3A 1JLSA 3LYAA 5I4IA 2PUAA 5E1MA 1GN9A 3MWJA 3C5CA 1P7VA 4D9CA 4G0UA 1N2CA 3E2IA 4DB4A 3ADBA 2VNKA 2DHCA 5CXXA 2Y68A 2YVAA 4D44A 1GTMA 2QGNA 5KWEA 1G0OA 2IYNA 2GK3A 2JAWA 2JHAA 4XB1A 4CU5A 1LX7A 5CTJA 4I55B 1QGDA 4LZPA 1JXMA 4QJ5A 2VHUA 3S70A 3IELA 1M2OA 3QHAA 5H68A 1DB3A 3P2OA 4UUBA 4E6EA 1VSBA 2F2TA 3R9WA 3Q3JB 1OPXA 3DXYA 3PQ7A 5HMLA 2I1VB 1XQ6A 5AKHA 4BNNA 1RSZA 1E60A 3AR5A 5B7GA 1RM4A 5AUQA 1GDTA 1XTTA 1WZEA 2NPIA 2WJJA 1O97D 2GBLA 5TNXA 3HS3A 3NW9A 3AFGA 3F7OA 3O4FA 4PZDA 3TTVA 3TR5A 4HPWA 1R6DA 6YASA 1VJ5A 2FVYA 2O8VA 4MR7B 1NPDA 4N8EA 3VO9A 2WB2A 2ZTLA 1JDUA 3HL0A 3H4MA 2HZ7A 3J7AC 1AQYA 1MJ5A 3GL9A 3D6UA 1O5TA 2R5WA 4M0LA 1OC4A 4Q3OA 1XKLA 2G88A 2IP4A 3EFOB 3K0FA 4S35A 5DXFA 4L07A 5FOWA 3RSZA 1VSQA 1JTEA 1KFEB 1CFJA 2HH9A 5FX2A 3KZVA 5KINB 5LVAA 2TRSB 5E9WA 1YI0A 4CEHA 5BSWA 1GY8A 3KQYA 3IA7A 3NOXA 4CM6A 3R3JA 3LGXA 4K1LA 4W9RA 3ZXXA 3K96A 3AUYA 3Q3HA 1XK6A 5EKUA 4DM3A 4W5RA 3U81A 2ZVPX 4BTEA 2HTFA 1D8TA 4MUJA 3E7DA 2FEMA 2FJUA 4C07A 2GAFA 2ICAA 1BU5A 2MDTA 2AMVA 1XZCA 2FFJA 1DAFA 4FYIA 1Z5UA 4JVNA 4B76A 2XSZA 4WNCA 5JH7B 4QQ8A 2O4UX 2IIPA 4K8RB 1UAAA 3DL2A 3JATB 1F60A 4MYDA 4BAGA 1ZVKA 3E6AA 1Y7HA 1FQKA 2JFZA 1U28C 4EY5A 3MJDA 4L16A 3MT7A 4YRQA 3KKZA 2GPSA 4C6TB 2PE5A 4G0WA 3OCZA 3PLNA 5HSGA 2ETXA 2Q3MA 4LV8B 4YK7A 4DYVA 4DBVO 1TM2A 4EKIA 4M8NE 2F9FA 2QN9A 4OXXA 3RBXA 4Q19A 4MKIA 1X2BA 2PEYA 3THWB 2N9UA 1CUWA 2Z3ZA 1AXRA 2PRZA 1ADFA 2B61A 2UYCA 2FPIB 2KMLA 3JQ7B 3N0TA 4IBOA 5KAMA 1ABFA 1DEXA 1UC5B 3LP8A 2HMAA 2XB6A 4I1OA 5LP6F 4KACA 5K4GA 2BBTA 3UA4A 4ENWA 3QVXA 4A82A 2E2WA 2VWQA 4UJ5A 1QZ3A 1XJWA 3WBFA 3U31A 1Z4KA 2DPGA 3OMLA 4HC4A 4Q00A 4TZTA 3TLKA 4TVKA 1K7EB 1V7ZA 1PJTA 4RHUA 3HR7A 3ZWOA 2WM9B 3SX0A 4UBJA 3ODPA 4MB0A 4MGYR 2ZIWB 4EM6A 1Y3HA 4WBXC 1IXYA 2ZJ7A 1HH4A 3CZ4A 3TBKA 3EZ2A 3QOFA 4IIDA 3OWXA 3SJCA 2IPAB 4OQYA 3M6MD 4E5UA 1A69A 1D2HA 3RVOA 4YCSA 2J08A 1PW5A 5KX5A 3ZN2A 3IX7A 4G9BA 3UICA 4BLSA 1X86B 2FPOA 2XMZA 3ICOA 4RK4A 3VNAA 3GPLA 4BN4A 1T6XA 1P62B 3CEAA 3JD1A 3SF0A 3UEOA 4ZWNA 2WF6A 5DWQA 1U1EA 5EJIA 5B7PA 2GEFA 3OC0A 2UXDB 4YRKA 3UC5A 1FDVA 3TGLA 4Z7JA 4MS3B 1D1PA 4QNRA 1WS6A 3DZBA 1KWKA 1SM4A 5AWFC 2UUAB 3EXG2 2NOAA 4U7DA 1DOZA 5C1DA 3NRCA 5IBRA 4TTJA 1HG1A 1PZXA 2PQMA 3BTVA 3GEHA 5IAKA 4UTNA 3LUHA 4D7AA 1IDOA 1CNFA 5LZ7A 2CXSA 1XVIA 1NGSA 2AZDA 2O20A 3UMCA 3QF4B 3LF1A 4HGPA 5K03A 2WU1A 2YC4C 5JJBA 5ITWA 4JIGA 1XZKA 2FSUA 3IQHX 4DEVA 3NG1A 3U61B 2RGRA 3TLMA 3Q2IA 1Q7RA 2NG1A 2RI0A 5K45A 1GJRA 1EUYA 3TPCA 2BMDA 2A9QA 3IXLA 3OKPA 4CJXA 1M2FA 1O2DA 4L3WA 1UDXA 2WYUA 1NW8A 2GX6A 2WSSD 4IL5A 1A5SB 5DWDA 3ZZNA 3TECE 1G3IA 3NTLA 2PKCA 3OLVA 3QGMA 3TN7A 3Q3GE 5CTAA 4PYMA 2Q5HA 4B4OA 4XSGA 5JUWA 3DTVA 4GMDA 4KIJA 5EYPB 1ISIA 4DMGA 4U9UA 2IJGX 2OM6A 3JQCA 4N3BA 2YV2A 4RJTA 2ZUBA 5FT9A 2GZ1A 4BX0A 4KQMA 4HH4A 2ZXEA 1QO7A 1CWUA 5BSKA 1JQDA 3WA7A 2DC1A 2VRWA 4FHDA 4YP7A 1F5NA 2CKDA 2XCUA 1AG9A 1P2DA 2DSTA 3C8ZA 3O74A 2A0FA 1KDVA 1W8IA 4DADA 1FNBA 2ZJFA 4R31A 1DC4A 4GC5A 1LVGA 1W76A 5FUMA 5JYBA 3U4QB 5HUJA 3WRXA 1W581 3I9NA 4MYCA 5K4HA 4NNJA 3ZVKA 3MCAA 5MF6A 2OCAA 3BL5A 3H8JA 1MOSA 2VZLA 3O95A 4LIPD 3R7LA 4E5PA 5L3VA 1RQXA 2ZQ5A 3GFQA 2JJ2D 2VJPA 1K75A 1U5CA 4CQLA 4OREX 2H0QA 5L3SA 4I4TB 3E84A 4BX2A 5DI9A 3HM9A 3UMFA 2I1QA 3I4CA 3QPUA 4HAVA 3PGMA 1YR3A 1UXGA 1MQSA 4LRYA 3VKUA 4YIHA 4CETA 1JQKA 2F90A 3H6HA 1N5LA 3TLEA 3O8OB 4L27A 3BWXA 3HUDA 5E4YA 1QHEA 2W2TA 4MHOA 4LJYA 5IT4A 3NOOA 5HKOA 1NP7A 3OEEA 5DLYA 3GLGA 3GRZA 1DWUA 1T5SA 4E5KA 3JVVA 2PGDA 2EFGA 3B7WA 3LY9A 3RC8A 5LA6A 5EE9A 721PA 1T9ZA 1PT5A 2HQBA 3J80A 1P0MA 4RTLA 3TKLA 4JBYA 3DA8A 3WIVA 1YCDA 5B2EA 3FKJA 3JR7A 2W6MA 3N8IA 3OE7D 4TKLA 3B3GA 5DNVA 4EJSA 1CQIA 3AJRA 3CBGA 4D41A 4LY6A 1BEEA 2ZTHA 3QW4B 3ZDCA 1B6SA 3BK7A 3TRJA 4B4DA 3KPUA 1RI2A 4MARA 1KMHA 4P5EA 3QPWA 1Q3KA 4LBZA 2DPMA 5HKBA 5IJ9A 1TZCA 1VB5A 3UGJA 3KT8A 3IQGX 5F52A 1KMHB 3H3XA 3HYLA 3ME5A 1GU7A 4XH9B 3EARA 1LBIA 3D7KA 2WJ4A 3BJMA 3GT0A 4TWZA 1ISMA 1BX0A 1JN0A 1QAQA 3BA1A 2OFPA 2Y93A 3KVRA 4G24A 1CSEE 5IVDA 5H7XA 5B4UA 5TVGA 1BROA 3ETLA 1BKSB 2GWHA 4S05A 1U4SA 2ZRLA 3ZWBA 4EYKA 2QU7A 4JOCA 3T95A 5AUPB 5SYMA 5LQUA 1JSXA 2C00A 9MHTA 3CNEA 4ERXA 1DMRA 3N2KB 3FF1A 3D0OA 3LIPA 1MMFB 5TGDA 2CXOA 2WFLA 4NCJA 3BDAA 3KZXA 3GZNA 2WMOB 5AM1A 4F3RA 3PFGA 2ZT5A 3FKSD 3RIGA 5BNWA 4LA4A 2HQSA 3VR6A 1Z56C 1KAGA 4LSGA 5I4KA 3BB4A 1PKEA 5CVDA 4LJAA 3QVVA 1Z4LA 1QUEA 5JSKA 4HNAA 2YMQA 4IVQA 5AKLA 4HVTA 4CHTA 3PX3A 4PN3A 3CCBA 2UUCB 1T3TA 1YK1A 2W6IA 3GJ0A 3PR2B 4WZZA 1X19A 1GILA 3C41J 3OQ1A 5KOHA 4AX4A 5FO0A 3N2IA 2QXYA 1TZJA 4WCVA 2QBYA 2BFOA 1Q20A 1RW4A 1BX1A 2DYKA 3G79A 3OJCA 4S1TA 4YNBA 1CVRA 1E9EA 2PD6A 3BCSA 5DW3A 5AW7A 1BE8A 2G83A 3A6PC 3X1DA 3MTIA 1REQA 4WY8A 4YAOA 3EQ6A 4K6MA 4RK7A 3ANSA 1T9HA 4FI3C 1WCXA 2F1HA 4DCGA 1MC4A 1FRQA 2NXCA 4UHBA 3KVOA 1ZHOA 2IC5A 4MUGA 3BXZA 1DIBA 2WWWA 3KXIA 3SC3A 2X8BA 3NYIA 5BV7A 4HDSA 1N2EA 4YCJA 3DE5X 3KKPA 1GGJA 4MKFA 4U2BA 1R50A 1R3UA 1SQGA 3LD9A 2NUPB 1U7HA 1UKZA 3FH0A 4RW0A 4ZT2A 3C3WA 3BKXA 3O94A 5B55A 2AF4C 5E6UB 1XJ5A 1POWA 1GZUA 3GEIA 5A0VA 4JAVC 2AN4A 1PGNA 1YRLA 3D7MA 3WTBA 3CSUA 1ISFA 5E6RA 5C18A 4X8MA 1JE1A 3SQWA 2C58A 4BVLA 3HUEA 5J2UA 1ZO8A 4RZQA 4M1QA 1W75A 4YAUA 2Q0SA 7YASA 4CM4A 1U0NA 4TYQA 1NE7A 3P2JA 5JI2E 4JP2A 1CKEA 2D7JA 2JDIA 5K3BA 3HB9A 4YRZA 3TG8A 3QVKA 4HDQB 4XJSA 4CM4B 4DAOA 3QKUA 3R5SA 5I7RA 4AZ0A 1M6VA 5JMWA 5D3MA 5CU7A 5KHAA 3WMEA 3CVYA 3D8SA 4G5YA 1I6KA 3KJXA 2ZBFA 1ZGZA 2G9UA 1TEVA 2WB4A 3KUKA 4FW8A 4G56A 1GPBA 1ZK1A 1G55A 3LC0A 3VVBA 3LM8A 3E7WA 4YFYA 3FPSA 1I2DA 1L4BA 2YHBA 1QKIA 5D51S 2VSFA 3TM5A 4D6YA 2V97A 1LBQA 2VF4X 1K8RA 2W6OA 4K46A 2XBLA 4LCEA 2QN6A 4DR3B 3FLMA 2V9PA 3UHPA 2QSUA 3R5FA 4GR4A 4BO9A 1ZM3A 4JR2A 1ST2A 3KFVA 3M1YA 3M4JA 4EPRA 3OEWA 3OZCA 1E2HA 1GA1A 4LDPA 3BRQA 4NYJR 1C3EA 1BJRE 1Y4AE 5DGDA 1WTCA 1YS2X 2ZRFA 5C4GB 4A8JB 1JWAB 1Z15A 2IIQA 2QJTA 1SBIA 4MROA 2BR4A 3EEOA 4OQDA 4ID9A 1KI9A 4JL8A 4Z9AA 1V3QE 5JADA 3D8HA 4FFOA 4FDLA 5IDWA 1MHPA 3MG9A 3IQZA 5IAOA 1EU1A 2J6BA 2OL4A 2X0KA 1ZNQO 1SQ0A 2PSDA 1G3MA 2R44A 1V4VA 5IAEA 1U5BB 4EGJA 5BMVB 1CF2O 5K3EA 4R3NA 5H5JA 1DDGA 2VUUA 4GBMA 3OFVA 5NLLA 4DLRA 3B1VA 5A6SB 2CEAA 3UG7A 1STOA 1Z0SA 5SY6A 2E48A 3RBAA 1TT5B 1B43A 4UBOA 1QH1B 3DMRA 2ERCA 4L2IA 3PUJA 3DHEA 3NBMA 1JAYA 3W8FA 2VJAA 4NE7A 4NC9A 3KQUA 2V7XA 4F8JA 1EWRA 2VYND 1NX6A 3JY6A 2TYSB 3M4YA 4OXIA 3PEEA 3RUIA 2QX6A 1IC6A 2CN1A 3DAFA 1EM6A 2JAPA 1N8SA 2JFBA 3KLMX 4IIEA 1KEEA 3UJNA 4LCJA 2BYTA 1N6RA 1JE0A 4IZIA 2FKAA 3SP1A 3ZBUA 1BVRA 3CF2A 2GCPA 3WDSA 5LN1A 3PTAA 2G1KA 2C7GA 1RHQA 1KDTA 5LP6B 3Q7QA 4Z6KA 4RTRA 2FVXA 1A7JA 5HK9A 4DV4B 3ZW8A 3U4HA 1KO4A 3CRRA 3M6LA 4K5QA 1C9YA 3I2IA 5HTKA 3ZQ4A 2WKSA 1U7WA 3EGWA 4FT2A 2ODQA 2V03A 3DO8A 5JJ5A 2GUWA 4M1SA 1J49A 4JI7B 1E94E 3USCS 2D0OB 2GVNA 1LLDA 1M3SA 3FETA 1EUDB 3H9QA 4DCJA 3DHVA 3K9CA 2FTKE 3WGKA 1Z4PX 5L95A 1YZ3A 4LYJA 1PR3A 3ABRB 2FCRA 4HMQA 4LECA 1P60A 5CK5A 2GOYA 2E0IA 4NESA 4A2CA 4FPXA 4N7BA 3TLXA 3AFOA 3K09C 1DLJA 1Y80A 3O4GA 3OICA 2XQGA 2R85A 4L73A 4RH1A 5C32A 1SVNA 1TUIA 1X7HA 2AR7A 4TXLA 3JQFC 1UPUA 1QHGA 2FSIA 4YT4A 3OJXA 1OC2A 2W4MA 1DINA 2B2CA 2I22A 1GQOA 2ZK7A 4DT1B 5CH8A 3QE0A 3I01M 4IGKA 5E38A 5DV9A 4BO4A 4BGIA 2X1VA 2Q5IA 4YRGA 2IYYA 4JLBA 4ZALA 3IJPA 3GPIA 3WOHA 3ZIDA 5CD1A 1N6IA 2P4UA 2ZBEA 4WESA 3A3NA 4AG3A 3DZJA 4FX2A 1KL7A 5LYYA 4AQDA 1Z3IX 2NTVA 5KOJA 1H1TA 3RR2A 3DEFA 3V33A 1FW8A 1QP0A 1XCMA 1CP3A 2AI1A 2HUPA 2BKLA 4LNHA 4M86A 4WNAA 4XJXA 2OQVA 3WB2A 4CIWA 2A30A 1E89A 3ZHSA 2I8AA 2DAPA 4KG7A 4AQYB 4DKXA 5GIOE 4PPFA 3ZPXA 4IDCA 2WHRA 2BD0A 2VC2B 2YRXA 2Q0XA 4C4ZA 3KYCA 1PJCA 5HS4A 2HM7A 4GPTA 1B93A 1BMFD 3THSA 2BZ1A 1A9ZA 3FMGA