2YK1L

Structure of human anti-nicotine fab fragment in complex with nicotine
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
207
structure length
188
Chain Sequence
b'ELTQPPSASGTPGQRVTISCSGSSSNIGSNYVYWYQQLPGTAPKLLIYRNNQRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCAAWDDSLSAWVFGGGTQLDILGQPKAAPSVTLFPPSPKATLVCLISDFYPGAVTVAAGVETTTPSKQSNNKYAASSYLSLTPEQWSYSCQVTHEGSTVEKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB FRAGMENT, HEAVY CHAIN
publication title Different Binding Modes of Free and Carrier-Protein-Coupled Nicotine in a Human Monoclonal Antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 35
structure length 188
sequence length 207
ec nomenclature
pdb deposition date 2011-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2yk1L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2yk1L01
3BKYL 4UIKH 2W0PA 2DIJA 35C8H 5IB3A 5F7MC 5MEOB 1HYSD 4GO6B 3MRJB 4X6DF 5F96L 2VWEC 1NL0H 4U1MA 3TIEA 1T4KA 1UJ3C 2EE9A 5DRZA 2V5YA 2W60B 4S1RL 4UB0L 3DGCR 4IRJA 2BNRB 1KC5L 1WJ3A 3GK8H 2YUVA 1AGBA 5DJAA 1R24B 4JPWL 5E2TL 5DD0L 4F15C 2ICWB 3F7YB 4JM4H 3T0BA 3L9RB 1CICA 2ZSVA 4ESKA 2FWOB 4GRMB 3VWJD 3MV8D 2BSTA 2ARWA 3VI3E 3SDAA 5F89A 1JV5B 2JJVA 2Y5TA 4HGWB 4G6AC 2EC8A 4MQSB 4ERSH 4M1DL 3LQAC 4U1JA 4KRPC 4JFYB 4HH9B 5CEYA 2YD1A 1FH5L 4JRWA 5LBSL 3RWJB 1YNLH 1DBKH 3QI9A 4ELMA 3QQ9C 3D9AL 2H8PA 1RPQA 3RY6A 4AYFA 4D9QE 5IEKA 4GG8B 4R97C 3UYRH 3QNZA 3SKUD 1FG2B 3CDGB 2A38A 3P4NB 5DD3L 3GJFK 5J13B 1U6AH 3PWPE 4NZJA 5KSAD 2QSQA 4WENB 1I1YB 3WJLC 3NTCH 3PF2A 1YEEH 4D94A 1RZIA 3RUGE 1JPSH 3S36X 2OYPA 5HGDA 1N59B 3N9GL 2B2XL 1S9XB 3WIFB 1OHQA 5GGRA 4F9LC 2VXSH 3ZLQC 3MUJA 3FFDB 2FO4A 1OB1B 4PB0L 3TJHD 5JNYA 5TJWK 4FFYH 4L4VA 5CD5C 1MPAL 5JTWA 2HH0L 3RGVD 1QR4A 1RZFH 1KTKE 2HKHH 4JKPH 3OKMA 1I85A 1YMME 1UM6L 4OUUA 1ACZA 2C1PB 3DRQB 2C3XA 4NQDA 1OWWA 4P9HC 1I9IH 1E0OB 5C0GA 1KFAL 1RIVH 2EH7H 1X5HA 2VZOA 1RIUL 5DJCB 4KUZH 4H5SB 2X1OA 3LEXA 3BD5A 1V3JA 4Y4HD 5KTEH 1AGCA 2R0LL 3LQZB 1JWSA 5D1XB 1QSEB 4IIQB 2NTSP 2HFTA 3GSWA 3IDJA 5EO1A 2V5RA 2Y5EA 2D0GA 1DUZB 4JRXA 3MRRB 1Y0LB 2XT1B 2UYLA 3RTQA 4BSJA 3LIZL 1YPZB 1NBYB 4OCRL 1JWMA 4L8SA 3VWKD 2GITA 3BIAX 2WP3T 3BH9A 5I1GL 5T5FL 4NM4L 3LSOB 5CP7A 2W9LA 3SKJH 3DUUA 1E6OL 1HQRA 5FB8A 2QQNL 1I1RA 2ZOLA 4K3JH 2WAHA 1T7YA 3VFPB 4NQCA 1AGEA 1PX3A 5D7LE 3TNMB 1LE5A 1JZ4A 1NCCL 1BAFL 2BJMH 4NZRL 2CIIB 3H7LA 4J3SA 3MGOA 1W0VB 3S97C 2DLTA 5D8JL 2I9LA 1MFDH 4G6JH 4ZTPH 3RX5A 2ZKHH 4OTXL 1GOGA 3MPCA 3T8XB 3HTLX 4TNWF 2DQFA 4HXBL 4PRAB 4GKNB 5TQ0L 4O5LL 4MHHG 2BXYA 4O58L 2QR0A 3MLXL 4QOKB 1IGMH 3PWVA 4M6MH 4WI6A 1EO7A 1G7JB 3VDCA 5DD5L 4YFLI 4G7VL 2EDKA 3AU1B 4M6NH 3PGCA 3VXQB 3HRZB 2PXYA 1HKLL 3HNTL 4MCYA 3E2HC 1T66C 3U4BL 4LBEA 1VFAA 4CVWA 3R8QA 4UNTA 1QPPA 2ADGA 4OGAD 3FO0L 1A14L 4WCYH 2HKFL 4S1SL 5C09A 4HUWB 4HZLA 3T1FB 3U0WL 1IEBA 1MJ7H 1J1XL 3CX5K 3E6FA 3MRIB 4OZHE 5F9WC 1JHLH 3P0VL 3SDCB 4P2RD 1C7SA 1BVLB 4EKXA 3C08H 4WWKD 4CVXB 2VDNL 4PIRF 4PJDE 4TN9A 3SDXB 4KKCD 4FABL 3HUJB 4X5WB 5CIPA 2OTUA 5AYUL 2P44B 5D1QA 1IE5A 4FG6D 3FAXA 5I16B 2P5EB 4G6FD 3PGDA 4PR5B 2YD9A 5HPOA 2WBJB 1MAJA 1F6FB 1K8IA 3KGRA 5D7LD 1D5IH 5A43C 4HKBA 5TE7H 3O45B 2WUBH 4Q2ZB 3W39B 1TVBA 4U3CA 1U8PA 3S3PA 4G8FB 1KCLA 3DMMB 1EEUA 1XGRA 1U95B 4JFED 1MRCL 5DVOA 2ID5A 3PDGA 3OAZH 4HIXH 4YDIH 4PPTA 1TQBC 3AC0A 3M1BA 1O7VA 3H9SB 1NEUA 2BC4B 1EO5A 2GTZA 3FONB 1TJHL 1BHGA 4Z7UB 4OIIH 1TTUA 1C8PA 4LOUC 3JWDH 3GMQA 3O6FD 4CU8A 2QJDA 2CKBL 3JZ7A 2CRYA 1VSCA 1PYWB 1AXTL 4DZ8A 4YGAB 2F8OA 4JREC 1T1YB 3V95A 4G6KL 3N50A 4KI1A 3BVNB 4KMTH 1PG7L 2QKIB 5AZ2L 1J86A 4GRWF 1P4LB 2L7JA 3X3FH 3L7FA 3JV4B 4PJGA 3JV0A 2RCSH 5CEZE 3K4AA 3MACL 4U05A 4NJ9L 1BBJA 1ADQA 3VE0A 3EJYD 2D31A 4YWGL 2AJSL 5F71A 3MRQB 5DD1H 5I1HH 1CGVA 5EOCL 1IM9B 3VXSE 4WHTB 1CLYL 5BW7C 1QNZH 1QLEL 4OLUL 1H8OA 4Y5YA 4PLKC 1D5BA 4CVUA 3CFBA 2KPNA 4ZYKB 4V1DA 3LKQA 4LSSL 2R29L 1CYGA 4W6WB 1SYVA 4HZAA 3MLUL 4L1HA 4H26B 5CEZH 2X4TA 1FLTX 4NNPL 1OT2A 2HRPH 4KRLB 1FL6B 5B21A 4K8RD 5SWSB 3BPLC 3ZE0E 4BFIA 3X13A 1TTFA 2X2YA 2IGFL 3QUXC 4FZEL 1IQWL 4Z7WB 2IBBA 3DETC 4GW1A 2BP3A 2UZYB 4LVEA 4KTEL 2O61B 1EH9A 4PJIB 4GLRI 4LP4A 1C1EH 2A6DA 4MA8L 5GIRA 5A16B 1HINL 4RGNB 2EDDA 3OQ3B 4ODBD 3DGGA 5ALBL 1KT2B 3UTPE 1G7IB 2HAZA 1H0DB 5EIIB 1HH9A 1K85A 2N56A 1MREL 1P2CB 3ZHLA 1LO0L 1CDUA 1MF2H 3C60D 4JY5H 4KDTA 5D93C 2YC1B 5C08A 2YPLB 3UTSB 1DQML 4Z18A 4KVCL 1W8OA 4G8IB 5C7XL 1QSED 4C83A 1B2WL 1BFOA 4HQQL 2X4QB 3MRNA 1WZ1H 4J6RH 4LSTH 4ZFFB 5GSRB 2JF1A 4MD5B 1S7RA 4PJ5E 3VXNB 2XXMB 2BVOB 1FNEB 1KIRB 1WT5C 3CPLA 3PQYD 4P5TC 5J8OA 1V05A 1UWEH 4M3JA 5L8KB 5FYKL 5HHPB 4I4WB 3WFBL 4LF3A 1X3DA 2NY7H 4XCCH 3VWJA 3KYNA 2WANA 5DK3A 4H88L 2Y6SC 3QDMB 4AQOA 4YHNB 1YEHL 2YD8A 32C2A 3C5ZC 1DFBH 3VXSD 4TUJA 2QSTA 3MV9E 4J4PD 3WL9B 2A9NL 4HJGA 4PS4H 2ED8A 4JY4A 1I1CA 1QSZA 1YN6B 3VH8A 3VH8G 3CC5A 2YZ8A 4DKDC 4ZOAA 2E7LC 2CK0L 2UVFA 4LSRH 1CD1B 4XNZC 4Q97A 4X4YA 2F5BH 4FQQA 3VXUE 4MVBC 4J12A 4UNVA 5KSAA 3O0RL 2I07A 1UB6B 4LLWA 4LCUB 5SWQA 1CFSB 1XF2B 1GCFA 2ITDB 4RMSA 4I13B 5CHNA 5K9QG 4D0BB 1G9NL 4R90H 5DO2C 3V5KB 4XP9H 5GJSH 4BQ8A 1NMCB 3C6LC 3B9KA 1P1ZB 1SJEB 3FO1B 4LKCB 5H35B 4YC2B 4UIMB 3ZKND 5KG9A 2QADB 4HV8B 4ZFZB 1EFQA 5I1LA 5C86A 3EO0B 1T0MB 4NQXA 1AD0A 2Q8AH 3U7WH 3OJMB 1G1YA 4XPHH 3SDCD 4LLVB 4J3XA 1G7PA 1R5WA 4EXPX 1NJ9B 5HHNB 2YXMA 3WSQH 3NA4A 1ETZB 2OR9H 5ILTH 2OSLB 5L6YL 5FM5O 4UQ3A 1GZQB 2XTJB 5FHAL 4AM0B 4MNQB 1KJ2B 5GISL 5DJ8A 1JYNA 1AC6A 2D4FA 5GS1B 5L88L 1LP9F 2P5ED 4JM2B 3H42H 1X5XA 2BVPB 2WBJD 3O8XB 1A9BA 5F9JA 1EA9C 1SEQH 2LAGB 1H3UA 2W0FB 5TGBA 4MWFB 4ODUB 4LCYA 1N6UA 4ODVL 3PP4L 4OIBA 2V2TA 1IM3A 1UYWL 5I74B 3HZMA 3D0LB 3G04A 5DUML 1MH5A 5E8OB 3S3JA 3WS6C 3REVB 2YUZA 3IDGA 4MAUH 5CWSB 4MJ6B 2QSVA 3R8BB 4RQQA 4YHYC 1MFNA 3VXUD 4YLQT 3PWPA 4M7ZC 2XFXB 4JPVL 3LKSB 3OXSA 4G9FE 1NDMB 1T03L 3RUGA 1T89C 5EUOA 15C8L 2H1PH 5JMRA 1A0QH 2DJ4A 4TYUA 5F1NA 5KANI 1BWWA 3P2TA 1N2RB 2XN9E 2G5BA 5JMOC 2P7TB 3V8CA 3CSYB 2AV1A 5TQ2H 3ZKMD 3ALXA 3LMJL 2BMKB 3C5JB 5I1KL 1SMOA 3S9DB 3DPBA 3PNWB 4UT6L 5DR5L 5GXBB 5JQHC 1I9JL 4Y2DC 1CGWA 4JZNB 1RSFA 2X1PA 5JZ7D 1AGFA 3VFUA 5GRJH 5DLML 5HVFB 3PP3K 1F4WL 3WEXA 3UPRA 3R1GL 2DWDB 1I7UB 3Q3GA 2PETA 1BFTA 2VIRB 4X7FC 3LQAH 3VI4F 4X99B 3WS3B 4NUGH 4P2QB 1KBGL 4I0PC 5E2UH 3FQWB 1A1MB 3SGKC 1I1AA 4MXVF 1NGZA 5D70H 4KAQH 3MLPA 3WUWA 3WUWG 4E5XA 6FABH 5IB5B 1M6OA 1DE4B 1HEZB 1SMAA 2C3GA 1FO0L 2ZP0T 4G3YL 3VRLE 3CUPB 3THML 1U58B 1RZGB 2OQJA 4HBCL 3ULUL 3Q1SL 3UZEA 4BSWA 1WAAF 5CILL 5D7LA 1J9CT 4K55A 3LD8B 3L95A 4JFEA 4KK8C 5L9DH 1XF4A 2IF7A 4GBXB 1LK3L 3VMNA 3EYUL 1QTYT 4WW1A 3EOBB 3GSXA 2YPLD 3UTSD 5E6IC 1M7DB 3B9DA 4P9MH 3QHZH 1P4IL 4WU5A 4DW2L 1HHJA 4G6AD 2KH2B 1T21A 3MYZA 4HUUB 4I48B 3NIDE 1DBJH 2AJYH 2HTLC 2AXJA 2ICEB 3SY0B 1T5XA 2NY1C 5GS0C 3T0VA 3BUTA 2X7LB 3QXTA 3O6FA 4P9HH 2VZUA 4NSKB 4TNWK 5DJDB 3V0VB 3OAYK 1FNLA 4PYHA 4UQ2B 4HWZB 3CCHA 1O5DT 3WFZA 2KDGA 1MCJA 4UU9B 3ZE1F 4BQ6A 1G9NC 3CVIL 3QDMD 5E24E 3NFNB 3V6ZB 3VFNA 3AB0B 3BDYH 3GHEH 3ILQD 1JE6A 4L9LA 2DJUA 3FT3A 5IHUL 3MRGB 1NC2B 1NKOA 3U6RB 4X9GA 1SBSL 1U8OA 2WM0A 3G5XB 1IGJA 1MJJB 5DJ2A 1HIMH 2AJXL 4HMDA 4OZHA 2OTPA 1BMGA 3L5XL 3O6ML 1XZ0B 4JFXB 2NX5E 4I2XB 1YEDB 1TJIL 2FIKB 3LS4H 4FXKB 3BP7B 4FQXB 4PJDA 5TE6H 1X5AA 5INCB 4LCCA 1NBVL 3ARFB 5DSCB 1QEWA 4OGXH 3VMPA 4RGOH 4IDJH 4Q6YA 4NT6B 3OTTA 4CMMB 1A7OL 4UT7L 5DS8A 4G8GD 1QBLL 1TXKA 1CL7L 1A6TA 1X5FA 1P6AB 2EO1A 1YNTB 4KJYA 5GGRY 1WWAX 5EN2B 1JPGA 5J11B 3B2UC 5EG6C 3MRLB 1HDMA 5CJOH 5GS3A 1MHPL 3K4DA 1F90H 1YEJL 2B4CL 3S35H 1OW0A 3RVUD 1NMBH 2CLZB 2X4PA 3OL2A 4JO3L 5JHDB 1FFPB 2YD3A 4O2CA 4ZAKB 3FQUA 1PKQE 4XAWL 2VDPH 3Q5OA 4R7NA 1A3RL 3TYGL 4NM8L 3I2CH 2DMCA 4EOWL 4M7LT 5EPMA 2VDQL 3GJEA 3PG2A 4F7PB 2H32B 3LKNA 3C60A 4NBYB 1PLGL 5T3ZL 3FRPA 3FRPG 5EO9B 5TDNA 5JW4M 4FQIL 2XTJD 4CVZB 3BKYH 3L7EA 1GGTA 2DQJL 5IQ9B 3VCLB 4F7TA 4GRLC 2VQUA 1WZKA 4U6XB 1UWGH 2J8UF 1T1ZA 4KGJA 1ZV5A 5T1KB 3O8XD 5F1IA 3R4DA 4PRPD 3BGFB 4S1RH 3GIZL 3PQYA 3BJ91 4OT1H 3T2OA 5KN5B 1JZ2A 3TCLB 3GMOA 1FIEA 3BT2L 1KC5H 1LO5B 1U8QB 3L5HA 4K3DH 5EH1A 2Q86A 4QHNA 2VC2H 5IJKC 2FGWL 4RBPH 3HB3D 3O3EA 3CK0L 3OJDB 2PTTA 1FZJB 4I18C 4OCNC 5HVGB 3VXSA 9CGTA 3TA3C 4P4RA 4WW2B 5DD0H 1IL1B 2AJ3B 4J4PA 3CDFA 4F7CB 1QVOA 3WE6A 4JDZB 1NFDF 2M1KA 3X12A 4DOHE 4PRDA 1CGXA 2DMKA 2MKWA 4TPRL 3KLAB 1R3JB 1S5HB 4ISVB 3BD4A 4M1DH 1T66D 2PCPA 3MRBA 5IG7A 2NR6C 4MXQC 4PP2B 1FH5H 3FQNA 5LBSH 4WO4C 5ID1B 1QQDB 3ARXA 3D5OF 4NWTL 3BYTA 1P7HL 1KYOK 3QIUC 3G6DL 3O9WA 5HJ3B 1OAYL 1INQB 5C0IB 1EBPA 4OI7A 4JQVA 3V5DB 1HZHL 3QDJB 2ERJC 3TN0C 4IS6A 3U7AA 3ULUC 2QSCL 2OR8A 1OP5H 4QHUA 5GGTL 3QG7L 3BUYB 2HRLA 4EEEA 2QBWA 3ARZA 5D7IA 1RZJL 2B2XH 3N9GH 43C9B 1V7ML 5C2BL 1RY7B 4NO5B 4TUOB 3P30L 2CKBB 4PJ9C 4U0QB 2C9AA 4JPKH 4PB0H 4YBLB 4P2QD 1CG9A 4HIIA 4PJ5A 1MPAH 2LQRA 2HH0H 1EBAA 4YPGB 3L5WA 4NDMB 5E5UB 2VQ1A 4WUUE 2IPUG 3EZ8A 1UM6H 1AGDB 3BJLA 1NANH 4AH2B 4R96A 4HFWB 1YYML 2P45B 1ZTXH 5DYOB 3BP4B 4HIEA 1S78C 3HAEH 3M17B 4YDJA 2NY4C 4NKDB 4RFNB 1RIUH 5ESQA 5C07D 3PV7A 2RBLA 5TE4H 3SGDI 3MV9A 1UXSB 2WWMD 4U6HA 2R0LH 1OTSC 4CNIB 2R1XA 2IG2H 4GBXD 3PUCA 3O3UN 5DMJB 7FABL 1C5BL 4JDTH 3H0TB 2GTWA 3DWTA 4QRQB 1ND0B 4QRRE 2JCCB 4NQED 3ZDXE 3ZTJH 3LIZH 3VXUA 4OCRH 4Z7VB 1UENA 4F2MB 3FFCB 4X7EC 5T1LB 1P7KA 4NO3A 2UZXB 2XKNA 5B3JE 1ZK9A 3RWIB 1DQQA 1ZAGA 1E6OH 3U9UA 3SCMB 2QQNH 1A64A 1EUTA 5T3XD 1KCUL 3EDDA 5FCSH 1S9WA 3OR7B 4KKNA 1UWXK 1DANU 1LO4L 1NCCH 3OWEA 4B41A 4MMXC 4YK4C 2R2HA 3D2UA 3KR3L 4WI3A 4PJFB 2VLLA 3SDDC 3BAEH 5D8JH 3L3HA 5IUSA 3HC0B 3CSGA 1BZ9A 2B4CC 4OTXH 1RMFH 5CUSL 2X10A 4AL8L 2GIYA 3L1OH 5IBUB 4HXBH 1KIQB 3DVGA 5TQ0H 2NNAB 4IMKA 2A6JB 3T4AB 2FIRT 2XTLA 2UWEF 1IAKA 4O58H 5CINL 1R5VA 3GMPA 2BY2A 1DLHA 1U8JA 3MLXH 1ULVA 2X70A 3IXAB 4OGYL 4P59L 4V2CB 4PJAE 5DD5H 5HTSA 4G7VH 3DETD 4U2ZA 4RNRA 4EIZC 4MJIB 3PWUA 3C2SA 1EHLL 1AQKL 2GT9A 4JQIL 1HKLH 4LLUA 3HNTH 4PV9B 1F8TL 1A7QL 3BX7C 4KFZC 4J7RA 3D69A 1J0IA 2C5DC 3BIBX 2EKSB 1YN7A 4OF7A 3UPCA 2VLJD 3GMMB 4BH8A 1A14H 1CBVH 2JKXA 1UJ3A 4U1KA 3ULVF 3W0WE 3U0WH 2EDLA 3QXAB 4MJ2A 1UH4A 3BPNC 3DI3B 2XQYG 4JZJB 4MQTB 2E9WA 3P0VH 4H1LH 2VXQL 4MQXD 5D6CA 3AS0A 4NNYA 5JHDD 1TVHA 3BZFA 3GB7A 4ZAKD 3V9FA 5GRWA 4JHZA 1Q9LA 2VLMD 4PTUB 2VDNH 3OBAA 3HMXH 1R3KA 5AYUH 4HK3J 1KGCE 5DZOA 1HOCA 2R4RL 2XNAA 4DN3L 3ARRA 2Q7YA 5IGXH 1KJMB 1JRHL 2C3VA 4Z7OE 1S3KL 1FFOB 5EC2A 4MA1B 4ODXB 4JLRA 3C5ZD 3DX7B 4GKZA 2DWEA 5EOQL 1MUJA 5T1KD 1MRCH 3P9WB 4I5BA 1OSPL 5F97E 3DRTB 5E5MB 4HKJB 1RVFL 4U1IA 4ZUVB 3EFDL 1KLFA 3VXPB 3GJFH 1SY6L 2BVTA 3IVKA 3VXTA 4U1LB 4AENA 1ZLSH 1S7WA 4X5XB 1TJHH 5LWYH 5C92A 1DR9A 5C0FB 4X7TB 4UI2A 4MVBD 2Q6WB 5JHLL 3JUZA 4NHCL 4LPXA 4HT1L 4RRPG 4RRPA 4U1NB 5D2NB 2I9TA 3WJLA 1T2QH 4JFQB 1OGTB 2RB8A 4N9GA 4ORGA 5T5NF 3NAAH 4JPIA 3NPSC 4AZ8A 4F9LA 1RZJC 5DO2D 4MJ5B 5FOJA 5BMFL 5H2BA 1BZ7B 1CE6A 3KJ4B 1ZEAL 1F6AA 1G7QB 1PG7H 5ITBL 3C6LD 5KSBB 1MHEA 2W91A 3QIBC 2AKRB 3H9YA 2HJKB 4TSBL 3MACH 3B5TA 4NJ9H 1YMMB 4Z0BL 2CD0A 4YWGH 2FO1A 2JJWA 1O7SA 1MCRA 3GSRB 4TVPL 4G8GA 1AHWB 2CR3A 1CFBA 4HC1L 4A2LA 4WFGE 1QLEH 4OLUH 2XA8H 3QBTB 3QDJD 2J8OA 4HS6B 4PYGA 2P46B 4FA8A 1I1FB 4G5ZL 4PRIB 5IM7A 3WDHA 3MRMB 5ESVA 1WTLA 3T3PF 4NKOB 5BJTA 3SGEI 3CXHK 2OI9B 1J05A 1M71B 1MWAA 1RZ7L 3AMLA 3E6HB 3UEZA 1MLBA 4NNPH 1ZMYA 5L8JB 5IW1A 4LARH 1NUDA 4NJAH 5I6XC 4NZUH 4ZDHA 3NGBB 5B22A 2VDKL 1IQWH 5AWNL 4Q58C 4IDLA 5IK3A 5A2JH 4MLSA 5HHNA 1MJUL 3AREB 4KTEH 2FJHA 4NQSB 4AIXA 1CFNA 5M95B 4UINL 4MA8H 2M26A 3LRSB 1A22B 1G84A 2DF3A 4WHCA 5JW4Q 1AP2A 5ALBH 5SX4I 4FQ2H 1IEHA 2IFFL 2HT2C 4M7KL 4NKIL 4GQ9L 1NGXB 1TITA 3OKEB 1N7ML 3S5LA 3S5LG 2GKIA 4PRPA 1NFIB 3K7UA 4FXGB 4PUBL 1DQMH 1JNHB 3BRGC 1OWRM 1XGYL 3GMRA 4KVCH 3UTTE 1B2WH 1H3TA 3O3DB 4HQQH 1EDQA 4K71C 1QFWM 4TRPH 2HLAA 4W81A 1BLNA 5BZDA 1SJVA 4L3CA 2FECI 3ULSB 1TJGH 4Q0XL 1M05A 4OCYL 4WDIB 1NCUA 4ONFL 1L6ZA 3HCVB 1VB9A 2PF6A 4C57C 1KJ3L 1PFCA 3GBNL 4X8XA 1GGBL 3BEVA 4XC3L 1S9YB 4KH2A 4H88H 4Y2DD 4WU7A 2YD5A 1FO0B 1RJZB 1MVFA 3U7YL 4XZUB 1JGVL 1IZJA 1X5YA 4W6XB 4WNQA 1A6UH 4Y16B 2A9NH 3K1DA 2VDOL 5FGSA 4AIZB 1ZA3A 3HPLA 4I0KA 5EU3B 4H0GA 1PKQA 2XZAL 5FUOH 2DQEL 4I0PD 5GS0H 1CK0L 5EU7C 2BOCB 4X9FA 5E7FA 2W9DL 4MX7B 3O0RH 3CH8A 5C0DB 3O41A 4OZIF 3BHBB 3MJ9L 1FN4A 1N8ZB 3MJ8A 1MHCB 4LFHD 1VPOH 4O9HL 1B0WA 1F58L 2YR3A 1DQLH 4Y5XC 4JN2B 3REWB 1IJ9A 3LV3A 4Y88A 5FYKD 4WEMB 1KPUA 4MAYB 3EOAB 4DN4L 2HJLA 2R1WA 3RL2A 2Y7QA 3ZKXB 2APFA 3VA2C 2FD6L 5LXGH 5DI8A 4HX1B 4IOIB 4KK8D 3VD9A 5E8PB 1YC7A 4NRZA 1ZHLA 5DWUH 2H26B 3PV6A 5GGVH 2HP4A 2AGJL 5ICZB 4C59B 3OAUH 5C07A 2Y23A 4MB3A 5D71L 3R06A 2HTLD 4E41E 3NCYP 1IC7L 1DZBA 2NY1D 1S7VA 2VOTA 5ID0B 1IAII 4LVOB 5GISH 3JV6A 4J1UB 1WISA 4J3TA 2EDNA 2J6EL 4KI5F 1HXYB 2VERN 2BFVH 5F7YC 4M7JH 1XEDA 5FKAB 5TDOB 4XNQA 4XAKD 1PJ9A 4NN5B 4NQEA 4HUXB 1I8KB 4J8RA 4MQ7B 5DEFB 2YSSB 4U7KA 3L3IB 4FQLL 4KZEL 1C16B 5F1SA 1UYWH 4TUKL 4X4XA 4PJCB 4RFEB 1GSMA 5J1TC 2X4NB 5DTFB 4ONGH 1NCDL 1RUAL 1TNMA 4X0KA 3G08B 3H3PL 4GKOA 3ES6B 3G9VA 4OUOA 4DUVA 4RZCB 1CS6A 2EH8L 5JQ6L 1QRKA 5BW7A 1TETL 1MEXL 3BXNA 1NGYB 4DWHA 3HAEA 3HAEG 3HNVL 4I1NB 4LAQL 5E00A 4JKKA 4AT6B 1YMHB 3KPPA 1XH3B 2AV7A 1FL3A 2DLFH 5D2LB 4FQCH 3RNKA 4EI5C 1G7MB 3MLZH 5EB9A 1XGPA 3AFLA 4MNHB 4ZUUA 1MOEA 4BKLA 1JK8B 1ZVSA 3KPOB 4OD1H 3KYMA 3QRGL 3KS0H 3LMJH 3QUXA 3ZTJG 5DR5H 2O5YL 1I9JH 4KQ4L 5SX5H 5AUMB 2AAVA 1LEIB 3VFWB 4JKLA 1P9MC 1G6RB 1NC4B 2PW1B 1CZ8L 1G9ML 1MRFL 5DLMH 3U4EB 5F7HA 4HIJA 4I3SL 1F4WH 4IM8A 3CNKA 2VLJA 4QRSA 4E41D 5GZOD 3R1GH 4NPYA 4L8BA 4Y4KC 3DROB 4PRID 2Y06L 4QHMA 1KBGH 1VACA 3GSQB 4QRUB 5I8KL 2B0SL 4GRLD 4ZXBC 3MRDB 1KJVB 1VADB 4NOBA 5EIQA 4QRRA 5MP6L 5DK2B 5KOVC 1U3JA 1B9ZA 4O51A 1WT5A 3K8LA 2P8LB 4M93C 4P5TA 1NAKH 5IMOA 2EDBA 1YEFH 3OXRB 4ZO8A 4HBCH 2ZG2A 2CUMA 1Z5LB 2PNDA 5I71B 3QRFM 1KCRL 4WHYH 2IPTL 1FFNA 1Q9WA 3C5ZA 3IAGC 4OFVA 2A6IB 3TA3D 1A6PA 1PZ5A 4FMKA 2FLRT 2CLVB 4U1GB 2HFFB 5FO8B 3EYUH 2L0DA 4LRNL 2NW2A 1KLUB 3BFOA 4P2OC 1DN0A 4GUPB 1BFSA 3C5SA 3MRPA 4YX2L 4MD0A 1KELL 3KYOB 2ESVB 4JAMA 1WIUA 1TZHA 3I9GH 1BWMA 3HE7B 1NQBA 4ZOEA 4YQXL 2E7LA 1A4KB 3WHXA 4MCZA 5CMAA 1GGCH 5FM4A 3CMOL 4H1LA 4H1LG 2HVKB 2NW3A 3AROA 4WO4D 4PJAA 3OF6A 2EYRB 3P4MA 4JCLA 2EXYC 3U36A 1BIIA 4HDIB 1XR8A 3HMXA 3EIFA 2VDLH 1B4RA 4N0RA 3GM8A 1MCFA 5MEQB 3V4UL 3I02A 3O6KH 4X83A 3WCYA 3BE1H 3C6LA 4UAOC 5C0CE 5LJYH 3ULUD 3KPLB 3MLRL 1VGKB 4KK5D 1ACYL 3W0WA 4Y16D 3CFIC 3DXAB 2A83A 3W11D 2AEPL 2AJXH 4Z0XA 5IT2L 3QNXB 3L5XH 3IU3A 3O6MH 3WIIH 3O2WL 1KPRA 5GZND 5KVFL 4PJ9D 5C0IA 2DQIL 1QSFB 3QJHA 5JOPE 3MNZA 3WJJC 1ZGLM 3CFCH 1JNNL 3LKRA 2RHEA 3HR5A 1NBVH 3GJFA 1KPVA 3S36L 1FV1A 4Z77B 1A2YB 1IAOA 1Q9OA 1DL7L 3I50L 5E2VL 5KVMC 1T22B 5C0EB 1U8MB 1A7OH 1NKRA 4ZSOE 4P23B 1CL7H 2FJFA 4JO4L 5LAXA 1AKJB 5DMGC 2YD7A 2XI9A 5IB4A 1GHFL 1XAUA 4BFBD 2MPAL 5IP4A 4WWID 2IMNA 3EYOB 3RY5A 5JW4N 4QT5B 4APQC 1U8KA 1JHTA 2R9HC 4O02L 4XAWH 3MFFA 4EDWL 3TYGH 3WS6A 1A3RH 1G9EA 2W07A 3O2DL 4EOWH 3RVVC 1IILE 2AEQH 2H6PA 3MR9B 4G9FB 5I66A 3CH1B 4M5ZL 3TESA 1PLGH 3TZVB 2J2ZA 3KXFD 1UKQA 2ICES 4XWOC 1U8NB 2G2RB 1T89A 1TFHA 2PW2B 2W9EL 4Q6IB 4RX4D 3RA7L 2DQJH 3GBML 3RPIB 1VFBA 4TSCL 2GK0A 4XI5C 4ODSL 5D7KE 4C56B 3TT3H 5I8CB 2XN9B 1Q9KB 1GOHA 5CBEB 5F72S 4DKFL 5MHSD 2VZTA 1WBZA 4GAYA 3QH3A 4LLYB 1DLFL 2YRLA 1CGSL 4YNYA 1RUQH 1GAFH 3RWCB 4M61B 4Y2DA 3E8UL 2FGWH 4QF1B 3B4NA 5EZLB 1UB5A 1T2JA 4RDQG 1EJ6A 4XMLH 1JGDA 4R0LC 3TBTB 4XMKH 5CCKH 1G9MC 1H3XA 3MJ7B 3QISA 3SE9H 2QQKL 3UBXA 3UBXG 1OM3L 3V6FA 1BVKB 1LO3L 5I30L 3ILPA 2BCKA 2ZNWA 3N1QC 4O2EB 1IRAY 4TPRH 5KSUA 5T3ZD 2DQCL 2VLRE 4I0PA 3RX7A 2D7NA 1AFVL 3SGKA 5A3IC 4YHLL 3N1GC 3MGTB 3FZUD 4KDWA 3OKOA 5K9JL 1D5ZB 2BRRL 4JO1L 3MSPA 5I1CH 3ARGC 4P5KB 1DQJB 4JG1H 4LFHG 1B90A 5DT1H 1WCQA 4S2SA 3G6DH 3RIAK 4Z78B 3T2NL 2EE6A 4R26L 3QUML 4M8QB 4EXKA 5BV7H 1HZHH 2OP4L 3IKCB 4GG6B 3PDOA 5DJ6A 1N5AB 2QSCH 1QFOA 1NC4D 5HGBA 3QG7H 3D87B 4H25A 1AE6L 2DIBA 5IJVA 2DDQH 2OM5A 5D5MB 4DUWA 3L3GB 3O11A 1RZJH 1IGFL 2RJMA 2IEPA 5C2BH 3SJVB 3UTTA 3P30H 1NLBH 3V6BR 3K4ZA 5D7KD 1P7QD 3K3QA 5E6IA 3EYFA 4Z7NF 3SE8H 5FYLL 5EBLA 5JPNB 1S7QB 5EOTB 2R4SL 4PGJA 4FFZH 4Q9RH 4FFVD 1F4XL 2NYYC 4NRXA 4BQCA 3EHBD 1V7NL 2WBWB 2NY6C 2A77H 5F70A 3FHAA 1YYMH 1LE9B 1TPXC 1WFOA 5IB1B 1NGQL 4OFYA 4U1HB 5FA3A 3PGFL 4QXGL 5BVJA 2A6KB 2PYEE 3I6KA 1GGYA 3B9EA 1VERA 4R2GB 2BY1A 4IOFD 4N0FA 1X5JA 3UXFA 3QA3B 3NMEA 3IB4A 5FHBL 2NX5B 3BYYA 4TTGA 1VKXA 2WINA 3ULVL 1OAXH 3RWEB 4K7PL 2YK1H 1MCWM 4OFIA 4DGIL 1BD2B 1F11B 3DIFA 2J3SA 4LCWB 1YY8B 1FLRH 2GJJA 4DAGL 1MIMH 1R3LA 1LEKA 2AJUL 3BN9C 5E8NB 2AJZB 1FL5B 1MJ8L 4YBQD 1KCUH 4PJ7E 4TULL 1LO4H 5CBAA 1YEKL 3KR3H 4XVJL 3QIWC 4QEGA 3BZ4A 1N64L 1WIPA 4YPJA 3DVFA 3IDXL 3BIKB 2YA0A 3CU1A 2DMBA 1OD7A 3DXAD 5CUSH 3U46A 4AL8H 43CAA 5I1AB 3BZEB 2DI9A 4OFPA 5T33L 1ZA6A 2P5WB 3N1MC 3JV5A 3ELAT 4OKVB 4XHQA 4CJ1A 1TMCB 3HNSL 4I3RH 4Y19E 5CINH 1MFEL 1QSFD 4OGYH 4P59H 4XTRD 5DK0A 2XIDA 1A6AB 5EU7E 4E41A 1ZT7B 5FO9A 2DAVA 4LNRB 4HS6A 5TDPB 5D7JC 4LAJH 5J6HA 4IJ3C 3OJVC 2R0ZH 2R23B 3HMWH 2EE2A 1FNHA 4GRLA 4P23D 4XP5L 4M48H 4ORZC 1FIGH 1Z3GH 3V4VL 1FP5A 4O00A 4PJHB 1EIBA 2JB6B 5GRVK 1I3GL 3MLTB 1ROWA 3QCTL 2VXQH 1MQKH 5I76B 1OLZA 5GRYA 3MRKA 5FDYA 5MI0B 3VFGH 3QXUA 5IJKA 4Z9KB 5DGQA 2Z92B 2YZ1A 5CD3B 1CDBA 3H2WA 4I18A 1VESA 2APWA 1MRDL 3TA3A 2X40A 1D6EA 1UEMA 2R4RH 2D3VA 1QBML 4YGVA 1KXQE 3RQ3A 2GJZB 4YHIB 4QWWD 1A7RL 1RUML 1R5IB 2R2BB 3JTTB 1A3LH 2J5LC 1YPZF 3IF1B 4N8VA 4N8VG 4NQVB 3AAZB 4C56D 4ENEC 2CDGA 1D5MA 5EOQH 4XVSL 1BBDL 2VXUL 3NCMA 1DSFL 2YRPA 4WO4A 5EBWA 4HUNB 2IADA 3LKPA 2B1HL 4DZBB 1OSPH 4GAJL 3OHXB 1TZGL 2Z0BA 1RVFH 1MCBA 4D0CA 3QIUA 4AEEA 3IFPA 2HJFA 3EFDH 4HBQA 1SY6H 4MDIA 4NO0B 1IGYA 2AJVL 2N7BA 3T0EB 5F7DB 3TN0A 2MSPA 3MRFA 2OJEB 1FNGA 5IVXB 4HT1H 5FK9A 3CFDB 3PL6B 1NCBL 2E3VA 3Q6GH 4WHYG 3DX8B 1C5CL 5KS9B 1ORQA 4XX1G 3SEPA 4ZNEE 1I8LC 1RUKL 3SKOB 3JTSB 1BQHA 1BQHG 5HGAB 4PTTA 4PLNC 1S5IL 4NOFA 4PJ9A 5ITBH 1ZHBA 4XCYB 3KPNB 4TSBH 1U93A 5AYQA 2A0LC 4WUUB 1XT5A 1LK2A 2R69L 3UAJC 2VXTL 1XCQB 4Z0BH 2ITCA 1NGWA 4EI6A 8CGTA 3UP1A 2EZ0C 1TNNA 5KAQF 4GLRH 4HULB 1W72L 4HC1H 1U3YA 3MA9H 3P4LA 1JHKH 3EYQC 4CW1B 4JKWA 4G5ZH 4Z76A 4H8WL 1FJ1B 3RU8L 5DFWH 2ZUSA 3PDDA 5IMKA 4WEBL 5KVGH 4LVNB 1H9VA 3CFKA 3SJVD 3X14B 3SDXF 3BEWB 3HUJF 4X6DA 4P3WA 4OD2B 3ULVC 2VDKH 3QUZC 5AWNH 2H45A 1KLGA 3KXFA 4UINH 3T77B 1DP0A 4MB5A 3S37X 2J12B 3B6SA 4HGMA 1QBAA 2DI8A 2P49B 2IFFH 3FB6B 2V9RA 3LOWA 4JZOA 2BOBA 4M7KH 4YDLB 3MC0A 3QUKA 3A6BH 4NKIH 3KJ6H 4G9DB 5C0CA 4LSVH 4TVPD 4MLIA 1IQDB 4IRSC 1HH6A 3HPJB 4HWBL 4JDVB 4X6CF 4PUBH 1HK6A 1XGYH 1GJIA 3SDDA 4R2GD 2V5SA 2JELL 1I3UA 1JYWA 1LP9E 4GMTH 3WIHH 4CADB 4OZFH 4EDXB 4DQOL 4EUPH 3SE4C 3U0TA 3ARBB 4PGZA 1U8LB 1QFUH 1BD2D 3LH2H 2PN5A 5IR1B 4LCWD 4ZFOL 5FA4A 1FNSL 1GGBH 1EMTH 3CD4A 5C3TA 1OAQH 2FL5A 5J89A 1J0KA 3OGCA 1WCBA 1UZ8B 1JGVH 3EYVB 3FQTB 3UO1L 5DQ9B 4MS8C 3T2PA 5HY9B 2VDOH 4RCAA 5BQ7B 5GRVL 2NTFA 3TIDA 3KHOA 1EEZB 1P53A 2XZCH 1F5WA 4RISL 3HZYB 4HK0A 1EPFA 1CK0H 5CEXA 1ONQA 1D9KB 4BH7B 5L2KB 3B9VA 2P5WD 4LLDA 1DEEA 1U8IA 4K9EL 2VLKE 3DV6A 3G5VB 2DIAA 5E0QA 3BO8B 3U30B 5F3BA 3IDIB 2IQAA 2R2CA 1IAIL 3TF7C 1T1XB 1P7QA 4M03A 3QO1B 2OK0L 1OQOA 2AEIT 5C0NC 3PHOB 3QDAA 4EN3C 4Z7WF 1IGTB 3Q5YA 2CXGA 1EEYA 4OF3A 2Q76B 2FBOJ 4X80H 2FD6H 4PJIF 4P0DA 1CCZA 3GGWA 3TBSB 2J8HA 4P2OD 3CVHL 1AXSB 4F7EB 4KQ3L 4WTZA 4WTZG 3VI4E 3VD5A 1MFCL 4WFHD 2AGJH 4M4RA 4R3SB 1MCNA 4KUCD 4LQ1A 3VFOB 4MXVE 5D71H 3OX8A 1FYTB 4ONOA 4OM1L 1BOGB 2A74A 4OLVH 3TNNA 5DA4A 1MCWW 2EEAA 5FOBB 5EZOL 4KHTL 5GGTA 5E1AB 1KIPA 1YUHA 5EZIH 1FC1A 5JDSB 2J6EH 1UM4L 4JFDB 2VLRA 1MIEH 1Z0MA 3LS5L 5EO0B 4PJXB 4ONHA 2ZOKB 3HI1A 4R9HA 4TUKH 3MUGB 3QIBA 3ECBB 2C1OB 5EU4A 1NCDH 3FRUA 4QYOA 1HHHA 2DS4A 5B4MC 5EFIA 1F00I 1S8DB 2I60L 4NBXB 3IGAA 3IAQA 4LDEB 3GSVB 5ECJE 5B8CC 2DM2A 3IFNL 1DBMH 2Y25A 4L29B 1FVCB 3RJQB 2EH8H 5JQ6H 3IJHA 1FE8L 2OTWB 3T0ED 1TETH 2JIXB 4MA3A 4P57B 4XNMA 4KZDL 1MEXH 3CSPA 3LB6D 4LAQH 3WO4C 5ADOL 3DHMA 3TVMC 4H8WC 1YEIH 4J3VA 3C8KB 5FIEA 1CN4A 5ICYB 4M6OL 2JB5L 1ZLWH 2IH3B 5DMGD 4LSUL 3QXVA 2BSSA 3BI9X 2OJZH 3QEUB 3V4PH 3QRGH 5INDB 8FABB 2VKWA 5C6WH 2XQBL 1DVFC 1JTOA 3FCTA 2NY5L 5A2FA 4KQ4H 1RZ8B 2ZUQB 5C0BD 2R0KL 3F58L 4NYLA 3F12B 3B43A 4APQD 1L7TL 5JLZA 2R9HD 5HYQA 1CZ8H 4N1CA 2EC9U 1E4WL 4XH2A 4I3SH 3RVVD 1JZ6A 2WV3A 4F3FA 2AXHA 2PYEA 2WIMA 5IV2B 3V7AE 5FO7A 5I19H 4LKXB 4D8PA 1FGNL 3HLAB 3BKJL 4R8WL 5JA8B 5EBMA 1K8DA 3ZKSD 2B0SH 3V5HB 4CDHA 3G6AA 4XI5D 5MP6H 3TO4B 2X4RA 1V8HA 3VXMB 3C87A 4PRNB 4Q9QL 1K4DA 4XCEA 1Z6JT 1EHXA 4N90E 4NC0B 2Y4SA 4JGMA 4JM2F 3QDGE 5HI4C 2DTSA 3HI5H 4RAUB 2BSRA 2CH8A 2G9HA 4X7CC 5E4IA 3W9DB 4YDVB 1MCOL 4XPAL 3FB8A 1MCLA 3GRWL 2H2SC 2ATKB 3BDXA 4LRNH 1ZGLB 1S7UA 1CD8A 1LD9A 1KTLA 2MMXA 1T5WB 4PFEA 4Y5VC 1QA9A 3KLHC 4KI5C 3MFGB 1X7QA 1KELH 1DJSA 1T04A 2X4OA 4GW4A 4NRYB 3STLB 2W1NA 4Y19A 2J8UE 3CMOH 1Y18B 4WI7A 2CKNA 3L3OA 4BM7A 5C0RH 3ARBD 4Y1AD 1DQTA 4QRPE 2AK1H 5IEHA 1Q8MA 5CZVL 3ARGD 3VXRE 4RAVB 5J06A 5HHMD 3A6CH 5E6YA 1KCVL 1FAKT 3EO1A 4K9EC 2FB4H 1IC5H 3D25A 4JE4B 3AS2A 2YMXL 4JY6B 4Y5XA 3DSNA 2EYSB 3RI5F 5JIPA 4K3HA 2CGRH 3HZVB 3GKWH 3IAPA 5E6ZA 5I8EB 3TPUA 1FGVL 3PXHA 1WVZA 2BVYA 4WGVB 1ACYH 2WMPA 3ARUA 3NZ8B 5CJ5A 5L8LB 4PGBB 4XNYH 5IT2H 4PB9L 3KDMB 2HWZH 4G42B 4JRYE 3O2WH 1L9NA 4F37F 5KVFH 2M8XA 1XGUB 1UM5L 2DQIH 2VABA 5F88B 5DRXB 3T0AA 2ZPKL 2K7QA 3C09C 4NO2B 3KPMB 1JNNH 2AK4B 1D3CA 1I7TA 1QPXA 1D9KD 5L2KD 1SY6A 3S36H 3DX6B 4HIHB 4F8TA 1EAJA 4MNGE 2BNQE 1E4XI 2NYYD 1FPTL 2NY6D 2Z31C 4JO4H 1RURL 4XNXH 1U2HA 1OP3K 2AXGB 1QSVA 1WBYA 3G5ZA 3PABB 5GJTL 3TBVB 1NBZA 2HG5A 5J56B 5T1MA 5E08L 3T65A 5F8RC 3DLQR 2VDRH 3UCRA 1RK1A 3SHSA 5FEBA 1D6VL 4EDWH 5EU6B 2P24B 4RGMC 3VRJA 2IALB 1W0WA 3ARYA 3S88H 3D18A 1ORSB 4PG2C 1HQ4A 4LQFH 4UOJA 1M7XA 1MLCB 3GMNB 3IFOA 4HF5L 4RSVA 4Q9CA 3QP3A 4L3EE 4F57L 5KVEL 3BP5B 4M5ZH 1NMAL 3D85B 4ODTL 1FYTD 2VISA 4G80B 4GS7C 4HC1A 5CKGA 3MBEB 5IFJA 2A73B 1P84K 4YZFF 1XR9A 5ALCL 3TWCL 5LGKA 4ZNEA 1KV3A 2R0WL 4KY1L 4ODSH 3SPVB 4MGXA 4LPCA 4EI5A 3RFZC 3RZWA 4JFDD 1FVDA 4RMQA 2B7DT 3MLSL 3MRCB 1KG0B 3GSNB 4Z8FH 4XWGH 1RJYA 2EDWA 3QIWD 2DQUH 3S34L 4ZD3H 4L4TE 3FOMB 4XXCC 5F9AC 1CGSH 1CXFA 4BZ1L 5HYSB 3OKLB 4JRYD 1IFHL 4NC1C 1P9MA 1INDH 4Y0GA 3H9HA 1L4IA 4P4KC 2NXZC 2APBA 3WFHB 2RFXB 3T08A 2JIXD 1OM3H 3QEGH 5I30H 1LO3H 3F62A 1QRNE 5ENWA 5DC4B 1WWBX 4RFOL 4Y4KA 4YXKH 3T2QA 2FGZA 5F7EH 3RZCC 3LHPH 1BJ1H 3IJSB 3RAJL 1L7IH 4YHLH 4ZXBA 1HN1A 5JW3H 4BUGA 4QXWA 5K9KA 3QAZB 3DI2B 2BRRH 4JO1H 5GGSB 3GUTA 4OCWL 3WIHA 4NIKB 4OZFG 4OZFA 4K94L 5FYLE 1MSPA 2YRZA 4HMCA 3T2NH 5DJXB 4R26H 4NP4L 4QGYA 4PGEB 3VG9C 4KMLB 4OV5A 2OP4H 1A6WL 3WN5C 4YUEL 3AUVA 4WFFE 1OF2B 4YHOL 5SWZB 2IAMB 5K9OA 2Y36L 4JG0L 2UWEE 3SE3C 1AE6H 5JO5B 1MVUA 5GGQL 3IDYC 2YXFA 4U7MA 1PEZA 4M02A 3NH7L 1CXLA 1IGFH 3GNML 2PO6C 3BOVA 3KNBB 2OZ4H 3T4YB 2GI7A 4NUJA 3QPQC 4P2OA 1AY1H 1JTTA 1OPGL 1JCKA 4N0CD 1LP9A 3RGVC 3VGFA 1K5NB 5EZJB 5TH2B 5FYLH 1IGIH 1BF2A 2VR9A 3FO2A 1JF1B 1E27A 3FN0L 3WD5L 5C0AE 3VXMD 2P47B 3HG1E 2XPGB 2R2EB 3PWLA 1TCMA 5HDQL 3LKOA 4ZFGH 3MJ9A 4WV1C 4NGHH 1ZHKB 1G1CA 1SBBA 4Y4HC 3F6IA 3EFFB 5EOCJ 2FZ3A 1HSAB 1ES0B 3QQ4B 4PGDB 5ICXB 1DBBL 1ZXQA 4JJ5A 2F53E 4JFFE 2V9QA 3ALWA 1RJLB 5FYJD 1LEGB 2GSGB 2DM3A 2XACC 1ED3A 3RDTB 1T83C 3DNKA 3FO9A 3MOBH 1KB9K 1HHKB 3VWKC 4WW2F 4D9RE 1X6LA 4DGIH 1ZKAA 2EXWC 1DDHB 3OKDA 3D3VE 3WJJA 3DVNA 3S4SB 5KZCB 4XVTH 2XWJA 2VLKA 2AJUH 4A6YL 3OB0K 4QHLB 1XF3A 1QFPA 4ZSOB 4OCXL 5FECB 3TBWA 4YAQB 1F6LL 1MJ8H 3ESUF 1OT1A 3QFJE 1SEBA 3QEQE 2DBJA 4N5ED 5HYJE 4WFFD 3NACH 3TP4A 5JPMA 1YEKH 2CIKB 4DVBB 3HFMH 1UVQA 4N5UA 3SKMB 5F7FA 2J6EA 2CMRH 4XVJH 3EYQD 4FS0A 5K59F 1KULA 3FT4B 1N64H 1WFNA 5FF6B 3EOTH 4KHXL 3IDXH 5ISZB 5B39A 5B39G 5E99L 4JCMA 5C0BA 4F33B 2ZCLH 3QQ3B 4APQA 5T33H 5I2IB 1C5DA 4GKSB 3ZYJA 4MMZC 1OGAE 3HNSH 1NAMB 4LSDA 2ZUTA 2HN7A 4IMLB 3MO1A 5IB2B 4NNXA 1MY5A 2AK4D 1NPUA 1YDPA 2Z93B 3QB7C 1I7RB 3ULVD 3HI6L 4YHPA 1SM3L 1UACH 2IPKA 5MERA 1UGNA 4OGAC 2G75B 1YQVL 3RJDA 1WAAA 4XP5H 3FN9A 2CR6A 1KNOB 2V2XA 3V4VH 2GSIA 4GAGL 2F53D 4IRSD 4JFFD 3OKNA 4WUKH 1INEL 4OBSA 3T3PE 3CX5J 4WWKC 3UTQA 4X6BB 1ZE3C 3B5GA 1A6VL 4ODWB 1T3FA 1NEZB 2ARJQ 4KKBD 1H3VA 3BDBA 3MLWL 4FG6C 5DD6B 4U7SA 5DXWA 3U0PB 1NUNB 2DQDH 4P46B 1FZOB 2NLJA 1CTOA 5BV7B 4U6VL 1TDQA 4N8CL 3U1SL 5IMLB 1OSZB 4R0LA 1QBMH 2WUCL 4DCQB 3MROB 4PD4K 3D85D 4NQDE 1CVRA 2EDJA 3MRHA 5MENE 3MBED 3IRPX 3O3BA 4G7YL 2JCCF 5EC1A 4OBRA 2SEBB 3FJTA 3L3KA 4Z7VF 5JW4R 1IC4H 5FKPB 4QTHA 2E8YA 2GAZB 5DJ0B 1A4JA 1VA9A 3ESVF 4O2FA 4XVSH 3ZTNL 2VXUH 5HPMB 4MS8D 2R1YB 4Y1AA 3BWAB 4CJ0A 2B1HH 5DJZA 2AQ1A 1TZGH 3ARGA 4NBZB 3VFSB 5DDHA 4K94C 2FR4B 3FB7B 2VXVH 3QUYB 4LHUD 3CVHB 5ACZA 4CL7A 1JTPA 3VGBA 3TV3H 1WLHA 1CDYA 3S98A 4BJLA 4EBQL 1JGEA 1TCRB 2C7UB 3C9NA 4OAWA 5BRZE 1A6ZA 3ZT5A 3V7AG 4FTVE 4PJ8B 2X44D 4ZUSB 1RUKH 5AZEL 3ZHDA 3F5WB 5AD0A 4GMSL 3NIGE 1GRWA 1S5IH 2PTUA 4NKMB 4S10A 5C0ND 3P9MA 5HDBF 3EJYC 1JWUA 4PJEB 5C70A 2V6HA 1FNAA 2VXTH 2UUDK 4IRZH 5JORA 1P4BL 3NABL 4PJBB 1N0LA 3MV7E 3QDGA 1QO3A 5KSVB 5J13C 4Y4FB 3MXVL 5GGUB 1W72H 4OQTL 3K80A 4MJ4A 1HNFA 3SDYL 5SWZD 1A3QA 4QCIA 3FT2B 3PHQB 4OZIE 2J7LA 1TZIA 3ARDB 4L8DA 5L2JA 4PG9A 3VXOA 1KF9B 4WEBH 4PGCB 4K07A 2PUQT 4K8RC 5DHYA 5J3HD 1GGIH 4FFWD 2QV2A 4IHOB 5C09E 4I9WD 2GFBB 2J8UA 4RMVA 5IOPA 4M43L 1UZ6E 2V7NA 4ODHL 4RA3A 4QRPA 4TNVK 5SV4A 4X7SH 2FHBA 4YO0B 4XP1H 1BX2A 5E9DD 5DC9B 3AXLB 3VXRA 4RWYL 1CFQB 3QCVL 2LVCA 1S7SB 5B4MD 4PJ7B 1U91A 5IVNA 2VE6B 5C8JA 4NZTL 4P4KB 3VW3L 2NXZB 5IHZA 5D1XC 2EIDA 1C12A 4IIQC 12E8L 1LNUB 3BW9A 1JYXA 2Z8WC 1QLFA 3QIWA 3MYJB 4PY7A 1NFDA 1ZVYA 1CLZL 3KPSE 3TVMD 4R7DA 1HWHB 2JELH 4JRYA 1AO7E 4UV7L 3RVTC 3P0YH 4XBGB 2ORBL 4FQPA 4KI5E 1ZLVK 2VAAB 2I25N 3ROLA 3K2UH 3W2DH 1J11A 5DRWA 3OR6B 3LZFH 4GH7B 5F8QC 1F3DJ 1G6VK 1GZPA 3P9LB 4GSDL 1NSNL 3O2DA 3TBYB 4R4FH 3TO2A 2GUOA 5DHVB 5CIPH 1B0GA 1FNSH 1AI1H 1WC7A 2VR4A 3LN5B 5D7JA 3DO7A 3NFPA 2IH1B 4UOW0 5KBNC 1RAMA 5ANMB 3ZE2F 4D0DB 3M8OL 2FYYA 4UDUA 1CFTA 4X4ZA 1XGQA 2B1AL 3KG5A 4KTDL 2B8OT 1CR9L 1AQDA 4L8CB 3D39B 4HCRH 1ZVHA 2XG4A 3FAWA 2JK5B 4RISH 5ISZD 4UILL 1PAMA 3MREA 3SO3B 1LMKA 4KKLC 3O6LL 3O4LE 4FQ1L 4L3EA 5ITFB 2DTML 4X8JB 4K9EH 2GQHA 3D0VA 1MFBL 2ZSWA 2IWGA 3UYPA 5BZWB 5JOEA 2H3NA 4HEPG 3KPRB 2ICCA 2F5AL 2R15A 3G5YA 4K23H 3ZKNC 3QG6A 2CDEA 4YXLL 2OK0H 5C9KA 3GHBL 1PZUB 2D03L 4LPTA 4LEOA 5H94B 1QLRB 1FCCA 2D7OA 1T1WB 2ZWLT 5C9JB 2H2SD 4L4TA 4GW5B 4EVNB 3SQBA 1I8IA 3KPSD 3WV0A 4M1GH 4ZS7L 3SDCC 4QY8A 1KSRA 2I24N 3X11A 4KQ3H 5E95B 1ADQH 2MHAA 4DTGL 5E8EA 3KLHD 5HGGS 3CAFA 5ETUA 1H8SA 3RWHB 1DEDA 5HGHB 1HNGA 3NIFF 3QUMA 4JVWA 4P46D 3AM8C 2J88L 2PTVA 5DRNB 1HXMA 3KPQA 4P3DB 2WBJC 4XP6H 1QRNA 4PRHB 1OCWL 2X1WL 5FFLA 1UM4H 2H9GB 1C08B 1I8LA 1WEJL 1ZT4A 3DMMC 3QJFB 1PQZB 3IFLH 2FLBT 4M5YL 5HSFA 1JNLL 2WIIB 3LN9A 1ERNA 3BPCB 2OL3B 3QULB 5I73B 1ZANH 4FZ8H 3MX0A 1J0HA 3MNWB 1R0AL 1D5XB 6CGTA 1JPST 1EAPB 1G7LA 4S0SD 2I60H 1FZKB 1FFRA 1R3IH 1Q94B 3H7BB 3NCEB 3IFNH 1KJ2L 4NC1E 3QUYD 1U41A 1FE8H 1CIDA 3D48R 2UWEA 3VGDA 1VFOA 3WDIA 4OZHF 3W81A 3MV8E 1KENL 5DQJA 5BO1H 4ZPTA 2GJ6B 4U6YA 1IBGL 5ELIA 1CE1L 1I3RB 1PD6A 2LE9A 3QO0B 4PJ8D 4M6OH 3VGAB 3BGMB 2YUXA 5DMIL 3V6OC 1AIFB 3RWGA 2ARJB 4OJFH 4OZ4A 4EUPB 1FORH 3HG1A 2XQBH 2RIKA 3HS0B 3QUZA 4JANA 2BVQA 4ZPVB 4L5FL 3F58H 4IEFB 2DKUA 1L7TH 1CGTA 3UTZA 5IMMB 2ADJB 2HVJB 1F3JB 2D4DA 1E4WH 3OPZL 4R4BA 3HE6B 1BQSA 1KB5B 3KWWB 4WHDA 4B5EA 5GSVA 2F53A 5KW9L 4IRSA 4JFFA 1ZHNB 1FGNH 3ARDD 5EBGA 4R8WH 1X4YA 2YWYA 5B38B 4AJ0A 3B3IA 4LIQE 1MCEA 3WHE0 1T0NA 3MJGX 2BNUB 3NA9H 3QCUH 4PP1C 5D7SL 3SE4A 1A7PL 3D3VA 3EZJB 5I17A 1E6JL 3L3DB 3QR2A 4GT7A 4XCNB 4RGNC 3MCLL 3SQOL 5DQDL 3PWNB 3GI9L 3JWNC 5I15H 5DVMA 3QFJA 3HZKB 3QEQA 5HYJA 3FTGA 4NCDA 3EUUA 5GRUH 1MCOH 1RFDL 4XPAH 4P4KD 4PJCF 2LTQB 4KVNH 5L0QB 2NXZD 1UADC 3SBWC 3QEHB 1Y6KR 4LIQH 4WJ5B 4OFKA 2H2PC 2F54B 4NQTA 1N3NB 5T5NG 3QHFL 3SO5A 3RZCD 1G0XA 4XRCA 4LHUA 4LHUG 3EO9L 1IEAB 5I9QB 3LEVH 1OGAA 1PVHA 3U2SA 3UJJL 4DFHA 5ADPH 4OCSH 5AG8A 3CXDL 3MNVB 5CZVH 5GHWH 1I8MB 5DJYB 5D2LF 4ZUTA 1NCAL 1E4XL 3AGVA 3ILQC 1BGXL 3FOLA 4JB9H 2VITB 4YE4L 5JDJA 4QO1A 4XPGH 1JJUA 5DURB 5EUOE 3TH4T 1FGVH 3HC4L 3MCKA 4EN3A 2ATPA 1UA6L 5I18L 1TQCB 2V17L 4XBPB 4PB9H 1J8HB 3D39D 1N5YL 3E1F1 2PO6D 1GPOH 4LGRB 4HHAB 3SGJC 3QPQD 3BP6B 3NCFB 4BZ2L 1UM5H 3WLBB 2ZPKH 1F4YL 2XWBB 4X6EB 2DBLH 1H5BB 5T3XL 2AXFB 5LGJB 1FBIL 5DMKB 5EUKB 4ZUWA 1OLLA 1FVEB 3EDJA 1XGTB 2C26A 1BOYA 1MCHA 1S7XA 1SHMA 4Z5RB 3SOBL 4A6YB 5MENA 3QNYA 5HHOD 1NMCC 1WGOA 3Q6FB 3EGSB 3KPRD 4YC2C 3EBAA 3RVUC 4HKXB 1PSKH 1UXWB 2QADC 3RWDA 2Z91B 3VFTB 5IESL 3P40A 1AJ7L 4P2RE 4AQ1B 4OIAA 5E9DA 4JFPA 2DYPB 1D6VH 1GL4B 4OI8A 1JL8A 2HFGL 3P77A 1ZWIA 4MA7L 2Z9TA 1DUYB 5B8CA 4XXDB 1BVZA 3DURA 1B0RA 5F3HB 4HF5H 4X9HA 2XTJC 2EXWD 4LLMA 2E9JA 5KVEH 1J5OL 1NMAH 4JN1L 4ODTH 5BRZA 5GS1C 1W72A 4UDTA 4JM2C 1EFXB 4KPHL 2O5ZH 4ZO6A 5ALCH 1YC8A 4FTVA 2DD8L 3TVMA 2R0WH 2APXA 4OLXH 3BQUB 3O8XC 1KTDA 1KEML 3QXDB 5I1IL 4NN6B 1JN6A 5J1AB 4JFEE 1GOFA 2EYTB 4HG4K 2FX7L 4FOMA 1F2QA 4IRJC 4CDGC 3DJ9A 2R39A 1KN2L 5I74C 2V7HA 5I75B 2YPVL 3DBXA 3S34H 1HI6A 2PYFA 3HB3C 4PBWD 4ETQA 3MV01 4X9IA 4YIQA 3ZHKA 4AMKL 1DVFA 2B5IB 3MV7A 5C0JB 1MHHA 3J7HA 1IFHH 5IF0B 1UKSA 4XGZB 3I75A 2ENYA 1J1OL 3F8UB 3H9ZA 3S96A 3IDMA 5F21B 3L5JA 4OZIA 3F7VA 3TYFA 1A1NA 1M7IA 3QFDA 2GJ6D 4GQPH 3I6GA 4G8EB 3RAJH 1OVZA 4N0UB 5D9SA 2EKJA 1X9QA 2ZJSL 5HVHB 2P8MA 3VRIA 1KYOJ 5HHXH 3RL1B 1A5FH 3BH8A 4NP4H 1AD9B 4PV8A 4U1SA 4X6FB 1QR1A 4YUEH 4ZFOA 4UUJB 4YHOH 5IW6B 5IKCA 3IJYB 4W70A 2KKQA 1A9EB 3HE6D 2VR5A 5BOPA 3DVIA 4LPWA 1JPFA 5GGQH 3NH7H 4QRTB 5CGMA 3FQXB 3KPSA 2ZUXA 2EDOA 3GO1L 1OPGH 1AO7A 4Y5VA 2ENSA 3OKKB 4QXTA 4ZQKB 5BVPH 1ZSDB 4HCRA 5IWLC 1FDLL 4PRBB 2NY0B 3ZYOA 3ZZ1A 2F8XC 3RVWD 3FN0H 3GI8H 3WD5H 2FSEB 2YBRB 4X6CB 3PWJB 1QHPA 5IVZA 1YECL 2BNRD 5HHQA 3HN3A 3BKML 4XT1C 4POYA 4LLQB 5HDQH 1Q72L 4U2YA 1UFUA 1R3HB 1QHOA 3IRZA 3MA7A 3VFMA 4K7PX 5CSZB 3QPXL 4U6TA 2WWMC 5I1DA 3LD8C 3FB5A 1T7ZA 1XCTB 3F6LA 1XF5A 4GBXC 3LN4B 1JRHI 4S1DC 3CLFH 1U3HB 4K8RH 1QSEE 4NHUA 3QWOA 4E42A 4JFOA 3P11L 3IETA 2F54D 3OZ9H 5IHLB 1J87A 1JFQL 5E94B 3PQYE 1YPZE 5JOFB 1A7BA 2PR4L 5BXFB 5JR1L 3O4LA 4TOYL 3X17A 2OR7A 4MNGB 2X4UB 2GCYB 2BNQB 4DVRH 3O3AA 1S7TB 5EWIL 2X4SA 4CMHB 5MEPB 3X3GL 5IIEA 2Q8BL 4HFUL 5JW5B 2HFEA 2DOCA 1EX0A 4V2BA 1SQ2N 4ZTOH 2Z31A 4AEIH 2CDFA 3AB0C 3L3JA 5D1ZB 2FEEL 3ROOA 2OXGA 3M45A 1FZMA 1HHIA 5DURD 4JHAL 3QZWA 3QZWG 1XIWB 2XWTA 4G43A 3DX9B 4D3CL 3N1FC 1J8HD 3DUSA 4GG6F 2CLRB 2VL5A 2NMSA 4FQXC 4QTIL 1RK0B 2DLHA 1RULL 2E7CA 5EORL 5J9PA 4PG2A 3ARFC 1A02N 5D5MF 3RNQB 4I77H 5GQBA 5BS0B 1SJHB 3VJ6B 3K46A 1V3KA 4TVSa 3ALPA 1WV7T 1X5ZA 1JUFA 4ELKB 4UIKL 35C8L 2YEZA 3STZB 2ADIB 3NIDF 3CZFA 5JIIA 5J11C 3DTXB 3IXTA 4JO2L 3FQRB 5DVLA 4ZG1A 1HILA 4MSWB 5DUBB 5D7IE 1S9VA 2P8PA 5EU5A 1PW3A 4MQXC 5D1XD 2YHGA 4BSVA 4KJPD 1INEH 4ZAKC 4PREA 3AVEA 1CT8A 4XXCA 3GK8L 5DFVD 4RIRA 3S37L 2V2WA 1G7HB 1UEYA 2DYPD 3RVTD 1J0JA 3RWFB 3MLWH 5D1QC 1ZS8A 4YXHL 3SDXE 2X1XR 4JM4L 4U6VH 2LU3A 1K2DB 4N8CH 3U1SH 3GMLB 3TH3T 3MV8A 1I7ZA 2BVUA 5TF0A 2P5EE 1DANT 2Z35B 1EFXD 4ERSL 4G7YH 1VGEH 1TTGA 3ZDZF 5J4MA 1U92B 2NXYB 4M6AA 3BQUD 2FJGA 3RZCA 3GSUA 3GIVB 3BGFC 1YNLL 5ERWB 1DBKL 3ZTNH 3P73B 4KXZI 5A40E 3PJSA 3OAZK 3DV4A 3OG4B 1H15A 4HKZA 4HJJH 2Z4QA 1U8HB 3H9SE 1A1OA 1H8NA 1E28A 1U6AL 5IBTH 4WW2C 2EDYA 2IANB 1SYSB 4Z7UE 3WN5A 4JGUA 1X44A 4QOKD 4EBQH 5GS2D 4KKLD 3SKNB 1JPSL 4OGZA 4HUVB 3SE3A 3NCJL 2ZCHL 2VXSL 1J18A 1FYHB 1ZT1A 3IDNB 3VFRA 3GSOA 2PO6A 3GRWA 3H3BC 4OZGB 3NN8A 3L6FB 1MI5B 4E9LA 4FFYL 4GXVH 3RGVA 4F7MA 5CGYD 2VSDA 3ET9F 5ESAB 4LASL 3V6OE 5C0AB 4MDJB 3K8MA 5C71A 4JKPL 4LPUA 1EXUB 5HVWA 1JF5A 1P4BH 4NZDA 4YR6B 3C6SA 2QQLL 1Z9MA 1I4FB 1HHGA 5HHOA 3G6JB 4LU5H 1RIVL 4WV1A 1RHHB 2WLYA 2W65B 3VFVB 3EJZC 4X98A 4Y4HA 4PJHF 1X5GA 3RVXD 5IB3B 4M4PA 4E0RA 1UQSA 4M1CC 4KUCF 3CXHJ 3GEWB 4U1MB 3TIEB 1T4KB 4YBLC 5DRZB 1T83A 4GXUM 5IBLC 2VWEE 2EIZA 5FDWA 1K4CA 4UTAL 3VWKA 3DMMD 4IRJB 1MCSA 3L5IA 1NLDH 3P4OA 4M43H 5J6GA 2NY0D 1NDGA 4Z7WE 1NANI 4Y89A 1HSBA 4BFGA 3SKJL 2XG5A 3W9EA 3C8DA 3MMEA 4IOSD 2WQRA 4PJIE 5L7XL 1AGBB 3H9SD 4HW6A 4RGNE 5DJAB 2NQCA 4LDOB 1N4XL 4EQ3A 4RFNC 4NZTH 1CICB 2ZSVB 2C3HA 3O4OB 2BSTB 3SDAB 5F89B 1EZVX 12E8H 1MFDL 2Y5TB 4O4YH 2YPLE 3UTSE 4P5MA 2ZKHL 3PIQA 4F58H 4U1JB 4LGSB 5CEYB 1WBXA 3QI9B 4ELMB 4FXLA 2H8PB 4MD4A 5IVXF 4K7FA 5IEKB 1IGML 1CGYA 4M6ML 2VSCA 2EDTA 5FCUH 3QNZB 4FQHA 1NSNH 5KS9F 4M6NL 3SCMC 2HLFD 1QFWI 1RD6A 2YPKA 4NFDA 4ZMAT 2FCBA 3QDME 2F74A 1IM9D 2IQ9L 1RZIB 3M8OH 4Z6AT 5HGDB 1KACB 4WCYL 2B1AH 5D1ZD 4KTDH 5GGRB 1NH6A 3CFEA 2ADFL 3CFJA 1CR9H 1MJ7L 2FO4B 4P2RA 2AI0L 5JNYB 4L4VB 1T20A 1OD9A 4HS3A 4K7PY 3VD7A 2D7TH 4WWKA 1AR1C 2NY2B 2IPUK 4DUXA 2X89D 3T0XA 3OKMB 5SWSD 4WGWB 2X5PA 2FBJL 4OUUB 4PP1D 1KIUA 4JFHD 2WQ8A 4NQDB 5C0GB 2HT4C 5BS0D 4G8GE 4OB5L 4RGND 3ZDXF 3JXAA 3RIFK 5MEOA 3RHWK 4YXLH 3LEXB 3MRJA 2EICA 2C4FU 1AGCB 1P5UA 1JWSB 4LRIC 5B38G 3GHBH 2W60A 4MZ2A 3GSWB 3IDJB 1T2XA 5EO1B 4YDIL 4JZJC 4JRXB 2BNRA 1Q1JL 4U0RB 2UYLB 3RTQB 4ZS7H 2H2PD 1JNJA 1JWMB 4DTGH 4L8SB 4HK3N 1XFPA 2GITB 3TC9A 5F44A 5J12B 3BH9B 2Y1VA 4JGJA 1R24A 5CP7B 4OLZH 5E5RB 1WZLA 3BZDA 2ICWA 3F7YA 3DUUB 1N6QL 3L9RA 1HQRB 5FB8B 2J88H 2XTJE 2EIEA 1IGCH 2ZOLB 2FWOA 4NQCB 1AGEB 4GRMA 1LE5B 1OCWH 4MA1C 1JV5A 2COQA 4HGWA 1WEJH 4KMTL 3OSKA 1MWAH 1UJTA 3MGOB 4PRPE 1JNLH 2XY1A 4HH9A 4JFYA 2I9LB 2RCSL 3RWJA 1R0AH 2DQFB 3PHSA 3QHTC 4GG8A 5CP3H 3U82B 1FG2A 3CDGA 3P4NA 2QR0B 2DKMA 3PWVB 1CLCA 1KJ2H 5DFTA 3MLVH 3ARSA 2IAND 5D2NC 2WK2A 2WNGA 1I1YA 2BX5A 1QD0A 5LKNA 3PGCB 2PXYB 4MCYB 1KENH 4Q9BA 3JWOL 1N59A 1FFQA 4LBEB 1S9XA 1VFAB 1BQLL 3WIFA 4CUCA 3FFDA 5CEZL 3KJ4C 2ADGB 1A47A 2HRPL 1OB1A 2HTKD 1J1PL 5C09B 4HZLB 1IEBB 1KXTB 4YHML 4OLWL 3E6FB 1QG3A 2FX8H 2QADD 2IBGA 2O26U 4NKQB 1ZLUK 2FX9H 2C1PA 3DRQA 1AHWC 2G60L 4G6ML 2Q20A 3WLWD 2EDEA 5GZOC 4JFZH 2OTUB 5D1QB 3OPZH 5DJCA 3PGDB 3BKCH 5HI3C 4JY5L 5JIKA 4H5SA 1A21A 5IHBA 2V5MA 3LQZA 4F8QA 5D1XA 4MNQD 5KW9H 1K8IB 4XPBL 1QSEA 2GYSA 2OI9C 3P3YA 4IIQA 1LGVA 4HKBB 1TVBB 2ZG3A 4JM2D 2XXCB 1U8PB 4P2QE 1WZ1L 5F96H 1DUZA 3F65A 1XGRB 7CGTA 3MRRA 1Y0LA 4PY8J 4UB0H 1YPZA 1NBYA 1BJ1J 3NGBC 5D7SH 1Q38A 3TJEL 4IRJD 1E6JH 3AREC 3M1BB 1G6RL 2OMBA 2NY7L 3LSOA 2MQCA 3WKNA 4XCCL 4YJZL 2GTZB 2VYRE 1XF1A 3GI9H 2Q7NA 3VFPA 5C07E 4PJXF 4JPWH 5E2TH 3TNMA 3GMQB 2CIIA 1CICD 1W0YT 2E7BA 4S11A 4DZ8B 1W0VA 3GZKA 3EDEA 1HCVA 2CRMA 3T8XA 3HHRB 4ALAL 4NQEE 3L7FB 4PRAA 4HAGA 3QHFH 4PJGB 4GKNA 2YOCA 1EGJL 1EJOL 3D9AH 1BBJB 3VE0B 4QOKA 2D31B 2XKUA 1G7JA 1T7VA 3AU1A 4R4ND 5DD3H 5T3XE 4R90L 1CDIA 3PE9A 3VXQA 3HRZA 4XP9L 1QP1A 1E4XH 3HA0A 4OQ1A 5GJSL 4Y5YB 1BGXH 3VGHA 1D5BB 3CFBB 4V1DB 5KAQG 1X5KA 4KK5C 3LKQB 4Y16C 4YE4H 3W11C 1AR2A 1UA6H 1SYVB 2MNUA 3P0GB 4PY8I 4HUWA 5I18H 3T1FA 4FQJL 2V17H 5JXAL 5GZNC 2X4TB 1L0YA 2Q8AL 2F19L 2XA3A 3MRIA 2Z8RA 4I2XE 3SDCA 4XPHL 4BFIB 3X13B 4L4VD 3ZSSA 1BVLA 4POUB 1F4YH 2NY2D 4GW1B 4CVXA 4ETYA 3ZT7A 5T3XH 2OR9L 5ILTL 3SDXA 2VH5L 3HUJA 4X5WA 5GIRB 2A6DB 5I16A 3DGGB 2P5EA 3AM8A 5A2LH 4PR5A 4N1EA 1HH9B 1KFAH 2WBJA 2JLLA 5IFAL 3J8F7 4KROB 4MAYC 3O45A 4Q2ZA 1SEQL 2VLJE 3W39A 3UC0L 5DF0A 4QLRA 3D6GA 4G8FA 3DMMA 5C08B 3ZKXC 1U95A 3T1WA 2MQ3A 4KJQD 1OAZL 2HMIC 4C83B 1BFOB 5IESH 4S1DD 3MRNB 2B20A 5JHDE 4JRXD 4ZODA 1S7RB 3H9SA 2VLME 2LU7A 2BC4A 3CPLB 2DN7A 5FGCB 2F58L 3FONA 4Z7UA 4YEEA 4LF3B 5M94B 5I1GH 5T5FH 4NM4H 3VWJB 3KYNB 4LVOC 3TFKC 1I9EA 3FKUS 4TTDC 32C2B 4TUJB 3RGHA 4NQCD 1FC2D 1PYWA 1BAFH 3JWOC 1T1YA 1KEMH 1WFTA 4NN5C 4NZRH 4HJGB 2VUYA 5I1IH 3BVNA 2FX7H 2QKIA 4JY4B 1P4LA 3JV4A 3V6OA 1NC2D 2ZCKL 1KN2H 2YPVH 3VH8B 3A0OA 3CC5B 4JKMA 1YEGL 5CJXC 4X4YB 4O5LH 4FQQB 4HLJA 3MRQA 5KSAB 1GVIA 2I07B 4RBPK 1IM9A 1J1OH 4LLWB 4NCC1 4WHTA 3H3KA 5SWQB 4FQXD 5AG9A 4UNUA 5CHNB 4ZYKA 5C1MB 3ARFD 5FGRA 3KVQA 4N0YL 2PXYD 4QKXB 2OBGA 3SN6N 3U4BH 3B9KB 3B9AA 1L6XA 4H26A 3FZUC 4LVHB 3FO0H 5KG9B 1FL6A 4KAQL 6FABL 2HKFH 4S1SH 5SWSA 5I1LB 2ZJSH 4NQXB 1AD0B 1J1XH 4Z7WA 4DGVL 5K59E 2MCPL 2O61A 3INUL 4PJIA 5A16A 1G7PB 1R5WB 4N8PA 1KT2A 3QDJE 1G7IA 1H0DA 2YA2A 4UQ3B 4FABH 5EIIA 3FL7A 1OP5K 1P2CA 5D1QD 5DJ8B 5L9DL 4AEHL 4NFCA 2YC1A 2YPLA 1RIHL 3UTSA 3SBWA 5IVOA 4JR9L 4G8IA 1A9BB 5F9JB 3GO1H 5TGBB 2X4QA 1EVTC 4LCYB 4ZFFA 2V2TB 1DBJL 4FFVC 5GSRA 1IM3B 4GFTB 4MD5A 1AC0A 3HZMB 3G04B 3VXNA 2BVOA 1FNEA 1KIRA 1MH5B 4NQUA 3EHBC 3IDGB 4KKAD 1YECH 5HHPA 4I4WA 4JHBA 4KRNA 2R56L 4RQQB 5I71C 3KPTA 1Q72H 3VD3A 1CXKA 3PWPB 5LG1A 3QDMA 3QPXH 1X6NA 1CD9B 3OXSB 3QSKB 4YHNA 1DQDL 3BDYL 3RUGB 3GHEL 5EUOB 4IOFC 4U1GC 3ARPA 3WL9A 1F97A 1KCKA 2CKBH 1HIML 1AXTH 3V8OA 1YN6A 4G6KH 4POZC 5F1NB 3HE7C 5AZ2H 2G5BB 2F9BT 2AV1B 1CD1A 2JCCE 3SGJA 4MXWL 4Z7VE 5TE6L 4B7IA 2D2OA 3FFCE 2V5TA 4LHJB 3UX9B 4TOYH 1UB6A 4LCUA 4YBQC 1Y6NR 4RGOL 1CFSA 1XF2A 2AJSH 4XNUL 3AS3A 2ITDA 4B50A 4LPYA 4D0BA 1AGFB 3VFUB 4HFUH 5EOCH 1JPTL 1CLYH 3V5KA 2QHRL 2D0FA 4LL9A 3WEXB 3UPRB 5CJOL 1P1ZA 1WF5A 3Q3GB 1F90L 1SJEA 3FO1A 3I6LD 4X4MA 4LKCA 5H35A 4LSSH 4PJFE 2R29H 3EJZD 4UIMA 5LVEA 5CGTA 1NMBL 4HV8A 4ZFZA 5CZXD 3MLUH 3RIAF 3EO0A 1I1AB 1T0MA 1OOAA 4D3CH 2VDPL 1NGZB 1GXEA 4M1CD 3WUWB 4E5XB 4XTRC 4L1DA 4QTIH 5IBLD 4LLVA 2IGFH 1M6OB 1UG9A 4FZEH 1NJ9A 4JJHA 5CP3A 4G6FB 1ETZA 2OSLA 2OQJB 2VN7A 1GZQA 1HINH 4AM0A 4BSWB 2VNCA 4U33A 4MNQA 1KJ2A 1CGUA 5GS1A 5D7LB 1BQUA 4P23C 4L4JA 5DUPL 1J88A 5FYKE 4JM2A 3ZYIA 4JO2H 3L95B 1MREH 2BVPA 1UWGL 4JFEB 4M00A 1LO0H 3O8XA 1XF4B 2W0FA 4KROD 2E6PA 4MWFA 4ODUA 1HCFX 4WW1B 3GSXB 4OT1L 4M9OA 2IBZX 5C08D 5C7XH 4HJ0C 2E7MA 3D0LA 1B4JL 4UOW1 4WU5B 1HHJB 1T21B 4K3DL 5E8OA 3REVA 3S37H 2VC2L 3KLDA 5CWSA 4MJ6A 5DGRA 2DM7A 1T5XB 4QXUL 3FFCD 4YXHH 2XFXA 3O6FB 5T1LD 3LKSA 4QWWC 5FYKH 2XRAL 3WFBH 3TZVC 2P1YA 1NDMA 1OAKL 3CCHB 3IU4L 4JHWL 4Q6IC 4HWUA 1URLA 4U31A 2XY2A 1YEHH 3SCMD 1V3LA 4XAKE 3VFNB 4L9LB 1QFHA 3FT3B 2E5EA 1U8OB 3IT8D 4XP4L 1IGJB 5DJ2B 1N2RA 2P7TA 3CLEL 3CSYA 4OZHB 1N0XL 1P6FA 2W0KA 2BMKA 3C5JA 3PNWA 2CK0H 1JMXA 5E4EB 4PJDB 4NN7B 5D96B 2EDFA 4JZNA 3DYPA 1AR1D 4LCCB 2LV4A 1QEWB 4LDLB 5D2NE 1G9NH 2DWDA 5DS8B 1I7UA 3NCJH 2MKLC 1A6TB 2ZCHH 2XZQL 4MJID 4KJYB 2VIRA 1JPGB 2HT4D 1HDMB 4X99A 3WS3A 4P2QA 4JPKL 3B9KD 3FQWA 1A1MA 1J7VR 5J57B 3U48A 3ZE2E 3G9AB 2X4PB 4LASH 5IWLA 5KSBE 5IB5A 2FH8A 2YUWA 4O2CB 3FQUB 1CDGA 1DE4A 1HEZA 4R7NB 2ZUUA 2QQLH 3CUPA 1U58A 1ZTXL 1RZGA 4KWUA 5EPMB 3JUYA 3GJEB 2RAMA 4GXUN 4BYHA 3LKNB 3VU2A 3K8KA 3C60B 5L6YH 4XHJC 5TE4L 2NCMA 2QL1A 2YD4A 5TDNB 5FHAH 4DEPB 4PRIE 3L7EB 3MQIA 5L88H 4F7TB 4GBXA 2G5RA 2IG2L 3O81A 3EOBA 3FMGL 4M7LL 1T1ZB 4JDTL 1M7DA 5F1IB 2QTEA 3PQYB 4HUUA 4UTAH 4ODVH 3PP4H 4I48A 3KHQA 3GMOB 2VZSA 3TGXA 2BERA 5DUMH 1WZMA 2ICEA 3SY0A 4D9QD 4B7LA 2Q86B 4QHNB 2X7LA 2NPLX 3U9PL 3O3EB 4NSKA 5DJDA 3V0VA 2PTTB 1JI2A 1FSKB 5L7XH 5HXMA 2YWZA 3VXSB 4UQ2A 4HWZA 4P4RB 1H3WM 1QFWL 3Q2CA 1N4XH 4UU9A 3PWPD 3VMOA 2BRQA 4JPVH 1QVOB 3WE6B 2JJTC 3NFNA 3V6ZA 5CJBA 3X12B 3MODL 1T03H 4PRDB 15C8H 3MRGA 4R2GC 1NC2A 3U6RA 3NIFE 3BAEL 4LMQE 4YFDB 3G5XA 1MJJA 1RMFL 4WIQA 3L1OL 2PCPB 3MRBB 5IG7B 4KJWC 1XZ0A 4JFXA 4CU6A 4I2XA 3FQNB 1YEDA 3MJ6A 2FIKA 4FXKA 3BP7A 4HPYL 4FQXA 4M3KB 3WNLA 2JE8A 3O9WB 5I1KH 5INCA 4Y8DC 4UT6H 1YMMD 2GY5A 3ARFA 5DSCA 4K2UL 4N1HB 5F7NC 4NT6A 4IS6B 4CMMA 2EDQA 3WHE1 4QHUB 1YNTA 2IQ9H 5EN2A 3ULUE 3MRLA 3HKFA 3MOAL 5D7IB 1CBVL 4PJEF 3R0NA 1WK0A 4LCIL 2ADFH 5HI3D 4XX1E 4C4KO 4UBDC 2CLZA 4PJBF 2CO7B 1CG9B 3UJTL 5JHDA 1FFPA 2AI0H 4ZAKA 4HIIB 4PJ5B 4W4NA 1I1AD 1F3DH 4YFLF 3L5WB 1OAUL 5HD8D 4HUKB 2P43B 2VQ1B 3JSSA 2FEDD 3HMXL 1CD0A 2FBJH 4F7PA 2H32A 4R96B 1FO0H 4G3YH 3THMH 3ARED 4HIEB 5EO9A 3Q1SH 3ULUH 5IGXL 3MUY1 5CILH 4CVZA 4OB5H 4YDJB 5ESQB 5IQ9A 3VCLA 3W5MA 2HYMA 3MV9B 4OCLC 4U6HB 4U6XA 5T1KA 1LK3H 3NVQA 2R1XB 5F6IB 5KN5A 3TCLA 2GTWB 1Q1JH 2HT3C 1LO5A 1U8QA 5EIVA 4PJ7F 1P4IH 4DW2H 4YDKL 3TCXA 5MI0C 3VXUB 5AAMA 1L9MA 4X6DE 1ZLSL 1P7KB 3OJDA 5LWYL 1X5IA 1FZJA 4NO3B 2XKNB 2N7AA 4WW2A 1LVEA 1IL1A 2AJ3A 4F7CA 3KXFE 3BPOB 1N6QH 4OM0L 1DQQB 1T2QL 2QLVB 3ORJA 4JDZA 3U9UB 4D9LL 3BGAA 2X6MA 3QT2A 1JVKA 3T0WA 3NAAL 1S9WB 3CVIH 2LFGA 1XMWA 3KLAA 1F45A 3OB8A 1R3JA 1S5HA 2R2HB 3D2UB 4ISVA 5HYFA 5IHUH 2VLLB 4WY7L 1SBSH 4PP2A 3L3HB 5MHSE 1BZ9B 5ID1A 1QQDA 2NY3B 4PJCE 2R8SL 3DVGB 3GKZA 1TJIH 5HJ3A 1INQA 1IAKB 2CPCA 1R5VB 3R0MA 3GMPB 3V5DA 1DLHB 1U8JB 3T0EC 2X70B 4HEME 3QDJA 2XA8L 3LB6C 5CJ8A 3EJJX 3PL6C 4RNRB 3PWUB 1A7NL 3BUYA 2IBZY 2GT9B 4LLUB 2VO5A 3JWOH 4UT7H 1QBLH 3D69B 1BQLH 1GGUA 43C9A 5T3ZE 5D2LE 4NO5A 4TUOA 1YN7B 4ZS6D 2CKBA 1MHPH 4BH8B 1NCWL 1MFAL 1J1PH 1UJ3B 4LARL 4U1KB 1YEJH 4MAYD 4NJAL 2B4CH 4NZUL 4YHMH 5K33A 4OLWH 4YPGA 4NDMA 4JO3H 5E2JA 2FHCA 1BJMA 5D6CB 4NNYB 2HMID 1TVHB 3BZFB 3GB7B 1AGDA 1CTNA 1Q9LB 2IC2A 5SX5K 4AH2A 2G60H 4G6MH 4NM8H 4HFWA 4FQ2L 5DYOA 1IKFL 3BP4A 1R3KB 2VDQH 3M17A 4F15B 4NKDA 1HOCB 2JTDA 5T3ZH 2XNAB 1UXSA 2Q7YB 1RHFA 4FQIH 2C3VB 3TFKD 4XPBH 2VZ1A 5EC2B 4CNIA 4JLRB 2K3TA 4TTDD 4LVNC 4CN1A 5LCVL 5FYKU 3H6JA 4GKZB 4TRPL 2DWEB 3H0TA 4KRPB 1MUJB 4QRQA 1JIBA 1ND0A 2JCCA 3GIZH 4I5BB 4Q7DA 4Z7VA 1TJGL 5CEZD 4F2MA 3FFCA 3TJEH 5T1LA 3BT2H 1W8NA 4U1IB 4R97B 1G6RH 4OCMC 3IVKB 3RWIA 3VXTB 4AENB 1S7WB 3CK0H 2VTFA 3SCMA 3KAAA 4FRWA 3PP3H 1KN4L 5F7WC 4YDLC 3OR7A 2ICWJ 2I9TB 1A6UL 2GY7B 1WSST 4HXAL