2YJZA

Rat steap4 oxidoreductase domain complexed with nadp
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
177
structure length
174
Chain Sequence
b'QGVVCIFGTGDFGKSLGLKMLQCGYSVVFGSRNPQVSSLLPRGAEVLCYSEAASRSDVIVLAVHREHYDFLAELADSLKGRVLIDVSNNQKMNQYPESNAEYLAQLVPGAHVVKAFNTISAWALQSGTSRQVFVCGNDSKAKDRVMDIARTLGLTPLDQGSLVAAKEIENYPLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METALLOREDUCTASE STEAP4
molecule tags Oxidoreductase
source organism Rattus norvegicus
publication title The Crystal Structure of Six-Transmembrane Epithelial Antigen of the Prostate 4 (Steap4), a Ferri/Cuprireductase, Suggests a Novel Interdomain Flavin-Binding Site.
pubmed doi rcsb
total genus 60
structure length 174
sequence length 177
chains with identical sequence B, C, D
ec nomenclature ec 1.16.1.9: Ferric-chelate reductase (NADPH).
pdb deposition date 2011-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2yjzA00
1EUZA 1CIVA 3AJRA 4JBIA 2HRBA 1EUDA 1YQGA 2JHGA 2VZ9A 3NEPX 3QWAA 4OHUA 3GH3A 4RVDA 4Z0PA 4PCVA 4MVJD 1K2WA 4A2CA 3M2PA 4O5OA 4TZKA 1XSEA 4XGIA 5EL0A 5G0VA 1D1SA 4KMSA 1UXKA 1Q2XA 4MVJH 2PGJA 3VH1A 2DLDA 5I9NA 4Y98A 3CKYA 4WLUA 4M54A 5F3RA 4FN4A 4OQYA 3ANNA 3PWKA 1PSDA 1XU9A 4L75A 2ZATA 4P4GA 3ZGYA 3FWNA 5L95A 2IZ0A 1Y5MA 4U8GA 4KUEA 5I7FA 3EZLA 2IYOA 1JVBA 4DBVO 4RJTA 1DRVA 4IDEA 3ZWVA 4YT4A 3H8VA 3PP8A 4OJNA 4HADA 3OF2A 2CD9A 5THQA 3P5SA 1HE5A 4CV1A 4CQLA 3RC2A 2EKQA 4ZRMA 2P68A 4RPJA 4FW8A 5TJHA 1WMBA 1YDEA 2R2GA 3C3XA 3L0DA 3PFWO 4OSPA 4GH5A 3H7AA 4BO4A 1XKQA 2IRWA 4CPDA 1JKIA 3E6AA 2GR9A 2ZYAA 3LSYA 2D5AA 4FD3A 3O03A 5CPFA 2HMTA 1A7AA 1AE1A 4X54A 4Q3CA 5JAIA 1NP3A 4R1UA 3S2FA 5DDIP 4DYVA 3EGOA 2O4UX 4RCVA 3U0BA 4NK5A 2JCVA 2UYYA 3WB9A 4OOFA 3H3FA 2AQKA 1P0FA 2R00A 1BW9A 3PZBA 1DXYA 3D7LA 1YO6A 2Z95A 5JE8A 4OO3A 5IN5A 1MB4A 4EJ0A 3GGPA 3NJ8A 4E5KA 1LC0A 3JD2A 5L4SA 5L4NA 1KETA 1Y8QA 3AM5A 2O4CA 1LEHA 3GLQA 3R3SA 4IQ0A 5J23A 3CIFA 4PLCA 1T25A 2J5QA 4P4NA 4PIVA 3IJPA 3E8XA 3TSCA 5A3VA 5C37A 4PLFA 1GUYA 4RDHA 4BS9A 3AFMA 3Q1LA 3JYNA 1NFFA 3RC9A 1FDTA 1YL6A 5B4UA 5JFOA 1YB5A 5HTOA 3E5MA 1I2ZA 4CQMA 4RPHA 1QXSA 2Q4BA 3RUFA 3W4JA 1WVGA 1UDBA 2JKVA 4IZHA 1O5IA 2QHXA 3SBOA 5IF3A 3Q9UA 2HCTA 3NTOA 5TT1A 3TL3A 4I9HA 2YY7A 4CM7A 1BG6A 3W6UA 1UZMA 1GU7A 3KEQA 4DL9A 5A02A 3AY3A 4JROA 1GEGA 5JPIA 1JKJA 2VYNA 4DIFA 3LDHA 1PR9A 1NYTA 3K9QO 1LX6A 3VZPA 1SZJG 5FFFA 1Y8RA 3TZCA 4IPTA 5H81A 3GFBA 1K6IA 4KTVE 4YAIA 3FRJA 1OFGA 3ZH2A 2P5YA 1MA0A 1NWHA 2ZCVA 2UV8A 3DZGA 3I9JA 4HNHA 4M55A 5FI3A 4BNGA 4DQVA 4ZQEA 3NT2A 4D44A 5JY1A 3D5TA 2ILTA 4IJUA 5COQA 1H94A 4Z3DA 3PXXA 4LSWA 3LT2A 1TT5B 4FGWA 3WLFA 3WYEA 4LMRA 3ZV4A 4QTZA 5CPBA 4DREA 1SEVA 4LVCA 3JQFC 4R9SA 4FR5A 4XJTA 3VKUA 1OAAA 4BO6A 5KWEA 2VCYA 2I76A 3I83A 2EEZA 8LDHA 1A71A 1IYZA 4FJ2A 5A9SA 2I65A 5EESA 3UF0A 3NYWA 3V2HA 4D43A 2JJYA 1CF2O 2CMDA 3PYMA 2OO5A 1EE2A 2PA3A 2AEJA 2NLOA 1CJCA 3ROPA 4MVJM 2YV2A 4N5NA 3KV3O 2VTDA 3FSRA 4R54A 3MJ4A 4AJLA 1B16A 3JTMA 2ET6A 1KY5A 2H5LA 4IGEA 4YBZA 5TIIA 1BWSA 4B8ZA 3TOZA 3ZU3A 1EVJA 1HTBA 2PGDA 1DSSG 1IZ0A 3KO8A 5BQFA 3L07A 3JQDA 1LDYA 2B4QA 4KDFA 5A5FA 2I9PA 4TKLA 4BHTA 4W7IA 3KLMX 1F17A 4A26A 2C7VA 4B8WA 1ZK4A 4CM3A 5JC1A 3RUAA 1UDCA 3RJ5A 1NPYA 4JJFA 3QIVA 1I3KA 3ASUA 4J9VA 5ICMA 3ADOA 4JBGA 4Z0HO 1KVQA 4I1IA 4OSOA 2AE1A 1GPJA 3E18A 1PJQA 4CR6A 4DTIA 1AUPA 2X7HA 3RASA 4I5DA 2DPHA 1W8DA 3L6DA 3WGQA 3B1JA 3JYQA 3AI3A 2BGLA 1O89A 3V1UA 3UGKA 1U28A 1GUZA 1ADGA 1Z7EA 4AJKA 1FJHA 3RUDA 1HE2A 2P5UA 1D1TA 1MC4A 2O3SA 1TLTA 4J4BA 4GKBA 2GZ2A 4XQEA 2WM3A 3DOJA 1M6WA 4GAEA 4J6FA 1SB9A 2RH8A 3BTSA 1T2DA 2NVUB 3DZBA 2JFHA 3H2SA 4DPMA 4CMEC 4XYLA 4OH1A 1S7CA 3F3SA 1NAIA 3ANLA 4IDBA 4EEXA 3E5RA 4KDEA 3KLPX 3P7MA 4D3FA 2C7GA 2NACA 3TPCA 2Y1EA 5F1KA 1H9AA 3OMLA 4TZTA 1OBFO 2I6TA 1F8FA 1FDWA 1DB3A 4JN6B 3WDSA 4K6CA 2HUNA 2I3GA 3ICCA 2POQX 2SCUA 4HXYA 4W6ZA 3RD5A 2ZB8A 3BTVA 1J6UA 5CFZA 4LISA 4A10A 1ZBQA 1RM5A 1LLDA 4IGFA 5JLAA 3H3JA 2BFOA 3TRIA 1N1GA 3FBTA 1GZ4A 1WXDA 3DMYA 1KOLA 1TXGA 1GEEA 1U3VA 3DXFA 4J1TA 1RYEA 3KYDA 3PIIA 5F5LA 3GVXA 1DDOA 3JQAD 4RORA 2GD1O 2RBEA 4HFJA 4W4TA 2ZQYA 3GAZA 2R6JA 3HN7A 2PZJA 5TRTA 1YKFA 3P19A 1N92A 2VYND 3HUDA 1R4MB 3CPSA 2A92A 3RBZA 1E3IA 3DDNA 4XX0A 1GPDG 4BNXA 4TVOA 1O6ZA 5JCJD 4DIOA 4JK3A 3OSUA 5F1PA 1I32A 1MX3A 3OA2A 5L51A 1XELA 3A14A 4B79A 3VKVA 3HN2A 3LLSA 4WEQA 1B8UA 5BNIA 1SOWA 4NK4A 3HADA 1Y6JA 4L9RA 2PKQP 1AXEA 1H5QA 1FDUA 2OORA 4MVJA 2E82A 2E37A 2H9IA 1PJCA 3D5QA 2WTBA 3PYXA 4PVDA 2Q3EA 2FR0A 3BIOA 3KYDB 1ZK1A 1ZW1A 2ZQZA 3DONA 2Q1TA 4MO2A 3S8MA 4OGWA 4NBRA 1A7KA 1PGQA 1QLHA 4F3YA 4YJGA 3OFSA 4Z9XA 4AJ2A 3GDFA 1YQXA 1SBYA 3BMCA 4J1SA 1JWAB 2AQIA 4B3JA 1EVYA 1KEUA 4RO0A 3WTCA 2NADA 5BNTA 3ENKA 4YB8A 1JWBB 5BSHA 1U3WA 4J1NA 3JD0A 3GDGA 4OKNA 2J5KA 5EN4A 2VHWA 3ETDA 1PWXA 4FSHA 3B6ZA 1MXFA 4QX6A 4XR4A 4FC6A 1XLTA 4BNKA 2D2IA 4BO9A 1UDAA 4BKUA 4AJOA 1BXGA 2O50A 1HEUA 2Q4EA 4YYZA 3FCOA 3BHIA 3ZV3A 3I1JA 5IXYA 4KWHA 3DFUA 1DRUA 5T8KC 1HDXA 4BNTA 3VPXA 3LVFO 4P22A 3O8QA 4WCFA 5KNLA 1K0UA 1RM3A 2CNBA 2P9EA 3I23A 3AU9A 3QW2A 3ZWPA 4J2HA 3C1OA 4XA8A 1JTVA 1NASA 5EINA 2Y0CA 3OECA 1A9ZA 4NQZA 1AGNA 1M75A 3LC2O 4YJDA 1MP0A 2EKLA 2LDXA 3MWDB 4QSMA 1UP7A 1B2LA 2C29D 3ZU2A 2AQHA 1QYVA 1B26A 2X58A 3KETA 3V1YA 1YL7A 2J3KA 2O2SA 3U4IA 4L8VA 3CUKA 3GVHA 5G4KA 3A06A 4DLAA 4IQGA 3SVTA 4EDFA 1QSGA 4GX2A 2Y99A 3C1TA 3U3XA 4KQWA 1KVRA 4A03A 2GF2A 3DTYA 5KKAA 4BGEA 5TF4A 1VLLA 2O2YA 4XDZA 1I3LA 4I8XA 4BGIA 4L73A 1R0KA 4R3WA 2OMEA 2BHLA 2BMAA 3JQBA 4F6CA 1OC4A 3OA0A 2JL1A 2AW5A 5BSGA 4BNLA 4YR9A 1BXZA 3FNHA 1XG5A 3ROMA 1L7EA 3UW3A 2VT2A 4L74A 4AJ4A 5BSEA 2B69A 1E7MA 1ISFA 4J90A 1N9GA 3HE3A 1I3MA 1ORRA 4WNIA 4B7UA 4W7HA 5B4VA 3JYLA 3KEOA 3LC1O 2Z5LA 1F0YA 2FR1A 5C3MA 1P33A 3A4VA 1K6JA 3KSDO 4CLRA 3PGXA 1JA9A 1P0CA 3UICA 1DIGA 2RCYA 1Y81A 2NWQA 2FY8A 3Q0EA 5C7OO 2YFQA 3I9NA 4PLGA 5IDWA 4L4RA 4RF2A 4MKXA 3VAZA 1A9YA 5JAZA 3E03A 2FRDA 4A27A 4TVBA 3WJAA 1UP4A 3G17A 3PRJA 1GZ6A 3GVIA 1LNQA 2PR2A 4ZJUA 1ULUA 3WFJA 4AICA 3NGXA 3KVOA 3FNGA 1XGKA 2W2KB 4NMHA 2C5AA 1LDGA 5G2OA 1Q1NA 4GLOA 1VL0A 4B4UA 4R51A 2YHUA 4CUKA 5AOVA 3CEAA 1PQUA 4DBZA 2PWZA 1NTOA 1DFHA 3FPLA 3HSKA 3VVCA 4MVJI 5U1PA 3D3EA 4GGPA 5L7WA 1ZNQO 3GNSA 3E9QA 5GZ3A 1CYDA 3MJEA 4GX0A 4IDDA 1C14A 1UH5A 2P91A 5AQ1A 2C07A 4PLVA 2DVMA 3MOGA 3GRPA 3WWZA 1ISGA 2B5WA 2B36A 3RUEA 2AA3A 3L4SO 4E3ZA 2O3RA 1IUKA 3KOUA 4O6VA 1DAPA 4J7CA 2OBNA 3E48A 5COBA 1FK8A 1LSOA 3WYCA 2DC1A 4UULA 3QLJA 1IHYA 3ZV6A 1KC1A 2G5CA 2BF7A 1RM4A 2VT3A 3UXYA 4CM9D 4FFRA 5CDTA 2JHFA 2P4QA 4J49A 4ZQHA 2H63A 4YT2A 1EZ4A 3HG7A 4EUHA 4HWKA 2CVOA 1FXSA 5ER9A 4CUJA 1E3WB 2BGKA 2PY6A 5JBIA 3W8FA 1P45A 1P31A 1NWCA 4IZIA 1VM6A 3T7EA 4AJ1A 4BOYA 1N2SA 4WE3A 1NR7A 4XGKA 4WASA 3FTNA 4ZQGA 3PFFA 3FN4A 4OIMA 2WYVA 1ADCA 2TMGA 3ZDFA 4A7PA 1I0ZA 5C7IO 5IG2A 5KJCA 3TDKA 1ZO8A 2HAEA 2YHIB 3PHLA 1QKIA 3I5MA 3WNVA 3QA9A 4RPKA 3Q3CA 1Q7BA 1LDEA 1VPDA 3BXXA 4TMFA 3QVOA 3VC7A 5KVCA 3JQAB 2QX7A 1JKFA 3DZFA 5IDQA 3LZ6A 4RLSA 5L9AA 3NDIA 3LF2A 2FPPA 5JY6A 2NNLD 3PZRA 5TNXA 1V6AA 3BMQA 4EZBA 5CDYA 1OMOA 3OEYA 1NPDA 1T4DA 1Z73A 1ONOA 3DZKA 1PL7A 2AHRA 4IDAA 1HXHA 1E3LA 1M2WA 4BO1A 4UEOA 1VSVA 2PD4A 2DUWA 1HETA 1XIVA 3EVNA 4UUOA 2GUGA 5K6AA 4GPD1 5A03A 1NVGA 1U1IA 2FP4A 3IAHA 5ES3A 1N9GB 1V9LA 1ONPA 4YRBA 1Q0LA 2EXXA 2X0IA 4NI5A 5MDHA 1M66A 1D7OA 3BA1A 3PJGA 4IJVA 3K8ZA 2W4QA 3CZRA 3RUIA 4E32A 5DBIA 4NJMA 2NU7A 2EF1A 1TB4A 3MJSA 3I9OA 2G0TA 3AI2A 3F46A 4MVJG 5A4DA 2VTEA 1ADBA 3IQDB 1B0AA 1C0LA 5CHEA 3WJ7A 1DLIA 3B1FA 3PK0A 2V7PA 2AMFA 4CMEA 4N5MA 1DO8A 1PGJA 2P2SA 1P1FA 2BFAA 2DFVA 1KS9A 2DAPA 5IFLA 1ZSNA 3TZ6A 3DHYA 4S3MA 4H15A 2H1SA 4IQ8A 1VE9A 3KM0A 2VWPA 1EBUA 3ZV5A 5ITWA 4RVUA 5TQVA 3PWZA 3DBLA 3C8MA 1WDLA 4RPLA 3Q11A 4LRSB 2BELA 1QLJA 3JQCA 1EK6A 2X4GA 3G1UA 3JQ8A 5G0WA 1IY8A 4CLEA 2PD3A 4E6PA 3KXDA 1KIFA 1DOHA 3C1AA 1E1MA 1NBOA 5L40A 1B3BA 3RSHA 5EERA 1GQ2A 1DAOA 4J4HA 1NHWA 2Y0DA 4ROSA 3NKLA 4TKMA 4E5YA 3ETEA 4C4OA 3WTBA 3IJRA 4E2YA 5JYDA 4Z6KA 1DC5A 1JLLA 4NBUA 2OP0A 2ZTVA 2BI8A 4N7RA 3WLEA 4R69A 3V1TC 1LA2A 1PR3A 1I30A 4CR7A 5GY7A 3K6JA 4JP2A 4MIOA 1U8FO 1SNYA 1R16A 2VHYA 4BGUA 1BRMA 4QFDA 2HQ1A 1A72A 1D3AA 2GN4A 4FB5A 3GG9A 1AXGA 1H93A 2G17A 2I67A 3R6DA 4MIYA 1LC3A 2OL4A 5T64A 3BMOA 1VC2A 2OXIA 3ROKA 3D1LA 3K31A 4GGOA 3OICA 4EITA 2QW8A 3ZHZA 4BO5A 3PJEA 3INRA 2Q2QA 4HFRA 1JAYA 4BNFA 2GRAA 1X1TA 1LJ8A 4DLLA 2VUSA 2ZTMA 1BW9B 1GL3A 1H6AA 4GMGA 4Q9NA 5C5IA 2PKQO 3G79A 1YBVA 2FOIA 4PZDA 1HDZA 3FD8A 1X7HA 2JFGA 1R0LA 3BMQB 2A9FA 4DPKA 4W9NA 3N74A 2HMSA 4BKOA 4ESOA 5L4LA 1PZHA 3HFGA 1ISMA 2X5KO 4GKVA 5IDYA 3VTFA 3NTRA 3V2GA 1I01A 1U2GA 2GZ3A 4IDGA 1EEHA 5JCJA 1HT0A 4OXNA 4YPOA 2BFPA 3AWDA 3PPIA 4QQRA 9LDTA 2GERA 2P9CA 1VI2A 2AEFA 1T2AA 3H6KA 4ND5A 4OXYA 3RI3A 1LDBA 4MDHA 4RDIA 1F06A 2O3JA 3QY9A 5AXDA 3TN7A 3FI9A 4CM8A 4GL4A 4QEDA 4YA6A 1F14A 2GN9A 2DKNA 4BNWA 5ICSA 1E6EA 3RQSA 1SPXA 2DTDA 3FNEA 4GWKA 4IS3A 3KTDA 4FBGA 4UVHA 3LYLA 1L7DA 1E1NA 1YWGO 1PQWA 4RZHA 1AHIA 1W6UA 2B5VA 3DC2A 4AJNA 2VOJA 4WOJA 2CUKA 4KOAA 3WICA 1LLUA 4ZQFA 4BO8A 4BL5A 1W4ZA 3KRTA 2PZLA 2RH4A 4CQMD 3STHA 1GV1A 1CQIA 3UFXA 1GCOA 4UAGA 5BNFA 4NZ9A 1DBVO 3MWEB 1EDOA 4BO7A 2AXQA 1YDWA 1NXQA 1MFZA 3H5NA 2BFMA 2J3JA 2Y0EA 4NNJA 4BV8A 4ITUA 4CM4A 3L77A 5IDXA 4TRNA 4QT0A 1WP4A 4U6SA 5DBGA 1GY8A 3IKVA 4D7AA 5TJ9A 4YEDA 1WDKA 1UJMA 2GSDA 3Q2IA 1AN9A 4F6LA 1JDJA 4TROA 2HKIA 1NVTA 2AG5A 3RU9A 2FN7A 5ADHA 1I36A 4Y9DA 5JCXA 4RVFA 1H2HA 1EVIA 1UZNA 4J4TA 1GDHA 3F5QA 4GX1A 3H65A 4TSKA 1G1AA 3GPDG 4JLWA 4M86A 4XDYA 4MVJE 4OXKA 4UVDA 4PG5A 2I66A 3AFNA 4LMPA 4NU5A 5A05A 1MG5A 1U2DA 4O59O 1ZK0A 4IBOA 3S55A 1A27A 1Z45A 3JYOA 3V5NA 2EGHA 3F9IA 1BXGB 3IDSA 5DULA 4Z0TA 4JBHA 4ILKA 4TWRA 4CODB 4CLOA 4DMMA 4K28A 5TX7A 1ARZA 2XOXA 3F1LA 4RVSA 3B20A 3FNFA 2X0JA 1BHSA 3V2UA 1MC5A 4J1QA 4D0RA 5LDHA 1KYQA 1PZGA 1B15A 1EDZA 2ZTLA 3I9MA 1EFKA 2Q46A 4O0LA 4ID9A 3WIDA 1KERA 3ZCXA 2HK7A 1V8BA 4J43A 1RWBA 2HMWA 4RF4A 1B7GO 2X5OA 3I4CA 2UUPA 1PGNA 5L53A 2UDPA 1DIHA 1J5PA 4EW6A 1HDCA 4XWYA 1R4NA 1V3UA 1VJ1A 4M87A 4KQXA 1VL6A 5F1OA 1SMKA 3TL2A 3UHAA 1WZEA 5ITVA 4OOEA 4EI2A 3U4CA 4GBJA 4HY3A 4NU6A 4M8SA 2EP7A 1P1JA 3INGA 3ZNQA 4RV9A 1GUFA 2DBVO 3ANMA 2VHZA 4IJWA 3WMXA 4ZVVA 1CERA 3PQEA 4Z3KA 5HS4A 1SEPA 1GYPA 5L7YA 5LDGA 9LDBA 4IUYA 3U09A 4UVIA 2FPIA 3G49A 3EHEA 4E21A 4B7XA 1ONNA 4H16A 2HDHA 4E5MA 3S2EA 1Z6ZA 3IP1A 1U7HA 1HF3A 4KP7A 2DBRA 1UXGA 4PZCA 1D4FA 3QWIA 3AM4A 1HRDA 1UXIA 1ADFA 4OM8A 3HQ4O 4YVFA 3WWYA 1LDMA 1T4BA 2QYTA 1HSOA 7ADHA 3FHLA 3GEDA 5B37A 1H6BA 1I2BA 2CZCA 1K3TA 2CF6A 1YJ8A 4DIBA 4I5EA 3CMMA 4CM6A 1P1RA 1IL0A 2DUUA 2I99A 4LGVA 4MVJP 4BNJA 3OJFA 3PQDA 4LRTB 4DQUA 5I8WA 5IXSA 2WD7B 3O9ZA 3VOSA 1Q0HA 4L0QA 4H7PA 4JP3A 4OYRA 4BMNA 2YHIA 1J49A 3RUHA 1LUAA 2VZ8A 5EQFA 1B3RA 4QUKA 1R15A 3QVTA 1VJ0A 4DMLA 2W8ZA 2C5EA 2O3QA 4YJFA 4BNIA 2X1HA 3N58A 2Y1CA 1X1EA 2FSVA 4NIMA 1WZIA 4PGFA 1PL8A 3C85A 2UVDA 1ID1A 1UAYA 1ZXLA 2Q1UA 3X2EA 4RVGA 5JW6A 3TJRA 4A0SA 4YJHA 2AQ8A 3JD1A 3PHGA 2F1KA 2FPGA 4DYDA 4JGBA 4RQUA 3HDHA 3DHEA 4WLFA 1XWFA 4YRDA 4D42A 1N7HA 2TMDA 1OI7A 3VDQA 4PG6A 3DAFA 1XR3A 1GV0A 3TZHA 4ONEA 4BMSA 1MUUA 1ZIDA 2NQTA 1I3NA 2J3HA 3DR3A 3NT4A 2HMUA 3PIDA 3JYPA 5BSFA 4RF5A 1U4OA 3DQPA 4FJ1A 4K6FA 1FMCA 1E7YA 4BKPA 1O0SA 3H9GA 4PZEA 4WJZA 3U4DA 1HE3A 2GPTA 1Y8RB 2JCXA 2RHCA 2E6UX 3D3WB 3SEFA 5IZCA 3H4VA 1LBEA 1TVEA 5GMOA 1RJWA 1YBMA 2C2XA 1JQBA 1T2EA 2CDAA 3L6OO 2ZJ1A 1GR0A 4BO0A 1EE9A 5U4QA 2C2YA 2PZMA 3ON5A 1U4SA 4LCJA 5JDIC 2Q2WA 4CMBA 2A94A 4DQXA 4KZPA 1NFQA 2WYWA 1BVRA 3JQ6A 3ITDA 1XQ6A 1M6HA 1VKOA 4BKRA 4R1NA 3DHNA 3WGYA 1ZKMA 1IPFA 4WOKA 1LQTA 2VRCD 3BMNB 1R12A 2HJSA 5FWNA 2YQ4A 3PHJA 5JC8A 3ITKA 1ZMOA 3W8EA 5KOIA 3SC6A 4BO3A 2NTVA 3JQ8B 3AM3A 4MP8A 5KJEA 1PJTA 2BI7A 3MOIA 4XB1A 1K5HA 1PS8A 4J0EA 3T4XA 1QYDA 5DNAA 5IAAA 1KEVA 2VNSA 3ULKA 1N1EA 4XJSA 5I7EA 4E13A 1GD1O 3GNQA 3F6YA 1ZSYA 3NX4A 3D3WA 1EUCA 3JQEA 4Q39A 3PWSA 3BYZA 3PDUA 3EDMA 2EG9A 3I4FA 1UUFA 4M1QA 2D59A 3L9XA 1T1SA 3GHYA 2JFFA 3ENNA 4JCOA 3IKTA 4XRGA 2FR8A 1ZZEA 2OOSA 3JD3A 1P1IA 1H6CA 2PKRA 3L6EA 1T2FA 2XAAA 3JQ7A 1N7GA 4XD2A 4XIYA 2WE8A 1B8PA 1V3VA 1QYXA 3EW7A 3S1LA 1CETA 2OUIA 2VWQA 3OQ6A 2NQ8A 3GA0A 3ZWOA 4Z9FA 4DA9A 4DPLA 1IULA 3K2EA 4S1VA 2EJVA 5IJZA 4D41A 1MV8A 3D0OA 2IODA 1U3TA 1R6DA 1LSSA 1DFGA 1JU9A 4FFMA 1LSJA 3RIHA 1MFPA 5G4KB 5T5QA 4J2OA 2A4KA 2GNAA 2IXBA 2NV6A 3LT4A 4U7WA 1QR6A 1HYEA 5DP2A 5ER6A 3IS3A 1O94A 1IHXA 2Y05A 2FSSA 1C1DA 3SLKA 4XR9A 4WNCA 1PS9A 4NBWA 4ZD6A 3C7AA 3MEQA 1PJ2A 1HDYA 5K6AC 1KY4A 2X86A 4JXKA 4ZQBA 2PLAA 4MVJF 4C7JA 2Q1WA 2WD8A 1KVTA 4CL3A 2QRKA 1RKXA 3FTPA 4K1LA 3CE6A 2EV9A 3QHAA 3OJLA 4LN1A 1NNUA 2NM0A 1ULSA 2Z1MA 3JQ7B 2WMDA 2XXBA 1PQPA 3PI7A 3RVDA 1QORA 4CM5A 2OBYA 1YE3A 4AG3A 3DBHA 1P3DA 2PFGA 3GGOA 3T4EA 1ZEJA 4FIZA 5ILGA 3WQRA 3CMCO 4E30A 1HZJA 3DBRB 5CP8A 4EGFA 3V8BA 2J8ZA 3CXRA 2PGLA 3IOYA 3K73O 1B8VA 2X5JO 4NG5A 5JXWA 3EAGA 4WLEA 4PLHA 4HX5A 3D4NA 1WNTA 3ORFA 1ENYA 2IZZA 5JSFA 2OZPA 3DAGA 5KVVA 3DOOA 4ZICA 3LC7O 3BAZA 4YAEA 1U8XX 4P4LA 4CMJA 5JNLA 4IY1A 2VOEA 2CF5A 4IJKA 1HZZA 1SB8A 3TFOA 1C0PA 2B37A 4CLDA 1XDWA 2NSDA 4HFNA 3VPFA 5JAQA 2O7QA 3KYCB 5DCUA 2OP1A 1JW9B 4U6QA 4YACA 3GZ4A 3W4IA 1HL3A 3HHPA 4WK6A 1Y7TA 1DIRA 3K96A 3NT5A 3AOEC 3D4PA 4IM7A 2UUOA 4NDNE 5JO9A 2C54A 2E48A 4FFOA 3FWZA 3SXPA 4D79A 4Y6RA 1FF9A 1WWKA 2YUTA 1MLDA 4BNNA 3DBRA 4LCEA 2X22A 4BNYA 4G65A 3IC5A 3GMDA 5G0SA 1E6WA 2DQ4A 3OQ1A 4LVUA 3RBVA 5C7LO 3JQFA 3ZI0A 1I5RA 1HKUA 2PH3A 1E5LA 3F4LA 3R3JA 3ZHBA 2XF8A 1ZK3A 3E9MA 4I08A 2O7SA 4IIUA 4K9DA 3G3EA 3PGJA 3ZWYA 1YB4A 2EGGA 3KYCA 1YH3A 4YRAA 4PRKA 4NFYA 1LI4A 5I9LA 5FYDA 2PD6A 4E4YA 1LRKA 2IDZA 2NU8A 1XHLA 1PJBA 5THKA 3RFXA 4FOSA 4RPGA 4B7CA 3B1KA 3GY0A 4YTEA 3TWOA 3GMSA 4Q3EA 2C0CA 4YJGB 3VZSA 3WIEA 4YCAA 4EJMA 3E1KA 2EERA 2I5PO 3GUCA 4WLVA 4BUCA 2O3UA 4HKTA 4CM1A 2ZYGA 1IPEA 1DC6A 3LK7A 3KZVA 2V6MA 5EJ2A 3UH1A 4HBGA 4Y67A 4ALLA 2Y93A 4CMIB 3JQAA 2D3TA 3KSZO 4NFHA 4J3FA 3NDJA 4R68A 3G1TA 2EP5A 2FZWA 5EQDA 5DN9A 3LF1A 4G2NA 4XIJA 2OHXA 5IZ4A 1TT7A 3NJ4A 3VH4A 5CAEA 4JX8A 2VHVA 1IB6A 2FMUA 1QYWA 3KBOA 3EC7A 3ZWXA 3KSUA 2BGMA 3QRWA 2YFHA 1H2BA 4D0SA 1PTJA 3CZMA 4CM4B 1KBZA 4FS3A 3UOGA 3JV7A 3BHMA 1E3EA 4J7XA 4IXTA 1NPTO 1UZLA 1QV7A 3AK4A 4YDRA 3WGHA 2YQ5A 1ZJYA 1KEPA 2F00A 3DWFA 2DPGA 4RL6A 3ETGA 3GQVA 2VUTA 4ND2A 2QG4A 4Y6PA 5JO0A 4XQGA 4GWGA 4ZU3A 4E5PA 1YBAA 2IZ1A 4MJLA 2LDBA 1LU9A 2IXAA 4XZ3A 3CSDA 1E1KA 2WSBA 1K6XA 1JN0A 2GASA 2W90A 3H9UA 3RKUA 5I7SA 4R01A 3ZWAA 4DGSA 3O26A 4YT5A 4E2WA 3NRCA 4TQGA 4ALKA 1OZAA 4CJXA 3GDOA 3D4OA 4IXWA 2WD7A 4CUZA 1Y1PA 4ALIA 3RKRA 1TT5A 1A4UA 2V6FA 4GMFA 1U3UA 4H3VA 1O9BA 4UUNA 6ADHA 2QQ5A 3PVZA 4QO7A 4G81A 5L45A 3WGIA 5G0TA 3MTJA 4JJIA 3S2GA 2CDBA 4CMCA 4WGGA 2J5RA 4N54A 4AVYA 3PTZA 4XYBA 2VHXA 4DXHA 1DHRA 3VZQA 5GZ1A 1M67A 1VSUA 2YZ7A 4YWJA 1DPGA 5H83A 3GVCA 3E9NA 3I6IA 4MINA 2X9VA 4GVXA 2Q45A 2ZTUA 4ALMA 4B3IA 1W0CA 4EJ6A 3WBBA 5DOZA 3GPIA 5LCXA 1ZVMA 3UVEA 3AUTA 5H82A 3KYBA 4TRMA 4UREA 4CLRB 3UKOA 2ZCUA 3GUYA 2Y68A 3RU7A 2GO1A 4D46A 5COAA 5FEUA 3JSAA 1O8CA 2DTEA 4IMPA 5KIAA 5HRUA 1HWYA 4BNVA 1C0IA 1MXHA 1YRLA 1DJNA 2NVWA 4UUMA 3VTZA 2VRBA 6LDHA 3OETA 3GOHA 3ONFA 2OFPA 4YAKA 1V3TA 3H9JA 3A1NA 3ZWMA 3KHUA 4E33A 2J6IA 3DOCA 2P9GA 4ND3A 1WAMA 2NUAA 1VJTA 1Y9EA 4P8RA 1ZUD1 3WR5A 3TNLA 1E77A 4FFLA 4PLYA 2WDZA 3TZKA 1LSUA 3BMOB 3QWFA 3QVSA 4OAQA 3TQHA 3AU8A 1ISIA 5JAMA 4R1TA 1EBFA 4Y8VA 4CM9A 3FPCA 3VHRA 3WQQA 4BO2A 3RFTA 4RGBA 1E92A 4Z9YA 3JQBC 2ZJ0A 3Q9NA 1SO8A 3FR8A 3GEGA 5L3ZA 4BB5A 1I8TA 2GZ1A 1IZ9A 2ZIZA 1A5ZA 1DIBA 5IZCC 2ZB7A 5JMPA 1PGOA 4YXFA 3QWHA 1PJ4A 3WGTA 1BDMA 5T57A 1DEHA 5HM8A 4NJOA 3GG2A 1LRJA 5DT9A 1X7GA 5I8ZA 1VKNA 3ROQA 3WGOA 2Y66A 3DZIA 3F47A 3H9EO 5B4TA 1DFIA 4O63O 4CV0A 2DBZA 3L4BA 4GSLA 3G0OA 3RROA 2B4RO 2CY0A 1X7DA 2G82A 3AY7A 2B83A 2ZK7A 4RF3A 4PLPA 4BV9A 1WDMA 1PJSA 4G5HA 4IMRA 2QYSA 5CEJA 5I9MA 5K9ZA 1KVSA 5JS6A 1D8AA 3EY4A 4RVHA 1H6DA 1Z75A 2Q1SA 2DU8A 2X9NA 3SJUA 5K0ZA 3ZU4A 2VWHA 1HLDA 1XCBA 4MP3A 3X2FA 4PN3A 2CVQA 3WBFA 1X14A 3INTA 5KVSA 2AG8A 3H2ZA 4DWVA 2X9GA 3U5TA 4C7KA 4B3HA 4ZRNA 1WLYA 1DIAA 1NR1A 2GYYA 3DMTA 4NPCA 1ML3A 3CH6A 4OL9A 3IUSA 5U9CA 4MPDA 3ZNOA 5T6BA 3VPGA 5CEEA 4HNGA 5CEFA 1F8GA 4CLHA 2X0NA 4ALNA 5B12A 4FFPA 3JQ9C 2B35A 2GLXA 2PTGA 1X13A 3GNTA 3ZWWA 2GDZA 4HV4A 3IP3A 1CEQA 3VPHA 3DAPA 2Y1DA 4WCDA 4E12A 1YVEI 2BRUA 3GT0A 4I5FA 4UEKA 4IDCA 3WGZA 2BLLA 4CMKA 2X6TA 1I24A 3O8QB 4WCFB 1HYGA 1DHTA 1T2CA 2CSUA 3PDJA 3PJFA 3WQSB 4BNZA 1DC4A 1T26A 2IEBA 4W99A 4BVAA 1KC3A 4AJIA 2AE2A 3C24A 4XEHA 3ZWNA 2QIOA 1HE4A 4UEJA 3DBHB 3I6QA 1HDOA 1OC2A 1J4AA 2PV7A 3WFIA 2VZ0A 3IUPA 1BVUA 2Z1NA 4QECA 5AXCA 1DC3A 2CFCA 2VYVD 1YGYA 1BDBA 2Y1FA 1Q7CA 4XYMA 1HYHA 3TFQA 1PL6A 1WPQA 5TS3A 2R00C 1R66A 3R0IA 4EYEA 4OQZA 1LLQA 3BTOA 1UXHA 3GZNB 5HA5A 1UAGA 1K89A 3MJCA 2BKAA 4N5LA 5AVOA 3W1VA 3H9QA 2Q49A 3BHJA 4J9UE 5EMHA 1DJQA 5ENDA 1HDRA 3BMCB 1WMAA 2FZEA 4D3SA 2Q99A 5JDCC 1EQ2A 1CQJA 2QZ9A 3HZZA 2GCGA 1QP8A 3R1IA 3ZWBA 5I7VA 3JQGB 1NQTA 1G0OA 4GI2A 1DRWA 3COSA 2JAPA 1GZ3A 1PJLA 2D8AA 4XYEA 1YS4A 2YJZA 3VZRA 1I2CA 3WG9A 2WYUA 3QQPA 3WX0A 3GVPA 3RUCA 8ADHA 2G76A 1AHHA 5DOVA 4HFMA 1GCUA 3OJEA 1Y8QB 3M1LA 3GAFA 4ZGWA 1NAHA 2QRJA 4MIEA 4ZHSA 3EYWA 1E3SA 1E7RA 2VYVA 2QZZA 3SX2A 5AXBA 5KJ1A 4CQMB 4Q3BA 1P77A 2CDCA 5BR7A 2HLPA 3QJ5A 1YJQA 5HBRA 1EVZA 1Z74A 1WW8A 5A06A 4YAJA 2B0JA 4FGSA 4NH4A 1EMDA 3JQGA 4TRRA 2V6GA 2G1UA 1M76A 3GK3A 4R4JA 5DF1A 2HJRA 3UN1A 1C3VA 2VN8A 3OM9A 4FDAA 2DBQA 1U7TA 4IINA 4DUPA 4DLBA 3A28A 4CV3A 1PEDA 2VWGA 1HDGO 3EVTA 1E3JA 4MOWA 4AJJA 2ZKLA 4PFJA 4QXMA 4XQCA 1BMDA 3UCXA 2NTNA 1N8KA 1NVMB 2PK3A 1G0NA 2V6BA 4OMUA 1ZJZA 5JDIA 1LQUA 3GEMA 2C82A 2E4AA 2A35A 4UVGA 1PU2A 1XU7A 1RPNA 4I5GA 2Y1GA 3M6IA 2JD1A 2PH5A 4NBTA 4P38A 4WKGA 3W6ZA 1CWUA 3I9LA 3TOXA 1FDSA 5KKCA 4J91A 1SOVA 2GGSA 3DBVO 4R3NA 5TC4A 4B4WA 2EHDA 4I9UA 2IEDA 3F4BA 5DCYA 1SCUA 1OOEA 3OP4A 4XYGA 4CM8B 1TEHA 1T1RA 4D3DA 1R37A 4WPGA 2GN6A 3QWBA 3UCFA 4KUHA 1EFLA 3WYBA 3SC4A 1LTHR 5EIOA 5ENVA 1KVUA 3M1AA 5F21A 3ZN2A 2WWRA 2WE7A 1LDNA 3GN1A 4WLOA 1H9BA 5G0UA 4YT8A 3MJTA 3LT0A 4KTTE 1Z82A 1ENOA 3HB5X 3IL2A 2PZKA 3K2BA 4LK3A 1S6YA 4UUPA 3OIDA 3PLNA 2O23A 1ZK2A 2Y67A 1FDVA 4WUVA 1X15A 3GR6A 2PNFA 1X0XA 3U4HA 3NDRA 3CTMA 2RHRA 5B1YA 1GQYA 4CLXA 1P74A 3UUWA 4L76A 3ZW8A 1HLPA 2DT5A 2ZB3A 3NV9A 3BMNA 4AL4A 3QSGA 2W98A 4XKJA 1GAEO 4GX5A 1KEWA 3HDYA 3I52A 4PLZA 4WLNA 3GFGA 3VH2A 3RWBA 4NR0A 5KJ6A 5KCZA 5KJFA 1RYDA 4F45A 4CMIA 3HDQA 1IOLA 1ZXBA 3GC6A 3K30A 5A5EA 1YB1A 5DZSA 1P1KA 2GN8A 4E0BA 3AOGA 4E31A 4GSKA 3OJ0A 3WS7A 1PIWA 3QV1A 3LLVA 2X0RA 4J16A 1XYGA 1BGVA 1LRLA 5A9TA 3Q2KA 1GADO 2J3IA 2VNAA 2NVUA 4A73A 1VRWA 1R0SA 2XXJA 3DTTA 1VL8A 4FC7A 3PEFA 2CVZA 1EK5A 1I10A 4LW8A 2Q2VA 1J0XO 4NHEA 4CLOB 1JVSA 2RIRA 5A9SB 1ZH8A 3ONEA 3PQFA 2QRLA 4Q3AA 5HS6A 2DFDA 3TF5A 3VVBA 1O95A 3D64A 2D0IA 3AUUA 4XB2A 1LXCA 3W8DA 3ZW9A 3L9WA 4BIIA 3EK2A 5BT9A 4BB6A 5CDUA 4O1MA 5LC1A 1ZSVA 5ILOA 3EMKA 3RCBA 4CMHA 1A4IA 1E6UA 4MKRA 4PVCA 2WJPA 2YV1A 1R4NB 1T24A 3F5SA 4AJEA 1BTOA 3NAQA 4HUJA 5T8KA 3RAJA 3GGGA 2XPCA 5T67A 2NU6A 4WCFC 3HJAA 5A3JA 1GYRA 2YV3A 4CR8A 1CRWG 3TZQA 3BTUA 4MKZA 1EQUA 3A9WA 4JJGA 1XEAA 4ND1A 3K92A 3HFSA 4CV2A 4KWIA 4CMAA 5TT0A 2DM6A 1R4MA 4JQCA 3T7CA 3WSVA 3OQBA 4FQ8A 1QG6A 1X0VA 2BH9A 4FOOA 1U9JA 3NUGA 4BNHA 1NQ5A 4D45A 1Q7GA 4PRLA 5IN4A 3ZZNA 1NFRA 4GQAA 3RC7A 1I33A 4NJMB 2X23A 5FF9A 2W2LD 1NHGA 4PG4A 2RAFA 1E0DA 1QV6A 4L4SA 2UAGA 1BSVA 4XGNA 1Z7BA 2ZB4A 3DO5A 2D1YA 4E5NA 2O3TA 3DZJA 1C1XB 3P2OA 2EWMA 3N7UA 1E5QA 1P44A 3RFVA 5CDGA 5DBFA 4CMGA 3OBBA 3F1KA 2DTXA 4PLTA 4DC0A 1E1LA 2Y1OA 3KB6A 4PLWA 4EEZA 3OJOA 4R5HA 1QMGA 1GYQA 4GLLA 4E2XA 4EUEA 3OHSX 4FFNA 2EJWA 1PWZA 1NQAO 4E2ZA 3HWRA 3WOHA 3ZNPA 1GFSA 3DBLB 1YQDA 1BXKA 3QVWA 3VPSA 3MTGA 1PZFA 1TI7A 4XCVA 4RZIA 3ONDA 2IE0A 2ZYDA 4M89A 2HO5A 2HRZA 1GTMA 3UAGA 3M2TA 2AEMA 3ICPA 2YYYA 4W9NC 4QFCA 2EW8A 4AJPA 4KUGA 5DP1A 2JAHA 2HK8A 3OIFA 4TRJA 3PLRA 4BKQA 1V35A 3DMTC 3HNPA 3DB2A 3GN2A 3VH3A 3PHIA 4W82A 4RQTA 1UXJA 3B70A 3ZHYA 2NTJA 1PGPA 3RBXA 5CG1A 1ZMTA 1ENPA 2VUUA 2VRCA 3ST7A 1ZCJA 2H6EA 1UR5A 4ND4A 3ZNNA 3OH8A 4BQPA 3QP9A 4J0FA 3SJ7A 3LU1A 4ALJA 4N18A 3PHHA 4B4VA 1PS0A 4R5MA 1NM5A 4ZA2A 4AFNA 3I9KA 4HP8A 1SAYA 4FPXA 4XQ9A 3JD4A 1PJ3A 5FI5A 2W2KA 5MGBA 4XRRA 2O48X 3PYLA 4GVLA 4B4OA 4EUFA 4EBFA 4I9NA 2C20A 4U5QA 2D5CA 3L4BC 3WMWA 1F12A 4BQRA 4INAA 1C0KA 3KUXA 3AY6A 1YONA 4UVEA 3AOEA 1ENZA 4BGVA 2C59A 3DEYX 4YQYA 5TGDA 3VDRA 3RC1A 2X8LA 3ASVA 1IE3A 5A1TA 3GRKA 5JMWA 4IDFA 3C7CB 3E82A 2EW2A 4K26A 4Q3NA 3H5RA 4YAGA 3WNQA 2YDXA 2HSDA 2EIHA 2HMVA 2B4TO 3EZYA 1E7QA 3IMFA 2P4HX 2VQ3A 3CINA 1U5CA 4Y6SA 3AUAA 5GZ6A 3DZHA 4PG8A 2NVBA 3ZHXA 1G6KA 3HB4X 3OIGA 3AI1A 5F5NA 2E49A 4F46A 3QE3A 1Y5RA 4URFA 3RJ9A 2YW9A 1LLCA 5G4LA 1E7WA 4U0JA 3H5AA 4M49A 3NGLA 3FR7A 1ZFNA 1E3WA 3WXBA 4OKIA 4II2A 4II3A 2D4AA 3SLGA 3GF4A 1QYCA 5EPOA 2OGUA 4DRYA 5L7TA 1HSZA 3LT1A 1E7SA 1GQQA 3LQFA 1MGOA 4PG7A 4R16A 3C7DB 1TA4A 1C1XA 1CDOA 4FCCA 4Q3DA 3ZWCA 2WEKA 1YOVB 2BD0A 3AW9A 1ISHA 1P9LA 4RLHA 3EUWA 4BMVA 4MP6A 4ZN6A 2NU9A 4CL8A 5JDCA 3FBGA 5TLSA 3QVXA 4FJ0A 4L4XA 5A04A 5KTKA 4R1SA 1U5AA 3DFZA 3Q6IA 3AUSA 4R41A 5TSDA 1Q0QA 1C1DB 5KVQA 7MDHA 4IIVA 3U62A 3W4KA 3GHHA 5CG2A 3S2IA 1ZEMA 2W2LA 3ADPA 2IYPA 1L1FA 5HWSA 4DVJA 2FHSA 1PX0A 3GZNA 4IS2A 3U49A 3IIEA 1B14A 1PZEA 3O4RA 1UP6A 1NQOA 2EKPA 1N5DA 4R9RA 5AYVA 5CDSA 4AJHA 5AXAA 2YDYA 1SC6A 1YXMA 1H0KA 2HK9A 2HU2A 3FF4A 5DCWA 1Y9AA 3DL2A 3MZ0A 3P2YA 1RM0A 4DC1A 1NX6A 2JCYA 3MCVA 2JD2A 2JD0A 5JYEA 1YOVA 4WEOA 3U9LA 3BZUA 4WECA 3ABIA 4BNMA 3UCEA 1W73A 1QRRA 3O38A 4JNKA 3NTQA 2V65A 4JIGA 1XA0A 1MG0A 3OEWA 3HDJA 4A5OA 4NFSA 1XQ1A 2I3AA 3K5PA 3JCZA 2FWMX 4J7UA 4YJFB 3ZU5A 1V0JA 1ISJA 4U0KA 1DLJA 2Q50A 4YQZA 1P1HA 5A9RA 3PJDA 4LSMA 1YL5A 3I3OA 3WGGA 3JQ9A 4QO8A 4CQLB 4BNUA 1JAXA 3WSWA 4YJHB 4NBVA 3MJVA
chains in the Genus database with same CATH superfamily
2EZ9A 5EMKA 3ROXA 1EUZA 2PNJA 1FZTA 3TO5A 2PZAA 3F6BX 4JBIA 4PQRA 1ICIA 2VZ9A 4DEXA 3T12A 3ND7A 1UQRA 1VCHA 4MVJD 1MH9A 4TTJA 1J39A 2J4CA 4M21A 3OX4A 2WUDA 4MCIA 2GPJA 1G4UR 4G4GA 4R2KA 1D1SA 4JB0A 1WCWA 4C3VA 2RE8A 1TCBA 2GZSA 4MVJH 5HF5A 4MLCA 3CW2A 1DBRA 2PGJA 2P3QA 2O1XA 1CY6A 2RI6A 4EIWA 2DPYA 1UANA 1XV5A 4WLUA 5LNK6 3EIQA 4EGCB 2ONKA 3KSRA 2AC4A 2VDOB 2YS7A 3ANNA 3G0IA 4HCJA 1PFVA 4LWZA 3V7UA 2EBFX 3FWNA 3HCOA 1S96A 1PRYA 1U99A 1Y5MA 2IZ0A 2B9VA 1CUGA 4U8GA 1N0WA 4QVGA 2FZ4A 2GX6A 4QBHA 5IVIA 2IYOA 2W2OA 4NENA 4R1LA 5GAJA 3W7BA 4LJ9A 3GLGB 5JRDS 5IHXA 1HMYA 3KVYA 1Z33A 4YT4A 1JDUA 5JEEA 2HIHA 1DXOA 3PP8A 3OF2A 3V7FA 1S0UA 4UBOA 5C52B 1DWOA 1JQJC 2H48A 3QBVA 1A9OA 1HE5A 4JLBA 5BMVA 3HCEA 2FUNB 3RC2A 1AZTA 1V11B 3WDLA 4LNUA 3RS0A 4YYEA 1COWD 1YMUA 1RAEA 1ZS9A 2G9ZA 4RPJA 1QGUB 3HKCA 2IP2A 2E5WA 4IRXA 5TJHA 1WMBA 2R2GA 3RHTA 4YCJA 4OK5A 1FVFA 4GH5A 5K0SA 3VYWA 3H7AA 4BO4A 5B2EA 1X87A 2IRWA 2FDRA 3P20A 3OU2A 4HEJA 4CF4A 2HD4A 2HHAA 4OHKA 4HWPA 1WXGA 2GR9A 2ZAOA 5CPFA 5AKIA 2NPOA 4D8TA 4PICA 1HX7A 2ZJYA 4E03A 2P9FA 4G5FA 5HKBA 3IVGA 1TPZA 3IP6A 4F2DA 2WAOA 4FI3F 4GM1A 4R1UA 1JNYA 4G0QA 2PT7A 4LHSA 2WTEA 4RCVA 3R7AA 2LCQA 3VSCA 4G07A 4DYVA 3WB9A 1NJFA 1UPTA 3ONNA 2AQKA 2FQQA 3DSRA 3IAXA 1P0FA 1SVLA 5ESXA 4JC4A 3ZBUA 3R3ZA 4TXNA 3I6YA 1YO6A 1F6BA 1N75A 3EXIA 3GLHB 4BQIA 2HH9A 3ZBPA 1J8VA 3QY0A 3UEOA 4F7DA 2VF8A 3A8TA 1N1MA 3BB3A 4Z0NA 3DGFC 1KH3A 3AM5A 1LEHA 3GLQA 4WD3A 4P4NA 1ES9A 3DCYA 4IWXA 3E8XA 2FV8A 2G63A 4N3NA 3ROTA 2LWIA 5C37A 1GJRA 3WK8A 1XU4A 2QUJA 3Q1LA 4N6GA 4QULA 1YL6A 4QZVA 3MS4A 1YB5A 4WZAA 1USVA 4GE3A 5GOZA 4CQMA 5CYOA 4ENRA 4RPHA 1QMPA 2Q4BA 3FHOA 5AM0A 1FUYB 3IKLA 3RUFA 1WVGA 3W4JA 1PYGA 3C15C 1UM9A 3OE7D 3QKIA 3IR5A 3RAFC 3B3QA 1Z6GA 3FYUB 1E94E 4Z8YA 1KAOA 2IUSA 2D5BA 1XN1A 3G9QA 5ALLA 4G37A 3KEQA 4QPPA 3AY3A 3NC4A 4JROA 4BBPA 5BWNA 3LDHA 3A6EA 1PR9A 2FCRA 1X3LA 3L79A 4UE3S 1VTKA 2XNJA 1SZJG 2IYRA 3OZGA 1SC9A 3V4PB 4CE6A 5H81A 4MRRA 1K6IA 1KJNA 2E4YA 2PYIA 3FRJA 4R9NA 1N0HA 4E5SA 1DKNA 4XWKA 5HUHA 2GZMA 3EZ6A 3QI2A 3ZH2A 3R9IA 2ZRDA 1T9HA 2X4DA 2ZCVA 2UV8A 4BNGA 2QAJA 4LVNA 5IJWA 4NBNA 1L2TA 4FBLA 4DARA 3NT2A 5I48A 2E1RA 5JY1A 4Z3DA 2DQYA 4ABYA 3PXXA 4LSWA 4C6HA 2QPLA 1VJCA 1E2JA 2XITA 3P2JA 2H92A 3KQMA 3L05A 4CKEB 3WLHA 1SEVA 2C4KA 1SHLA 3HUEA 3DWEX 5IMBA 4XJTA 3VKUA 3JR3A 2YRXA 4D8XA 5KWEA 1GL6A 3LBNA 2EEZA 1YQWA 4FXOA 3X1JA 2VJNA 1Y1KE 2XYRA 1N33B 2QRMA 3NYWA 1IRIA 3ACDA 3E23A 3KNZA 1CF2O 4EQZA 1EE2A 1UC4B 1ZUNA 2B1RA 5FWDA 1XCMA 1H8ED 2IKQA 3ROPA 1QPZA 5K3OA 4F2WA 2YV2A 4FYJA 1U2DC 3PR2B 1S2IA 3HSSA 1YC5A 1KK3A 3MJ4A 4K9PA 1EFVB 3OLZA 4XSGA 4HVLA 2ET6A 4ZYLA 1GHTA 1II0A 2JVIA 1UOOA 4IGEA 3ZGVA 3GEPA 1FFBA 4W5JA 5TIIA 4BWGA 1BWSA 1GGEA 3HLYA 3KUDA 4B8ZA 2VQDA 3HPQA 4C0SA 4QODA 2C58A 1HTBA 2AD5A 2IHYA 5BQFA 4B73A 3NVMB 1UL1X 1Y7LA 1JT2A 2JEOA 3GV0A 3JPYA 3LLCA 3P9IA 4RTMA 2J9YB 3LRXA 1L0BA 2BEWB 3THYA 5AI5A 3FWKA 4O4HB 4AP5A 1Z4OA 2VXBA 2I3DA 1T4CB 2L19A 2WZQA 3PNBA 2ALJA 3GGDA 4J76A 3HSYA 4W7IA 4AS3A 1Y89A 1F17A 4BX9A 4R2LA 2C7BA 5EYPA 4B8WA 3H9BA 1ZR4A 3UOWA 1T2NA 5B57C 1UDCA 2J32A 3DLPX 5HXAA 1SOMA 4JUCA 5I4KA 1Z4NA 1NPYA 2ZDGA 4ZWNA 4OQQA 3TQQA 4JJFA 4B7ZA 4DABA 3WWDA 4ZZ1A 3QKSA 1TYDE 1CUXA 1HI9A 4JBGA 4O29A 2XLCA 5FL7D 3IRVA 2FWIA 4BRUA 3TOCA 1U0SY 3WO1A 3IV7A 3ROGA 5I8PA 4WTOA 2AN5A 1QPBA 5FHRA 3GLTA 4JI6B 1C3JA 1PJQA 3IALA 5GJCA 4CR6A 3W5DA 2X7HA 1HNXB 1DRKA 1E18A 2DSTA 2B25A 2YJ5A 3HB9A 2VJCA 5J3JA 3A6PC 1W8DA 3L6DA 4KN8A 4RZ2A 3WGQA 4DA4A 3B1JA 2QY6A 2Z1DA 4GBGA 4HNRA 5CNKA 3GZTB 1BX3A 1DL5A 1E1QA 1M2NA 4CIDA 2GARA 1HT3A 4JLPA 3CO0S 3DLCA 3TZEA 2X1VA 2QTZA 1G98A 3RUDA 1Q12A 5A3QA 1D1TA 4J4BA 3RSCA 1TLTA 4E5KA 2IS1A 2B92A 2GZ2A 1JSLA 4MUYA 4PSUA 2NG1A 1PJZA 3OY2A 4HAWA 2P65A 1M6WA 1YTLA 4JC8A 1CQZA 4ZCPA 4FM9A 3F67A 4ER7A 2ZBFA 5FUXA 4DPMA 1NBEA 2WLSA 4CMEC 2HA4A 1FNMA 2CXSA 4WSOA 1YHYA 5I7OA 1J8FA 4DILA 4OH1A 1O94C 4PR3A 5A4IS 1LK7A 4ZI5A 3H1EA 3IAM1 4BTEA 2VK2A 3GUZA 4G4JA 4RGQA 4EB8A 2PN1A 3LCRA 5HZKA 5BXQC 3AFHA 2DY0A 2XUHA 1JBKA 3KKQA 3K0FA 1XT6A 3EYAA 4UKDA 3CNEA 2NACA 2Y1EA 5F1KA 1U31A 3OMLA 4M6WB 2YVUA 3ZEAA 2QRUA 3BRSA 1UT8A 3IXMA 1DVRA 1YR2A 4HDRB 1MOPA 2V6JA 4K6CA 1X1BA 2QTCA 1P7WA 2AFRA 1V6SA 2POQX 2XNCA 3EULA 3MS2A 3RYCA 4IQFA 1RXVA 1RM5A 1LLDA 5HOEA 4IGFA 3KQUA 2YJ6A 1FSFA 4ZYZA 1FSPA 1CEYA 3TRIA 2FLVA 2ZEJA 1GZ4A 5IC5A 1A2KC 5CGQB 3WZMA 5EJGA 1BU8A 1Q0PA 3L41A 4NJEA 4AO7A 3DXFA 1L3IA 5F52A 3RG8A 1O4VA 2H8GA 3RAGA 4AF6A 4WT7A 1JPUA 3MB8A 2YICA 4FFBB 2IWRA 3K71B 5KNCD 3JQAD 4RORA 1SU4A 2R6ZA 4FQ7A 5EC8A 3SEQA 5BNZA 2OCLA 1W9MA 4W4TA 5CFOA 1KBQA 4IIXA 1XKLA 5TRTA 3CR8A 2PZJA 3GJ4A 3F97A 1YKFA 3AVTA 3JY6A 4AG5A 1W5AA 2XMPA 1QYIA 3AVPA 4I8DA 1XQVA 4MMZB 1E3IA 4GBMA 1KO1A 4LHYA 4LZNA 4BE4A 2JS7A 4HPXB 4R2HA 1XQ9A 5JCJD 3DVSX 1EGAA 1VIYA 3DEJA 4JK3A 1L5ZA 5EXXA 3FM9A 4LXIA 3VO8A 4CG0A 3OA2A 1E5DA 3NKFA 5DIZA 1LI5A 1O97C 4F5WA 2GCIA 1B1CA 2NO0A 3W5CA 3BFPA 4EAAA 3LLSA 3WV4A 2DETA 1UBHS 4D9MA 1A9RA 3OLYA 1CNFA 2BEWA 3THYB 1OH7A 4DKXA 1H42A 2PJZA 4L9RA 3WJ2A 1AXEA 1NF9A 4MVJA 3W2IA 4YRRA 3SM3A 4WBNF 2H9IA 1MOQA 3EFOB 2WTBA 1P17A 3LA8A 1ESCA 5AFSA 4RK5A 2C97A 3IDAA 1PZNA 3BIOA 2WLTA 2FFAA 3QF4A 1XTIA 2WT8A 5F9MA 4GSYA 4OV6B 4KDCA 3KQHA 4G1CA 1D5CA 4LFAB 4JUIA 1V8ZA 3FUTA 1NUPA 1UJ6A 1Z5UA 4FSXA 1AQUA 1UKVY 1TM7E 4NBRA 3QG1A 5DYNA 2ZRNA 5HEKA 2M6RA 1VECA 1E4OA 3K72B 1QLHA 1ZDMA 4Q1DA 1C7IA 3DD1A 1A76A 3VX4A 2AUMA 3K3PA 4Z9XA 4Y1EA 1OX6A 1DP4A 4AYWA 2AFHE 1YQXA 1CZUA 2CGEA 2OSVA 4J1SA 4JYBA 4QEKA 1DADA 2WHQA 4Z4IA 4KR3A 1DRJA 2H2DA 2LRHA 4BFXA 3TK1A 1T6YA 4MS1A 5J4LA 4CKBA 3ZK9A 4UHHA 1Y6GA 2C8KA 3QX8A 1NBMA 1EHYA 3Q1KA 5FRDA 5K0FA 3R24A 3AGPA 2WJAA 3CRQA 4E51A 5KYYA 4QT4A 2J7PA 1SUIA 4WBXC 1F8YA 1XAGA 3CA8A 3A25A 3TTVA 1OHHA 3VR5D 2J5KA 3LXRA 2IUTA 2HU8A 4FSHA 3L8CA 3B6ZA 1MXFA 1THZA 3ZLVA 3R41A 2D2IA 2V9ZA 5CH5A 1Z39A 2BV3A 5CURA 2FEXA 3HV2A 7MHTA 3OF3A 1WHSB 3V42A 1KJ9A 5F7ZA 2O50A 3V55A 3QV2A 2BIFA 4YYZA 3ZDBA 4D9IA 1W59A 1RQXA 4EPRA 4V3CA 3I1JA 3TX6A 3ZV3A 4AS1A 3KD3A 4KWHA 3QLUA 3AJ8A 5T8KC 4GT1A 4BEJA 1FS6A 5SYAA 3VPXA 1I6WA 2VHQA 4MV8A 1TM1E 3LI2A 2XD4A 3O8QA 1K0UA 2OK7A 2AH5A 2V3WA 3AU9A 3SOPA 3ZWPA 4O25A 4Y7DA 2QRVB 2HWYA 5FR1A 5DM60 1IQ0A 2JZNA 1FB5A 1R27A 1NASA 2MHCA 2RDMA 2VYFA 3KXLA 3LUKA 4MLZA 4EKDA 3PUHA 4NQZA 4ANFA 3LC2O 1NSTA 1UBMS 4YJDA 4D3XA 3H3XA 1QRTA 4Z54A 1UP7A 4MR7A 4F6LA 1B2LA 1G7RA 5LB2A 4AMBA 1U6IA 3PEWA 3FKQA 4UHCA 1WKVA 3QGMA 2OV1A 5CD1A 2FPUA 2J09A 5FULA 2CLFB 3U4IA 5JSKA 3UKDA 4YC7A 5FLXA 4DLAA 5D84A 3RFCA 3ZDDA 3U3OA 4R1OA 1LPPA 3F73A 2Y99A 3A0UA 2FRDC 5K03A 2GF2A 4DDKA 2AMYA 3SD7A 5EIHA 1AK2A 1NDUA 4NU8X 4X3OA 3K0BA 1QFYA 1TYZA 3LLUA 2J48A 2ERYA 1VE6A 5JBQA 4NYIQ 2IXGA 4R3WA 3RK0A 3UMFA 2QTHA 3JQBA 2J9RA 4NBLA 3A1TA 5F1YA 1IY2A 5I7HA 1WY5A 2XQKA 4BJ5A 3OA0A 4JUDX 2IE8A 2CEAA 1YQUA 3PFIA 1TIKA 1A8SA 2PQ6A 4YR9A 1BXZA 3FNHA 4H60A 1XRQA 3JWJA 1K97A 1UKBA 2VT2A 5BW5A 2FB9A 3EHDA 1H3EA 4P92A 2Q9UA 1XHFA 3CE9A 5LQAA 1I3MA 4WNIA 5B4VA 5HZMA 1GUAA 5C3MA 1PSZA 2Z5LA 3NEYA 4ESHA 3O7WA 3FVWA 4F56A 1NNLA 4FHDA 3C6QA 4RM3A 4A6XA 1DIGA 2RCYA 3PTLA 1IQRA 4O4HF 2C98A 2GM9A 4D8UA 3I9NA 3BMXA 5EJ7A 3BH0A 4P3KA 2HCRA 2H54A 3VAZA 2JJ2D 5DNCA 1F1BA 1FRFS 3GNLA 4MITA 5LFAA 3WJAA 1CS4C 4FWIB 1Z5WA 3PRJA 1GZ6A 4G5YA 2PR2A 2ONJA 4BQEA 1A8IA 4NOMA 5DEOA 1IBMB 5EIBD 3ELYA 2QKYA 2HZ7A 1FJXA 5G2OA 4GLOA 5AOBA 4Q05A 4M1OA 1MPXA 1YVDA 3NTLA 4HZGA 4LDJA 4MUNA 1XROA 1A2QA 1XRJA 3PFBA 2N1BA 3O8BA 5T4BA 2O0KA 4M37A 3AHDA 3IEUA 3HSKA 4OBXA 4F8YA 1LWNA 3NHLA 3WAKA 2UU9B 2XYVA 4CF5A 3D3EA 3EG9A 4GGPA 3GNSA 3E9QA 5EKXA 1NKSA 4QQNA 2ASVA 4RK4A 5CMLA 4J94A 1UH5A 3LOPA 2P91A 2C57A 3GT7A 5FOTA 4OB6A 1KFBB 1VLHA 1WOYA 3VKGA 3GD5A 3MOGA 4PSDA 5DHTA 2LW7A 2AFIB 2IJGX 2B36A 1OTXA 2VR1A 2FN3A 3L4SO 4FYKA 2O3RA 3SFVA 1IUKA 3ICOA 5AM4A 4E3ZA 1Z3IX 2XWPA 2C9BA 3AEUB 4RFSB 4EHDA 1LS1A 4HO1X 4Z9BA 3QPUA 4JYPA 3SZRA 1QIHA 2G5CA 4MAMA 1G63A 1KMHA 1W29A 1Q5PA 5I47A 1RXWA 4F91B 1BNCA 1KYIA 1XEWX 3BIJA 3GP5A 5CDTA 2JHFA 3KJQA 4TLEA 1M6VB 3HG7A 3L5OA 2WSSD 3TLGA 2CVOA 1FXSA 3PNYA 3LUJA 1TKBA 4MJXA 2PY6A 3EBPA 5JBIA 1P31A 2L0XA 3T7EA 4AJ1A 5BYAA 1AK9A 2PWBA 4UTXA 2YX1A 4KH1A 3EJ6A 4HR7A 1NR7A 1O77A 2FSUA 2PYDA 3GJYA 3PSAA 4C87A 4CQNA 4WASA 1DG3A 1CQJB 4F0JA 3PFFA 4DA8A 5LXTA 3RRZA 4NAUA 3DL7A 4CFYA 4FI3C 3KR1A 4MICA 1R8SA 2WHXA 5C1PA 2M6SA 3BDIA 3ZDFA 4A7PA 2CXQA 2WF8A 3W79A 1QH1A 2QB5A 4Y6OA 1C4KA 2G77B 2HHCA 1D2NA 2IZ6A 2Q21A 3TI9A 1ZO8A 2AUNA 3JSXA 1A50B 1QTNA 3SEZA 1YC2A 4XPZA 3QA9A 4RPKA 3Q3CA 4MWDA 4OQDA 1NDHA 4JY7A 4DMUB 5KVCA 3VC7A 1KR2A 5KPDA 4X66B 4WAUA 4GD3Q 4S35A 4UMDA 1QGDA 1R5BA 4KQCA 4ZALA 3SQNA 3NDIA 1RSZA 3LF2A 5FWXA 4YHHB 2BZGA 4C0LA 4TN5A 5D3MA 5AOCA 4Q03A 3LA6A 5CDYA 3DXZA 4UARA 4YASA 1OMOA 1Z2EA 4G0YA 4NYMQ 4TKZA 5FB3A 2IV3A 1G5FA 4X64B 4YHBA 1ONOA 2NYUA 2WOJA 3DZKA 5EKUA 1UZAA 2XQVA 1V8FA 1XKTA 5EHGA 4CWAA 2ZRCA 2ZIXB 3PUKA 5T3YA 2XR1A 1GOTA 1Y3HA 4DUGD 1WW2A 2PD4A 2J0UB 1T9GR 2Z5VA 4X7PA 4H2DA 2GUGA 4UUOA 4Y2UA 5K6AA 1PBNA 5ES3A 1N9GB 1V9LA 2V4MA 2HEIA 3V6MA 2EXXA 2ZI7A 3PG5A 5C2JB 4OTZA 1NXPA 4PZPA 4NI5A 5A0VA 3BA1A 4OB7A 4Z99A 1L4NA 1DTWB 3U13A 2G5GX 1MTZA 3RUIA 3QZUA 5DBIA 2EKBA 4NJMA 2EF1A 1ZVVA 3AHEA 1JLRA 2GCOA 3S28A 4ERNA 2OESA 3I9OA 1KSFX 3UK6A 1T3GA 2FFJA 3MTBA 3KJIA 4C88A 2VPWA 3HJNA 4AUKA 3A4YA 1CG6A 3A6JA 2W11A 3DM9B 1RLJA 1T0UA 3B1FA 1ST2A 3P2KA 3OUTA 1JAZA 1LV8A 1AM4D 4U5XA 1T34A 4PAQA 2BSQA 1QHNA 4N5MA 2NSJA 1DO8A 1W1WA 3P45A 1CF4A 1E2DA 1Z38A 2AG1A 2HNKA 1E9VA 2OZKA 2ZYIA 2DFTA 4R05A 5DLPA 5A3SA 1GAJA 3FOWA 4LF4B 3C98A 3CLTD 5EE5B 1VLQA 3PITA 4TV8F 1RIIA 1AQ6A 1IXKA 1NMXA 5F2NA 3U3RA 4MW0A 2VDRB 4M83A 3V6LA 1K75A 3IA2A 4OF4A 3W5IA 3ZHRA 3OOWA 4YMUA 2HDWA 4N8DA 2C9MA 2WM8A 4OJKA 1NVWQ 4MV1A 2AUTA 3CLRD 5TQVA 3TIVA 1U0NA 3PWZA 2ZCJA 3C8MA 3NNNA 2NOAA 4Y7CA 7REQA 2WQZA 3Q11A 1ELOA 4LRSB 4NZPA 4XLLA 4N5IX 3H13A 5FAKA 4TLBA 1EK6A 4CLEA 1QONA 2YWXA 3OZDA 4TSFA 2VL7A 1NUAA 3AVOA 3B9BA 3O74A 3C1AA 5DSTA 1KMNA 4A1OA 1NBOA 2C2ZA 4EYOA 4KW7A 5KYVA 4XWOA 5L40A 4YRMA 5EJ4A 4E15A 1XNRB 1UZUA 3LD9A 1P3Y1 2OMKA 3ICVA 1NHWA 2Y0DA 1GQSA 1ZOLA 3NKLA 3PD1A 4TKMA 2XJ9A 2PX8A 4UHFA 2IYWA 2QNBA 3E9RA 4E2YA 2HWKA 2A0YA 5JT1A 1JLLA 3E84A 4I4TF 4ZVRA 3H42B 4B2YA 1G18A 2EZUA 4FUQA 2ZTVA 4LHXA 4QUDA 4ZDJA 621PA 1IMOA 5JG7A 1DKMA 3DVAB 2NZUG 1C2TA 4QC2A 4R69A 1I30A 3UC9A 4CNBA 2WYHA 3T41A 4CR7A 4CDNA 4DV6B 1JS1X 1SCNE 4FOLA 3T7KA 2GAJA 3VI3B 4MIOA 2ZLBA 1T0JB 2F8MA 1GFZA 3ETHA 1S2NA 2JFQA 3OZIA 3PC4A 4V3BA 5EUMA 5IP5A 4CRWB 5JYBA 4JEHA 3NIBA 3RSOA 4FN5A 1RWPA 1A72A 1M2OA 1Z68A 4PHCA 4FB5A 3FZYA 4KPEC 1H93A 4F85A 4JYZA 2VHTA 4C4XA 1QRUA 2E21A 3ROKA 1R4AA 2OC9A 2OXIA 1ZJJA 4H9GA 8AT1A 5AICA 2QW8A 4NCNA 4HFRA 4AO6A 2P2YA 4OXQA 5D1NA 4O2BF 1FCJA 1RLIA 4AY5A 1LJ8A 3DDUA 4LRXA 1H6AA 5C5IA 1RWMA 4XWWA 4HXGA 3G79A 4LOHA 5CGZA 2FOIA 4OEHA 2CFOA 3VPBA 2JFGA 3B6IA 3C8UA 5HJ2A 1MDBA 4RPIA 1BDHA 1MB0A 3S8YA 4TKVB 4ZODA 4BBZA 3IHLA 4ESOA 4TV8A 1ISMA 5DMXA 2X5KO 4GKVA 5IDYA 4K6HA 4IDGA 5LD2B 2C04A 1EEHA 5JCJA 3P32A 3RABA 1N57A 4A5SA 4C06A 3BF8A 1OKKD 3N0VA 3RUPA 1CUYA 3GPCA 3IULA 5CH3A 4LYHA 2ADMA 4H7HA 2OYRA 2IH4A 1TQDA 3H6KA 1U0FA 3CW8X 3D6NB 4MGZR 1QLWA 5G3ZA 2PMBA 3QY9A 2WWTA 2Q9CA 2XQIA 5FV4A 2QENA 3FI9A 4CM8A 4L5YA 2PUDA 4XW2A 1V43A 4D96A 3A04A 4YA6A 4BNWA 4YMVA 3GA5A 5ICSA 3DBIA 2MR5A 3E22B 5AP9A 1JFTA 4YP6A 3URKA 3IEMA 2DTDA 1WG8A 3RIMA 2ZRBA 1L7DA 3N8GA 3C5EA 3W5SA 1E1NA 2BCGY 1QOPB 4RY2A 2PUTA 3W3AH 5ERXA 2RGBA 5BWLA 4AJNA 4KL8S 5AW6A 4B0OA 3A31A 2GCEA 1LTQA 3DVQX 4BO8A 1Y1TA 4QBIA 4FYIA 2O7NA 4IIGA 2XUJA 1W4ZA 5CVTA 3LXMA 4P34A 1Y34E 2PZLA 2Z3WA 2H4XA 1TO6A 4HDAA 3K16A 1R3UA 3F5FA 2NIPA 4LY0A 4UFNA 1CQIA 2NN3C 1B6SA 5FKJA 5BNFA 2DHCA 4Y6QA 3U4GA 3R3VA 1QU3A 5E38A 2G80A 1A88A 1K86A 1YDWA 1JDVA 3D0KA 4K8RB 1NXQA 1MFZA 2QX6A 2BFMA 2R8ZA 3H5NA 4LDRA 3C3YA 4ITUA 4LOLA 3L77A 3H1TA 3FUVA 1WP4A 2XMSA 4U6SA 3FYSA 2CV0A 2WJHA 2FF7A 1P4RA 1GG9A 3UGTA 4D7AA 1NVFA 1BWQA 4ARCA 1UJMA 5AHWA 4C2BA 4ZV4A 1N2XA 3K0CC 3RVMA 1S3SA 4D6YA 5LOVF 4KREA 5AW4A 3SZOA 5EFZA 2RGNA 1P7PA 1NN5A 5ULLA 4BB0A 1XZHA 1AC5A 2FN7A 3MAAC 3THXB 2QWXA 1DWQA 4ZZ2A 1U2GC 2XH8A 5BORA 5A62A 1NKVA 1XEXA 1V7CA 1T36A 4Q1AA 1UZNA 4J4TA 2FFBA 2ODWA 3MUFA 5T41A 4EPWA 3GP8A 3TNJA 4MKHA 3WIOA 1QKJA 3B6JA 4GX1A 4O4IA 4CIWA 1NVAA 1G1AA 3MK31 2WU0A 3NIDB 1Z2NX 2WYIA 3P96A 4MAFA 2WIJA 1TQHA 4MVJE 4OXKA 3FPSA 5K8CA 3PBKA 3KZNA 3WGLA 4G23A 4YQEA 3O0DA 4EB6B 3QYAA 4IBOA 2VPQA 4G97A 3PT5A 4YXWD 3WRXC 1GRVA 3HPRA 3R7WB 3JYOA 3KL4A 2WIGA 2O8EA 2JLVA 4Z0TA 3M5PA 2QN8A 5LLSA 4JOBA 2VPYA 1CR0A 1O5TA 4KQHA 4TWRA 2RGCA 1M1ZA 4OP3A 4TL7A 3RIXA 4DMMA 7REQB 2DPXA 5IJXA 3CRVA 4WNAA 2D1TA 2C84A 4UJ5A 3WQBA 2VP9A 3WLJA 7AT1A 1TZBA 2VTBB 4V2UA 3U4QB 4JKYA 5HKLA 1TECE 3LHDA 2LZ0A 4J1QA 1AV6A 3RQIA 5DE3A 4KFCA 1L5FA 4O0LA 3HWWA 4E4TA 2ZTLA 1C8BA 1P2VA 4ID9A 3NI2A 1ZCBA 3WIDA 3ZCXA 4TYPA 1V8BA 2JFZA 3X1WA 1B7GO 4POAA 2R5NA 2I6UA 2BM9A 3D3KA 3JALA 1YHZA 1DIHA 1J5PA 1T36B 2VO1A 4UQPA 1JA1A 2GA8A 4ZOCA 1A0OA 5DJ5A 4TL9A 221PA 1XRLA 3UJCA 2ZRKA 3OQVA 1A97A 4M87A 4O4JA 1BHO1 3FHCB 4KQXA 5IAKA 3TZLA 5BV0A 1E0AA 3TL2A 2OM2A 4TKUA 1E2NA 4FYWA 1G21E 4EI2A 1PVDA 4GBJA 4GHWA 1U90A 1DX9A 3T7DA 5J2UA 3UUGA 4MQEA 3INGA 1K7EB 4KGDA 5EAIA 4WVLA 3ZNQA 4LF7B 4QQFA 1RD4A 4BAGA 4BP8A 4ZOLB 1TTPB 2VP3A 3A37A 1CERA 1DKLA 4RH3A 1WZ2A 2WG1A 3BD7A 3PQEA 1SEPA 3KT3A 1AO0A 3LE8A 1C9NA 5LDGA 2O2GA 3DOUA 1Q6YA 3O93A 2J4FA 1J99A 3ZIAA 4EF6A 3G49A 2OHGA 3EHEA 2X19A 3O0TA 1SC4A 3DKIA 4H16A 3DPSA 4M1EA 2CB0A 2Y9MB 1U7HA 1HF3A 3IP1A 4R2IA 4ZEOA 3S2EA 4JB2A 3FPGA 3LPCA 4HB2A 2PJUA 2XGGA 5J63A 1ZL0A 3ZXIA 4OQEA 5FNZA 3T9AA 1VKZA 4OM8A 3HQ4O 2PU5A 3A9TA 4YVFA 1LDMA 5B3JC 3FLEA 1CUUA 2OXRA 3FDXA 4NZOA 5E7QA 1R0BA 1E60A 1OREA 1O95C 3O5AA 4P08A 5B37A 1FQJA 1I2BA 2IEAA 3IUYA 3RB8A 2KQUA 4L8FA 2DRIA 2YJNA 1ZL2A 4CM6A 4B32A 5HM6A 1P1RA 3ISVA 4BNJA 2XCLA 3A6GA 4X1OA 5D00A 1ZVKA 2YFKA 3SZUA 4H31A 5DWQA 5KDDA 4LRTB 3S2SA 4DQUA 1N2CA 5LZ5A 5IXSA 4TKUB 2II6A 3G9TA 2IH5A 3VOSA 1VPTA 4G41A 2WSMA 4L0QA 3CFYA 3EQ9A 2B1JA 2B34A 3ONWA 2YHIA 4QTTB 1ZNWA 3U61B 4HGNA 1ABFA 3AXTA 3TR6A 4IOMA 4TYYA 1LUAA 3DXYA 3IEVA 2CFRA 1UIMA 2D1FA 3NO4A 1B3RA 1Y4AE 1VJ0A 4BNIA 4EHLA 1JI3A 1F5SA 2FVXA 1T6NA 3EASA 2Y1CA 3N58A 3N6XA 1AHNA 4H4CA 2FSVA 4YV2A 1Z6QA 4UUAA 2Z58A 1SC3A 1M2VA 1T10A 1X38A 3M81A 4QGAA 2H9AA 4EQ6B 1FRNA 4PGFA 2P77A 4GO1A 1PL8A 1K66A 3C85A 1ZXLA 1M1NB 1XTVA 1DJMA 4R8VA 4RVGA 4WFKA 3H1AA 3TJRA 1CRPA 5HKKD 2GEUA 1Q22A 3PHGA 4NCKA 2F1KA 2Z6UA 1E9BA 2E6KA 4JASB 5A4MS 4RQUA 3HDHA 5K3FA 1RC1A 4P86A 4FDUA 1OT5A 2HQBA 3RARA 1MVOA 2PQ2A 3B6EA 4IEIA 5HPYB 1OH8A 2FI1A 3ZV7A 3QE2A 1N7HA 3ZY6A 3W6OA 2I7CA 2JFVA 1VMEA 1LLFA 1OI7A 2ACVA 4RX1A 1OILA 1GV0A 1G16A 1N1DA 1RBQA 3HB0A 3LUAA 5KNDA 3DR3A 3IELA 2J3HA 2ENUA 3LYAA 4IJQA 2HMUA 1TKAA 4RF5A 3WV5A 4DMCA 4I6JA 1NKTA 3B38A 4YAFA 1E7YA 2BR3A 2QUKA 4BKPA 3H9GA 5ECYA 2WVHA 4NESA 4A4DA 5JH7F 4GZLA 3JARA 4BGDA 4RIGA 3H5TA 2RHCA 4LOAA 2L18A 2ZE8A 3GLSA 3G8DA 4KE6A 4QPNA 1TVEA 3U19A 1H4VB 1YBMA 1JH8A 1WUJS 1WZUA 2QI9C 4YN3A 1T2EA 5C80A 2BGRA 4ILEA 2VTBA 3WK7A 3SHQA 1EE9A 1EAYA 2JGIA 1NJSA 4CMBA 3P2MA 2WVGA 2XNKA 2XA2A 1BVRA 1BQ3A 3AP3A 4IHKA 4WXHA 4WY2A 1VKOA 5JS8A 3A3PA 4Y9SA 3RDPA 3THWB 3ZBTA 4BKRA 1WE2A 4CIBA 3ICWA 4QYIA 4IIJB 4EJSB 1IXYA 4B9AA 5EUQB 1J8QA 2RB5A 5MFPA 2C0QA 4TSRA 2BFFB 1XPUA 1IPFA 1GIAA 1XJCA 3A32A 1UBNA 2VRCD 4ER5A 2C88A 4N4AA 2BONA 4O1HA 3ITKA 2QD4A 2BOVA 1GDDA 3RADC 3E15A 5TQ0B 2YXNA 4DSUA 1Z5GA 1PJTA 3DT9A 4Y2GA 4J0EA 1WHTB 1A4RA 1YJXA 5FBHA 4D0GA 4LE1A 4HVCA 2QLJA 2QZJA 3UB3A 5I7EA 2AIRA 5AJWA 2GKGA 2XNSA 2IVZA 1C3OB 1VJDA 5EP1A 2F1HA 3P0HA 2J46A 2RJ3A 2QF7A 3PDUA 4IJMA 3KUKA 3R8XA 3ZE8A 4BDSA 2A1TS 2VT7A 3AQ4A 1N25A 2F3RA 3I4FA 1NLMA 4E1BA 4KR2A 2QN7A 1P7VA 1RAHA 3JAKA 4FCVA 4K3VA 1R0XA 2JFFA 3ENNA 3PEEA 4RS3A 4LJ7A 4XRGA 3T1YB 2FR8A 3CZ5A 1ZZEA 2CE7A 4KWEA 4MWGA 4KI7A 1JR3D 4M1TA 2PKRA 3QM1A 3R0JA 3QUCA 3TJMA 2Y3IA 1KEEB 3ZQUA 1XE3A 1XFAA 4XD2A 1SBTA 1X1AA 3LTNC 1QYXA 3DR5A 4TV9B 3UTDA 2YJGA 1QFMA 3OQ6A 4KXQA 1CIPA 2UZ0A 3U4QA 3QKSB 2RHMA 1AS0A 5GONF 1IULA 2C9CA 4I0WB 4GZ3A 3D0OA 1U3TA 1VL1A 1JG1A 3N2ZB 2OC4A 1MRSA 3A26A 3RIHA 1MFPA 3F3KA 5T5QA 2JH8A 1VZ3A 3ILSA 1EA7A 2IXBA 3N3BC 4LOKA 4JAVC 1DOZA 3OCYA 2VP6A 4HSGA 4PPGA 3RVSA 1SC1A 3AERA 3ED5A 2QTRA 1EEXB 3OTWA 3Q6MA 4ODIA 1K8RA 1QR6A 4U7WA 1X7WA 3FNRA 5GOTA 1HYBA 3E61A 2Y05A 3NASA 4C7MA 2QUAA 3FYTA 1PS9A 3OQMA 2J9ZB 1M10A 1EUCB 3W5VA 3MEQA 1PJ2A 4L4ZA 4RE5A 1KY4A 4EQ6A 3ZE0B 3WRYC 2X86A 2GD0A 1X70A 4PC3A 4B2PA 2PLAA 3DUFB 4MVJF 2H5EA 1M1NA 1E3MA 2ZDHA 4HQRA 4YP7A 4YCLA 1KVTA 4HZUA 4AYTA 3FZEA 2BFEB 2QRKA 2O59A 2EV9A 2E0IA 4DXAA 3COYA 2H7CA 4O2RA 2YOFA 3K8QA 3LBHA 1UMCB 3JQ7B 3GMIA 3K0HA 4L5BA 2WMDA 2QN9A 3EXFA 3PI7A 3VC2A 3GUVA 1D7AA 1ZICA 5AW1A 1CY0A 1OXBB 3TIGA 4CM5A 1YE3A 1GQRA 4JFAA 2J3LA 3I28A 4AG3A 1P3DA 3W7VA 3W1EA 1ORTA 3ZUPA 1ZEJA 4OK6A 5ILGA 5E1MA 3LBAA 1Z06A 2H1VA 1ECGA 1CFZA 2VPXA 3TBKA 3RWOA 4EK9A 3DBRB 1ZJ4A 3ECAA 1N3IA 1JHVA 2XUGA 4IIBA 4E07A 4G5SA 2IT1A 3ORFA 1X7WB 3ZGNA 3NRBA 4Q24A 4EYKA 5KVVA 3F71A 1O8BA 2YQZA 1NYRA 4ZICA 1SBNE 2F8LA 5JNUA 2O0HA 2A3NA 1D2MA 1OWOA 1U8XX 3L7BA 1UK7A 4DUZB 2C9OA 4CMJA 5JNLA 4PSVA 2J3QA 2VOEA 4QD3A 4KSCA 3WIBA 4WN9A 3CVVA 1SB8A 1PX2A 1GCGA 3ACBA 3HY4A 1FL9A 1GA1A 1XDWA 4CEJA 2H4YA 2QSYA 2CFTA 5DCUA 1U0RA 2AJTA 5LP6A 4ZEXA 3K6RA 2RGYA 1W4BA 1WVMA 2HPAA 3LXXA 3BSWA 1CJKC 4YACA 5DYIA 3VFDA 4EJSA 2BM1A 1NVEA 3E81A 1E62A 1KYTA 3OMXA 4IWNA 4UTZA 3EIHA 5CLQA 3PC6A 4OXXA 3MCWA 4MUFA 3NT5A 4GS5A 3AOEC 4F2HA 2O2EA 2CXUA 5EMJA 2H85A 1L9KA 3A1VA 4G09A 1VMKA 4NDNE 4V0SA 4OL0A 2CNNA 2PS0A 2V7QA 3R09A 3SXPA 3OPXA 2FEMA 4D79A 1FF9A 4LEIA 3R6LA 2GCPA 3K09A 1MLDA 1RMTA 3DBRA 2QN2A 3I1IA 2X22A 2W43A 4BNYA 4C7OB 5JALA 3OM1A 1Y4DE 3ZYZA 3H04A 4MWSA 1PT8A 1QHIA 1HTWA 1NM5C 2XEXA 3EQ6A 3PSHA 5JNWA 5JWRA 4WV3A 1GPUA 1YIOA 3OQ1A 2XEDA 2V5VA 4Q4AB 5C7LO 2UUBB 1XLTC 5FT9A 2PH3A 3QTTA 2VH1A 3FYCA 2H7VA 5LBTA 2BY4A 3C3DA 1K88A 1K7FB 3AKZA 4Y2XA 1CJUC 3LUPA 1AURA 3RYFB 4RSMA 4B74A 4FYXA 4ZOBA 1GT91 4URUR 1XLUA 4RKEA 1FS5A 2EGGA 4X1KA 3GJ3A 2OYCA 4PRKA 4V0MA 2F55A 1KDRA 1QVZA 4ZANA 1PYOA 2EU8A 4E4YA 1LRKA 3U60B 1LQ2A 4QRDA 2IDZA 3KFVA 3LJKA 1A82A 1L8QA 2YXLA 1R5OA 2G7ZA 3B1KA 4JBNA 4WJKB 3D8HA 2MINA 2C2BA 5DI3B 5AKEA 2PVSA 4YCAA 2H8KA 3PNSA 2C5SA 3NTVA 3UK2A 2BM8A 4LHEA 4S1WA 4BUCA 2P11A 3C3AA 1ZI9A 4NMLA 5EJ2A 1XMSA 1WOMA 3UH1A 4CMIB 1KZ9A 2VJAA 1TUBB 3EGDB 3K70B 1WS6A 4NFHA 1TM3E 4ENQA 1ZNXA 4DV7B 4OVKA 4Z7JA 2FZWA 1SHUX 1L5NA 5IYZA 5IZ4A 1TT7A 3NJ4A 3IUBA 5ALYA 1ZAYA 3RH0A 4JX8A 1QYWA 3DOFA 3EC7A 4CCYB 1I14A 4D74A 3QRWA 3R3WA 2YFHA 3K05A 3U0VA 1H2BA 5A5GA 1X1DA 4D0SA 2GBLC 2H7XA 1PTJA 2PXXA 3DOIA 3B53X 3BERA 4EA7A 4CEHB 1ESDA 4MDYA 4AP9A 4LZWA 5C8YA 4X1KB 3KQPA 4B2LA 1TTQB 2Q28A 4LGMA 2A58A 2PLWA 1P2UA 4J7XA 1H66A 1NPTO 3X44A 3WGHA 3CR7A 1S9DA 3IPYA 5D7BA 4BMDA 1NSYA 2GD2A 5F33A 5LA6A 2HA0A 1EG2A 2ZRIA 3OZTA 1P19A 2VH5R 2WJVA 4M7OA 5LIRA 1CCWA 2VUTA 4ND2A 3FAZA 1N9KA 4BP9A 2Y6VA 3ISJA 4TM7A 3AO0B 4ISCA 4MZDA 4MUKA 4GWGA 4P82A 3RVRA 1V1RA 1Z8NA 4KQIA 5GWXA 2O2DA 2IV7A 1CUJA 3U7GA 5ALQA 1C50A 5FI1B 3WK6A 1DZIA 4AMZA 2H3HA 5HQJA 1SHJA 3ER8A 1LPNA 2HC9A 2IXAA 1WB6A 5CB8A 2K5UA 3KG2A 4E4RA 2WSBA 8ATCA 5LPNA 3HYNA 4WBSA 4LQCA 4R01A 1MRZA 1XL1A 3SC2B 1PT7A 2FW8A 3NVKI 1ABEA<