2YK1L

Structure of human anti-nicotine fab fragment in complex with nicotine
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
207
structure length
188
Chain Sequence
ELTQPPSASGTPGQRVTISCSGSSSNIGSNYVYWYQQLPGTAPKLLIYRNNQRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCAAWDDSLSAWVFGGGTQLDILGQPKAAPSVTLFPPSPKATLVCLISDFYPGAVTVAAGVETTTPSKQSNNKYAASSYLSLTPEQWSYSCQVTHEGSTVEKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB FRAGMENT, HEAVY CHAIN
publication title Different Binding Modes of Free and Carrier-Protein-Coupled Nicotine in a Human Monoclonal Antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 35
structure length 188
sequence length 207
ec nomenclature
pdb deposition date 2011-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2yk1L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2yk1L01
5E1AB 4C83A 5IW6A 3RWCB 3Q6GL 1A1NA 2BVPA 3C8HA 3QEGL 3VXRB 4AT6A 1DBBH 4ZUWA 3RUGB 1I7ZA 3IRZA 2Q7YA 3SDYH 4L29B 2VIRB 5BVPL 3SKMB 4PR5A 5T1KB 2E3VA 3T0DA 2EKSB 4RFOL 3IDIA 5F3BB 1IGJA 4LVOB 5E9DD 4Y0GA 1J87A 2F5BL 3L7EB 4UZGA 5IQ9A 4XPTL 2C3VA 2X4RA 4R90L 2FGZA 3CLFH 2GAZB 4UDTB 4MQSB 5D8JL 5ACLA 1WIPA 2QSQA 5I75B 5MHSE 4GMTL 1MUJA 3WFEL 1INQB 5L2KA 2EEDA 4FABL 4YNYB 1Z5LA 2R1YA 4GW4A 3O11B 2DWDA 2NYYD 5FCSH 2DWEB 1BREA 5E8EB 1FIGL 4J1UA 4M6NL 3TO4B 2X10A 2VERN 1CLOL 2CKBB 4BA8A 4LCUA 4MNGB 4CVWA 5CHNA 1DEDA 3HMWL 3STLA 4TPRL 3DARA 4M7LT 1N4XH 4HF5L 3KPMA 4KK8C 4KDWA 2YPKA 3SGDH 1JF1A 3DO7A 4QYOB 1ZT1B 2CQVA 1GH7A 1UYWH 4WGWB 4HLZG 2GJ6B 1AO7E 4BH8B 3MO1A 1J18A 4DAGH 5E8PB 3S96B 1EAPB 4JRXA 3TBWA 4M1GH 4HS3A 2BNUA 3EOAB 5DQDH 4RFEB 3WD5L 4WU7B 5CIPH 4XMKL 3L5HA 3GO1L 4JRYE 2MCPH 4JRWA 3S7GA 1D5XA 1CLZH 3WN5A 4F7PB 1CT8B 1GIGL 4R7DB 2VDLL 1YQ2A 2NY6C 3P3YA 3UO1L 4CMMB 1H3XA 1Y6NR 1X4ZA 3BH9B 3SDAC 3MV8D 1FNHA 4OV5B 1IZJA 5D72H 3MGTA 4EVNA 1A4KB 3TPUB 5D2NB 1JJUA 3JV4B 4Y5XC 4G5ZL 3MLVL 3BZDA 4GAFB 5MEPB 3VFSB 4J3WA 3BE1L 4GXUN 2VITB 1Q9LA 4EN3D 3ARGB 1NAMB 4X4MA 5E2WH 1JGDA 1N2RB 1PSKH 3O81A 1KB9K 1ZHLA 2DLFH 1OAXL 4WWKB 3BAEH 2RCSL 4DUWA 2P49B 5FCUL 4E0RA 2IFFH 1Q9KB 1S3KH 2VYRE 4XB7A 3VFVA 1AGEA 1J1PL 2IBZX 4MA8L 4PJBB 1MCOH 3KVQA 3VFWB 2XKNA 2QSCL 3G5VA 3IJSB 4R97B 3GSUB 3C60B 1P84K 4I2XB 3U9PH 4JPKH 4MB3A 4KH2A 4PJFF 3VG9B 1P4IH 5GS1A 1F5WA 3O8XD 4X6DF 1S5HA 2DICA 1IAKB 1GGCL 3KLDA 4KK8D 4X9IA 4E9LA 2E8ZA 3D25B 1AFVL 4NC1C 4PLNC 2F5AH 5A2LH 3V0WH 1NBVL 5JDJA 2FWOA 4FTVB 1Z3GH 3RY6A 3EOTH 3S4SB 3RKDD 4AL8L 3GMPA 4FFVC 1TVBB 4P46D 4LEOA 5IB2A 3WFZA 1SJHB 5DVKA 1KJMA 5EC1B 1JPSL 1C5DA 4KHXL 2E7CA 2VLMD 3BGMA 4QLRA 1U8OA 4MD0B 1C7TA 1V7NH 1TQCC 1MFAH 3VFUB 2EYSB 1IE5A 2NY6D 5HDBF 4FQCL 3S36X 3KPPA 3CVHB 4F7CA 3SDAD 5DT1L 4N0FA 3VG0L 3V5KB 5SWSE 4ETQA 3VW3L 4HS6B 4Y4HB 5JR1H 1YNKH 4NQDA 4QXWA 1D3CA 4J23A 5I19L 3MCG1 3D3VD 2X4QB 4K8RC 2VNCA 4PY7B 3WXWH 1NGZA 2HFEA 2VLKA 3CDCA 1L4IA 4NNPH 5HYSA 5DVLA 1KIUA 1ZOXA 3P4OA 2KZ1B 2EYRB 3E8UL 5EZJB 2VXUH 1SJEB 1YEEH 4HWBA 5FUZL 1AY1H 2ZG2A 5ALBL 3MV8A 1IGML 1U91A 1I7TB 2FO4A 4Y16C 1HSBA 5I8OL 3I2CH 3NZHL 1IEHA 1MJJA 3WFDL 3T1WA 7FABH 5IROC 1BMGA 2NXYD 2DDQL 3RU8H 2CXGA 3VGBA 3MV7A 1W0YT 4DUXA 1LNUB 4KU1A 2PYEB 1X6NA 3WIFA 4WO4B 4P9MH 2GSIB 1T1XB 4XBGA 3RAJL 3D0LA 1CGWA 1NC2B 2FL5B 1UCBL 5BXFA 1R3HA 2YUWA 3NTCL 3CIQA 3ARSA 4CDGC 2NY2D 4NN6C 3CC5A 1IM3A 1JVKA 1HXYA 4P9HL 4GKNA 4PJXA 3WIHL 3BWAB 5HHMD 3L1OL 2VB5A 3N0PB 5HYQB 4RGOL 2LAGB 3DV4A 4WU5B 4F3FA 4RX4A 5I0DA 2JELH 4OT1L 3O6KH 1S8DA 1A6TA 4FFVD 1JRHH 1XGPB 4ETYA 1WC7B 4ZPTA 1FDLL 3AFLA 4AEIH 3CU1A 2K1MA 1AKJA 3LKNA 4WENB 1GOHA 4O2CA 1XH3B 4JN2A 3D39E 4ZUSA 3GJFA 4K7FB 3FT2A 3MFGB 2V9TA 3BH8A 2ADFH 2X4NA 4UOJA 5GGQL 2A77H 3BESR 4QHKI 1CLYL 4UQ3A 5HY9A 3TIEA 5IGXL 1C12B 4B7LA 1XGTA 1JNNL 1AGDA 1I3GH 3JVGC 4U6XB 5TH2A 1BZQK 5GJSH 4AIXA 5DSCB 2PR4L 4XP9H 4PJHE 5CSZB 1ZLWH 5H35A 4U1KB 4FNLH 2E6JA 1RK0A 5DRXA 1EVUA 4LLAA 2XNAB 4K8RD 3O2DH 3L6FA 1M71A 2C7UB 3PP3H 4D0DB 1NDGB 3VXNB 4WJ5B 3ZYIA 5LGHH 2DQGH 4PUBL 4CJ1A 4XPFH 1U8NA 4LU5H 1ZAGA 5BOPA 4OCXL 5LVEA 3SDAA 3CFDB 3EDDA 3H3BC 4HUWA 1OP3K 2VQ1B 2FSEA 5GGVH 4Y5XA 4L9DA 2R39A 1BIHA 2D9CA 3MRQA 4H0IA 2AS5M 1MCRA 1I9IH 4H5SB 3H9YA 3D3VA 4X7CC 1U6AL 4Y1AA 5ID1B 3T4YA 2R0LH 4U2YA 2ATKB 2CK0L 2V5MA 3MLYL 1FH5H 1FLRL 3U0PA 4D9RD 1QVOB 1C5CL 2B8OT 5FYLH 2F8XC 3IXTB 2I26N 4O2FB 1UM5H 3FOMA 3MRRA 4F7EB 5D7IE 1NMAL 2ZUYA 3IXAA 5SX5H 3O4LD 1EEYB 3DSFH 2Z8SA 4B41A 3IDXH 3SQBA 2VWEC 1WZ1L 3SKNB 5LAXA 3RGVC 3VXSB 1PKQA 4CU8A 1SEBA 2FZ3B 2J2ZA 3TA3C 3DIFA 4PJ5B 4NWTL 3RHWK 1S7QA 2X70A 1EEZA 1CFNB 4XVSL 3FB6B 1G7JB 4BJLA 3MJ8A 3D69A 4HBQA 2LQRA 1FJ1B 2E5EA 4LPXA 4YHYC 4GUPB 3BKCL 4RMUA 3GSXB 4NM4H 4XPHH 1FVDB 3QDAA 2XQBH 4QTIH 2Y6SC 3S9DB 1CDHA 3KDMB 5EORL 3GI9H 1NKRA 4BFEA 1A2YB 4OZGE 3ME0A 5GJTH 1IM9A 4HHAA 4GW5A 3VGAC 1TETH 4RWYL 2NY0B 3Q1SL 4HEME 2BNRD 4UB0H 3WKML 2HJKA 3T65A 2VDPH 4MD4B 5D6DC 1S7UA 4TULH 2FATL 1MIEH 1YPZE 4HG4K 2OLDA 4PJBF 1TITA 5EU6E 3ARFB 2H8PB 4LCIH 4E5XB 2EDEA 4NO5A 5DJ8A 3RWJB 3OKEA 1JZ8A 3QAZC 5ALCH 5FXCH 3NH7H 4XNUL 4YGVA 4JB9L 1FZKB 4XXDA 3UAJC 5J1TC 3EJJX 3SO5A 3MRFA 5ITBL 4OGAC 5LWYL 3WLBA 3QQ4A 1ACYH 1HSAB 3ZKQD 3B2VH 4Y89A 5EN2B 1L0QA 5CKAA 1I1RA 1J0ZA 4UU9A 5T3XD 4CVZB 4LFHG 1QPPA 4IRJC 3MRHA 1D9KD 1AGFA 1OAYL 3S36H 1UT9A 5CWSB 4TRPH 2GFBB 3VXOB 2YN3A 2PTUA 3T04D 4Y16A 1AD9A 1CIDA 4M7KH 4ODBD 1I8MB 5IROA 3RGVD 3TA3D 4AMKL 4G8FA 3GM8A 3BZFB 1F13A 1QBMH 4MA7H 2HG5B 3DXAE 4MJ6B 5C3TA 3L7FA 4RAUB 1OVZA 1K4DB 4HH9A 2Z35B 4NCDA 5F9AC 4UTBH 4ZPVB 3KHQA 5HXMA 3G6JE 2R1WB 1T5XA 2F53A 3O4LA 5H37G 2Y6SD 3BKMH 5HYEA 1G6VK 2DLTA 2YPLE 2FB4H 4I1NB 4YHLH 3BZEB 3EYFB 2CKBL 1JGUH 1T1YA 4IS6A 5KVFH 1E4KC 4QY8B 3S34L 4MCZA 1QHOA 1XGYL 1MFEH 2NX5E 3ARZA 4ZTPH 2ZSVB 4GMSH 3MUGB 3HPLA 1ZLUK 1ZLWK 2V2TA 2QHRL 4X7EC 4ZOCA 2XN9E 2R2EB 3W9EB 3MLRH 1IAIH 2P43B 2EDWA 3GSWA 3P0YH 3JVGA 1NC4B 3VJ6A 4Q97A 1P4BL 4PJFA 3TBTA 2YKLL 1IGTB 4LLYB 2FH6A 4CMHB 4X6DA 4WUUD 3BJLA 4OGAD 1AE6L 5IVZA 5A40E 1C16B 4QRRD 3SGEI 2G5BA 5D2NC 2ID5A 3LKSB 1SJVA 2XZAL 3QEQE 1ZTXL 3GMNB 4IRJD 1K3IA 2XWBB 3ARGC 3H9SD 4PLOB 1FZMA 1T7XA 3TYFA 2WNGA 3QIWB 3SY0B 1ZE3C 1V3LA 4PJCB 4HGMA 6FABL 4WWKC 3VXPA 1NLDL 3O2VL 4XHQA 1NAML 1KOAA 4OLXL 1KB5B 3MYJB 1I8KB 4MVBC 1KGCE 1RZJH 2ZP0T 5HHPB 3VCLB 3VDCA 2Q8BH 4U6HB 4S0SD 1K8DA 4R97C 4FA8A 4UTAL 3C60C 1LK2A 4X9FA 3P4MB 2CDFA 3EGSB 5D70H 1KPVA 5DGRA 2J88H 3CNKA 1MRCH 2I5YL 1GCFA 4QXTB 3VRJB 3VE0B 3VG9C 3O9WB 1CGTA 4Q2ZB 3RGVA 4M5YL 1GGIH 2IWGA 3G5XB 5TFSL 3TA3A 4HJGB 4TNWF 1T4KA 4HUXB 5FF6B 2A9NL 4Y19E 3U7WH 3H0TA 3PWNA 3RPIB 3UJJL 4Z8FL 3IDUA 4NQEB 2AABL 4HWBH 2OP4H 5FO8A 1LHZA 3FN0H 3V7AE 3D18B 5TE4L 4JJ5B 3MV01 4RQQB 4NSKA 1S7RB 2NY4B 3IAQA 1MI5A 4LSSH 1EVTC 5IMLB 4OD1H 3N1MC 4HUNB 4ISVA 3LQZA 3WHXB 1MFDH 3AGVA 1EXUB 4GRWH 3S35H 1WWWX 1A1OA 1IGCH 4M7JH 3L5JA 3GSQB 3ARED 5GHWL 1VACA 2VLJB 5DK0B 3QDJE 1OTSD 4HLJA 5ICYB 2CD0A 5D6DA 3RWFB 5IEHA 4MAYA 3QDGA 4HEPG 5JHDD 4DK3A 3CVHL 3ARGD 4TUJB 1D6VL 3UZEA 3OF6D 4KAQH 5L8JB 1FORH 3NN8B 3M1BB 1CS6A 1KXQE 2V5RA 2G60L 5FA3B 1FFRA 1CE1L 4X7DC 1B6DA 4JJHA 5AUMA 4HXAH 1EGJH 1W72B 4LCWA 5JW4Q 3FQWA 4HAGA 2GSGB 2NW2B 4NZUH 5E1AA 4GFTB 3RWCA 2XOTA 4LASL 4ALAL 2I25N 5I30H 3OGCA 5DMKB 4OD2B 3SKMA 5T1KA 1P7HL 1EJOH 2EKSA 3NCJL 5T5NF 5F3BA 4WO4C 3CPLB 4LSTH 3D5OF 3L7EA 5FYLE 1I3RB 4P4RA 5J3HC 4UDTA 2VC2L 4X8JB 3B9DA 5F44A 3T2NL 1INQA 3DV6A 3N85H 3BRDA 1KACB 3MRGB 4L9LC 2DWEA 5J13B 1OSPL 3KPRD 5L7XH 2DQUH 5E8EA 1HEZB 3U30B 1XF4B 4RMSA 2VDRL 4MNGA 1KXVC 5L9DL 4K2UL 3GUTB 5C0CE 4LHQB 2IPUK 1G9NC 4X80L 5DRZB 5IB3B 1V5JA 3DECA 4ZXBB 5DFTA 2HH0L 4U7SA 5ANME 5KVMC 1T7WA 1NSNL 1OGAB 1SMAA 3FB8A 1E4KA 1JGVL 1K9TA 1RJLA 1QFWH 1ZT4B 2LAAA 4QYOA 3B5HA 1OCWH 3LEYH 1ZT1A 3MV9E 3OMZA 4BH8A 4ZFGH 2AK4D 3QDHA 2YZ8A 3MOBH 1M4KA 5E8PA 4UT6L 2DTML 5FKAB 5HPMB 4RFEA 3LMJL 3EYSL 4TTGA 2DYPD 4WVRA 5J11B 2O61B 1U3HB 3DETC 4F7PA 3RZCC 1CT8A 5ILTH 3RTQD 2OXGA 2A74B 4CMMA 32C2B 5D2LA 3V6OC 4NQCB 1XF3B 4OV5A 4JLRB 5D6CB 1A4KA 2PW2B 4CRPA 1GZQB 5D2NA 4JPWL 3VFSA 5JHDA 5GPRA 2VITA 4OLUH 3S5LB 3ARGA 4D9QD 1NAMA 1QA9B 2WK2A 3KPLB 3NIDE 3WUWB 3CU7A 3TH4T 2RJMA 4NO2B 4WWKA 1NH6A 4YBQC 5J12B 4LHJB 4IDLA 3EDJA 4RGNE 2W59A 4K3DH 5DHVB 1Q9KA 2EIDA 2B1HH 2NW3B 2ICEB 4YHKH 2G9HB 4M43H 4PJBA 5JXEC 3K80A 3DVNB 5JHLH 2CDGB 2R56H 1C5BH 3IJSA 4NZTH 3GSUA 4HCRH 4AH2B 1A6PA 1U8JA 3H6JA 1WK0A 5I18L 3C60A 4MA1B 4I2XA 5ESVB 2Q7NA 2O5YH 4V2BA 4ZO9A 1GPOH 1DBKH 3FFCE 3EJZD 3PF2A 5JPMB 3X3GL 3HFMH 5C0BD 5JLZB 4PYHA 2XZCH 2WUBH 3WNOA 3R0NA 1QG3A 4PRDB 4EUPH 4K8RH 3WLWC 2QQQA 3D25A 4YFDB 1PG7L 1NGQH 4KPHH 2DS4A 4OLVL 4HK3N 1CFVH 2VKXA 4G7VL 3VFTA 3S4SA 5F7LB 3QRFM 1S9KC 4OAWB 1TVBA 2H1PH 3B5TA 2JJSC 2NY0C 1SJHA 4BZ1H 4LLDB 3IETA 2I27N 4OCWL 1TIUA 5DUPH 5J1SC 4MD0A 3WSQH 2FJGB 3WIIL 3RZCD 3VFUA 4RBPH 2I60L 2EYSA 4XNMB 2HFTA 4KGLA 4QT5B 3ARFC 3CVHA 1MJ7L 1BWMA 4JN1H 2Z93B 3V5KA 4RMQA 4HS6A 1SYSB 4Y4HA 2P8MB 1TQBB 4I0PB 1HH6B 2W9DH 3PDDA 5J9PB 4NP4L 3VH8G 4NJ9H 4PY7A 5E9DE 1MFBL 2IQAB 3U1SL 2DN7A 2OL3B 4YBQD 3LKPB 1U8LB 2EYRA 3GI8H 5EZJA 1RUQL 2AI0H 1UM6H 4NO3B 1PEWA 1I7TA 1RQ5A 4XNYL 3B9KB 2OX5A 4WCYL 1VKXB 4I4WB 4DGVL 5FKPA 2Y07L 2Z91B 4G6ML 3VMOA 5JIHA 1VEOA 5GGTA 1MFCL 1LNUA 3WFCL 3AB0B 3CSGA 2PYEA 1JIBA 4GAYB 5KG9B 3UPRB 4WO4A 2GSIA 4PS4L 3L3IB 1T1XA 2ENSA 4KQ4L 1KCVL 5E5RB 4H1LB 1NC2A 1JTOA 2FL5A 2W07A 3QHTC 3OPZH 4MAUL 4TTDC 3F6IA 1KNOB 2RBLA 4PJGE 5FHAL 3MXWH 1DFBL 4L9LA 3L3DA 5T3ZD 3G6AB 4NDMB 3N9GL 5HYQA 1JK8B 4MQ7B 4WU5A 2YK1H 3KLHC 1CYGA 1K4CB 1XGPA 2P7TA 3R1GH 4HUUB 1N6VA 3ZDZF 2L0DA 2WZPD 1IKFH 1JP5A 1N26A 1QLFB 4LPWA 3KR3L 1D5BA 1XH3A 1A6UL 3MV11 4K7FA 3B8YA 1L6ZA 1EK3A 5IF0B 5D93C 1QSFD 4JGUA 3ARFD 1G7IB 1IT9L 3JBG7 4ZO8A 3SQOL 4PREA 3UC0L 5T3XH 1MHHB 5JUEH 4Z18A 4U6XA 1NFDE 4HS8H 3BX7C 3LS5L 5DSCA 2AEPL 2XA8H 2XRAH 3RDTC 4BZ2L 5CSZA 4MNHB 4NRYB 4CMHC 1TTUA 4XT1C 4MNQB 4GRWE 4U1KA 3VXTB 3D2UB 4EI6B 2APFA 2XNAA 3ZT5A 3TBVB 4UINL 3E6FA 2C7UA 3GFUA 1NDGA 3VXNA 2DAVA 3PGCB 3GMQB 1BVZA 3E2HB 1J0YA 4HX1B 4QRQB 3RZCA 1IC5H 4HKBB 3CUPB 5IFAL 3UZQA 3V6OA 3T8XB 3QIUB 1AR2A 4NKDA 3CFDA 2VN4A 1IILE 3QFJB 2EIZB 2VQ1A 5DJZB 1T7ZA 1N0XL 4R4FL 4Y5VC 3HAEG 3B8SA 2MKWA 4H5SA 4LCYB 1SQ2N 2UVFA 5CUSH 4LIQL 5K9JH 5TF0A 4XCNB 5ID1A 5CSGA 3NFSH 2ATKA 5J57B 1IQWH 1EJ6A 1QVOA 2N7AA 1NDMB 3IXTA 1BQHG 4HBCL 4JFED 1KB5L 1FG9C 4F7EA 4TTDD 4Y2DB 3KAAA 2P4AB 3L3GB 1EEYA 4PJEE 5JXEA 5JPNB 4Z7VE 5LQBH 3FN3A 1YEKL 4K7PL 4X83A 4TSCL 3SKNA 2UZYB 3VXSA 2IADA 3KLHD 4XC3L 2FZ3A 3VWKD 4JKPH 2ZZUT 4PJ5A 3G9VA 4ZDHB 5I1EL 2CIKB 3ULVC 3BHBB 2W65B 3ABZA 5DMYA 1CFNA 2VLME 1DEEB 3L5IA 1G7JA 5CJOL 5D1ZC 4UOW1 2DM4A 3IFLH 4X7SL 1KN2H 3QDMB 1FJ1A 4KZDH 4JAMB 4GUPA 4AEHL 3GSXA 4M6OH 4M1DL 5LJYH 1FVDA 4ONGH 2D03H 1XCQB 2NY4C 1FNFA 1H3VA 3ZTNL 2A6JB 2FX8L 1A2YA 3B9VA 3WHE0 3RDTD 1BD2E 3L3KA 5HGHB 3U4AA 1LO3L 5D9SB 4RBPK 3ZDXF 1BZ9B 2JJSA 2IMNA 2A1WL 4F9PC 5DWUL 3BT2H 4OQTH 2LU3A 4MD4A 3EYOB 4G6JH 4BKLB 5L0QC 3ARFA 2H8PA 4E5XA 1I85C 1LILA 2QBWA 1WWCA 3RWJA 4D3CL 2MHAB 1JPTH 3DBXB 2VQUA 2HKFH 1FZKA 1OLZA 1X44A 2VXTL 2YUXA 4LFHD 2EDDA 1HE7A 4YDLC 4YPGB 3HI6L 2ZOLA 5EN2A 3NIFE 3HC4L 3SEPA 4CVZA 3P9WB 5LG1A 3UX9B 1W72L 3FZUC 3GHEL 3LEXB 1SM3H 2HP4A 2M26A 5HHME 4ZFOA 5IW1B 1VB9A 2GFBA 2ICES 4X4XB 3VXOA 5A2JH 2EC9T 4V1DB 1I75A 3WV0A 1UH3A 3SCMB 1I8MA 2KH2B 1Z9MA 4XZUB 4HD9A 4UT9L 2VLRD 1E4XL 3ULVD 3AVEA 3BZFA 1A7BA 1W8NA 1NEZG 2AJXL 2HFFB 4MDJB 5EWIL 4YDVA 2HG5A 4MJ6A 5JQHC 5D1ZD 2VAJA 1MHEB 1J0KA 5T1MB 2R2CA 4RAUA 4XXCA 1UH2A 3QCUL 2NXZB 3LPFA 1K4DA 4XNQA 3TVMD 5E56A 4Z7WB 2EE9A 2QEJA 1CU4L 1CXEA 1LD9B 3U30C 4ZPVA 4ODTH 5IBUB 1BLNA 2R1WA 3TWCH 3ARTA 3MLXL 3LRSB 1OAZH 1HH9B 5TF1L 5GSRA 4P4KD 4DN4H 12E8H 4LBEB 3JWOC 3TNMA 4G6KH 1TJHL 4KKNA 4ZD3H 4N9GB 1JMXA 4JDZB 4MYWB 4ZXBC 1K85A 2A38A 3BZEA 3EYFA 5GGRB 4QY8A 1CF8L 2H41A 4WFHE 2UZIH 4PRPB 4YPJA 4ZNCD 5L2JB 2ZSVA 3MUGA 5IIEB 4FMFA 1JWMB 3FTGA 1PW3A 5TQ0L 1V7ML 3SDDD 2DQCH 1T66D 4U0RC 3W9EA 1NGXB 2HAZA 3QNXB 1U3HC 1YMHA 2APVA 4QGTA 3RDTA 1GOFA 1IGTA 3D1MC 4LLYA 5GRXG 3WNKA 3GSRB 1CFSB 1TENA 1H15B 4N0YL 5ADPH 4LPUA 5IFHH 1MWAL 3F12B 5CILH 1W0WB 1J05B 2X1QA 1KULA 2BNQB 1KFAL 3LKSA 8FABB 3MMEB 2CUMA 4I18B 1T2QL 1KEML 4DTGH 2XWBA 2Y7QB 4OTXL 3NABL 4PJ9C 1UWXH 2A9ML 1ONQB 3QIWA 4F2MA 5CINL 5J06A 4R4BB 4LARH 5K93A 4Y5VA 3FO1B 3MRDB 5J12C 4Z77B 2B1AH 4P23C 4PRHB 4O5LH 3MYJA 1I8KA 4WRLA 5HHPA 4RRPG 1MCNA 4HLZH 3AU1B 1CN4A 4U6HA 4KMQA 5JIIA 1WFUA 1NCCL 1PYWB 4MA1C 3P4MA 5EIVA 1UB6B 2BFVL 1YJDL 5DURB 2A6DB 3CAFA 4QXTA 4RWHA 5GSVB 3VRJA 3VE0A 5E2TL 5C9KA 4X6DE 1T1ZB 3OHXA 4Q2ZA 5E24E 2AV7B 2C1PB 4HJGA 1SBSH 1F4XL 1FL3B 2BNRE 5HVGB 5C07B 4ERSH 5D1ZA 1T21B 4ZTOL 3RPIA 1JZ4A 4NQEA 2X89A 4RGMC 1FGNH 2VZVA 5KSBE 3ET9F 2YD3A 3D18A 5JOFB 5DZNA 1S7RA 1IC1A 3BOVA 3CDGB 3ZSSA 5HDQL 5IMLA 1AD0B 1FCCA 5JO5B 1ZEAH 3PDOB 3WHXA 1PZUB 2BERA 4A2MA 1EXUA 2IGFL 4I3SL 3NIGF 1OQXA 2WM0A 3VI4F 4HIXL 4ZYKB 3GSQA 5T3XE 2VLJA 3ARBD 4G8EB 5DK0A 4F9PA 5JQ6L 4XHJC 1V3KA 4XTRD 5KVEL 1TQBC 4I0PC 4HJ0D 1DUZB 3EYVA 1UC6A 4TUJA 4PJ9D 4JCMA 4KI5F 3QCTL 4OJFL 5HDOA 5I9QB 1I85A 4WFFD 1YMMB 3K1KC 4NM8L 1CGXA 3GK8H 4DFHA 3NN8A 2YPVL 4GJTB 5GS0C 1CZ8L 3M1BA 4JHBA 5DA0B 2E9BA 5FA3A 4NKOA 3BXNB 2E6QA 4P23D 5GRUH 1O0VA 2DKMA 4P3CL 4U6YB 2AGJL 3KPQB 3ZSTA 2OL3L 1CBVL 1G9NH 1NMBL 1HN1A 5T5FH 3TN0B 3LS4L 2NW2A 2ZJSH 4NJAH 4YHZL 4QOKD 3O6FC 2YD8A 3QCVH 5CD5C 1BPVA 3OJMB 3MRPB 4OD2A 5DMKA 4F8QA 2YUVA 2Q86B 4O58H 3EDKA 5GGUB 4QHKJ 3CPLA 5GISL 1F42A 2RB8A 4EOWL 4CKVX 1I3RA 4JG0L 4P5MB 4X8JA 4N0CC 3SKJL 2EE6A 3QI9B 5EFIB 3ECBB 4AG4H 4Q6YA 4ZG1A 3MRGA 1CGUA 4RNRB 1PEZA 2AERT 1T03L 1FPTH 4JCLA 4JR9L 1HEZA 4AIZB 1XF4A 4WNQB 2B4CC 5DUBB 4IDJH 4I48B 3GUTA 1R3IH 1NL0H 3O6ML 1R5WB 5AYQA 5GRVK 3T3PF 5DRZA 3IRPX 2DJSA 3SJVB 4MWFA 3S37X 3HC3L 4ZXBA 4WUUE 3FO2B 4Z76B 5IK3B 1DUYB 5EU4B 1OGAA 4QRRE 2NPLX 1YYLL 1ZT4A 4M48L 1VPOH 1PGRB 3MXVH 4H8WH 3UPAA 5EBWB 5A3IC 1RPQA 3H9SE 4WI6A 3OX8B 2V17L 5FKAA 1Q72L 3CSYA 3LHPL 5IBLC 1KJ2B 2GK2A 3WFBH 2IPTL 1U3HA 1NCUA 1EHNA 3HI5L 3LY6A 2P47B 1H5BC 5SWZB 4MQTB 5MI0B 2R8SL 2A74A 3QUYB 4BSVB 3MLSH 4NQCA 5C0RL 1UWXK 1XF3A 3DI3B 4JLRA 2WQ8A 1XR8B 2ZWLT 3MR9B 5D6CA 1VFMA 1GZQA 1CDJA 4Z7WF 3O6FD 1DJSA 2YD6A 5M94B 5CD5D 2UVEA 1GGBH 4LRIC 2QQNH 3O6LH 3T2OA 2WANA 1QA9A 2VL5A 2EDBA 1HXMB 3KPLA 5T3ZH 2EO1A 3WUWA 4WFGD 4NO2A 1QLRB 3VWJC 3IJHA 3NCCB 2BY1A 3MLUH 4CU7A 1QSVA 5DHVA 5GRJH 1KBGL 1IRAY 1YN6B 4LEXH 4P23A 4JM2B 3DMMD 4Y2DC 2ICEA 2NW3A 4U7MA 4LNVA 4YX2L 3F7PC 2G9HA 4KI5C 1MH5B 4FQ1H 3DVNA 5ECJE 2CDGA 1AO7B 1T2JA 4J6RH 4AH2A 5KN5B 1K5NA 2EDRA 5ESVA 3KS0H 1L7IL 3ARDB 3V5HB 4KZEH 4KV5F 5JPMA 2Q8AL 3VFOB 4JHAH 5JLZA 3WCYA 4JRYB 5DJ6B 3SGJC 1JYVA 3C5SA 4NCC1 3EO9L 4PRDA 4XBEL 5D2LE 1XAUA 5IV2B 1OPGL 4D8PA 5DD6B 3QO1A 1BQLH 3CFJB 5HI4C 3MNWB 2HVKB 3L95B 1F4WL 1KC5L 3CFCH 4XMPL 4N8CL 1I7UB 4W70A 4OAWA 3MLWH 1RK1B 5E8DH 5TQ2L 1CE6B 3NAAH 4P57B 5IBLD 2LU7A 5EOQH 4LLDA 43CAB 4PGEB 2RHEA 1YEHL 1FE8L 2FJGA 4QNPE 1N5YH 1FL6B 2AJZB 3FKUS 5D1QB 4AQ1B 4QT5A 2Y06H 5BZDB 2QSVA 1JV5A 1H8NA 4PJ8C 1SYSA 2P8MA 1ITCA 1CL7I 4I0PA 1HH6A 1CD8A 4KRMB 3T0EC 5J9PA 2FHFA 2YMXH 1A3RH 2HJFB 4JO2H 5DLML 3M8OL 5CZXC 4MZ3A 2IQAA 4YBLB 5F72S 1EDQA 4TVPL 1FFQA 5ETUB 1D5IH 2BK8A 3VWJD 3LKPA 5IESH 1U8LA 4MXWL 1W0VB 5KSVA 1QRND 2E9WA 4TSBH 1X5YA 2AJ3A 4IMKC 1KCUL 2F15A 4H26B 4TSAL 2R2HA 3QNZB 1U0QA 4NO3A 3KPRE 2BSTB 4KI5D 4IOFD 1QEWB 5CBEB 2ERJB 3SCMC 3BD3A 5DVNA 2OK0H 2Z91A 1HI6A 1TNNA 3FRPG 4I0CC 4JGMA 1DBJL 1ADQA 2W0PA 1CFTB 3R8QA 4R0LC 5BS0D 5KG9A 5BW7A 3MODH 1XCTB 3L3IA 2WBKA 2NXZC 4H1LA 3D9AH 2C26A 1A0QL 4RMVA 4OFYD 3OXSB 1DQQA 1SY6L 1CD9B 2AK4E 5HI4D 5SWSB 4OZHE 4NDMA 1FZOB 1JK8A 1QKZH 2AJSH 1MJ8L 1OLLA 2CLZB 2DBLH 4HUUA 4TUOB 3HN3A 1QLFA 3FHQA 5T1DL 3T0WA 1GGYA 1OAKH 2C4FT 3HTLX 2LV4A 4ZS6D 5JDSB 1W8OA 1HHGB 3JXAA 4NFCA 4MSWB 2HA1A 3C9NB 2ICCA 5I17B 3DUSB 5IF0A 3L3JB 1IGIL 5JW3H 1G7IA 3I6GB 4KKCC 4JPIB 1EBPA 4J3UA 3WO4B 1ZHBB 1BQSA 4GH7B 4PJ8D 5FUOL 3ZE2E 4OGXH 1MIML 3K7UA 3VXUD 4X4YA 4D9QE 1KTDB 5IB4B 5DMJB 3T0ED 4MNHA 4NRYA 5DJ2B 4JFXA 3VXTA 3D2UA 4EI6A 3VXQB 1KYOK 1EO8L 3CD4A 4NO0D 1DTUA 5CZXD 4ZODA 2YD7A 5HHNA 3TBVA 5AD0B 1A47A 5F9DC 4X99B 4OM0H 3GHBL 3PWLB 2OTPA 3KLAA 4JZNB 3GMQA 3K4ZA 4DN3L 2FO1A 3INUL 4HX1A 4I18C 3WJJC 4QRQA 5IT2L 3ULVH 4HKBA 1CL7L 1DVFB 3CUPA 4X7TA 3VRIB 3T8XA 3GJEB 4D9LH 1TTGA 3ETBF 5H37H 4UV7L 2BOBB 3QFJA 2EIZA 4PD4K 5E00A 4A2LA 4N0UE 4NUGL 2FGWL 1RUAL 3GMRB 3PGFH 3H42H 3O0RH 4LRIA 2APTA 2VISB 1NLBH 3GBML 4LCYA 3CMOH 1AXTH 3MNZB 4I77L 4XCNA 5C0BE 5KS9E 4LQ1A 1OTUC 2B39A 2VH5L 1A7OH 4LSQH 1G9MC 2W9EL 1NDMA 3HCVB 2ADJB 2NXZD 3VWJA 3A6BL 3D39B 4OGYH 1QRNA 3C2AH 4LLMB 1UACH 3LZFH 4Y2DA 1BOYA 1RZKH 4ELMB 3L3GA 2OZ4A 2HRLA 1WITA 2D4DA 1GOGA 2MWCA 3P73B 4NIKB 1YQVL 5DHYB 4GKSB 3GSOB 2CMRH 1BVLA 4PG9B 4PJHB 4ZDHA 1OAQH 2W65A 3QG7L 1WQVT 1D5MB 3CCHB 3Q6GH 3FQNB 5BS0A 1DEEA 4MJ5B 2G2RB 2H32H 4RFNB 4BQBA 2E7LC 4HAFA 5FA4B 3EUUA 3QDMA 4M62H 3SGJA 4JAMA 4OFYA 1MPAL 1PJ9A 4RFOH 1IC4L 1MLBA 4Q9RL 2F5BH 4JVUA 4XPTH 1XCQA 1CG9A 5D8JH 2A6JA 5I1LB 4GMTH 5E08L 1ED3B 4NZRH 3F7VB 4OUOA 2NR6C 5HGHA 5D5ME 1GC1L 1X5FA 2CPCA 5D9SA 2GITB 1KIRB 1BZ9A 4GRLB 3HZKA 4ZNEE 5ID0B 1FIGH 3L5XL 4M6NH 2V7NA 1CLOH 4W81A 2K9UA 3EYOA 5ENWB 4JM2F 1GXEA 2XACC 4BKLA 3QHZL 4APQC 2ZUSA 3UYRH 4OFKA 5D7IB 4HSQA 5I9QC 3KJ6H 1RMFH 4KJPC 4FQHB 1A7RL 4LDOB 1INEL 4N8VG 2V5SA 1TZGL 1EHAA 3C8KB 4UDUB 1Y0LB 3LH2L 3FO0L 4DW2L 1OTUD 4YPGA 3NCFB 4P2CG 3TN0C 4IM8A 2NLJA 1II4E 3BUTA 4YDIL 2ESVE 3WD5H 3FJTA 2R9HD 3HAEA 4IMKA 1LO4L 3CGTA 5HYIA 1ETZB 1OTTC 3GO1H 2OSLB 5DURD 5T3ZE 5IW1A 4NQXB 4N68A 4X4XA 3I6KB 1BFVH 5HYJB 4V1DA 4LPCA 2VDLH 3SCMA 3IU3B 1S7SA 5MEND 1NCBL 5E99H 4OZGB 4XZUA 2CJUL 4BK4A 3MJ9L 1UWGL 2QTEA 3F62A 3QI9C 1RURH 3NA4A 4U1NB 2HFFA 4MDJA 3MLVH 4P2QD 3U36B 3MBED 3ZHLA 5IUSA 2LTQC 3Q0HA 1MHEA 4FQPA 4Q7DA 3HKFA 1MCDA 5B21A 1Z9SA 1QSFE 4P5TB 4Z7WA 2ZUVA 2B0SH 3R06A 3U4BL 3MACL 4FFYH 1LD9A 4H20L 5IHZB 2GI7A 5EU6B 1OAXH 2IG2H 2RCSH 4JDTH 1U95B 5CIPB 5FCUH 4LBEA 3UTSD 4N9GA 3PWVB 1JZ6A 1J1PH 3RP1A 1CD1B 4YXLH 4DZBB 4CW1B 5B38G 3SPVB 5F7KC 5DFVC 1VFOA 1NCDL 4ZAKB 3ZE0E 1C1EL 1YEIH 2HLFD 2X1PA 5L2JA 4WY7L 1U8KB 3JV6B 4APQD 1F8TL 3ZMRA 1MQ8A 3SBWC 2F58H 4ZOAA 1YMMD 4LLUB 4OCSL 3S3PA 1BP3B 4TOYL 3QNXA 2HT2D 1WZKA 1DSFH 1AFVH 2H3NB 5MP6H 2Y1VA 2NNAB 2VKWA 3GSRA 5MI0C 1CFSA 2CUHA 1H15A 5F7UA 4M1CC 3QUYC 3DXAB 1FQ9C 3L9RA 3F12A 4JFEE 4XP1L 1W0WA 2W60B 3OJDB 2BNQA 8FABA 1A21A 4I18A 3WJJA 1QQDB 3K0WA 2R0ZL 1JPSH 2YSSB 4KHXH 1FNLA 1OTTD 1ONQA 3LSOA 1FSKB 4MMXC 3LPWA 4R4BA 5F71A 5JIKA 3MRDA 4WEBL 2YPLB 1P6AB 3DX7B 5GGSB 3X11B 1XT5A 4QRSB 4Z77A 4KQ3H 4DQOL 4XCFL 4JM2C 4PRHA 5CZVL 4YHIB 4ODVH 3OB0K 5C0NC 5FGRA 4CL7A 3N1QC 3AU1A 4JHWL 3UJIH 2NX5B 1UWEL 5I19H 3H3PH 1PYWA 3HZYB 1O7VA 5HYFA 3LAFA 3RWDB 2Y36H 4L8CB 2EDXA 1JPGB 1UB6A 4FS0A 3TPKA 4L3ED 3QR2A 2A6DA 1BEYL 2XN9B 1OAUL 4IMLB 2VDMH 3E8UH 1DR9A 2HT3C 2DIBA 1T1ZA 1B2WH 2AV7A 1IGMH 3TZVB 1FL3A 3RWIB 2LVEA 3WFDH 5JOPD 1FAIL 5HHVL 1T21A 2E7LA 1S9XB 1S7WB 1J0IA 1IC7L 1WBZB 4YGAB 3QEQB 4DKEL 3HG1D 1P69B 1MCKA 4P48A 1LO5B 5JOFA 3RAJH 1A7QL 2EEBA 1JHKH 3CDGA 4R96B 5H94B 1J1OH 3NTCH 1AD0A 1NGPL 5JO5A 3TT3L 5J6GB 3PDOA 3MYZA 3MA9H 4K55A 4KROB 3BKJL 3IGAB 2MTPA 3MRLB 2BC4B 4AM0B 2R4RH 5D1QC 2XV6B 4P9HH 3QUYD 1IFHH 4ZYKA 3I75A 4RGOH 3C6LC 2AXHA 2XKUA 4G8EA 5F3HB 4OT1H 1G6RA 4RMTA 4UI2A 1DUZA 4K3JL 2XTJD 1U92B 4APQA 1YMMA 3N06B 4YBLC 2UYLA 3AS2A 3WEXB 5DA4A 5FO7B 5IBTH 4PJHF 1QYGL 5BO1L 4MDIB 1RIVL 2VLRE 3ULVE 1OM3L 5GGQH 2B4CH 3BXNA 2YD4A 4U6YA 3KPQA 2Y25A 4HK3J 5C0ND 2PR4H 3TN0A 2X42A 4Y19B 3CXDH 3STBA 2ERJC 1TXKA 3EHBC 3OAZH 4LAJH 3MRPA 1BFOA 3MJ9A 1CVSC 4NKIL 4OIBA 4PUBH 5GGUA 5AG9A 4IBLT 1P5VA 3V4VL 1T22B 2HT3D 4X6CE 4IRSC 4JEGB 4OCXH 3UTPD 4P5MA 2NMSA 3VI3E 3QI9A 2ENYA 5EFIA 1EAJA 3ECBA 2VABB 5F9OL 5TE7H 4RNRA 1DN0A 1U6AH 5L88L 5D7IF 1WSST 3TJHC 4BM7A 2CK0H 3QT2A 3BO8B 3MBXH 4AIZA 4OFDA 4UV4H 3BWUC 1FLRH 5DUBA 2EYTA 4H25A 4I48A 1C5CH 1P7QB 3ZYOA 3A6CH 1R5WA 1RD6A 2HWZH 1VDGA 1QNZH 1GAFH 3SJVA 1NMAH 1A6AA 3FO2A 4Z76A 5IK3A 1BQUA 1IGFL 1DUYA 5D1QD 5EU4A 2YXFA 2R0WL 2QKIA 1WZ1H 3LDBB 3WO4C 3C6LD 5EBWA 4OLYL 4NWTH 3UYPA 5I1IL 3MROB 1CR9H 3OX8A 1HHHB 3V8CA 1A5FH 1QRKA 1KTLB 2DI8A 3B9EA 3SBWA 3U7AA 1KJ2A 1OARL 3BKCH 3L5WB 4OZGF 4KKAC 2YD1A 1DVFC 3KPSD 4EEEA 3MRNB 3QUYA 3SGKC 2CLVA 5EORH 4HUMB 4BSVA 1MCPL 5J89A 43C9A 1NUNB 2VR9A 1F3DH 1YPZF 4IHOB 3EHBD 4PBVC 4RWYH 3Q1SH 4H0HB 4JFDD 1I9JH 2PW1B 2YA2A 4U1JB 1GZPA 3OKLB 1URLA 3P4NA 3FRUA 2QADB 3WKMH 4DVRL 2ZUQB 1HXMA 4PB0H 5IR1B 1JYXA 2FATH 5C6WH 2FRGP 2XA3A 5IB5B 3QZWB 4IRSD 1WFTA 1S5IL 1I8LC 1TJGL 1YN6A 4XWGL 2PNDA 5ANMB 5HGGS 4JM2A 5CJQH 2FIRT 4XNUH 1CIUA 4JB9H 2BVPB 1MH5A 4FQXB 2HT4C 2L4OA 3MV9B 1S9YA 3V4PL 5ITBH 1AO7A 1I7ZB 1JNJA 2X9XA 2EDKA 5LWYH 2VDQL 4XPAH 3SGDI 2E8YA 3EYUL 3GMMB 2DD8L 3C08H 5E6ID 3V5HA 3VFOA 1E28B 4RFNC 2BRQA 2UY7A 1MRDL 1OAYH 4JRYA 5DJ6A 4F7MB 2XWJB 5DD0H 5K33A 1MVUB 5IV2A 5DR5L 3HS0B 3WS3B 4GW4B 2GEEA 4S1QH 4M93B 1CLCA 1FFOA 3JWDH 5EO0B 4AMKH 2FH8A 3L95A 3MNWA 1I9RL 5EO1B 3I6LD 3HAEH 3BKYH 3G6JF 4HT1L 1I7UA 1OSZB 4WFFE 4K3EH 1RK1A 1ZWIB 3JZ7A 3STLB 1CE6A 3BN3B 4GRLC 4P57A 4X98A 3KPTA 3X13B 4GG8B 2J7LA 3MRMB 4JY5L 43CAA 2AAVA 1WJ3A 4PGEA 3RHWF 1QFOA 4KKAD 4XCCH 1FL6A 2AJZA 2X44D 4RGNB 5E5UB 5D1QA 1OGTB 2IBZY 4JO3L 5IB1B 4NZDA 4X6EB 5BZDA 3EDEA 2BVYA 4QOKE 3C6LA 2BVEA 1P4LB 5KVDH 3K2MC 3MRKB 7CGTA 4GBXC 1EHLH 3TBWB 2FJFB 3GB7B 5EDXA 3K8KA 3SDYL 2BNUB 4LP5A 1XGYH 5CEYB 4G7YL 2MJWA 4Q9QH 5DF0A 2IAMB 5ETUA 3WN5B 2EDQA 3TIDA 4Q9BA 3RBGA 4FFWD 2VZTA 5DEGB 3OAZK 5EZIH 5I73C 3D87B 4QRPD 4H26A 3QNZA 1CXFA 3MFFA 2BSTA 4LGSB 5FYJL 1QEWA 5CBEA 2VDKL 1F3RB 1OHQA 3DGCR 1CFTA 1CVRA 1FC1A 3L3OA 2XZAH 3MZGB 5JA9A 1XCTA 5ELIA 4YWGL 5JW4R 4IRSA 1E6OH 4P5TC 2H26B 3SO3C 5C70A 4DKAA 1EA9C 4I13B 1UYWL 1NLDH 5GZNC 5IHUH 4DUVA 3G5VB 5EULV 5SWSA 4K94H 2W92A 4OLXH 1FZOA 1MCWW 1PLGL 4M1GL 1KF9B 5SWQA 1DLHA 2EXYC 1PG7X 2CLZA 1EPFA 4CN1A 4TUOA 3IFPB 2X4PB 4GRLD 5E9DB 3VGDA 4UTAH 2GYSA 3MRCB 5JDSA 4YC2B 2Q3AA 3KPNB 1LK3L 3C9NA 2YZ1A 2JB6B 5I17A 1J0JA 3DUSA 3L3JA 3MUY1 3K2UH 4N1CA 4JPIA 5D72L 1VFBA 2FWOB 1ZHBA 4OI9A 1EBAA 4GBXD 5HD8C 1T80A 4DKDC 3TNNA 1KTDA 5IB4A 3BPNB 5E2WL 5IB2B 3VXQA 4Z8FH 1PSKL 1ACZA 3RIAF 1C5DB 1ZK9A 4WFGE 5AD0A 4KKBC 3BAEL 4X99A 1FN4B 5KAQF 1BF8A 3PWLA 1V05A 4JZNA 3U2SB 5E2VH 5ESQB 1S3KL 1DVFA 5A16B 4N0FB 3SGKA 3VRIA 4OZFG 1MCOL 3GJEA 3V0VA 3UP1A 1T7VA 1FSKC 4PJGB 5M7QA 1SHMA 4CUCA 4WI7A 5DQJB 2BOBA 5FB8A 3GMRA 4O2EB 2VISA 2BOCB 5A2FA 4JPKL 5GHWH 1NGZB 2HFEB 3FO9A 3MNZA 1B0GB 4O51A 4J4PD 4WW1B 1E0OB 1JI2A 3ZE1E 1A9EB 2OBGA 3P4OB 4QHUB 5DD3L 1X5AA 3LD8B 2ADJA 1BJ8A 1JRHI 1J10A 3D39A 1J9CT 4LLMA 1I8LA 2V5YA 1HDMA 1FGVL 3MV8B 3FRPA 2UWEF 3V0WL 1LVEA 2FO4B 2G60H 1X5KA 3OKMB 1HSBB 1Z3GL 4HGWB 1CE1H 2VR5A 1K2DB 3FN9A 2OTUA 3P73A 4BSWB 5DHYA 1NFDB 4GKSA 3GSOA 1FO0H 4KK5D 3OR6B 4EN3B 4NQTA 4PJHA 2EXYD 1MY5A 3GKWH 5HGAB 3TZVC 4JFFD 3CCHA 4MJ5A 2G2RA 2GJZB 5FA4A 1V7NL 1UVQB 1MFAL 1NAKL 4JY6B 4HFUH 3BUYB 1T0NB 1IM3B 5FHBL 4XAWH 1HXYB 3BGFB 1T20A 3VFPB 2BDNL 5JR1L 5HD8D 5I1LA 2VC2H 2YXMA 1ED3A 3DV4B 4N1EA 4F3FB 5KSUB 5DQ9B 3TBSA 4LHUG 1A6TB 3C8DA 2GITA 4ZPTB 1KIRA 1OSPH 4GRLA 4NNPL 2AK1L 4L5FH 4KKBD 3HE7C 3O8XB 3MRJB 2VDRH 5ENWA 2VXUL 3BH8B 5L9DH 1YEEL 2EO9A 3T09A 1AY1L 5D7IA 4X80H 1S78C 2I9LB 3U0TB 3WFHA 4FQHA 4PJEB 4JQIH 3BRGC 3I2CL 1JWSB 5GZOD 4Z7VB 7FABL 1NSNH 4Z7UE 4CADA 2HRPL 2G75B 2V2XB 2YPLD 5TDNB 4XH2A 3IDNB 1CQYA 3C8KA 4P46B 1OP5K 5A1AA 1NCNA 5C08D 2WWKT 1M71B 3LQAC 4P9ML 1GJIA 5F1IA 4OSUH 1U8NB 2DTMH 2ZG1A 3K3QA 3LMJH 2NY6B 3ESVF 4Z6AT 1ETZA 4HUWB 2XN9D 4NQXA 3MRQB 2C3GA 2YS4A 3IU3A 5TPWL 2JELL 4ZO6A 3O6KL 4OZGA 2NY7H 3D3VB 1BD2B 5DMGC 4K3HA 3T0XA 3OJVC 5D1XC 2V9QA 3ULUD 3NIDF 4K7PX 3U36A 1RUPH 5CLWA 3U0PB 3ALXA 5I0ZA 3SKUD 1YYMH 4L1HA 5LXGH 3KYKH 3MRRB 1HQ4B 1WEJL 1DQJB 2DM3A 5F9JB 1R3JA 5JORA 4P5TA 3NFNB 5DEZA 1YPZA 5C7XL 5IHZA 2YUZA 1V3MA 1T0MB 2A77L 5EU6A 5KSAD 3W0WD 2R1XB 5CIPA 3VXUE 4Z78B 3T0EE 5LAXB 2NXYB 3I50H 1ZSDA 1F45A 3PWVA 1RUKH 3WXVL 4FNLL 5E70A 1TCRA 4CBPA 5C9JB 2X70B 1CD1A 1EEZB 3MCLH 4DZBA 3QPQC 3VXRE 4CW1A 3SPVA 1KGCD 5I18H 3LDBC 3MJ8B 3D69B 4LGPB 4PJDE 3HE7D 5LGHL 2DQGL 1RJZB 4OB5L 4LU5L 2VJXA 1U8KA 2NY2B 2BSSB 3X3GH 2OCFD 5GS3A 1F2XK 2YD5A 3JV6A 4S1RL 1S78D 5HHMB 4LLUA 1QBBA 1ZLSH 5GGVL 4KJQD 4RDQG 3O4OB 3BZ4B 4XP4L 2ZNXA 4HHAB 2H3NA 1ROWA 2A6KB 2R0LL 2AV1B 1FH5L 4OLVH 5D7SL 2HJKB 3DXAA 3BP5B 2H2SC 1A7NH 1VFAB 4B7IA 4OFIA 1YECH 2P42B 5J0BA 1KCSH 4NO5B 5DJ8B 2YSSA 1HKFA 1OP9A 3G6JA 2YA1A 2ZUQC 3DSFL 3IDXL 4G6AD 4FXKB 4XPGH 2I60H 4D0BB 5B4MC 4J7RA 2CLRB 4V2CB 4L3CA 2YPLA 1AJ7H 2E6PA 5BV7L 5GGSA 5I76B 1MJ7H 3BD4A 4EUPB 2BVUA 3WLBB 5D1XD 1UXSB 3QQ4B 3SE3C 3VU2A 1UEMA 4YHIA 4C57C 4OCRH 1BFSA 3DURA 2X4SB 4UU9B 3EFDH 4FQXC 4NP4H 3ZKMC 3QDJD 2NX5A 2DQIL 1AGFB 1MFBH 3HZYA 3F7RA 4XPHL 2EZ0D 3RWDA 3U1SH 2XQBL 4QTIL 4G42B 1JPGA 4O4YL 1PAMA 3AAZA 2XN9A 5J4MA 3GI9L 1T6VN 4IMLA 1MAMH 3PP4L 4EXPX 3TZVA 1IAII 1V3JA 3QPQD 2EDLA 3G08B 4DGYL 2KQMA 4M93C 3RWIA 4DGVH 4M6ML 4CNIA 2VDPL 1S9XA 1NBZB 1MFCH 1S7WA 1U8PB 4ZUUB 3DRQB 3BPLC 4J3TA 1WBZA 1RV6X 5DC0A 4ZFZB 2OR8A 1CCZA 3QEQA 3ZT6A 1T5XB 4NN6B 2A6IB 4XMLH 1NCAH 4LCIL 4PJGF 4QWWC 4ZOEA 1FYTD 5IVXE 1LO5A 2IC2A 3CDFA 2OI9C 4KQ4H 4QXGL 3AROA 5ALCL 4C56D 4R96A 3NH7L 5H94A 5J6GA 3WNMA 1G7QA 3IGAA 4WI4A 3MRLA 2BC4A 2RIKA 5FHAH 4RGNC 1DFBH 4X6BA 4XB8A 4XWOC 1ACYL 4YAQB 3BIBX 3B2VL 4R2GC 3N9GH 3DPBA 4X9BA 5F3HA 1F90L 4JVWA 4PGBA 4DK6A 8CGTA 5KOVC 2MKLC 1U92A 4X7FC 3KR3H 4LMQI 1BZ7A 4E41D 3NFPB 1M7DB 2Z9TA 1A6UH 2FEDD 4M7KL 3VJ6B 3WEXA 1NFDF 5I74B 5C0CD 5FO7A 2EE2A 2IAMC 3D85D 5MENE 4J2XA 3FB7A 5BRZD 5C09D 5B4MD 4GRWF 4X6DB 4M7LH 5EH1A 4P2QE 5IVZB 5MEOB 1KIPB 2BNRB 2QJDA 5HI5C 3GSNA 1WV7T 2AEPH 3GDBA 3IKKA 4BZ2H 4Y19A 5FOJA 2JCCE 2HTKC 5KSBB 4UINH 1KENH 3DUHA 2EEAA 3BKML 1N6QL 5I15H 3T2PA 1MVFA 3UTSE 3ZLQC 1LP9E 4A6YH 1ZV5A 2FB4L 1T22A 4G9FD 1KPRB 4OI8A 2BXZA 5D71L 3KG5A 4U3XA 1JGUL 5D1XA 2FX9L 5HHXH 4R4FH 1N0XH 1YEGH 2VABA 2GKIA 4ZTPL 3QDJA 3QUMA 4GMSL 4IJ3C 3E0GA 4LIQH 1AXSB 1D9KB 1KPVB 1OD9A 5LKNA 5C0IB 4PJEF 3LPGA 5AYUH 1B6UA 4Z7VF 3P0YL 1P7QA 3O2DA 4HBCH 4Y7MA 3V4UL 1KB5H 1AQDB 5BOZG 4YC2C 5AZ2H 2R69H 3TA3B 5KW9H 4XWOD 4R2GD 4TSCH 1VHPA 2P1YA 2NYYC 3QUXB 5T1LD 1N64H 2UWEA 4XC3H 1H9VA 3P9LB 5F8RC 3R4DA 1RIHL 3MROA 4ORZC 5CJOH 3Q6FB 5JOEA 1KTLA 5HVHB 5F6HI 4X7SH 3FFCD 1WAAF 1CFBA 2YOCA 1JF6A 2IAMD 1RVFL 5HHQB 1BHGA 3L5WA 4YHML 4OFVA 4IIQC 1A14L 2BY3A 3ZTNH 1RZJL 4GG6E 2I24N 5HI5D 5I1DB 3BQUC 4FQJL 4HXBL 4IHOA 2HTKD 4MJID 4L3EE 3TFKD 3OAYK 2A1WH 4M4PA 3OKLA 2VRAA 4R8WH 3VRLE 3MRIB 5IR1A 1HKLH 5C0CA 3KPOB 3D85A 4AZ8A 5IB5A 1GGIL 4XI5C 1BJ1H 3LCYA 3MREB 4WUUB 1Q9WB 1QR1A 3SE3A 2BVOA 5ANMA 5F93C 4D3CH 5JOPE 1AH1A 3V6FB 4HZLB 4QRRB 3U7WL 2IAND 3NIFF 1R6VA 1AI1H 2VAAB 4FQXA 1RAMA 3MV9A 3WJLC 3WO3B 4IRJB 3HG1E 4HWBL 3OGCB 2FX7L 4GW1B 4EN3C 3FN0L 1QFWI 3H9SB 5D7LE 3HI6H 1X9QA 3GMMA 3Q5YA 2MMXA 3HC4H 1I1AC 1EMTL 4LSSL 4OD1L 4ZSOA 1E28A 4P4RB 5I2IB 4G9FA 1W72H 1MFDL 3GHEH 5EPMB 4F7MA 1MCFA 2XWJA 4TVSa 3S35L 1MVUA 3RX8A 3DV6B 4M7JL 3RY4A 3UBXB 3HS0A 2NCMA 4KMLB 3WS3A 3BGFC 4JFHD 2DI7A 1C7SA 2APXA 5F7WC 5EO0A 2X41A 1WBXA 2XQYG 3HRPA 5D4QA 2XTJE 5EO1A 1JZ7A 1I1CA 4G80B 1VEMA 4KRPC 1OSZA 4KAQL 1FORL 1ZWIA 3QISA 4X5XB 3QCUH 2D31A 3X13A 2OR9L 2AW2A 3O8XC 3MRMA 4GG8A 5C6TH 4XVUD 4G6FD 5AG8A 2DLHA 2B2XL 3MUJA 5IMKB 5TF1H 3LN4B 1KJ3H 3FB8B 4HXAL 1OGTA 1RJLB 2W91A 5IB1A 2AXFB 2FLRT 5M95B 4X6EA 3O3DB 2D9QB 4R26H 2H6PB 3VD4A 1P4LA 3BQUD 1WLHA 3MRKA 2J8UE 5E4EC 3QSKB 5I30L 2FJFA 3GB7A 3RKDC 5H2BB 1CF8H 4P46C 1QBAA 4U0QB 5CEYA 1I4FB 1EJOL 3FFCA 5E03A 1PFCA 2IAMA 1CGVA 4WW2B 4YLQT 3UTPE 1G0YR 5TQ0H 2ORBH 4XI5D 4YEEA 4U1GC 1J8HD 3DWTA 4WI5A 2P5WE 5D2LB 5DEGA 3N85L 4M9PA 5I1AB 3AREB 4YFLF 2CO7B 1SVCP 3RJDA 4HJJH 4B0MM 1E4JA 1QFUH 4JZJB 4BQ6A 2LU4A 1XF1A 4N0YH 5JHDB 4WTZA 4DKFH 1IAOB 1MWAH 4DFIA 4JFZL 1OP3H 1YEDB 1VADB 1I1AD 2FBJH 1T2QH 1KEMH 2ZCHH 3OBAA 3NABH 4G9DB 3AS3A 1KUMA 4NWUH 4WHDA 4IEFB 2H26A 3MOAH 4LLWB 1DQMH 1OCWL 1MEXH 3LEYL 1CGSL 5JW4N 1KLUB 1KN4L 2VXVL 3PHQB 1U8JB 4ZFGL 4XBPB 5C0AD 2NXYC 3RX5A 4OIIH 1ZA3B 4KRPD 4PGCB 3C2SA 4NGHL 5CSBA 1NFIA 4YFLI 2C3XA 2GW5A 3IFPA 2X4PA 5E9DA 1NCCH 1CWVA 3TH2T 1CI5A 1NPUA 2Y4SA 4ODWB 3MRCA 3KPSE 3MSPA 3KPNA 5ILTL 1YC8A 1YJDH 3QG6B 2JB6A 2NY2C 2GUOB 4EXKA 5GXBB 5B39G 2CGRH 1F3JA 3P9MA 5E2TH 2WIMA 3KPRB 3CX5K 5KSBF 1GGUA 3O4OC 4JFDE 3VFTB 4OLUL 3RGHA 3UJTL 3DTXB 2CH8A 3E1F1 4ZTOH 5CJXC 1CXLA 4GAGH 4OZIE 4MLSA 4PLJC 3IETB 5FUCC 5L8KB 4N5ED 1FN4A 1EFXD 3LRGA 3U2SA 1QSED 4IIQA 2P24B 2LVCA 4UILL 5ESQA 5AAMA 1Y6KR 4AEFA 2B1HL 3ULUH 5A16A 2EH8L 4YHKL 1EHXA 2IQ9H 4M43L 4EJ1C 5I1GL 3ZYZA 4PJGA 5JHLL 2R56L 4NQUA 1C5BL 4M3KB 4NZTL 5DQJA 3BQUA 2AK4B 1Z0NA 3CXHK 1FNSH 2ICWB 3OQ3B 4O2EA 4XNXH 4HIXH 4ONHB 1BD2D 1GPOL 2BOCA 5JQ6H 5CJ8A 2DYPB 1B0GA 3HFML 4LDLB 5KVEH 4WW1A 1NGWA 3BN9D 2WUBL 1RULH 1A9EA 4QHUA 4K8RL 3RTQB 3QCTH 1S7VA 2KDGA 4NM8H 1XFPA 2O5XH 2YPVH 3FT4A 5FM5M 1NGQL 1FFPA 3OKMA 1LDPH 4KPHL 4HGWA 5FKPB 3I6LE 1K2DA 3WJLA 4BSWA 1EUUA 1NFDA 5K9OA 3OR6A 4L4JA 2OL3H 5EG6C 4EN3A 4PV9B 4EDXA 4TQEH 2IPKB 1JTTA 4UMGA 5HGAA 3W2DH 1N5AB 4BZ1L 4YHZH 3RVXD 4FQQB 5EZLA 4P2RD 2GJZA 3QXAA 4KY1L 5DUPL 4YHOH 1UVQA 2J3SA 4LIQE 1RZ7H 4Z7OE 5J56B 4JY6A 5EIQA 1MFNA 1OB1A 2BXYA 3BUYA 3LQAH 4LHUD 2NY1D 1T0NA 3GSNH 4DOHE 1MSPA 4L9LB 1J1XH 3L3DB 1G7LA 2PKDA 1IEAB 3VFPA 4UNVA 3CH1B 1P84J 1F4HA 2W9DL 1XGQB 3RIFF 4N0UB 3SKJH 5KSUA 1ZKAA 5DQ9A 4UIKH 5EC2B 4NJ9L 5JNYB 2P7TB 1EGJA 3H8NA 5C0BB 5KS9B 4PLJD 1L0YA 1D5BB 2J6EA 3O8XA 4JKLA 3RA7H 3PL6D 3MRJA 3CLEH 3TCLB 5EO9B 3GSVA 3P30H 4BSJA 1DQLH 2AI0L 3QQ3A 4QRPE 1UM6L 5C92A 4S1SL 3O6MH 4JZOB 1J11A 3BDYH 4PREB 1L7TL 1U3ZA 2I9LA 3U0TA 4RAVB 3RWEA 3HC3H 3QUMH 4PJEA 4XC1L 5I74C 5C0FB 1JWSA 4Z7VA 5F7EH 3U0WH 1FFNB 1ZLUH 2V2XA 2G75A 4UUJB 2C9AA 5TDNA 3IDNA 3QWOA 4M48H 1C08B 4AIOA 4P46A 5KANI 1B0RB 3PDGA 5FYKD 3E6FB 1MAKA 4HC1H 4WUKH 1FV1A 1H3UA 4WFHD 1EFXA 3RZCB 2V17H 1M7IB 3OPZL 2D7MA 3AM8C 4F37K 3LHPH 4KWUA 4NBZB 1ZANL 4EDWH 3WUZA 4NKDB 4QXUL 2AKRB 4M8VA 1ULVA 4KJYB 1WAAA 2R8SH 3VMPA 3DX8B 4L8BB 2MQCA 1A4JB 3TJEH 3IKCA 1BD2A 5D5MB 4J12A 1IKFL 1UKQA 3HA0A 5FGBC 3RFZC 3ARWA 1HQ4A 3BIAX 1DQJA 5F9JA 1D9KC 1O7SA 3NFNA 5D7JD 2XY2A 3GGWB 5GRYA 1T0MA 1B90A 1LMKA 3FFDA 5FGCE 1CK0H 4FQ2H 1RFDH 2R1XA 3LVEA 5JW5B 1WT5C 4Z78A 4HS8L 1G7HB 2XA8L 2XRAL 2IADB 3UBXI 1LEGB 5DK2A 5C9JA 1YNLH 4PBWD 1HOCB 3NBNA 4WW2F 3QUXC 1RJZA 1IBGH 1KG0B 3REWB 5D2LF 3UMTA 2O5ZL 3DYPA 5E8OA 2BSSA 1DE4A 2Q8AH 2HN7B 5CFHA 1EH9A 5HVHC 3FQXB 2GJJA 1UXWB 4XBEH 5IMOB 4UQ2A 1KT2B 1L9MA 3BZ4A 4OF6A 3L3KB 3QXUA 4G8GE 4BUHA 5CUSL 5K9KB 2A6KA 5CJXA 3NFSL 2AV1A 2F8OA 4GAJL 1IQWL 3VD7A 5F8QC 1F4WH 3LQMA 1UA6L 3BP5A 2R0KL 4GO6B 4N8CH 4QNPF 4HCRA 5BZWB 4KC3B 1VFAA 5TQ2H 1QSFB 3P11L 1INDH 4ORGA 1GL4B 5LQBL 1UM4L 1FE8H 4M61A 4PP1D 4FXKA 4QTHB 1AHWC 4ODUB 4D0BA 2CLRA 4JKPL 4JFFE 5I76A 1L6XA 4EUPA 4PLKC 1UXSA 3KXFD 1N0LA 3QULA 2ZOLB 3VXMD 1QO3B 2X4SA 4KZDL 5DLMH 4W4NA 3M8OH 2FIKB 2ZCKH 4ZFOB 4G42A 3V8OA 1EO7A 4L4VD 4KXZH 1PD6A 4JHZA 1CTOA 4MXWH 4N90D 1R3LB 4G3YH 5FECB 3T4AB 3X3FH 2VMFA 4CGTA 3IAPA 4YDVB 3G08A 3U48A 3OKNB 4U6VH 3HI1A 4XX1E 3QUXD 1BVKB 3BT2L 2VSDA 4XNQB 4JFEB 1NBZA 3Q3GB 4KGJA 4ZUUA 1U8PA 3DRQA 4ZFZA 1WIUA 1BLNB 4LVHB 3MJ7A 5DHXB 3NACH 2A6IA 5GSRB 2PO6D 3TNMB 3CZFB 2HKFL 4OZHF 5F97E 3ARPA 2YHGA 4HK0B 3H9HB 3VWKB 3QFDB 5C08E 4WHYG 4F58H 1SY6H 1KLGA 4YAQA 5IOPB 1AXIB 5CP3H 2WWMD 2VZOA 3QWRD 3HE6C 2YC1B 2ZNWA 1CICC 4YDJB 4POUB 4UNTA 5DC4B 1UENA 5INCB 3FQUB 3FTGB 5D93B 3RRQA 1DL7L 4Z7NE 4FP8L 1SM3L 1JI1A 25C8H 2P48B 5T1DH 3QJFB 3NFPA 1M7DA 3ZE2F 5DJCB 1YMHB 3RDTB 3I3BA 4WW2C 1IGIH 3VD5A 5HYSG 3PHOB 3W81A 3ULUE 1XR9B 3DX6A 4PLKD 5MEOA 1KIPA 2BNRA 3AREC 3H3KA 3V0AC 5LGKA 2ICWI 2K3TA 1SYVB 1OTSC 1NCTA 3WNLA 4JZJC 4HG4J 1HIMH 2IH3B 1EO8H 2NY3C 3ROOB 2DBJA 3AM8A 5KSBA 4WI3A 3VFGL 2NTSP 3TWCL 3RVVD 3W0WE 4XVTH 1OAZL 4F2MB 3GHBH 4DN4L 12E8L 4Y5VB 3INUH 4G6KL 4ZD3L 5IKCB 1KPRA 1S9WB 2G5RA 4P2OC 1BGXH 2GCYA 5KS9F 2P44B 2IH1B 2EIBA 4NBXB 2F9BT 5FGBA 2CDEB 4PJIE 2FGWH 1RUAH 4HV8B 3VXMA 3GBMH 4WDIB 5C0JA 5JA8B 4M5ZL 3ZKXB 1AXSA 1D9KA 3VD9A 4O02H 4JDVB 5C0IA 3HPJB 1BFTA 2Z31C 5KJRH 4L4VA 1JHLH 3BEWA 4K23H 1AQDA 1QOKA 1WT5A 2AQ1A 6CGTA 3OHXB 4KI1A 1AR1D 3U82B 2VLRB 1OF2B 2H9GA 2AEWA 5ADPL 1MHPL 3IFOA 4PBXA 5D1ZB 2QQLL 3QUXA 5EU3B 5C8JB 1N7MH 1T0PB 3HE6D 1CICD 3TVMB 3P9LA 3LKQB 3NCYP 5DEFA 4DTGL 4HPYH 2WBWB 2V2WA 3NGBB 3QG7H 5F96L 3EOYG 3DX9B 3Q6FA 4P4KB 4PGJA 4JE4B 5FYJD 3RVTC 1LWRA 1OT2A 1XGRA 4H88L 4KUCD 3HRZB 5HHQA 1MPAH 1IC4H 1TCMA 5D5MF 3PWPD 4Q9RH 3ZZ1A 4X6CB 4YE4H 2B1AL 5B3NA 4G43B 1Q94A 3ARYA 4HUVA 1RZFL 3K4AA 3TO2B 4ODHL 2DQTH 5I1DA 2Z92B 1MLCB 1UJ3B 2D7TH 3EYVB 2X4TB 3FQTB 9CGTA 2NY3D 1A64A 5L0QB 3QQ9D 3BDBA 5IFJB 3L5XH 3SDDB 4WI9A 3KYNB 3MRIA 3U9UB 1TPXC 2H32B 1RIUL 3KPOA 3QUKA 4NN7C 3QHZH 1AHWA 2JIXD 4NKOB 1AGCB 4P2OD 3RTQC 4WUUA 3MREA 1Q9WA 2FDBP 2ZSWB 3JTSB 2WSKA 4MX7B 2OJZH 1OY3B 4ERSL 4YDLB 4YQXL 1IJ9A 2J6EH 2UWEE 4HZLA 3V6FA 4MZ2A 5FAAA 4QRRA 2WBJD 4MNQE 4POZC 4Y4FD 1TZIA 1TZGH 2VAAA 3V52H 1FGNL 2A0LC 1LEKB 4IRJA 4GW1A 2AEQH 3LH2H 4NPYB 3VFMB 1FYTE 4EQ3A 1W2KT 2F54D 3H9SA 5LCVH 1Q8MA 1FHGA 4C56E 4PRID 2Z31D 2PETA 3D48R 1CDYA 3IFNH 4GT7A 3RPKA 2APBA 1NKOA 5I2IA 3LOWA 5GGTL 4OQTA 4P49A 1A7PH 5CZKA 5EPMA 1R24B 1A6ZA 3TGXA 1U9KA 1B88A 4E42A 3QB7C 3UBXA 3U7YH 4OZFH 4NQVB 5ABDE 1Z2KA 4IRZH 4WTXA 2CJUH 3QEUA 4JM4L 3QIBD 4E41E 4G80A 3EJZC 3EW3B 3OTTA 3NZ8B 2ZUTA 4HKXB 2MPAH 3GK8L 4X5XA 1AIFB 5BRZE 5C09E 5INDB 3RVTD 4MWFB 5I8EB 2DMKA 3MACH 5F7NC 4H20H 4C54A 3J7HA 3CJJA 5GRUL 5IMKA 2XT1B 4JREB 3REVB 3LN4A 1U3YA 1G9NL 2AXFA 1GHFH 3V95A 3O3DA 2H6PA 5CGMA 2ZG3A 4NJAL 2P5ED 3ZE0F 1FNGB 3HE6A 4LLQB 3QCVL 3QO0B 5H2BA 1F02I 2OTWA 3MRBA 3MLZH 3CSYB 1VGKB 4U0RB 1I4FA 4MXVE 4ZSOE 4X5WB 4G9FE 1C1EH 1WF5A 4LSUH 4Z5RB 4WY7H 4Q6IC 1WICA 4YDKH 4PB9L 4WW2A 3B3IB 3BSZH 3PWPA 5KVGL 1F8TH 5BQ7B 4YXKL 1NCWH 4P3WA 5AZEH 3RVWD 5I1AA 3AREA 4B53A 2DF3A 3ARBB 1HYRC 4YHNB 2JE8A 2DLEA 5DUMH 4CU6A 4POZD 3JV5A 1SMOA 5DRWB 2A0LD 4JZJA 4JVPA 4YHPB 2DQHH 5C0EB 1IAOA 4NQSB 4R4NC 2XG5A 2F19H 4PJ9B 2VL5B 3OF6A 4ZFFB 1YUHB 1YEDA 1R3IL 1VADA 4XP1H 4HPOH 1N59A 5ADOH 4H8WC 2R0ZH 3IJHB 2FECI 2JIXA 2ZUXA 4G9DA 5DI8B 4P2OA 4P23B 4F7TA 3C6SA 1F97A 4JFPB 4LLWA 2CRMA 1VPOL 35C8H 3MXVL 4L4TD 1KLUA 5EU5B 4QOKB 4OFPA 3PHQA 4XBPA 4XCFH 1K5NB 2JJWA 3AXLB 1G7PB 5DD5H 5CZVH 2AJYH 1NBYB 2XKSA 1ZA3A 4PGCA 1REIA 1JYNA 1NUDA 1J5OL 4JHWH 2Z31A 1UWEH 3MC0A 3WFBL 4OLEA 1NANI 4YO0A 4KHTL 4ODWA 3C5SB 3ILPB 5ACMA 3QG6A 4D8PB 4FFZH 5FYKH 4QHNA 1BEYH 2GUOA 4M9OA 3MLSL 1OAUH 3JSSA 3QO1B 1QTYT 4RGMB 3KPRA 1CXHA 4MJIE 2AP2A 2NY5C 1Q0XL 1EFQA 2RFXB 2HMIC 3O6LL 2FBOJ 5CCKL 1X5XA 3DTXA 4HWEH 5HHVH 5T33H 1RU9L 1YNTB 4ONFL 3CSBA 4POYA 3MLUL 2P24A 5GRJL 4LEXL 2EXWC 4LSVH 2IANE 1JV5B 2OR7A 4LP4A 4XGZB 4FQ1L 2ZUUA 2AK4A 2EDYA 2ICWA 1F58L 2SEBB 4OZHA 1DBML 4KUZH 3KGRA 4N8PA 4R4ND 3DROB 4PRPE 4ONHA 3HMXH 4HKJB 1Y18B 2HKHH 4KZEL 2DYPA 3OKOB 3GNML 2X9YA 4JHAL 2VDNL 4U1IB 5EBMB 3SE8L 4NN5B 4K3JH 3ULVF 5KSVB 3RTQA 1RZGA 4QHMB 2AJ3B 1QBLH 4JFHE 1JNHA 3N50A 3ZDYE 3FT3B 2R2HB 1QYGH 5BO1H 1JL8A 2GQHA 2R29L 1JFQH 1OM3H 2XYCA 3O6FB 4PV8B 2R4SH 1QR4A 5ISZD 2GT9A 3PQYD 3ZHKA 1MCJA 1HI6B 4EI5B 3T3ME 1U2HA 4PV9A 5E95B 4MLIA 4ZFOL 2IPKA 3MLWL 4M7ZB 4Q0XH 1N5AA 4LMQE 5EOQL 2MFNA 1DDHA 4FQQA 1IAIM 1HZHL 4QHLA 4X6CF 3C09B 4YUEL 1FBIL 1G7MB 2YR3A 2ESVD 3DMMB 4LVHC 3VI3F 5L6YL 2Y06L 1N3NB 1DQQB 3V4VH 2FYYA 2YBRB 1IEAA 3CH1A 1BAFL 1XGQA 1Q1JL 4N0UA 3UTQB 3VWKC 3WDJA 2HMID 5EC2A 4ZS7L 5KOMC 2YMXL 1A3RL 4DEPC 5JNYA 2DQDL 3JUYA 2WUCH 5I1CL 1MCIA 5C0BA 5KS9A 4XP6H 2X9WA 1D5IL 5L88H 2AXGB 3HLAA 1T3FA 5IESL 1P53A 1J8HE 3HUJE 2DQEL 1YEFH 3EO1B 3TCLA 5EO9A 5HGBB 1TLKA 1LEIB 2EXWD 4JZOA 4RAVA 5C0FA 4X4YB 5C07E 4M03A 1FFNA 3TYGL 4NHCH 4JFXB 3HZVB 2R0WH 3BPOB 4UUJA 2RQ8A 1C08A 5F88A 1B0RA 5HHNB 2HLAB 4OLYH 5DO2C 2HVJB 2K7QA 2VDOH 3MODL 4ENED 5I1IH 3KLAB 4Q6IA 4U1SB 3RVUC 3S3SA 3G6DL 1H5BB 1M7IA 4OBRA 1ZS8A 2DI9A 4X7TB 3BW9B 1OARH 3VH8B 4LVNB 2PXYC 1FRGL 2AKRA 3JTTB 2VR4A 5C0AE 5E00B 4KJYA 3V6ZA 2YD2A 5L2KD 4J3VA 4KVCH 3DX8A 4L8BA 2Y23A 1FZJA 1A4JA 2DBLL 1PG7W 5D5MA 3HNSH 5F6HJ 1OAKL 4RIRB 4ZNEA 2Y5EA 1SBBA 3VWJB 3GZKA 1QRNB 3ZKXC 3VDBA 2D7PA 5JW3L 5JMRA 1UFUA 3GGWA 5EUOE 4XPBL 4OGXL 1TZHB 3IB4A 3MPCA 5JW5A 1JN6B 1S5IH 1BVLB 1G7HA 1TJGH 4XNZB 5FM8A 2JLLA 3ZL4H 4Z7UB 3P40A 4NHUA 1LEGA 2D7OA 2IALB 4GXVH 5BS0B 1ZHKB 3V4PH 5J8OA 1UQSA 1HOCA 5LGJB 2ED9A 4OM0L 4KMTL 1XF5B 4JRXD 1FNAA 1QSEE 3TVMC 1F4YH 1GVIA 1KG0A 2C3WA 3EYUH 3REWA 3ULVL 4FQIH 5H8DA 2OQJB 3NGBC 1MLBB 3STZB 2ESVA 2HN7A 4U3CA 1FG2B 1UZ6E 1O5DT 4D9LL 1CG9B 3QRGH 4P4KC 3FQXA 5E5MA 1WAAE 1UXWA 5DJAB 4FHBD 5IMOA 1KT2A 3O0RL 4HZAA 5TE6H 2R2BB 1BM3H 1JF5A 3WL9B 3F58H 4L8DB 3GBNH 5K9KA 3HZKB 4NNXB 5DO2D 2P46B 1RZKC 2V7NB 1A7OL 1I9RH 3S88H 4RZCB 3RVUD 5CEZD 2BHZA 1UJ3C 3CK0H 2CR6A 1I8IB 3P4LA 4OGYL 1XGUA 5BZWA 2XIDA 1UACL 1QSFA 5JIPA 1RHFA 3OZ9L 3SDDC 3MLPA 1DQDH 1T66C 2PXYD 4PJ8B 3Q2CA 3BD5A 1EX0A 1EIBA 3VXUB 4QTHA 2XI9A 3T0EB 4ODUA 4KDVA 2DL9A 4ACPA 4LGRB 4NO0B 4KTEH 3MZTA 4P2RE 3BPCB 3NA9H 2NLJB 4RAHA 1QO3A 4OLWL 4X6FB 2NZ9C 4PJDB 4M62L 1Q0YH 4G7YH 2FIKA 3HAEB 3GIZH 5IMMB 5KTEH 1QFWM 5SWZE 2AVGA 3I02B 1MCSA 4GKOA 4NZRL 1U8QB 3DYMA 1S7SB 2A73B 4CJ0A 4OI7A 1ES0A 1BQHB 1R3LA 4HQQH 3MNVB 5FECA 3T4AA 5HPOA 1A6WH 3QHFH 3OR7B 4R0LB 5FUCE 3NCBB 5I8CA 3OKNA 1U36A 5FYJH 4KJWC 5F7DA 2VDKH 4GSDL 5D96B 1BVKA 1JZ2A 2X1WL 4OD3L 4FQLL 1WBYA 4GQ9H 4JFEA 3Q3GA 3R06B 3R8BB 3UYRL 1A3LH 4MXQC 3KJ6L 1RMFL 3RBSA 3S4SG 2YWZA 2GY7B 4YWGH 2BP3A 3CZFA 4JFOB 2F74B 1XMWA 4HK0A 3H9HA 3S6CA 3VWKA 4CDHA 3QFDA 4QO1A 5FYKE 4JREC 3NVQA 1K6QL 4NQDD 1X7QB 3JWOL 3FAXA 5IOPA 5I1KL 1P9MC 2PTTB 1PLGH 2W0LA 2YC1A 1QFPA 4YDJA 4KVNH 2VLKD 4LQFH 3FQUA 5INCA 1OW0C 3VGFA 3QJFA 4NZJA 4ODSL 1BFVL 3HR6A 5DJCA 1LK3H 4BQ9A 2J4WH 3FCTB 4HIJB 5E99L 1ND0B 3CVIH 5DDHB 3PHOA 2DTSA 4MS8D 4LPVA 1A6VL 1XR9A 5DJXA 1RURL 1CTNA 1FNEB 3ARBC 1ZGLB 3L9RB 4ELKB 1SYVA 1NJ9B 3MV7D 5A2IH 4NOBA 2NZ9D 4XTRC 1G9EA 4LSPH 4HJ0C 2IH3A 2B0SL 3EFFB 3SOBH 4FFYL 3ROOA 4Y8AA 2DQJH 1ZXQA 2IG2L 3LSOB 4JDTL 2PXYA 2X4OA 5IVXB 1IAMA 3TCXA 5IKCA 3EZJB 2PCPA 1F6LL 1S9WA 2DQFB 5CD3B 4YXLL 2ZOKB 1JYWA 3NMEA 4HMDA 3ZKSD 5IG7A 1AQKL 1WWAX 2D4FA 2IH1A 2XZQH 4PGZA 3GRWH 4KJWD 2CDEA 4Z0BL 4RX4D 3ZE1F 1HNFA 4HV8A 1FL5A 2P8LB 4O00A 1WWBX 1YEIL 4WDIA 1NUFA 1X5ZA 3P0VH 4QGYA 1AKJD 4JDVA 4MXQD 3CFBB 3HPJA 1DCLA 2F58L 2BJMH 5DD3H 1NEZB 1OD7A 2IBGA 1DSFL 5MENB 3FONB 5MP6L 1FGVH 15C8L 4U3HA 5F1NB 2VLRA 5TDOA 1OF2A 1B4JL 1I1FB 4JPVH 3T2QA 4P2QB 3MBEB 3O3EA 1IZKA 1RHHB 5EU3A 5C8JA 2EIEA 3B6SB 3I9GH 3TVMA 1QUNA 2LE9A 5IQ7H 3LKQA 2JCCB 4P5KA 2ZCLL 3DX9A 3IU4H 4P4KA 3V7MA 4MGXA 1NAKH 1L0XA 1R5VB 3UTSB 1LP9B 3HRZA 1HWHB 1TDQA 5E6YA 3MA7A 5FHBH 1UGNA 3HNVL 4KQ3L 4X6CA 3KXFE 3FQRB 4G43A 4Y5YB 2BDNH 1DBAH 1ZT7B 4ODVL 3VXME 3I75B 2E27H 4L8SB 3TO2A 2CIIA 1VESA 4GOSA 3UJIL 2Z92A 1MLCA 1UJ3A 1G6RB 1DQTA 3H3PL 4Y1AD 2X4TA 3FQTA 1FO0B 3EAKA 2Y36L 4APQB 4NKQB 1KELH 4L4VE 2AK1H 2H45A 3WMSA 3SDDA 5IFJA 4PJAE 3FMGH 2UYLB 4N90E 3KYNA 3U9UA 5C2BH 2KZWA 2VDML 3A67L 2H32A 2ZKHL 3SE9H 2Z0BA 2UZXB 2VOTA 4Z7UF 4NN5C 1A9BB 1AGCA 1B2WL 4OF8A 3SHSA 2VXQH 3ARXA 1UB5B 4PIRF 1UZ8B 2ZSWA 4HWUA 3JTSA 3C5ZC 4MX7A 2ARJB 5GS0L 2MOVA 4K9EH 4Y4KC 2HRPH 3WDIA 1LEKA 3WKNA 4BFGA 3GBLA 4EI5C 4NPYA 3PWUA 3VFMA 3ZKNC 4KKLC 3DVGB 2JF1A 1BFOB 5JW4M 4M7ZC 4QCIB 4P9HC 1JHKL 1J1OL 5F89B 4F15B 3MA9L 4Q74A 3C09C 3UROR 3MJGX 2R4RL 1ADQL 1R24A 3DMMC 4Z7QE 1IFHL 3SN6N 2LTQB 5IHBA 4GG6B 4NQVA 5TPWH 3W11C 5DJYB 1YEJH 1IM9D 1DN0B 3QWQB 3OWEA 3OGOE 1VCAA 2BSRA 3W39A 5T5NG 2EYTB 4H25B 4O9HL 4L3EB 3NZ8A 2E7HA 4HKXA 2A83B 3THMH 1AIFA 1WEJH 5IBTL 1L9NA 4TNVK 5INDA 5I8EA 5A43C 1A6AB 5C7XH 1MCWM 4ELME 1IGYB 1G1CA 2B4CL 4K3GA 3REVA 2QKIB 3RUGF 4LKCB 4JG1L 3N1GC 3P2TA 4PJDF 2XICA 4ONOA 1P9MA 3WXVH 1MHCB 3CXDL 2ADGB 1FNGA 4LLQA 1FP5A 3HG1B 4S11A 3BPOC 2GHWB 3QO0A 4U33A 1TTFA 2HFGH 1OW0A 5DC9B 5D7LB 1VGKA 1PKOA 5I71B 4R3SB 4X5WA 4JGJA 4OB5H 4XCYA 2GTWA 4Z5RA 2J1KA 1IMHC 5KZCD 1MY7A 3B3IA 4OCYH 4S1RH 2XQYK 2A2QT 4Y2OA 2AJUH 3TT1L 5BQ7A 3C5ZD 2CLVB 2X09A 4Y16D 4JO4L 4UT7L 4LVNC 43C9B 3ARBA 4YHNA 4XP4H 4Y4KD 5TE7L 1H3TA 2ZPKL 5DRWA 3V5DA 4OLZL 2AXJA 4YHPA 4EI5D 5C0EA 2XTJB 3MBXL 3DYOA 4KKLD 4NQSA 4UV4L 3ZKND 5D7SH 1GZPB 3P4NB 4PJ9A 3FRUB 4W4OC 4ZFFA 3LIZH 1YUHA 3UZVB 3BRFA 4NRXB 3A6CL 2HWZL 2NY5H 1QNZL 1GAFL 2F53D 3I84A 2B7DT 2J8OA 5DI8A 1JGEB 1AC0A 4R7NB 4JFPA 1QLEH 1RZ8B 3NCMA 1MRFL 3QH3A 2BMKB 4IOFC 3W11D 1S9YB 5EU5A 5BV7H 4QOKA 3S35X 4JY4A 4XNZC 2J8UB 3BISA 4HUKB 2BVQB 3AXLA 1G7PA 4F57H 1CR9L 1A5FL 1NBYA 2OZ4L 3CFEB 3DLQR 5FYJE 5E2UH 2DQIH 5IEKA 1HHKB 3PWPE 1IEBA 1NGYA 3ILPA 2VTFA 4WV1B 2XPGB 4O4YH 1X5IA 3QEHB 5HYJE 4TN9A 1MF2H 4W6XB 3U4EA 2P5WB 1JHTB 1FFOB 2X4UA 2FHBA 2N4IA 3PP4H 4NT6B 4PRAA 3QXDB 2P8PB 1JNLH 1I9JL 2RFXA 3WHE1 4DGYH 5IVXF 4M6MH 4PB0L 4X98B 4MAYC 4ODXB 4ZS6C 1MCHA 1YNTA 2DKSA 1WFOA 1GRWA 4Z95H 3LV3B 1DLFH 5BJTB 4QXGH 3B4NA 1RUML 5CJQL 4XGZA 3C6LB 5AWNH 5C2UB 1NANH 2EDTA 1CDUA 2F54E 2SEBA 4XPAL 1HINH 1HWGB 4PRIE 5E8NB 1PQZA 3DROA 4LK4A 1LO2L 1HHJA 3C08L 4HKJA 1Y18A 4RISH 1F90H 3OKOA 4U1IA 5EBMA 2BY2A 3JWDC