2YK1L

Structure of human anti-nicotine fab fragment in complex with nicotine
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
207
structure length
188
Chain Sequence
ELTQPPSASGTPGQRVTISCSGSSSNIGSNYVYWYQQLPGTAPKLLIYRNNQRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCAAWDDSLSAWVFGGGTQLDILGQPKAAPSVTLFPPSPKATLVCLISDFYPGAVTVAAGVETTTPSKQSNNKYAASSYLSLTPEQWSYSCQVTHEGSTVEKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Different Binding Modes of Free and Carrier-Protein-Coupled Nicotine in a Human Monoclonal Antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords FAB FRAGMENT, HEAVY CHAIN
total genus 35
structure length 188
sequence length 207
ec nomenclature
pdb deposition date 2011-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2yk1L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2yk1L01
4KHTL 3CMOL 4NQVB 4X9BA 1MCQA 1FNSL 5CJOL 3O3AB 4P9MH 4NKMA 3LRHA 4ZXBD 4CMMB 3G6JA 4L4JA 1ZLWK 4OAWA 4XVUD 1YNKH 1D9KC 4YXKH 4AQOA 1I1AA 4JY5H 3SY0B 2X4UA 1MF2H 1ZOXA 1SYVA 1Z3GH 2BVPA 5DMGC 5EBMA 2X9YA 3RWDB 3RRQA 5T1KD 3RIFK 4UIMB 4LIQE 2EIZB 2CKNA 5IF0B 5B3JE 4HCRA 3D3VD 1UENA 3QNYA 4XPTL 4APQB 1JZ8A 3GSQA 3STBA 2VR4A 5CBAA 4O58L 1X5LA 2ERJB 4PB9H 1E6JL 5JPMB 4I3SH 3ZHKA 5ESVA 1BFSA 1BEYL 1I9RL 3OXSA 5JUEH 5BS0E 1IVLA 2F5AH 1RIVL 1IAII 4CN1A 1BBJA 1S7TA 3BKMH 4U1KA 3BX7C 4QRSA 2GSGB 3ZKSD 1D9KA 2JELL 5I0ZA 4F15C 5EU6D 5GRUL 4J4PA 3IFLH 4X6BA 5E08H 4WW1A 5IVXA 1U93B 1EHAA 1M7XA 5CLTA 4G8IB 1RJZA 4P46B 2IPTL 4XPTH 5DJYB 1UKQA 3T3PE 1KFAL 4XH2A 2VXTL 3HI5H 4PJ7B 2XFXA 4P23A 1LEKA 3NCBB 5HDQH 3ZTJG 1CL7I 2DQHL 1KCSL 3LIZH 1Z3GL 2DYPA 4R3SB 4G8FA 1BIHA 1CLYH 1GC1L 5F7WC 1QR1A 3IKCA 1NLBH 4JY5L 3A6CH 2YOCA 3OR7A 5KW9L 5GGQL 1SY6H 4YHML 1BWMA 1B2WH 2FZ3B 2UZIH 4WFGE 4F33A 2E3VA 4ZXBC 3VMPA 1WCBA 3O0RL 4PRIE 4M7ZC 5EIIB 3VGFA 1EPFA 1CL7L 4YE4L 5EA0H 3VWJD 4ZOEA 3S36L 3D25A 1IGYA 5EZJB 3SCMC 5FKAA 1QFUL 2Y07L 1DUZA 3CK0L 4AM0A 2R1XB 1HH9B 3C6LD 3UJTL 1R3HA 5F3BB 2P8MB 1DQJB 1J18A 5CEZH 4AL8H 1D7FA 4NZTL 5IFHH 2NXZC 3RX8A 7CGTA 3MODL 4LVNC 3V0VB 3VXME 4JN1H 2UWEF 2P5ED 2UVFA 4HKJA 1XR8A 2AK1H 3TV3H 3MX0A 1DQQB 3NZ8B 1NFDB 2W0FA 3B9KC 1KXVC 2Z31C 3FKUS 5KANG 5A40E 3QXAA 5T1LA 4MAUH 3QH3B 3KPSA 2Q20A 3W82A 5IHZA 5F7MC 4BUHA 1U8PB 2EZ0C 3D3VE 3BD4A 3B9DA 4RAVB 4LCIH 3FT4A 4OZ4A 1E6JH 3J7HA 4ZAKC 2QEJA 1H3UA 5C2UB 1NBVL 4YO0A 4LLMB 1G7IB 1UJ3A 5J56B 1YEIH 1M7DA 4NO0B 3RVUD 2DYPB 1JGUL 4NQCB 3G6AA 3V9FA 1VFAA 3KLAA 4KDVA 3LB6D 3OKDA 1MWAB 2FX7L 4ZS6C 4M3JA 2XOTA 2V5YA 3MCKB 5DO2C 3MNVA 4PRHB 1HEZA 2VKWA 4ZSOB 1UH2A 1S7UB 1TJHH 1VFOA 4KKLC 5ID1A 5LKNA 5FUCE 4G9DA 2XQYK 2GTZB 3ZTNL 4F9PC 2VLKA 3C6LA 4JO3L 2XPGA 1ZSDA 5B8CA 3LS4H 3GSNB 3GUTB 3AXLB 5DSCB 3BISA 5DUBA 4U1HA 5L7XL 5E9DE 3NN8A 3QPXH 5AAWA 1K4CB 4Z7VE 4PJCA 3O41A 3LKNA 4OT1L 3T1FA 3HLAA 1WV7T 2EC8A 3KNBA 1YECH 3DHJA 4KZDH 4FFZL 4APQA 2FATL 4NCC2 2F54E 2QSTA 4JFFE 2CH8A 4L4VD 4TQEH 1A7QH 3VFOB 4Z78A 1G84A 4Z7WA 4XPGL 5EUKA 3C08L 3RWEA 5EBGA 5SWZE 3BUTA 3B9KB 3O9WB 4L4TE 4J1UB 4J7RA 1MRFL 3EYSL 1MRDH 5CS7A 3RL1B 2YK1L 2FECI 1BD2B 3OHXA 3S3JA 3TFKC 1R3KA 3IF1B 5HVHB 4KUZL 2D7PA 5B4MD 1JHLH 5E4IA 5BCAA 4YEEA 3WXVL 5JXAH 1YYMH 4S2SA 1U6AH 5IBTL 5EOCH 3UTZB 1D6EA 1T04B 4AEIH 3S37L 5C6TH 1FSKB 3QUXC 3FAWA 1CFBA 1XF1A 1JHKL 4HJJL 4XNQB 4NCDA 2G2RB 3HNTH 5C09E 4F7CA 3DV6A 1QKZH 3WNPA 2A73B 4LLQB 1NGZB 3IFPB 3MPCA 3EYFB 1FL3A 2OQJB 4OM1H 5IJVA 4O00A 3GIZH 4QRRE 1ZVSA 1T3FB 1XMWA 3RX7A 3ZSSA 4JKKA 2VLRB 2HVJB 4R4FH 4XNYH 3X11B 5EU6B 3KR3L 3Q5OA 1OTUD 3S8WA 43C9A 5I75B 4P23C 2I9LA 1EHNA 2DJSA 4FMKA 4OCWL 4O9HH 3S5LA 3UTPE 3KPPB 5F7HA 1CLCA 3I6LD 2VXVL 1ES0A 4P49A 3GBLA 4RWYL 5E6ZA 2WZPD 1BBDH 4PRHA 1DEEB 3PNWA 3DXAB 3ARFA 5E2WH 1HHJB 4LSDA 5F7KC 4AM0B 2A2QT 2V6HA 4LQ1A 3P2TA 1LO3H 4KXZI 3GBNH 3WJJC 3LKPB 2VDRL 1ITBB 4OIBA 3SDAC 2VDOL 1KXQE 5FO9A 1NFDE 1EEUA 15C8H 5I8EB 2H9GB 2DMCA 4J6RL 2Q7YA 5ALBL 1M71B 5I6XB 4JRYE 4LRIA 2FZ3A 4L1DA 4WNQB 4N0FB 4K7PL 5E4EB 2AXJA 1KLGB 3GMNB 2X41A 4YX2H 1KLUB 2Q8BH 1DSFH 2V17H 3HE6B 2P5EB 1SJEA 3MZTA 3GB7A 1Y6KR 2YUXA 1QRKA 3TNMB 4V1DA 1YUHA 4PRPD 5CAYB 4FQPA 4WEBH 3WIFA 4IJ3B 5IQ9A 5HHPA 5MEQA 3V5KA 1WBYA 4G8EB 3OPZL 3UO1H 3RZCA 2VR5A 3MV9A 2AQ3A 4HLJA 3F6LA 1JF1A 4TSBL 1CGYA 3ROLA 4PY8J 3G5XA 2BY0A 1DEEA 3ARFB 3PNWB 5D2NA 4WUUE 1BD2D 5INDA 3H42L 5J1TC 1A4JA 3GNML 3T2OA 3GIZL 3QNXB 1TVHB 3AM8A 4GKSB 2XG5A 4R4ND 2XG4A 3SE8L 2NW2A 1I9JL 3WUWB 3MV01 4UTBL 5D1XD 5FECB 3SOBL 4D0BB 5E2JA 4NNYB 5DJ6A 2ERJC 1W2KT 4AEIL 1U6AL 2OCFD 1NGZA 5JW4R 4YDJB 3VI3E 1K4CA 5KAQF 3KPSB 1CVRA 3V4VL 5IMMB 5C0CB 2XXCB 3LKRB 3IFOA 3UJJL 5I1EL 4Q9QH 2HRPL 5KOVC 2EKSA 2A77L 2BC4B 2MKLC 3LQAH 3VU2A 4M61A 2VDQH 4U1MA 3BOVA 3DO3A 1BZ9B 4IEFB 1U93A 1H3WM 1RHHB 4Y19A 3BYTA 5I1LA 4MCYB 3TO4C 4KJWD 5JW4Q 3DX9A 3VE0A 3Q6FB 4OKDA 1DQLL 2IMMA 3QUXD 4IRJC 2AEWA 2Y25A 4NQCA 5T1DL 2R8SL 1G9NL 2ZUYA 1K3ZA 3K1DA 1JGVL 3ZKND 5ENWA 1VEPA 3F65A 4HBCH 5HYSG 3CVHL 4PS4H 3I85A 3T0EB 2RBLA 4V1DD 4AQ1B 1A4KA 5F7FA 1A6TB 1OPGL 1TTFA 4L9LA 1C5CH 4OLUH 3MYJB 5DJCB 3T2PA 2FEDC 2A0LC 3BKYH 3Q3GA 1G6RB 1OB1A 1FVDA 2B4CL 1TVHA 4FQIH 3LKRA 4GKSA 1BECA 5EU5A 2JCCE 5FA3A 5FCSH 1TCMA 3PGDA 4KGJA 4CADA 3P0VH 4J4PD 5E8OA 4LKCB 3T1FB 1SM3H 3GSNA 1Q72L 1CVSC 3MRRA 3NH7L 1RSFA 3DROA 5SWSE 4KTEL 4XH2B 1VPOH 5F88B 3D39A 1T80A 4M5YL 2DTML 1KEMH 3T2NL 4TOYL 4UIKL 1A6WL 1FZOA 1P69B 3D0VB 2YA2A 2J6EA 3ARFD 4M8VA 3MLSH 3AREB 3BUYA 2IH3A 5SWZA 1HHJA 1FLTX 2VXSL 2NXYD 1HSAA 4QHUA 4MB5A 5EIIA 3V6OA 4J1UA 2NZ9D 1UXWB 3BRDA 5JQ6H 2A6KB 3VXTA 5EFIA 4L1HA 3QPQC 4XTRC 5EO1A 5E9DB 2WINB 3ZKXC 1GPOL 2ZNXA 4XWOC 1A64A 1G9ML 4NO2A 5J8OA 1SBSL 5IESL 1XIWD 3EHBD 4OCNC 1JI1A 4OZGE 4NUGL 2XTLA 3SE9H 2F19H 4X4MA 4XP5H 5AG9A 4PS4L 3OQ3B 2GITB 4Y1AD 5DJDB 1AGDA 1DDHA 1OGAA 1QFWL 4PGZA 4XNYL 3MRBA 2EEAA 12E8L 2NXZB 4KQ4L 5DJ2A 4DN4H 5FF6A 1K9TA 5ILTH 3FB5A 4JZJB 1KJVB 2EDHA 2FIKB 5JW5A 2FLRT 4X5WA 1KJMA 2VDPH 1K6QH 1S7RB 4YHKH 1ZHBA 3I9GH 4GLRH 4L3CB 4X6CB 5SV3A 5J9PB 3U4AA 5C6WH 1F5WA 3I50H 2LE9A 4WO4A 4H0HB 2AJXH 5IW1B 2UZIL 5C0JB 2Z31D 3C5ZA 3TYGH 1BBJB 1SY6L 2X4RB 1KCUH 3PL6B 5HDBE 1MLCB 4OBSA 1NGPL 1QPXA 2EDNA 4A2MA 2I07B 2GJ6B 1A0QH 3BH9B 4KI5C 3O8XB 3QI9A 2C1OA 4F8QA 3FO1A 1G7PA 4XP4H 4OGZA 3T0EA 3OV6A 3LZFL 2NPLX 2DBJA 2Q7YB 1A3RH 3MRKB 1NBYB 1UB6A 5TF1H 5HHQA 5KSAB 4PJEB 1CLZH 4GKNA 1J8HB 3PV7A 1QSFD 5FHBL 5F8RC 1U8NB 4OQTH 3TJEH 4HKZA 1W0YT 5IVOA 2C26A 4XPGH 5L0QC 3UZQA 2KUTA 2YD4A 3O11B 8FABA 3KPMA 2NY0C 5CP7B 1W72H 4ZOBA 4U05A 1EEQA 4HWZB 3U9PL 3PGCA 4U1MB 4Y8AA 3RZCB 4OQTA 5I1AA 3V4UH 4I3SL 1OQOA 1R24A 5C07E 1II4E 3BRGC 1X44A 4L4TA 4Z7WF 2BMKB 5C0RL 1I8MB 1Q9WA 2R1XA 1R6VA 1C8PA 4Y19D 3O0RH 1T22A 3V7AE 4PJ8C 3N1QC 3D39E 2VXUH 3QIUB 4HG4J 4PJ9A 1T1XA 1J5OH 3BZ4A 3X14B 4MXQD 1T1ZB 1I85C 2P5EE 4J3OC 5JA9A 4P46C 4GRWB 2JCCB 1OCWH 5C0FA 3FQUA 1UWGH 4NQXB 3TYFB 2RGSA 4G6AC 5DWUH 2YD8A 3STZA 2VXUL 1S7WB 4MB3A 4AIXA 2V2XA 2EH7L 3CPLB 5ITFB 1Q1JH 3IKCB 4N8PA 4KHTH 2BVTA 3A0OA 2APXA 3MRDA 1LK3L 1HE7A 2VDOH 2VUYA 1BP3B 1NJ9A 4LSRL 3O4LD 1RUAH 2DBLH 3B5HA 1P7QD 5E56A 3BP4B 2H6PB 4XP1L 1GJIA 1ZHBB 1ZA6B 4LOUC 4B7LA 1L6XA 1BZ9A 1JZ5A 2BC4A 4CGTA 1JPTH 3IETA 4ZG1A 3TBWB 4D2NA 3KPQB 4KQ3H 3ZT6A 1BD2A 3OHXB 3QP3A 4LSUL 1BEYH 1U9KA 1MPAH 4KJPD 5I8OL 1KG0A 3STLA 5DFVD 4P2RB 4BQCA 5IHZB 1UJTA 4UNTA 1ITCA 4JN2B 2CMRH 2NY4D 4KHXH 1XF2B 3PP4H 3H0TB 3D0LA 2EC9T 2GJZA 3QUYC 2WWKO 1LE9B 1UKTA 5C0CE 1IL1A 5CBAB 4JR9L 2Y36L 2CIKA 1EO7A 4QCIB 3WFZA 5DRNB 3SDXF 3ARFC 3IKKA 5IBTH 4RWHA 5HGHA 1M6OA 2P4AB 5JQHC 2AABH 4PJ7F 5IG7A 1KXTB 1RUPH 2I60L 3FB6A 2HG5B 2CSPA 2E7CA 2P24B 2L7JA 4X0KA 4TVSa 2GTZA 1PY4A 4F3FA 4NSKA 4OKVB 1QYGL 3S6CA 4Y7MA 5I9QB 4OLYH 4QXUL 3GK8L 4HEME 3OBAA 1G6RL 3IDMA 5C2BH 3O6LH 4LIQH 1RZKL 3NFPA 4QWWC 4ZQKB 1LE9A 3HPJA 4G5ZL 1KIUA 4JVPA 4K8RL 4WHTB 3CFEB 4NDMA 5CD3B 3MRGB 5JO5A 2IPUG 4IRZL 5EZIL 1VFAB 4PJBE 3TH3T 2JE8A 4MJID 2X2YA 3GHEL 2FB4L 1Y18B 1V7MH 1WJ3A 1M71A 4PIRF 1ZTXH 3TH2T 3TIDB 1EGJA 5IMLB 3QDAA 4KDTC 4NKQB 2WWKT 4WHDA 2NX5D 4RX4D 3VFUA 1F2XK 3KYMA 1XCQA 3K7UA 4GS7B 4KJQD 3DO7B 4X6FA 3BN3B 2AJUH 4DAGL 5IF0A 4PJXF 4ISVB 2FJFA 1P6AB 1AY1L 1QG3A 3N1PC 5FKAB 5I0DA 3WHXA 1CGSH 25C8H 4CVZB 2C7UB 4LGRB 5EC1B 2UZXB 1YEGH 2CO7B 2PXYB 3VH8G 4BH8B 5F70A 4OI8A 3JSSA 4NKDA 1PD6A 2H45A 4Z7WB 1DE4A 2IQAB 4U6HB 1XGTA 5IB5A 3F58L 3WFEH 1O7SA 3ROOA 1E4KA 2VN4A 3V5HA 5IM7B 1RJYA 4PJHB 1EZVX 4PJEA 5FO7A 4PGDA 3HZMB 1UADC 1YEGL 1RZJH 1UEYA 1NCUA 1RZIA 3O45A 3QIUA 1MFEH 5HVHC 1AY1H 3OF6A 4PRNA 1JNJA 4JFDB 3CMOH 5FOBA 3G04B 3K8LA 3GI9H 1MLCA 5C0AA 1GVIA 3O2DA 5C0CD 3VFMB 4LHJB 5FYLE 4K71B 1FVEA 4UQ2B 3DUSA 3U82B 5I18L 1ND0B 4K7FB 3DUUA 5I76B 4TVPL 3ZTJH 4EOWH 4H1LG 1RVFH 1IZJA 5KAQG 1PZ5B 2BVUA 3WD5L 1M05B 1DQLH 1RZKC 5HHOA 1VENA 1JPGB 5E7BA 1E4KC 4NHCH 4G6JH 5GGRA 3GSUA 5IFJB 2EDOA 1KSRA 4RISH 1HKLL 4I48A 4XVTH 5FDYA 3LKSB 5CINL 3PF2A 1T6WA 1JZ6A 2NY1D 4ERSL 4NNXA 5IUSA 4OLYL 2FJFB 2GJ6E 3L3KB 1Q9KA 2DQDL 4OZ4B 5DO2D 3HC3L 3ALPA 1A3RL 3LS5L 2KZWA 3MRCA 4GW5B 5ID0B 2HN7A 3MCLL 3GGWA 3RVUC 2OMNA 2P8LA 5DK0B 5I8KL 2VISA 1RQ5A 4RFEA 1T7WA 3VXSD 3NGBC 4Q9BA 4OLWH 3V8OA 3HAEH 3VA6A 3BIBX 4FXKA 3ESVF 2VXTH 3BWAA 3MLRL 1A1MB 5C0BD 3GKZA 3VFNB 1KPVB 3OJDA 3QFDB 4E42A 2VABB 1EZVY 1J05A 2QHRL 3DTXA 1BIIA 3EFDH 3RWHA 3VXQB 3EOYG 5EC2A 3GHBL 4FP8H 2FWOA 2R15A 5DJ8B 4MNQD 5CUSL 2HG5A 1YY8B 4N8CH 1CIDA 1WCBB 4FQ2L 1NMBL 3CFCL 1N5YH 3KJ4C 2HN7B 1F90L 4P5KB 4K94H 5I1JL 1OP9A 1BZ7B 5HHPB 3VI4E 1UA6L 3UTTA 4BKLA 3TESA 4JDZB 2FSEB 5ICXB 4A6YA 1YMMB 3D2UB 4GKZB 3MLZH 4ZFFA 5T3ZE 1MJJA 3WLWC 4MJIA 2ESVB 3KAAA 2IEPA 3QCUL 1MCSA 1JMZA 3OJ2C 2A73A 4P2RA 3I6LE 2ZCKH 3LV3B 1P4BH 4F15B 3WKML 5DEZA 2R4SH 3MXWH 2WANA 4YXLH 2E9WA 5DJYA 4PUBH 1KT2A 5D2LA 1I4FA 1TPXC 3VFGH 4GKOA 1ZGLM 1B4RA 3QHZL 2W0KA 4Y1AB 2HT4D 3EW3B 3QFDA 3ZE1E 3IXAB 5D71L 4G3YL 3QCUH 1XF4A 2J88H 1KV3A 2VDMH 1I3GH 4IMLB 4RQQA 3VW3H 1G0XA 3EYVB 3E8UL 1ZT1A 4ZS7L 4GRMA 3O2DL 1J0HA 1J1PH 4M61B 4MCZA 3ECBB 1QPPA 2W9DL 2OZ4A 1ORQB 1QBLH 4PJCF 2J12B 3RWGB 1X5GA 3QNZA 4MJIB 4KVNL 1NMBH 3CFCH 3MZGB 4ZUSA 4M43H 4F9LA 3V95A 3SDAA 3V6FA 4JFOB 4JDZA 2B1AH 4LAQL 1T1ZA 1IAKB 3FMGL 2OMBA 3O9WD 4D9RD 2XN9D 5D93C 2DQUH 5AD0B 4R9HA 4XCEB 1IC5L 1FNFA 1RIUH 4MAYB 4WI7A 1PX4A 3DVFA 2F54B 4D9LH 4HS3A 2A83A 5LBSH 1CGWA 3MV7D 1UH3A 5B8CB 3SHSA 4HKJB 5ICYA 5EORH 4JFHE 1R3LB 3LRSB 4TUOB 5TE4H 4HIXL 1A1MA 4D9QE 2CDGA 3BMWA 4Y5YA 2WLZA 3DUUB 3K2UH 1A47A 4S11A 4UTAL 5E0QA 2D7TL 3WJLC 3MV7E 4E0RA 3LKQB 2Q3AA 1AI1H 3MV8D 1MRFH 4BFIA 3VRLF 5JW4N 5D72H 3UTQB 4X7CC 4CKVX 4PJ9C 1MAML 2ARJQ 1U3HC 1IQDB 3K2UL 1BZQK 1FL5A 1SJEB 1CGTA 3MLUL 5I2IA 2V5TA 3CPLA 3PIQB 3QCTL 2AJYH 2J6EL 1K6QL 1G7LA 5DHVA 1AC0A 4ELMF 2WM0A 1J1OH 3GSQB 1TIUA 4RA0C 2V5MA 1AHWA 2HVKA 1L0QA 5HI5C 3L3OB 3PWNB 2IJ0C 3BPOC 3O8XA 1C12B 1RZFL 5FO9B 1OTSD 3QHFL 4G8FB 3X14A 4XPFH 1MIML 3KPRA 4P59L 4PLJC 1FYHB 4ZFOL 4FQQB 5D1QB 4GJTB 4TUKL 1JWSB 3REWB 5GRVK 4ZDHB 5E24E 4GRLB 3NACL 1QTYT 4CVXA 1S7RA 3L7FB 5TQ2L 5DF0A 1GPOH 2VLLB 2ZSVA 3QUMA 5EN2A 4S0TD 3QQNA 3G9VA 3O3DB 3B2UD 4OKVA 5TGBA 3GSWA 4PG9B 4XMPL 5DLML 2W9DH 1XGYL 4B5EA 3WO4B 3TZVD 3M17B 1NPUA 1DUZB 1FIGL 3H9SE 3WFDL 3CGTA 4RIRA 3U0TB 3O4OB 4MD0B 4DGIL 3MRGA 4S0SD 5GGUB 3TVMB 5H35B 1ACZA 3DUHA 4KUCF 4R26L 3GBMH 2NYYC 4BSWA 3L3KA 2W65A 5HHNA 1WWCA 1DZBA 2H26B 4XC1H 4MAYD 3ULUD 5C0BB 2AJSL 2B4CC 3T65A 2BFVH 2X4OA 3QDMD 4WV1B 3HMWH 3ZE2F 2RCSH 3LOWA 3N06B 4PJ9B 4MYWB 3FN0H 3P0VL 5F9WC 5C3LD 2YRPA 4CMHB 2Y1VA 2EO1A 4AG4H 4FQIL 4N68A 1ETZA 2VNCA 2WUCL 3C87A 3QXVA 5DJ8A 3X12B 1HXMB 3ILQC 4KJYB 2BSSA 3FO2A 4Z0XA 4RWYH 5KANI 3GHEH 5I19H 4YHZL 1V3MA 3DSFH 2ZUSA 3EJJX 3GO1L 3RX5A 4ZPTA 4GW1B 3BN9C 1RZ7L 1HHKA 2Q1EA 4Z7QE 3RTQD 3GMQB 3KPOA 3KPLB 5MHSD 3WLWD 4JB9H 4DK3A 1TVDA 5C0NC 2ATPA 3MRLB 5KVGL 4PY7B 4GS7C 5DMKA 2JB6B 3RDTA 2H3NA 2BSRB 4R6UA 5FAAA 3ZDZE 4LLWB 2DL2A 5IK3A 4EUPB 4F37K 1HNGA 1ZLWH 1EAPB 1NLBL 4OTXH 4ZFOB 4JQXA 1MWAH 1TNNA 5I30L 3AAZA 1RHFA 3HR5B 3DX8A 2XZQH 4WO4D 1GGTA 2DIJA 3EHBC 4P2OA 4QXTB 1QUNA 1AP2A 1PYWB 1FGNL 4X5LA 1T20B 3C6SA 1WIOA 5EOTA 4J8RB 4X4XB 3SDDD 3VRIA 4Z9KB 3IDYB 4MNGA 3QZWA 4H0IA 1KEGL 4F7TA 1UKSA 3BIAX 4PJFB 2XACC 2C4FU 1WUNT 1FFRA 3LD8C 4U6XA 4Z76A 4CMHC 4X4ME 4G6ML 3T77A 1NAMH 5C0IA 2XWJA 4I0KA 3B4NA 2NTSP 2R29L 4PY7A 2W0PA 4M62L 1QBMH 1BGXH 1ZHNA 3ARQA 1LO5A 2YEZB 1WLHA 5I16A 3QUYD 4Z18A 1QP1A 4HIIA 4P4RB 2OL3B 5ERWB 4HIJB 3DURB 2BNRD 1RMFH 1KTRL 1PAMA 5HYFA 4K3HA 1LD9A 4PJIF 4YDIL 5DWUL 4MDIB 2NR6D 4JKMA 1OCWL 3RVWC 5CFHA 1NUNB 1FO0L 5TDPB 5ESAA 3ULSA 4M7ZB 1VGKA 2LU3A 5I1DA 5EC2B 1YNKL 1CQKA 2J8UF 3S34H 3S96B 1MEXH 2FX7H 3HE6C 3B3IA 1M7IA 3DVNB 2EYRB 2I9LB 5CJOH 5GIRB 3U30B 5E8NB 1I9IH 1K8IA 3VXUA 5ALCH 5GS2H 1T0MB 5D2LE 5C0RH 2VZ1A 4FQCH 1CGSL 25C8L 4NUJA 3W5NA 4N1EA 3MLZL 5I15H 2GUOA 2G5BA 4W68A 5I1IL 4BQ6A 1HHIA 3ZLQC 1NLDH 4I0PA 1NH6A 3EYUH 3TZVA 4CU6A 3TT3H 1IGIH 2GAZB 2EDKA 4G6MH 4HX1B 1WZ1L 3H9ZA 4GG8B 4G7YL 4RZCA 1T7YA 3UP1A 1IQWL 3SE4C 2NY2B 2NY3D 4QRPB 4N8CL 5TDNB 1L7IH 1GOFA 3UAJD 3VD3A 5H2BB 3QDJA 1A7BA 1F11A 3NFSL 3DNKA 4PJXE 1INEL 4DKDC 2NY7H 3BZDA 1OM3L 2HKHL 1K8IB 3CLFL 5I1DB 4HDIB 2B1HH 1FDLL 1P5VA 3G6JE 5DMIH 5K33A 1ETZB 4S1QL 4F7MB 3QEQB 2ICWI 1ZS8B 2NY0D 3LQMA 5JOFA 1DVFA 4JM2D 3VG9B 2YWZA 3SDDB 1ZT4B 5F9JB 2IAMA 4MZ2A 1FVDB 4H88H 3F8UB 5EIVA 5LGHH 4PJ7E 5D7IF 3DETC 4WWKC 1KULA 3RDTD 5KSVA 5LCVH 1B0RB 4JZOB 2A6JB 4UT7H 1I8LC 3O45B 5E8OB 5FUCC 2BERA 4M6NH 1CI5A 4LLYB 3BGFB 3MLXH 2O5ZL 3BE1L 5C0JA 3QIBD 2Q7NA 5GGVL 3MACH 4LHUG 2CDEB 5C0EB 5IW6B 3SGEH 2G5BB 1P4LB 1H15A 1IGMH 3LKOA 4LASH 2EXYD 1BAFL 4NRZA 3HI1B 4LU5L 4MQXD 5CBEB 4J3XA 1N8ZB 3BPNB 4LEXH 2WUCH 2BSTA 4FFWC 1T5WB 3ARUA 1I1FB 1D9KB 1MSPA 3HE7D 5JHDD 1S3KL 5AUMB 3VXRD 1PYWA 1EXUA 3I75A 3QRGL 4F57L 4XNXH 1ZLUH 4NN7C 4Y5VA 3MRMB 2YZ8A 2ATKA 5D1ZC 2WBJC 5CZVH 3I3EA 1KJ2B 4MVBC 1IM3B 3WE6A 4NNYA 3INUL 3GBML 3QXWA 2YRLA 1DP0A 2OP4L 1DN2A 3N1FC 3VXRE 1CR9L 4DUWA 2IADA 5DD1L 4F7PB 3SDAB 2IAMB 2ATPB 3RY6A 3V6FB 1DANU 2PO6A 4GG8A 3CSYA 4RZCB 3O4LB 3ZYZA 2G9HB 4M4PA 5BVPH 2HLAA 3KPOB 5IW1A 1BX2B 1U95B 2ZNWA 4BQ8A 3QEUA 5DLMH 4KMTH 1B0RA 2RJMA 4OD1L 1S7VB 1KJMB 2JLLA 4WI4A 2F53D 3FB8B 2AK4A 1A1NB 4QOKD 3D5OF 1PFCA 4PRHE 1C5CL 3PDGA 4JANB 4OLUL 4DEPC 4S2SB 5IEKA 3PJSB 3QQ4A 5D1ZA 4LGSB 2VLKE 1GIGH 3QEQA 2XI9A 5LAXA 3QHFH 1S7SB 4DOHB 4KZEL 3LN5B 4PV8A 5DUMH 3BJ91 2IADB 3C8HA 2MQ3A 1WFUA 4JO2L 4U1JA 2WP3O 3C09B 1MJUH 2CK0L 4JG1H 1BAFH 2CDFA 1FZJA 2FBJH 3DJ9A 4PGJA 3R06A 1NL0L 3KXFD 5DRXA 3D2UA 3MJ6A 4YK4C 5KTEL 5T5NF 5H94B 2OTUB 2H26A 3O3BB 2D9CA 4OQTL 4JRXE 4JFEA 1U58B 2IANA 3MMEB 4GRLC 4JLRB 4DKFH 5J1SC 3DX9B 3W9DA 5D8JL 1VGKB 2YC1B 4L4TB 1WAAE 3N85L 1A1OB 3V4VH 4H5SA 2XRAL 3F62A 4N1HB 4NFDA 4PJHF 4WUUA 3UROR 4O2FA 2O5YH 3HPLA 5TQ0L 5E1AB 4PJIA 3SDCC 3K4AA 5J0BA 3ET9F 1S7UA 4HCRH 2LFGA 5B21A 1I9JH 1MI5E 1U3JA 3UPCA 3TZVB 4AIZA 2VDPL 4HAFA 5DI8A 5J3HD 3IRZA 5GISH 4JPKH 2C3VA 5EU3B 5L9DL 2X42A 4U6VL 4YWGL 4Q74A 2XNAA 3VGDA 4MXWH 5DRWB 4I77H 1YC8A 5IGXH 5IK3B 4Q0XL 4JRXA 1T66C 5KTEH 1YEJH 2A6IA 4XRCA 1JPTL 3K8KA 4CVWA 2ADIB 1CT8A 5J12B 3HLAB 4LCWD 1IGIL 3FQNB 2IAMC 1J1PL 3X13A 4P2CG 3DVGA 5EU4A 3RU8L 3GM0A 4K23H 3KPQA 4ELKA 1PEWA 4XNQA 2N7AA 4TYUA 3RKDD 4OZIA 4ZUWA 1IC7L 4G9FE 4N0YH 1EK3A 5H2BA 4O2FB 4R4NC 1PKQA 2HJLA 1KTDA 1Z5LB 1I9IL 2J3SA 4JFDD 4YDLB 3MROB 5KVEL 2CXKA 4JFQB 3WIIH 1OY3B 1RZ8B 2ZCKL 2ICEA 4LVOC 2YBRB 4LPVA 2YD3A 1C5DB 2DLEA 1BQHB 1DLFH 2BOBB 3VXRB 4UNVA 4JO1H 5E5MA 1FL6A 4KMQA 4P9ML 4KKNA 5F1IB 3FTGB 2AV7B 2R0ZH 1V3LA 3MUHL 3VJ6A 3UPRB 3ZE0E 4XNUL 2X4QA 3INUH 1RV6X 2Z0BA 4X4XA 1MHEB 3NCEB 4P3CH 5DMKB 2HFFA 5D2NE 4XVJH 5DVNA 2R1YA 5EULV 3O6KL 1ORSB 2HWZL 4M5ZL 1H8SA 1UH4A 5D93B 4EXKA 5J11C 1SMAA 3U7AA 1YPZA 1HWHB 2WSKA 3QEGL 4ODHL 4KGLA 4JDVA 5F89B 4P5TB 1HOCB 3QG6A 4YHNB 4HUXB 4I8DA 1FG2A 4H26B 4WUUB 3WUWG 1T2QH 1UT9A 3KPNB 4WGVB 2IPKB 4PG9A 1QKZL 3VXSB 4O02H 3BEWB 3I02B 2FGZA 5FHBH 1MUJB 1RPQA 4V1DB 4OJFH 4MA8H 1N6QL 2P8MA 3UZVB 2BRQA 3EZ8A 1WITA 4HWBH 3K8MA 4S1DD 1NEZG 4ODXB 4GT7A 3VFWB 3HKFA 1S9YA 5HGBB 3CSYB 1MAMH 3CH1B 2IG2H 3IXTB 2FX9H 3C8KB 3L3DB 3MUJA 4ENEC 1ZEAL 2PNDA 1J7VR 3LQAL 3U1SH 3CDGB 5KSBB 4HWBA 4YZFE 1TLKA 1WT5A 2LTQC 5AAMA 3TNNB 2NNAB 2D7TH 5I1EH 4Q9QL 5GZND 4Y4FA 5F7DB 2IQ9H 3CDCA 2M1KA 2MCPH 5TE4L 2OBGA 3NIDF 2OS7A 1LEGB 4WDIB 1WIUA 3MRHB 2R23A 3CVHA 2IH1A 2OR9L 3QEHB 3QDJE 4GW4B 4X80H 1FFPB 1WC7A 3ZMRA 5BOPA 1FDLH 2YRZA 2SEBB 5KSAD 3ETBF 1AKJD 4UI2A 4R8WH 1NEZA 5C70A 4J12A 4JO4H 5HD8C 5DEFB 3VFRB 2EDYA 1EUUA 2W65B 4ODTL 1INEH 2A0LD 2D31B 4YDKL 2EEDA 3EYOB 2QLVB 2BHUA 2VZ3A 4XVJL 4XVUC 4XZUB 2GIYA 4FZEL 3GB7B 5DA4A 5EO9A 3PXJA 5GZNC 2UZYB 2B2XL 1ADQH 3D3VA 1UZ6F 1X9QA 4OF5A 2E27H 3R06B 5DRXB 2PR4H 1CXEA 4Z76B 1TMCB 3UBXB 4Q6IC 6FABH 3F58H 4U1SB 4X4YB 2NY3B 2J88L 3W2DH 1KN4H 4UT9L 1LDSA 5C7XH 3MGTB 1F4XH 4UIKH 1JTTA 2H8PB 1FN4B 3FOLA 4MJ5A 3VWJB 4M8QA 1FH5H 4CUCA 2I25N 5CP3H 2J4WL 1VPOL 4PBVC 3RWCB 1EEZB 3IB4A 2BNRE 4WENB 3RQ3A 1UWXK 2HT4C 4YAQA 4YHLL 3VWKB 1FFOA 1NAMA 5TDOA 3PQYB 3P77B 3VDBA 2CGRH 4LLWA 5CP3A 4EI5A 4YGVB 1F6AB 1LQSR 2PYFB 2HH0L 3BGFC 4OLVH 3RHWF 1W0WA 3OGCA 5IMMA 5GRXG 3IDJA 4O9HL 2IBZY 3TLRA 1SYSA 2F74A 4HJGA 2HFGH 1RZFH 1V7NH 4MXWL 4FP8L 4PJ8B 1VFBA 5E2TH 1X4ZA 3VFPA 1FZKA 3BO8A 2J8OA 1JNHB 1J1OL 3JWOC 1QYGH 4PRAB 3QIBB 1AXTH 1JL8A 4NWTL 4F7TB 4Y5VB 4HUKB 1YQVH 2WK2A 2G75B 1IM9A 1I8IA 4PJDA 3PQYA 3Q6FA 3L3JB 4U0RB 2GT9B 3I3BA 3WHXB 3S96A 3TCXA 1QFOA 5GS0C 5IB2A 3RAJH 1C12A 3GMRB 3MV9E 4IRJB 1PG7L 3MJGX 43CAB 1SJXA 4WIQA 2VWEC 2Z93B 5HGGS 1E4WH 3AGVA 3U9UA 4BSWB 4L8BB 2FO4A 1FO0A 4YXHL 2GKIA 3OKNA 1UWXH 3BP7A 2E6PA 5BJTB 2K7QA 3DO7A 3CDYA 3O3EB 3RY6C 3IJSB 2ORBH 4FXGB 5ANMA 4ZFZA 4W70A 2J8UA 1IAIH 3N9GH 2JJVA 4D9LL 3BPCB 4RISL 4ODSH 5L88H 4LHUA 4OIIH 1OAUH 4NHCL 1ROWA 1KTKE 5L6YL 3KS0J 4NRYB 4OFYA 2OZ4L 1MHCA 3SKOB 1BREA 4OZIE 3VDCA 2B5IB 1AGEA 3U6RB 5DMGD 1NDMA 1F3JB 4BZ2H 2IPKA 1GGIH 2BNQB 1KCRH 3RWJB 5CZXD 3HMXA 2BRRH 2YUWA 4G80B 3T0EC 4WHYG 5E8DH 1A6AB 2Q76B 2XXMB 4YBQC 3VFSB 1EHLH 4JY6B 5DJ2B 4QXTA 5IFJA 1JYNA 3EO1B 5DJZB 4P5MB 4D3CL 4TUJB 3CZFB 4LSPH 1MFEL 4HV8B 2EXWD 3FOMB 3GMOA 3GSXA 5J1AA 3WS3B 2P47B 4M7KH 1CFQA 3H9SB 4ZFZB 1NC4D 5HHVH 1IEAA 2P43B 2WIIB 2PCPB 4KY1L 4EN3D 2H2SC 4Y16D 2XNAB 1O7VA 3H7LA 5B39B 3JWNC 1QSED 4JPIB 3BGAA 4BSJA 3NFNA 5IQ7L 1FNSH 2XIDA 4NQTA 1PKOA 4F7EB 1WEJL 2HLFD 2BXYA 4UDTB 5EZOH 3SEPA 1IC7H 3NCJH 4TSCL 1Q94A 1GAFL 3F5WA 1MCOH 1N0LA 3ZYOA 3RU8H 1UA6H 1ZHKB 2ZSWA 2X5PA 5KN5A 4DAGH 4MNGB 2CLZB 1TNMA 4Y5XB 4FQLH 4PRDA 4XMPH 5B22A 1A14L 3OKKB 4QY8B 3VD7A 2FR4B 2ARJB 3BHBB 1K8DB 2AK1L 3TV3L 3HI6L 4HUVA 3SBWA 3TBSB 5IB2B 4HQQH 5C0EA 1IAIM 2EO9A 4YDKH 2FJHA 1VFUA 3DX6B 5DK0A 3MQIA 4XP9L 4XCYB 1ZLVH 3AAZB 4YDVB 1IGML 4HK0B 4LLYA 1VHPA 3CC5B 4LLAA 5CILH 4EQ3A 3DLQR 1AIFB 3UYPA 1Q8MA 3MGOB 3ARDC 1LO5B 4HF5H 3GSNL 2QKIB 4HGWB 5ICZA 5DK3A 4H8WL 4HV8A 4LSSL 2X6MA 4JFPA 1SYSB 5I8KH 1QBAA 5HYJD 4MA1B 2XQBH 2Z31A 3C5ZD 1QFPA 3ARGC 4L8SB 4QF1B 5CWSA 3TN0B 2XZAH 3LEXB 4V2BA 1OAKL 5DQJB 1JWMA 5D72L 5HGAA 4MNQA 5DD0H 2HFEB 1QRND 2DQDH 3DYPA 4P2QE 1OGAE 1NGYB 4WTZG 1PZUB 5KVDL 1VACA 5CEZE 1WFOA 4IM8A 2ADGB 5F88A 3L5XL 4X98B 1NCAH 1GZQA 5T5NG 1WBYB 2XA3A 5ICYB 3PP4L 2DN7A 3F5WB 3IDNA 4X8JA 2DM2A 2EYSB 1JUFB 4M93C 3QZWG 2NY7L 4OJFL 3NABH 1HI6B 3SGEI 4ZFOA 3Q1SH 4HMCA 5HVFB 3SE9L 1U41A 4HX1A 1ZMYA 5D9SB 5L0QB 1O5DT 5FO7B 4OT1H 5KG9B 2UV3A 3CFKA 5GGSY 3TYFA 1P84J 2ZUVA 2AKRA 2VDLH 3S35L 1YY9D 3O41B 4BH7A 4TNVK 2OLDA 2CR6A 2BNUB 4HS8H 3EJZC 2EEBA 5IWLC 4ODVH 3WFBH 4M48H 2VLJD 1N26A 4LEOB 1LE5A 4WFFE 4MNQE 2DI7A 1GZQB 4DGVH 3JV5A 5DYOB 4RAUB 3BW9B 5DRNA 4X5WB 3KYKH 3QIBA 5E1AA 1MEXL 4PRPB 1AXSA 3NPSC 2OJEB 4UT6H 2G60H 1QFHA 2GQHA 4YNYA 1WZLA 4G3YH 1BWWA 1YEIL 5KSBF 5JW5B 3FB6B 2Z35A 2Z8VC 3QHZH 3GSRA 3ARED 2J8UB 2ED8A 3P4MA 4U4BA 5CZXC 5JMRA 3QUMH 4QRPD 4P4KA 2VL5B 4N1CA 1LEIB 1KB5H 5DTFB 2Y5TB 3QDMB 2JK5B 4XMLL 4Z7NF 1VADB 3TWCL 4IOIA 2HJFA 4Z7VA 3OXRA 1U42A 1KIPB 1EDQA 2GFBB 4TVPD 2D7MA 1S5HA 1AGCA 1GGIL 2P44B 3S4SG 4MDJB 2R8SH 2XICA 1T04A 3LN9A 4QRPE 3U0WH 3QUXA 4UNUA 4LQFL 5I1JH 5GIRA 4WW2C 2JB5L 1GGUA 4NZTH 5IFHL 5HYJE 4KRPD 3NIGE 2XWTB 4KTDL 2C3HA 1XR8B 5A16B 1T5WA 5T3XD 3EO1A 5DJZA 4JFZL 2D03H 2P5WE 3MACL 4ELME 4ETQB 4ZUTB 4PLJD 3DTXB 5LJYH 2PYED 1MHEA 1OT2A 2AEQH 3GK8H 3UC0L 3MRFB 2BNQA 2YKLH 4Z95L 3P73B 3RWJA 5JNYA 4YE4H 1KIQB 2HKFL 4WI3A 5IEKB 5TF1L 2AVGA 5B8CC 2XZCH 3HAEG 3LZFH 3MRPB 3REVA 2DQIL 4FA8A 3IDGA 4YHOL 5B3NA 4JRXD 4A2LA 2M26A 3B9VA 3OGCB 3F7VA 1T0NB 1IE5A 5LG1A 1A0QL 5CJ5A 4QRUA 4H88L 4IDJL 2NY3C 3HG1D 1CLYL 5ESQA 2W9LA 3HC4L 4GKZA 4ZFFB 2GK0B 3LIZL 3L5WA 1LO0H 4JGMA 3C5SB 5MEPB 3Q3GB 3MREB 1BQUA 2EDEA 5IOPA 3I2CL 3WNMA 4QXGH 4N8VG 3HC3H 1U3HB 4QHNA 3VMNA 2ZKHL 3FFCB 3VWKA 2Y9RT 4OSUL 2PTTB 1C7SA 4MZ3A 4GSDH 1A7PH 4FTVB 4I9WD 3VCLA 1RK0A 4MJ6B 1MI5D 2X1OA 2PN5A 4LBEB 1KCLA 4ZPVA 3PWUB 1U3ZA 1VEOA 3ULVE 1MWAA 5KS9E 4U1IA 1LMKA 5DZNA 2GY5A 4YHPA 1FRGL 3U36B 1ZXQA 4N8VB 4LQFH 3GM8A 5D7LB 1MY7A 2VAAB 3EYUL 2H32A 3DI3B 2AV7A 4PV9B 5I8CB 3U7WH 5I1IH 4U1KB 3IT8D 4AG4L 5K9OB 1URLA 5BS0A 1R5IB 3FB5B 4ZO9A 3VFPB 2P42B 3CXDH 4LSRH 3ARXA 4JY4B 4RMRA 4ZXBA 5BO1H 4RAVA 3EZJB 1E0OB 4WJ5B 3FONA 3GJEB 4AIZB 4JFXA 1WZMA 4JLRA 4K94C 5FYJL 1U8KB 4U1HB 4LDLB 3BVNB 5FYKD 2R9HC 3MGOA 2FO1A 4XT1C 3OTTA 2YS4A 4LVOB 2R1WA 1XFPA 4HIHB 5DC4B 2CJUH 2AJVH 4QLRA 2E6JA 4PJGA 4NZJA 5CGMA 1MFDH 1PQZA 3SJVE 3EOBA 4ZUUB 1A6VL 1A2YB 4DUXA 2IH1B 2ZP0T 4LSPL 2XA8L 2AEIT 3EOTL 4RFNB 3NCYS 4Y5YC 2DDQL 5EPMA 1EO5A 3ULUF 2L7UA 1UM6L 3E3QC 5FM5M 5B3JF 1MREL 5D1QC 1M6OB 2VLME 2XYCA 2QBWA 5CZVL 5GJTH 4NOBA 5FA4B 5F7DA 4ODUB 1V3KA 3QIWA 3RTQB 4J3SA 1H3XA 4KPHH 5GS3A 4PJXA 1CGVA 3T8XB 2CPCA 4R2GB 3QDME 5L2JA 3BDXA 1RJLA 1K4DB 3U4BH 1D5IH 4QRUB 4X80L 4GUPA 3V2AR 4Z77B 2PO6C 5D6CB 2G2RA 4FFYH 4P3DB 3D69B 5BJTA 3G5YA 4E41B 1DQQA 3TPUB 5GS1A 5J89A 3CLEL 3O2WL 4L9LB 4JJ5A 2FHCA 5D70H 3MNZA 1E4WL 5F97E 1FYTE 2OTWB 4UV4L 4FS0A 3VA2C 1Z0NA 5C09A 4LDOB 3T3PF 2H9GA 4LCCA 4XI5C 3SE3C 3HZYA 5FA4A 2FX8H 4P2QB 2BDNL 3TIEB 4NKOB 3DGCR 4MJ6A 4CW1A 4C83A 1EXUB 4M4RA 4CVZA 4DN3L 1F8TL 4FG6C 1LE5B 1JN6A 4OI7A 3KPPA 4Y4HC 3U2SA 1W0VB 4KRLB 1A6PA 3LQAC 3C08H 2Y23A 3G6AB 4LPYA 4ONGL 4WCYL 5ITFA 1RURL 2CIIA 1SVZA 2AJ3A 4H8WH 3I6KB 4X5XB 5FYJD 3TEUA 5LGJA 1LO2L 3UBXA 4JAMA 3OXRB 4KK9D 3GSNH 3MR9B 4P2YA 4XB7A 2VXQH 4EIGB 2X1QA 4OQ1A 1RZ7H 1QFWH 2B1HL 5H35A 3D85B 4HPOL 2DKSA 1G1YA 1T0NA 5D6CA 3IXTA 4ZTOH 3P30L 4Q9RH 1NAKL 5ESQB 4E9LA 4P46D 2LU4A 1NKOA 1S8DB 1MQ8A 3GUTA 3JWDC 4NKOA 4CW1B 4PD4J 5J6HA 3HI6H 2GJJA 4Y4HD 1BF8A 4BZYA 3SJVD 2A9NH 1NGYA 1D5XB 2ITCA 2MJWA 1U91B 3VD9A 1Y6NR 3BEVB 4P2OD 3QXDA 5K9JL 3ARVA 2EIEA 3U0PB 5MENB 3LKPA 3G5YB 4G6KL 3JBG7 1F4HA 4HHAB 3FT2B 3LMJH 1AFVL 3PWVB 4UDUA 4X6EB 3DWTA 4XMKH 1KN2L 1SHMA 1KJ3L 2A6IB 2MKWA 2R2EB 4U2YA 3O3BA 5B38G 3D85A 1EEYA 3UTTD 1J1XL 3CVIH 3IJHB 5IBLD 1H3GA 2X1WL 1JYVA 4QHMA 4LPWA 3LH2L 1TZGH 4GXUM 4LLVB 2Z8WC 5FGRA 1FIGH 3S34L 5IOPB 1P4BL 5ISZE 2B2XH 3QWRA 4M1GH 4NZUH 2HAZA 1UVQB 1YUHB 3VXMA 1FL5B 2E6QA 3C60C 5EO9B 2H3NB 3FO1B 4IOFD 3ZE1F 4ZAKB 3SPVA 1CDJA 5I71C 5EDXA 4AIOA 3E2HC 3ARDD 4PJIB 2I07A 3M17A 4HUWB 4OCMC 5BQ7A 2CRIA 5GSRB 4RGOL 3DRTB 4Q6IA 3RI5F 2XN9A 1D5MB 4Z6AT 4M62H 2VQ1B 2V7HA 1YC7A 4R97B 3TP4A 1MFNA 1P9MC 1XGPA 3V4UL 5HHOE 3IU3B 1AXSB 5LWYL 4NNPL 1JWSA 1S8DA 4M8QB 5CP7A 3VGBA 1Q94B 4R0LB 4NRYA 4RGOH 5ETUB 3CX2A 4KC3B 2EZ0D 3T0XA 4HC1H 2HFFB 4HUNB 1KGCD 1CT8B 3LSOB 1P53A 4Z7UB 4Y0GA 2NY1B 4IRSB 4EKXA 1N64L 1N5AA 5MHSE 2DQEH 4U0QB 1FJ1A 5DQ9B 2FSEA 4PTTB 2R1WB 4S1RH 3N1MC 1H8OA 1MQKL 3L7EA 2XZZA 4PGBB 4XP6H 2APWA 3QISA 1SEBA 4QT5A 1TZGL 2XKUA 3OB0H 4OCRH 4R2GD 2N4IA 4I0PD 5D2NC 4P5MA 2O5XL 5DC0A 5IVXE 4S1SH 2EDXA 4N0FA 4LDEB 3QQ9C 4GO6B 3UX9B 1BLNB 4IIQB 5I17B 4JANA 3CFBA 3DROB 1A7QL 1P1ZB 3UEZA 1NFIB 1AXTL 2PW2B 4DVBA 1C08A 2VH5H 1NL0H 1IEBA 3MRNB 3WIFB 5KS9B 4WFGD 1NJ9B 4OFPA 4JG1L 3DMMA 4Z0XB 5BQ7B 2MNUA 2P45B 1RVFL 2FECL 3X3FL 2D4FA 5GS1C 4KROD 3EOAB 4ZUUA 3UTTE 3F7VB 1A6ZA 3BD3A 3WLBB 1A6TA 3HR5A 5F9OH 3ARRA 4OFVA 2OX5A 2NY2D 3PG2A 5I1GH 4P3WA 4HXBL 4N0CC 4OF0A 4XCCH 5LGJB 1IAKA 2IWGA 4I0PC 4Z78B 3GIVA 3BP7B 5J13C 4ZS7H 1GZPB 4EXPX 2MHAA 4QRTA 5DQDL 5J11B 3M1BB 4TPRL 3FN0L 4YDVA 1QACA 5DI8B 1TJHL 1KUMA 4C57C 5C9JB 4N9OB 2DMKA 5DA0B 1JK8A 5E00A 3VCLB 4QHLB 4XCYA 3O4OC 3LY6A 3N0PB 2Z9TA 3FJTA 2NY1C 3HB3D 1WTGT 3JUYA 2OTPA 3MNZB 5SWQA 4N90D 1D3CA 3H2WA 1OTSC 1Q9OA 1U8HA 1QBBA 2ADGA 4YHPB 2IAMD 4GXUN 3GBNL 2DTMH 2ZJSL 4HS8L 2V9RA 3TO4D 3RZCD 3GMLA 5E03A 3JXAA 1U8LA 1ADQL 3GJFK 1U8NA 1NC2B 1Q72H 1F90H 3WDHA 1S3KH 3ARGA 1L4IA 4L8SA 5CWSB 2DLTA 5GGTL 5I74B 5DSCA 3IDIA 4LKXB 5TQ2H 5JW4M 5ID0A 1P7HL 5DRWA 4NBZB 1JGLH 3QHTC 5FKPA 5HHXL 5IIEA 4K2UL 1G7PB 3B43A 4OZGF 3KNBB 5C0DB 1L9NA 2I26N 2VIRB 5F7EH 4HBCL 1BJMA 3SDCD 5D9SA 5GGVH 4Q58C 3QAZB 3SQBA 3UYRH 4UAOC 4NKIL 4LPUA 4PP1D 3AU1B 5JORB 3CZFA 2G5RA 1R0AH 2JCCF 4BH7B 2OJEA 3RVWD 3IDYC 3QEQE 3O3DA 3WNOA 3SE4A 4ONOA 3DXAE 1TCRB 4NJAL 1RIHL 2EE2A 2NY4B 1IJ9A 5GGQH 4Y4KC 3A6CL 5IB1A 1U8OB 3IRPX 5I73B 4PREA 3MLVL 1ZEAH 2FHBA 4XBPA 4ZAKA 1BQLH 2PO6B 3TBYB 4K9EC 3H9YA 1AGBA 3FFDB 3QULB 2XV6B 4JRYB 5T5FL 5DRZB 3QUZA 4LF3B 1HKLH 4XVTL 5D70L 2LV4A 2EIDA 1CDYA 3O2WH 3CLEH 4X9FA 5CILL 1ULVA 4LLVA 2V9TA 1UCBH 3ES6B 5FOJA 5IROC 4FNLL 2WWMC 3IJHA 4YAQB 2V7NB 1H3TA 3SGKA 1A7NL 1HEZB 4YPGA 1P5UA 5D5MA 4KQ3L 1OWWA 5L7XH 3GSRB 5I74C 5T1KB 3MRIB 3P11H 1QVOB 3GSOA 1QLRB 5CJBA 4JM2F 3PE9A 5AWNH 1E28B 1KB5L 2ZG3A 1V8HA 5J12C 3UTSA 5D1XB 4R2GC 3FB7B 3IVKB 1EFXA 2DWDB 2DF3A 4UB0L 1T03L 3BDYL 1LK3H 4JREB 2ILLA 3LRSA 4TUOA 5GS1B 3O2DH 2IGFL 5HVWA 1E4JA 3ZT5A 1A6VH 4HJGB 1QFWM 32C2A 3QULA 1EX0A 1HI6A 2Z92B 3TPKA 1MFDL 1VFBB 4ODWA 4Y88A 3HZVA 1CR9H 1KLUA 2HT2D 4KY1H 5J13B 5C0ND 2Q8AL 1CD9B 3QA3A 3W0WB 3U79A 4MB4A 3GMMA 3C2AH 4GRWF 5FYLH 2YXMA 2NY4C 1FV1A 5JHLL 1ZKAA 4K7PX 3BYYA 3BN9D 3RL1A 2CLRA 3MNVB 4YIQB 1R3LA 1HH6B 4ZPVB 3O6FD 3U0PA 3I6GA 1AP2B 1OSZB 1JGEA 3MOAH 2VB5A 2OJZL 4JG0H 3MOQA 3AMKA 2YMXL 4PRHD 3NZHH 1X5YA 4K9EH 2VLJA 1V7ML 2FB4H 4HKZB 4K94L 1PQZB 3NABL 5IMOA 1J05B 3ZDYF 1OAYL 5C08E 1RY7B 3U0WL 4TVPE 4R4FL 1UC6A 4PP2B 3P4MB 2VDNL 4GH7B 4JFFB 1AGBB 3FFDA 3ZKNC 4JRYD 1XGRB 5HGDB 2XFXB 1CN4A 4P23B 4XMLH 1JHTA 1AR1D 4H25A 3HPJB 4HKXA 3MR9A 3FAXA 3TBSA 1UGNA 4FABL 2AXGA 4RMUA 3V6ZB 1FORL 3RPIB 4KJWC 5D96C 4KUCD 5KW9H 2HT2C 2DI8A 3ULUL 3S37H 4WHYH 1XF3A 1KTDB 1Z5LA 3HA0A 3BT2H 5K9QI 2Z4QA 4R0LC 1SYVB 2AK4E 5E00B 2ADJA 1RU9H 1E28A 1RHHA 5AG8A 3OR6A 4WV1A 2YD9A 2A74A 2XKSA 3T09A 3BESR 3BDYH 4KKLD 2IANB 3MMEA 4XP9H 2Q3ZA 2OK0H 3VH8B 2G75A 1YEDA 4PJBB 3GMPA 5IB3B 3BGMB 3C60B 5DK2A 1T21A 3OKLB 5EH1A 3FTGA 5K9KB 3MJ9A 1KIPA 3RKPA 5HYSA 4PTTA 4LLDB 2EDDA 4HMDA 2VDLL 4F2MA 4F58L 1A14H 3VXRA 4OLVL 1I8KB 4NRXA 4MSWA 3WD5H 3IDXL 2YMXH 2C5DC 3P9WB 5E6IC 2D0GA 5EG6C 3UTSE 5DRZA 1EH9A 1GAFH 4CDGC 3RBGA 5KZCD 4FQCL 4JKLA 3FZUD 1GIGL 4POZC 2CLZA 4Y5XA 1OGTB 3MA7A 5A43C 4WV1C 3QQ4B 5D1ZB 5J9PA 3RJQB 2VXSH 4NNXB 3RPKA 4XXCC 4RMQA 3QDGA 4HK3J 3FHQA 2MTPA 2GY7B 3SCMA 1YPZB 2AW2A 2ED7A 2YPLD 3U7YL 1WFTA 1DE4B 4Z7QF 4NN5B 2EE3A 2G60L 3QO0B 2IF7A 5DJDA 2F74B 4LVNB 3WDJA 2HA1A 1JNNL 3AB0B 3FQTB 2ADIA 3HMXH 5IV2A 1SEBB 4QT5B 2CO6B 3WFDH 1WZKA 5HGHB 3SQOL 1RMFL 3MXVH 4V2CB 4XAKD 3NH7H 2NY6D 5MEPA 4LPXA 4YK4B 3ES6A 3WFBL 2NNAA 3D48R 4KRPC 3QFJD 1ZA3B 2WINA 1TJGH 4QRQA 1TZHB 1R3IL 3GSXB 1KCRL 1HQRB 3WS3A 3DGGB 3LRGA 4WJ5A 4PGCA 4Z0BH 4BFIB 1TITA 1UXSA 5ISZA 5EZLA 4Y2DA 1D5BB 1LVEA 2R69H 4HH9B 5DS8B 2Z35B 3QXUA 1QLEH 3NTCH 4MX7A 2C1PA 4NT6B 5JPNA 3CX5J 2F58H 2Y72A 2R0KH 1YJDH 5L2KD 5SWQB 4QRSB 1JNLH 1EFXB 2DWDA 1JYXA 3ZT7A 5DEFA 1IBGL 4JFED 1WISA 2AGJH 1KJVA 4YH6A 1HILB 1HK6A 1XGUA 4ONHA 3REWA 1F58H 3WKNA 3MFFB 4M00A 1F4WL 2DLIA 1QVOA 3GSOB 3P9MA 2ZJSH 2PF6A 4CADB 1N4XH 2IAND 3FN3A 4DKEH 4CAGA 2P7TB 4P4KC 3MRCB 5EZOL 2VLRA 3IDUA 3X11A 5M95B 2BX5A 2OI9B 3K81A 2CR3A 4OCYL 4YO0B 3BVNA 4FQ1L 2HRPH 3P4LA 1L6ZA 4ZMAT 2BVEA 4BQBA 2XT1B 4U6HA 2RHEA 2X89D 4RA3A 5A3IC 2Y7QA 3I9GL 3LQZB 4C59B 5LGHL 5E5MB 2BY1A 4F7CB 4DTGH 2JKXA 3OJVC 4WW2A 1R5IA 4YFDB 2W0FB 1HH6A 3B6SA 4I0CC 3ECBA 4KQ4H 4M7LL 3MO1A 2VABA 2CKBA 3WMSA 2FH6A 3FO9A 4JPWH 4R90L 2APFA 4OAWB 4Z8FH 2YXFA 3PQYD 5CCKH 1FFOB 1NAMB 4X6DA 1JZ7A 3LB6C 4LCCC 5DJ0A 1MCNA 3SKJL 1W72A 4H8WC 3CDGA 5KSBA 3B9EA 1FYTA 1WBZA 3GDBA 4HUWA 4JDVB 1G9MH 4NN5C 4MXQC 3HS0A 3PGFH 3ZKQD 2VN7A 2DD8L 5C0AE 1UACL 4M6OH 1B6DA 3QUXB 5CSBA 4V1DE 3DV4A 5ELIA 2Y7QB 2ICWA 5FM8A 1CFTB 4XAKE 2GFBA 2AV1A 4EZMA 3N9GL 2GSIB 1VDGA 4PTUB 3ILPA 3HCVB 2ORBL 4DZ8A 1MNUL 4UBDD 1J1XH 3CVIL 4QTHB 2VLRD 5FHAH 1NBZB 5D7JB 3W2DL 1DSFL 1E27B 1Q1JL 5FCUL 5BMFH 5SWSD 1KCKA 1KEML 1UYWH 5F9WB 4HFUH 1FC1A 2HTLC 3PWPD 1KG0B 2DIBA 5MP6H 4LOUD 4L4VA 1CXLA 1U8OA 3TJHD 2QQKH 1MF2L 3D0VA 5EOQH 2HMID 1U8QB 2X10A 2FLBT 2QADD 3MA9H 4B7IA 3SCMD 3IFNL 4HJ0D 1CLOH 1C08B 3MRNA 2AEPH 3P4NA 2FL5A 4M6MH 4WI5A 4ZYKA 4JJ5B 1IGCH 5MERB 1RUML 5D6DA 4KVCH 4N90E 4JM4H 5IGXL 2JIXB 2X4PA 2YD1A 2FYYA 5KVFH 2R29H 4KROC 4F33B 4JJHA 1UG9A 2N56A 4PJBA 4PJ9D 3F12B 2DWEB 1NDGA 2HLFC 1YEKH 1Z6JT 4CRPA 5JZ7C 2IQ9L 4G43A 5JDSB 4PJFA 4WWID 2DLFL 3LEYL 4JRYA 4GLRI 3U36A 3WV0A 1LP9B 1IM3A 4HGMA 4J3TA 4YHLH 3ULVC 4WRLA 3PWUA 4ELKB 4U31A 5TF0A 4AMKL 3LHPH 3FQNA 3R8BB 3NCFB 3DOSA 1MCKA 1A02N 3PDOA 3THML 4M7JL 4PJ8A 1JTPA 1P9MA 1FBIL 2XQYG 3FQXA 3H8NA 3TPUA 4XBEH 1XIWC 3M45A 1KN2H 4NQSA 1ACYH 3F12A 3V5DB 5HHME 1BQHA 2BOBA 4PJEE 3T4AA 4NN7B 3VFVA 4DVRL 4FQXB 3WNLA 3IAQA 3DV6B 3EO9H 3MLYL 3RJDA 4FFZH 1UACH 1ZT7A 1SJVA 2JJTA 4OD2B 5DUML 5DHYB 5GJTL 1Q9OB 2VZSA 4ZUSB 2F8OA 1A4KB 3C9NB 4KVCL 3TT1H 3H7BA 1DLHB 3VG0H 3P30H 3TA3C 3P40A 1FCGA 1A4JB 1CXHA 1EEZA 4NUGH 5EU7C 5D7IA 5JOPD 4L8SC 1VEMA 4IS6B 3RNQA 3CXHK 4WO4B 4ZTPH 3CFBB 3GFUA 3MNWA 2A6DA 2I5YL 3A67H 3L5JA 4M9PA 1SEQL 1BFVH 4M03A 3QRFM 4Q6IB 2AXGB 1CICD 4ETYA 1INQB 2M2DA 1AHWC 1AO7E 4XBPB 4YPJA 3MLSL 4OZGA 5IBUB 4TRPL 1VKXA 1S9VA 1HCVA 2CQVA 4X7FC 3BKCL 3L5HA 3D69A 3QG7L 1A6WH 4RGNC 3VXUE 3ZKMD 5DURB 1JJUA 4P57B 1AXIB 1A9BB 5KS9F 3GIVB 5K9JH 1UM5L 3Q6GL 3S4SA 2AJUL 3S97C 2A9NL 4PJ5E 4IIQA 3PV6B 1E4XL 1CFQB 3H9SA 4QHKI 1TPXB 4K3EH 4LLUA 3RTQC 1HSBB 1IAMA 2R23B 1CXKA 2P24A 2GJ6A 2FWOB 3W11C 2R0KL 3WIHL 5DUPL 1HH9A 4AENA 1JF5A 4X6CE 1DBKL 2B8OT 1CGXA 5EZIH 1WAAA 3VD4A 1BVLA 4LK4A 1LEGA 2KZ1B 5CZKA 4HD9A 4K8RH 3H9HA 4Q2ZB 3KPRB 5HY9B 3MBEA 4PYHA 3W5MA 1CU4L 1JE6A 5HDLA 4XCNB 5TE6H 3JV6A 1MAJA 5E5UB 1IKNA 1QSFB 1S9KC 4YQXH 4Y8DC 1JBJA 3C60D 3VRJB 2VUOA 3K0WA 2MCPL 2GJZB 1Q0YL 3MRMA 4ODWB 3SDXE 1TZHA 3G08B 2JIXA 2X4PB 5EBLA 3T0EE 1FGVL 1TQCC 2DQIH 5T1LB 4W4OA 1JNNH 2C3WA 1G6RA 3WS6C 5DMJB 1NGWA 5J06A 4BFGA 1MRDL 3TBTB 3RVXD 4Z95H 4DKFL 2EYTB 3OKMB 2O61A 2ITCB 4N8VA 1WF5A 1BHGA 1T5XB 4UTAH 4DJMA 2NCMA 5D6DC 1F4WH 1MHHB 3CLFH 3OAUL 3MBEC 4BH8A 4ZNEA 4HIXH 4D0CB 1OSZA 35C8L 5BO1L 2OXHA 2FBJL 4FFYL 5KJRH 1OARH 2NY2C 1IGYB 5FA3B 3L3GB 5IT2H 4QO1A 3IFLL 3VXMB 2I27N 3E0GA 4YDLC 1MRCH 4CN6A 1AKJB 4L4VE 1FZMA 1QQDA 2VWEE 4POUB 2NY0B 4ODHH 1WZ1H 2DWEA 1BMGA 4UILL 4W4OC 4Z7VB 4YBLC 3BZEB 4WTZA 1ONQA 2CKBL 2P49B 4X6CF 5HI3C 4PY8I 5DEGB 3S88L 3SDXA 3QNYB 1MIEH 3RA7L 4Y2DC 3T4AB 4PB9L 4QRRD 4CVUA 4NBXB 3TBYA 2PYEA 4NFCA 4I9WE 2XKNB 4KK8C 1A7OH 4RGNB 5KS9A 2E7MA 4WWKD 4HZAA 3D9AH 5J4MA 1RU9L 2K9UA 2Q86B 1IAOB 2ED9A 4Q97A 2V7HB 3IETB 5IMOB 1VSCA 5FF6B 2L4OA 3CX5K 1N3NB 2PXYA 4Q6YA 2NLJB 5F89A 1FNAA 4YX2L 1X5JA 1AQDA 2QQNH 5IKCA 1U58A 4WEUD 2JJTC 3OKDB 3N1GC 2E9JA 4JZNA 4Y19B 1N7MH 3E2HB 5A2KH 2ZCHH 4O4YH 3DX7B 3SO3B 1AO7B 1JF1B 5C08D 3KS0H 1QSFA 1A7RL 4F2MB 5BW7C 4EN3A 4PRNB 1MCRA 4WU5A 2EKSB 3DECA 4QWWD 5HXMA 2COQA 5CEZL 5T3XL 5JW3H 1DBJL 1G7MB 1ZLSH 3NZ8A 4NZRH 1I1FA 4PJ7A 2P46B 4LLQA 1F3DH 2EDFA 3NZHL 1JP5A 3OR6B 1I7UA 5CGYD 3S37X 2C3XA 3RWHB 1WWWX 2ZKHH 3BKJH 2BXZA 3O6MH 4EBQL 1IGJB 3FQWB 2HTKD 3OG4B 4GAGH 2RB8A 2XY1A 3PV6A 4UT7L 1WQVT 4GW4A 2FIKA 3MO1B 1CICB 2NR6C 4HKBA 1CZ8H 3IFOB 3HUJB 2V2TA 1RZJC 2VJXA 5FM5O 2OYPA 1WVZA 1AGFA 3DVGB 1XCTB 3HFML 1MOEA 2PXYD 4WU5B 4KKBC 4KRMB 4PJHE 3R8QA 1Z9MA 4J4PC 1KCUL 4IRJD 2GTWA 8CGTA 3PWJA 3JVGA 2ESVA 4WNQA 3CFJB 3M8OL 3JV6B 2J8UE 2FIRT 3T65B 3HTLX 4RNRA 2ATKB 3KXFA 5DHXB 1T89A 2VDNH 4M48L 2ENSA 3WEXB 4JPVH 5FGCB 3LSOA 4BJLA 3C5JB 4DKAA 2BOCB 3OKEB 3ULVH 2E7LA 1ERNA 1KELH 4GRWH 3S88H 2J1KA 4NZRL 4JEGB 3HE6D 2NY5H 4TQEL 4KAQH 3T0AA 1C7TA 1JGEB 3U4EA 5CBEA 5LGKA 5MENE 4PG2A 2EDTA 1D5MA 1IKNC 1YECL 2DQGL 1K2DA 1YN6B 5FK9A 1BOGB 5JIKA 3NCCB 2X4TA 2VDKH 1MCDA 1SBBA 2VSDA 3NPSB 3ZSTA 4JZJA 3C5SA 5L8KB 1JNHA 3TWCH 1KPUA 3Q48A 2AXFB 4NYLA 3AMLA 4G8GB 1Z9LA 4D8PA 2PUQT 3MRRB 1X4XA 4JO3H 1I8LA 5HSFA 2A1WH 4XC1L 5L2KB 4ZFGL 3PHOB 5H37G 5T5FH 3MV8E 2I9TA 4J23A 4M1DH 4OD3L 4DZBB 3Q2CA 3G6JF 4MDJA 4EN3B 1IARB 4KKBD 1WSST 5HTSA 2E9IA 2XTJD 1OL0A 4ZPTB 1AE6H 3H9HB 5ADOL 3CH1A 5LCVL 4U1IB 4YDIH 2Z93A 1JGDB 2BVQB 4RBPK 5INDB 4C56A 2OR8A 3HNSL 5DR5H 3TIEA 1QA9B 3BZFA 5E94B 3CMGA 1BM3L 5EIQA 5CJQL 1UB5A 3EYVA 3FO0H 4HF5L 4HMEA 3SE3A 2I24N 5I17A 1UJ3C 2ICCA 3EO0A 2C4FT 2YHGA 1G6VK 2YD5A 4BZ1H 1NGWB 1A1OA 3O6ML 4EBQH 4Y4HA 3TA3D 4F37F 1XGQA 4K71C 3AVEA 3IJYB 4MD4B 4OZHF 2CKBB 2NY6C 4RFEB 1RFDL 2IFFL 2ZCLH 4LEXL 1DQDL 1I8KA 2X89A 1HIML 4NRXB 1DLHA 4JM2C 5F3HB 5CEXB 4GKNB 5FYKU 1NCBL 3RWEB 1U8JB 5K9OA 1MVUB 1NCAL 2Q87A 2IFGA 5C2BL 1YQ2A 1VESA 2ADFL 3MBXL 5EA0L 2D0HA 5L2KA 3IF1A 1WEJH 2PTUA 5D1XA 1AI1L 1CE6A 2ITDB 2MOVA 2W91A 4TRPH 3QH3A 1RZ8A 3FRPG 1P84K 1AQDB 4IBLT 3V6OE 2AABL 4YHMH 1SEQH 5SWSA 1BOGA 4EN3C 4D0DA 4PJEF 3KPTA 1GC1H 4LLMA 5HYEA 4EIZC 4XVSL 4TPRH 3QQ3A 4NKMB 4P5TD 4S1QH 4I18C 1N0XH 4E42B 1KB5A 1HYSD 4Y2DD 2FHFA 2W60A 1YY9C 5EWIH 4JFXB 1U8PA 3PIQA 1A3LH 1FNHA 4P4KB 1I4FB 4KHXL 3GNMH 3BSZH 1ZHLA 3QDJD 5AZ2L 1NUDA 3CFEA 4NDMB 2B7DT 1G7IA 1MIEL 1UJ3B 1MCPH 2PYFA 3X3FH 2UWEB 3T8XA 5E9DA 1YNTA 2YSSB 3PP3H 2RCSL 4Z7OF 2JIXD 1OAQH 5A2FA 1KENL 1DBBH 2H6PA 5A16A 1IT9H 4JM2B 1JPFB 1ACYL 3NCJL 1UB5B 4B41A 4L9DA 5GZOD 5TFSH 2FD6L 1LP9F 2O5XH 5TDPA 3UYOD 3BHBA 2V7NA 3OKYA 4DGIH 3RVVC 3ARGD 3H9SD 4TNWK 5MI0C 4S10A 2JJWA 2YC1A 1ZANH 3KG5A 1QHOA 1A21A 5GRJL 1JPSH 2YN5A 4K3JL 4XNMB 3TBVB 5JPNB 4OGYH 3MV8B 4LSQH 3V4PH 4YHYC 3D0LB 4GQ9L 4XC3L 2B0SL 5HGDA 1FL6B 4BA8A 3D25B 2QTEA 5LXGL 4HWEH 4M7KL 1T2JA 5DD6B 3REVB 2LABA 1H8NA 1EMTH 4G6FD 4JHWH 1R5VB 4C58B 5E6IA 3V0WH 5CGTA 1OPGH 2B39A 2FJGB 3KPSD 2ZUTA 1KB5B 1XR9A 1TZIB 3VRIB 5ENWB 1HHGB 1FAIL 4IHOA 5TE6L 4HLZG 3PWLB 1HINH 5DQJA 2XTJB 3QG6B 4YHNA 2Y6SC 1YY8A 4LBEA 4OGXH 3TO2A 5E1HB 1I3RA 4M6ML 2ZUXA 4NHUA 3ZYIA 1ZLVK 2AERT 3HNTL 4G42A 2AEPL 4UU9B 4ENED 2XWBB 3SKUD 4YJZL 5E8EB 3L3IA 1JHKH 4JQIH 1E4XH 5ICXA 3NA9H 4PJGF 3HMWL 4FXKB 5E6IB 4MX7B 5GRJH 3ZO0A 1QRNB 1YDPA 4MWFA 4MA3A 3PDDA 3UJJH 1X5FA 4KK9C 1DBAL 1JV5B 3MJ7B 1F4AA 4XP6L 5IMLA 2WBJD 1DTUA 1NFDA 3QYCA 1F4XL 3AM8C 3UTQA 5IMKA 3LVEA 2UYLA 3L5IA 5I1CH 4CU7A 1KN4L 4UT9H 1NGPH 5INCB 2KL6A 1XGUB 4MA8L 1N6QH 1YMHA 4GAJL 1LK2B 4G9DB 5IB4A 1PSKH 3W39B 3ZKXB 4O02L 4RGND 4I1NB 1IM9D 3EJZD 3DYMA 3HE7C 5E8NA 4ZQKA 3A67L 2J5LB 3R1GL 2P7TA 1OAQL 5D7KD 2EXYC 2QJDA 4JM2A 2BJML 3H42H 4DN4L 5LWYH 4IMKC 1CXFA 5IHLB 3V0AC 3LV3A 5HJ3B 2R1YB 4L5FH 1IGCL 5E5RB 5HHOB 2WQ8A 2NQCA 4XP5L 1NMAH 3QUKB 5CCKL 4ZTOL 3DBXB 1ZHKA 2KQNA 1NCCL 2FNBA 4NO0D 3UCRA 2H41A 4PLOB 3ZTNH 3BAEH 4PRAA 4DOHE 2DLGA 1LNUB 4JFOA 1FLRH 2VL5A 1ED3A 1AO7D 1LK2A 1IKFL 4DCQA 1W8OA 2UWEE 2VL4A 3KVQA 4OGYL 5D71H 1JHTB 1JPSL 3O8XC 3CFIC 4JREC 3KYAA 4YC2B 5I1HL 4PP1C 1JYWA 1BQSA 4HKBB 5JXEA 3HUJF 5HYSB 3VFWA 4Y16A 4PBXA 4R26H 5HY9A 1F45A 3U1SL 5GSVA 3BRFA 1FPTL 1XF3B 5JLZB 1YN6A 5FK9B 3T2NH 2GSGA 1VB9A 4Y1AA 3QQ3B 1N4XL 1S78D 2DTSA 1V05A 1IT9L 3SDYL 3LKSA 3UAJC 4C83B 4K23L 4YZFF 1G7JB 1I7UB 3LHPL 1KENH 3F7RA 4YUEL 5TPWL 5C1MB 5KVMC 1MLBB 2OI9C 4ZOAA 1T0PB 3W9DB 1BIIB 2VC2H 3FFCA 1LP9A 1A22B 1EO8L 4Y4KA 4WDIA 1G7LB 5DHVB 3NACH 4WU7A 2YWYA 4OV5B 2HVJA 1RFDH 4QNPF 1B88A 2X40A 5E6ID 1OTTC 1AHWB 2EDLA 2HVKB 4KK8D 5KBNC 5L9DH 1MHPH 1QLEL 4ODTH 4GAYA 2NTFB 2QQLL 3I6KA 4X5XA 1A6ZB 3WLBA 4LAQH 5CHNA 1VKXB 4AK1A 5IMKB 5DD6A 2D2OA 5EU6E 1QFUH 2Y07H 4JY6A 4WFEE 1W72B 3PL6A 3WCYA 1EO8H 5IROA 3B83A 4NO3B 4XNUH 4CMMA 3G6DL 2J6EH 1IM9B 2J7LA 1RURH 4LFHD 2ZOLB 5JLZA 4ISVA 1NCWH 3RNQB 1IC1A 3HG1B 1N3NA 3SGJC 5FYJU 1D5XA 4NQEB 1UCTA 1BVKA 4JFFD 2KPNA 3MUGA 3SKOA 4QHLA 5I1AB 5DDHA 5A1AA 3B8SA 1AD9B 1ES0B 2VR9A 1QFWI 4HT1L 1Y18A 4PJFE 1KJ2L 2AI0H 3QEQD 4PRPE 2NTFA 2Z92A 2PTVA 3NGBB 4PB0H 4PUBL 3WFHB 4A6YB 4ZD3H 4OIAA 4YXLL 1GC1C 4JHBA 1Q0XH 1IZKA 5IFAL 4LVHC 4ZO8A 5DJCA 2CD0A 3FHAA 1MNUH 2X4QB 3TN0D 5SX4H 2APTA 3L3HB 3MRJB 5I8OH 2A6KA 5I9QC 1I7TB 1LEIA 4ODUA 1NCCH 1FCCA 3T77B 1HSAB 4QHUB 3RWCA 4HUVB 1PKQE 4JQXC 1NFDF 3AXLA 5HD8D 5T3ZL 3STLB 4RFOL 3QSKB 4RQQB 5IEHB 3B5GA 3IAPA 4M5ZH 3V0VA 4LSVH 5GSVB 3QWQB 1TJGL 1DEDA 2B20A 4DQOH 2VQ1A 1RZJL 3S3SA 4ZSOA 4K3DH 2FJGA 1A3LL 2AQ1A 4M93B 1ZA6A 4C56D 4KI1A 3EOTH 3AU1A 5JORA 4NO3A 1AGDB 3CU1A 1XIWA 4EEEA 4LCWE 5KZCB 5D2LB 1JV5A 4CJ1A 4LARH 1UXSB 3BT2L 5ISZB 5EBLB 2GI7A 5EUOA 1CE6B 1GHFL 3L9RB 1AQKH 1NDGB 3RVTD 3WNKA 4D94A 1FJ1B 5DQ9A 4TN9A 4UOW1 5CMAB 1WWBX 3DMMC 3BEWA 3I02A 4UU9A 5HYQA 3CNKA 3NA4A 4OCLC 5DVMA 5IWLA 3JUZA 4I3RL 2AEQL 3UC0H 3KPLA 1S9YB 4P48A 2VDKL 4UAOB 3UTPD 5CINH 2C3GA 1XCTA 2VLKB 2W60B 4OZHB 5EOCJ 3B2VH 1ZTXL 3OJDB 1KPVA 2D03L 2XTJE 2VMFA 4P46A 3QIBC 1IRAY 5F6HI 4N0UE 5MI0B 3VFRA 3VWJC 4JFYB 2PTTA 1P1ZA 1JNLL 4X7EC 3S98A 1YMHB 3QDJB 4JO2H 3VFNA 4X0KB 4H26A 1FG2B 1KELL 3DPBA 1BF2A 5D7SH 4G9FD 2F58L 1FVCA 1R3JA 3B8YA 3PGCB 4OF3A 2P8LB 2W0LA 3VRLE 4HS6B 4X9HA 4PLKC 4X7SH 2BNUA 2F8VA 3MRBB 1CLZL 2X70A 3I2CH 3OKLA 2R9HD 1R3IH 4XP4L 2GSIA 2WP3T 3O3UN 3NCMA 1JZ2A 4U3XA 4LHUD 3OR7B 1XGTB 5IB5B 2ZUQB 2Q8AH 4UUJA 5I6XC 2O5YL 1N2RA 5I8EA 4PV9A 5I8CA 1ZHLB 1MFCH 2XRAH 4UOJA 1ZANL 2FDBP 3QR2A 5K93A 4WI8A 3DSNA 5TE7H 3KGRA 4ZUWB 3K1KC 5T1KA 4HJ0C 2AJXL 4JE4B 1T7XA 2D7NA 4WUKL 2XZCL 1QHPA 1PDKA 2ICEB 3QUYA 4WFHD 1FYTD 5TGBB 4N0UA 1PBYA 4UB0H 2HTLD 5FGBC 2F53B 3HG1A 4DQOL 1R3HB 5F3BA 3FQUB 5C0AB 4UV7H 1MJ8H 3S35H 4Z7OE 3HI1A 5AYUH 3BKML 4G6JL 3QRGH 1CD8A 4F57H 1GCFA 2Y6SD 4UILH 3VI4F 2F5AL 2QSCL 4KK5D 2F19L 2JB5H 3QAZC 4F7EA 1Y0LB 4B0MM 4XX1G 1NCNA 1DDHB 3QEUB 4PGCB 3JTTB 1DJSA 3D85D 4NQDE 1A7NH 3EYOA 3ARYA 1U3HD 1G7MA 1MCFA 3FZUC 4MQXC 1HHIB 3SGJA 5C0IB 3EDDA 4PJAB 4U7SA 4XRCB 3OX8A 2WNGA 4HXAL 3JWDH 3S35X 5IIEB 4NQSB 1IFHL 5IJKC 4RNRB 5IFAH 2NW2B 1KACB 3EO0B 3GZKA 1I3RB 4Y4KB 3L5XH 3QIUD 3RFZC 2W38A 3IU4H 3KYOB 4JPVL 2F53A 3WYRA 1FZMB 1CD1B 4MCZB 5CD5C 1OVZA 4F7MA 2IC2A 1INDL 2V2TB 1MCLA 3ARWA 4NJ9H 4WUKH 1HYRC 3HC0B 1FGVH 2VZUA 4KI5F 3HPLB 3DETD 3C2SA 3H7BB 1HHHB 1NCWL 4K07A 2VO5A 3WIHA 1Q0YH 1TFHA 5EUKB 5KSAA 2F9BT 4BSVB 1P7QA 1FVEB 4UQ2A 4QYOA 4KKCC 3WXWH 4NKIH 1J8KA 1TENA 3DIFB 1TETH 4FABH 3RA7H 4YBHA 5DMIL 1KPRB 1KCVL 2X4SA 5IQ9B 5TJWK 1YEHH 3RIAF 1PW3A 3C5JA 2QADB 3NFPB 5JIPA 5F7EL 2QQQA 4KK6C 3DMMB 4PRIB 3CZJA 1HIMH 3QIWD 4LCYA 4RDQF 4MMZC 4MA7H 3GSVB 3NIGF 4D0DB 4P5KA 4FFVD 1NGQL 4LU5H 5D7LA 1OP5K 3PWJB 4AL8L 1Z2KA 5IG7B 5CJXC 2GW5A 1CGUA 4G5ZH 5F72S 5TPWH 4YUEH 3I75B 3L3GA 5F21B 1A8JH 4NM8L 4JHAL 1ZGLA 5FDWB 1I8IB 2HJKA 5D1QA 2X9XA 3M1BA 2YSSA 1NFIA 4DVBB 4MCYA 1PVHA 4F9PA 4UZGA 4XHJD 3NVQA 3KWWB 3MRKA 4X6FB 3MFGB 3ME0A 1RIHH 4GG6B 5I1KH 5T1LD 4K8RC 1BOYA 2Q86A 1KJ2A 1FL3B 4O2EB 1KGCE 1TVBA 3VXPB 1MCCA 4OF8A 1FO0H 1W8NA 3HAEB 3AS1A 3FT2A 4OD3H 5D5MF 3HZMA 3TF7C 3CUPB 4MVBD 1TJIL 4I0PB 1F2QA 2RIKA 3TBVA 3MFFA 3X3GL 1IC4H 1U2CA 3GO1H 2HKHH 3PWPA 1IFHH 3IDMB 1H5BB 3KLDA 4TULL 1OP3H 3JV4A 4HXAH 5E8DL 3UDWC 5FYJE 2CMRL 3SKNA 3TT1L 3V79C 4NQEA 3GRWH 1P4LA 1JGLL 1P2CB 1MPAL 1FQ9C 4TTDD 4G9FB 2BSSB 4BZ2L 5T1MB 4P5TA 4LSUH 3I6GB 5JZ7D 4FN0A 2HJKB 1QNZH 3HC0A 3P11L 3T2QA 4TTGA 4EI5C 3TT3L 2NYYD 2EE9A 5AYUL 1UM5H 2DAVA 3ILQD 1I9RH 1QO3A 3GRWA 1KF9B 4TSAL 5D7KE 4UV7L 5ABDE 1UM4H 4YFEA 4XAWL 4NQXA 3ULVL 1YA5A 1T1XB 2YPLA 3EIFA 2QHLA 3TC9A 4Z7UF 5C0AD 3FT4B 1UXWA 3K74B 1RULL 4LKXA 3THMH 4Z7UE 3PL6C 3KYNB 3VD5A 2BSRA 1T89C 5DFWH 1BFVL 4Y4HB 5DUBB 2VSCA 4PRID 6CGTA 3MRPA 4JKPL 4P9HL 4FQXC 4PJCB 5BVJB 1ONQB 3QWOA 3EGSB 1KIQA 1MJ7H 1X6LA 4JQIL 5E8EA 43CAA 1J5OL 4WI2A 4LCUB 1T5XA 4PG2C 3U46B 4DFHA 1C1EH 1QO3B 5BZDA 5IW6A 5F9JA 1Q9LA 4CBPA 4AY0A 1EHXA 4N0RA 5CSGA 1AJ7H 2KKQA 1KIRA 4JZJC 4FQJH 4XWGH 5LQBL 2W92A 5C08B 4AEFA 1G9NH 4JDTH 3X12A 4A6YH 3DARA 4FHBD 1FNLA 3DRQA 4EDWL 3DUSB 4POYA 3U9PH 4MAYA 3WNNA 1ZLSL 1GXEA 1F11B 4IOSD 1T6VN 1NBQA 3KPSE 4X8XA 5J6HB 5I19L 3LCYA 2UY6A 4LLDA 4U1JB 5DHYA 1PGRB 3D1MC 4P3DA 5IHBA 3GMPB 5IB3A 4U49A 3C8DA 5JOFB 4WHTA 5HVGB 2EYSA 4OZFG 5ECJE 2R4RL 4OFDA 5KSAC 3IJYA 4MD4A 2A77H 1FZOB 5MP6L 1K2DB 4E0RB 3SO5A 4MDIA 2ZPKL 4MS8C 4F9LC 1PG7H 3MROA 4PJFF 3QDGB 1PJ9A 3GKWH 4WVRA 5EU6A 4MNQB 4QOKA 2BNRB 2D9QB 4Z7WE 2F53E 3LN4B 2VLLA 4XI5D 5EN2B 3FQRA 5DVOA 3SOBH 1K5NB 4XBGB 1BQHG 4J3WA 4BELD 4TNVF 3I50L 2E27L 4YC2C 1J9CT 1KC5H 1UZ8A 2MSPA 3DXAD 1CD1A 1JGDA 2BVQA 2ZUUA 4LSTL 5DGRA 5C86A 3RIAK 5FYLD 2DQUL 2PO6D 5E2VH 4HFWA 4DGYH 3ILPB 4FXGA 4U1LA 1W0WB 3ARBA 1NBZA 4RGNE 5D7JA 1DR9A 3BKYL 1EEYB 1J88A 3BP6B 3G5ZB 3BZ4B 1AGFB 3OZ9H 4QRRB 3ARGB 3CFKB 5JIIA 4PLKD 1XH3B 4XPFL 4JGJA 2XY2A 2EH8L 4PJXB 3DIFA 5T1DH 2EDQA 3BXNA 3FQRB 3VW3L 1RJZB 3MA9L 1T83C 4LLUB 4Q9CA 4LCUA 3H3PH 3VXSA 5JQ6L 5J57B 3KHQA