2YKAA

Rrm domain of mrna export adaptor ref2-i bound to hvs orf57 peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
124
Chain Sequence
MASMTGGQQMGRDPDKWQHDLFDSGCGGGEGVETGAKLLVSNLDFGVSDADIQELFAEFGTLKKAAVDYDRSGRSLGTADVHFERRADALKAMKQYKGVPLDGRPMDIQLVASQIDLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Competitive and Cooperative Interactions Mediate RNA Transfer from Herpesvirus Saimiri Orf57 to the Mammalian Export Adaptor Alyref.
pubmed doi rcsb
source organism Mus musculus
molecule tags Rna binding protein/transcription
molecule keywords RNA AND EXPORT FACTOR-BINDING PROTEIN 2
total genus 13
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2011-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ykaA00
2FC8A 5LJ5Y 2MKIA 3EX7B 3JB9k 2XS5A 2M88A 2RS8A 2ZJQQ 1KD1T 4LMZA 2F9JA 2MMYA 2CJKA 1FJCA 1L3KA 2DNGA 3UD3P 5LSOA 1YITS 2VOOA 2HVZA 1VBYA 3VF0B 2EK1A 1SXLA 2QA4S 4QU7A 5GAEU 3VALA 2RRBA 4ED5A 4UY8T 3U1LA 3Q2SC 4PR6A 3MUMP 3IWNC 5LXYA 1YJWS 2XB2D 2MY7A 2B0GA 2Q79A 2DIVA 1X4EA 1KQSR 1WI6A 1UW4A 2UP1A 2DNKA 1SJFA 3G96A 1QVFR 2N82B 5LXRA 2DNQA 4WCEQ 3CCRS 3CD6S 2LXUA 2DNRA 5DDQC 1OPIA 2JVRA 1VC0A 2CPEA 2MPUA 4YB1P 2VODA 1WWHA 2E5JA 2HZCA 2QEXS 1YI2S 1OIAA 2KI2A 3L3CA 2MGZB 3P5TL 3THPA 2KT5A 2M9KA 5DETA 2HGLA 2DHAA 1DRZA 2MYFA 1X0FA 1ZZFA 1NJIT 1UFWA 3MUTP 5IQQA 4EGLA 1BY9A 1RK8A 4FXVA 1R8HA 2AYEA 3NMRA 2J76E 3I55S 2M8DB 2DHGA 5JVHQ 5GADU 2NLWA 3G9CA 3P6YC 1WF0A 2DNMA 3S6EA 2DH8A 4CH0S 2DGSA 2X1BA 3D2WA 1Q7YT 3MOJB 1FT8A 2KG1A 3CULA 1K73T 2D9PA 2MKHA 1PGZA 2M4MA 2OSRA 4QPTA 2ZJRQ 1B7FA 5HO4A 2DNYA 2MSTA 2DITA 1G2EA 3SDEA 4ZKAA 3LPYA 1X5PA 3VAJA 1X5SA 3MD3A 3CXCR 1X4BA 1WHVA 2CQHA 5D78A 5IM0A 1VC6A 2LXIA 4WFNQ 5DDRC 2YKAA 4YOEA 1FJEB 2DH7A 2GHPA 1WI8A 2LEBA 2LKZA 1FNXH 2DGVA 2CQBA 1DZ5A 2CQ1A 2CPYA 5CYJA 3UWTA 3DLLQ 2L9WA 1K8AT 3ULHA 2YH1A 2CQCA 3CCSS 3SDEB 2OIHA 2KU7A 4FXWA 4Y00A 1U1PA 3UCUP 2DGUA 3NNAA 2AYBA 2XSFA 2DO4A 1SJQA 3VAIA 3BEGB 3G8SA 2L41A 1VQ8S 4U67Q 2HGMA 1YTYA 2CPIA 2MJNA 4CQ1A 3CMAS 4RU2A 4F26A 4WIIA 1HA1A 2U1AA 1W2BR 4M5DB 3R1HA 1YHQS 2OTJS 2N3LA 4WFAQ 2KRRA 2RT3A 1RKJA 1YIJS 1KC8T 3R1LA 1VQPS 4C4WA 1KOHA 4PKDB 4A8XA 3G6ES 2KXHA 1H2UX 2D3OR 2X1FA 2K3KA 4WF9Q 4F25A 4C0OC 4W90B 1WEYA 2KN4A 2MGZA 2G4BA 2CPXA 2RU3A 1VQ4S 3TO8A 2CPZA 1WEZA 1U2FA 1VBXA 1N88A 2RVJA 3SXLA 1FO1A 2KG0A 3CPWR 3S8SA 2BZ2A 2CQ0A 3PIOQ 2G1DA 3FEYB 2DGXA 3EGZA 3NNCA 5LJ3Y 1WG4A 5ITHA 2JRSA 2G0CA 2CQ3A 5GAHU 3IRWP 3G4SS 1QVGR 2L08A 2KM8B 2XNRA 1N52B 2EVZA 2KVIA 1A9NB 2DK2A 3HHNB 2DNPA 4TLQA 5CXTA 2CQ2A 3P3DA 4CIOA 1P27B 2EK6A 2N7CA 3MDFA 1D9AA 2DO0A 2E5HA 1WF2A 5H1SV 2V94A 5FJ4A 2JVOA 1X4CA 2MJUA 3CUNA 1U1LA 2E5GA 2ZJPQ 2CPFA 5GVQA 1CVJA 2KYXA 3V4MA 3CCVS 3S01A 2M52A 2CQIA 3H2UB 2KH9A 2U2FA 2FY1A 2MQOA 3G71S 1WTBA 2ADCA 5BJRA 5IM0B 2ADBA 1URNA 1X4DA 2HGNA 2O3DA 2KM8C 5DM7Q 2KXNB 2DHSA 1U1OA 2MZRA 3B4MA 3VAGA 2FPHX 1DBDA 1SJ3P 4IOCQ 2X1AA 3PIPQ 1R8PA 2GO9A 3CCLS 1JJ4A 4IUFA 4OZ0A 3BO4A 2DGTA 2M2BA 4LJMA 2OTLS 1Q82T 2DGQA 1U1KA 1WHXA 5JVGQ 3UE2A 1FXLA 2MQLA 2MKCA 2NZ4A 1VQKS 3Q2TC 1U1MA 2LECA 1IQTA 1X5TA 2YWKA 5D77A 2E5IA 1WELA 3CCMS 3US5A 1JMTA 3NS6A 2M7SA 1WF1A 1X4GA 3CTRA 5DDOC 2ERRA 2LEAA 2M0GB 2HYIB 3S7RA 2MKKA 4W92B 2K8GA 3RW7A 1WHYA 1S72S 2E44A 2CPDA 2JX2A 5LSLA 2LA6A 2RUGA 1WEXA 2YTCA 3BO3A 3UD4P 2DGWA 2VONA 1VQLS 2F3JA 2LQ5A 3CC7S 2MXYA 1OWXA 2DGOA 4OZ1A 1VQMS 2AYGA 2XS7A 3MUVP 1VQ7S 3MURP 3UCGA 4QQBA 2BOPA 2AYMA 3THTA 4BS2A 3CF5Q 2SXLA 3OW2R 1S79A 1SJRA 1XN9A 5GMKa 2WBRA 2RQCA 1Q86T 2XS2A 1X4HA 3NNHA 1P1TA 3CCUS 4TU7A 4J5OA 3FEXB 3CC4S 2MB0B 1YJNS 1H6KX 2D9OA 2DNZA 3CCJS 1HD1A 1M5VC 3H2VE 5IFMA 1Q81T 1OO0B 1H2VZ 2DNLA 2MKSA 1UAWA 1HD0A 2MZQA 5DDPC 2MHNA 2J8AA 1KOOA 3J7YU 1UP1A 2MQNA 2I2YA 2FHOB 1X5OA 1WHWA 1JJ2R 3HI9A 2KRBA 2CQDA 3TP2A 1VQ6S 2DNNA 3VAHA 4C7QA 2CQGA 1WG1A 3ZZYA 5MLCV 2LMIA 4WKRA 2MZSA 1U1NA 4PRFA 3TYTA 3UCZP 1YWXA 1U6BA 2CQPA 1VQ9S 1U1RA 2CQ4A 1VC5A 2RNEA 2DIUA 1M5KC 2FC9A 1VQOS 5CA5A 3DXBA 1VQNS 2MQQA 1M90T 3VAFA 1M5OC 4YUDA 1U1QA 2RQ4A 4TU9A 1N54B 2M70A 2LA4A 1X4FA 3ZZZA 3P49B 2DH9A 3I56S 4F02A 2LYVA 2VOPA 1NU4A 1U6FA 3N9UC 3K0JA 2KHCA 1N8RT 2CPJA 1O0PA 4CH1A 2XNQA 2MZTA 3VAMA 4UQTA 2AD9A 3LQVA 2MY8A 1DHMA 1NO8A 2MSSA 3MI7X 3CC2S 4WFBQ 4P6QA 3J7ZT 3BS9A 2JWNA 4TU8A 2DNHA 1F9FA 5HL7Q 1H2TZ 2KXFA 4Y0FA 4V19X 2N3OA 2OJ3A 5EN1A 3G8TA 2I38A 1K9MT 3VAKA 2PE8A 2MQPA 1FHTA 1JJHA 2LCWA 1WG5A 2RRAA 3MD1A 5DM6Q 2DISA 1ZZNA 2M8HA 2QFJA 1A7GE 2A3JA 3U1MA 1X4AA 1AUDA 3SMZA 1SJ4P 1VQ5S 2MZJA 3R27A 1HL6A 3CMES 1FJ7A 1D8ZA 3B4DA 2J0SD 1PO6A 4QU6A 1ZH5A 4IOAQ 1M1KT 1M5PC 2MQMA 1VBZA 3NS5A 2YH0A 2X1GA 3EGNA 4ERDA 2MKJA 4LIRA 1YJ9S 2PEHA 2CPHA 2OSQA 3MXHP 3CCQS 3CCES 2MZ1A 2DHXA 1QM9A 2DNOA 2F9DA 5GAGU 2J0QD 3RW6A 4IO9Q 2KFYA 2RS2A 2DB1A 4Z2XA 3BO2A
chains in the Genus database with same CATH superfamily
2FC8A 3A13A 2ASYA 2FTRA 3N0VA 3FMBA 4M5HA 3KHRA 4DR4F 2V9KA 2RHQB 5DZ7A 4FS1A 3DLJA 1NPRA 1S7HA 1W26A 2HNDA 2NXCA 3TJ9A 2EXUA 4DG1B 2XS5A 3EVMA 3MM6A 4K4XA 4CO5A 3HMJG 4DV5J 4ELVA 1HI8A 2ZJQQ 2HHQA 1R6VA 5FLXY 3KK2A 1VMBA 3ELHA 4CLLA 2CJKA 2V68A 3N4WA 3KNAA 3QT6A 1YITS 3QGHA 1PBAA 4GVLA 1FRHA 4K59A 4NXMJ 2DCUB 4I6YA 5D3GB 2FHJD 2EK1A 1SXLA 4JOUA 2KVQE 2QJ3A 3WQPA 2BJ7A 4OYPA 1VK8A 5HROB 4OIXA 3KKFA 2QA4S 3GJQB 5GAEU 4K4WA 4B9NA 1I51B 4O4GB 3ZZRA 2C2DA 1KLMA 1SC3B 1ROFA 3M8PB 3LGMA 2WVFA 2RRBA 3GU0A 2ZOFA 1DLOA 1H7WA 3DDKA 2AP6A 4RW8A 3U1LA 2FQQB 4RNOA 3MUMP 1YJWS 3QBCA 3OVSA 1AZSA 2CJAA 2MQ8A 4DCJB 4R5PB 3KJNB 5HN0A 1ZYQA 4NCGB 3PVXA 1NHUA 3G8QA 3ZNUA 3LALA 1X4EA 1XBWA 2W9CB 3IWLA 2CIMA 3PEHA 2OHDA 2VPYB 1N6QB 3BBFA 1R3NA 4DPWA 1UW4A 4R8UA 5KFJA 1CJKA 4NEZA 4DR6J 3MM9B 4ZCKA 4DLGA 3PM9A 1RTJB 3AB2B 3AOCA 2Z0GA 5I42A 1S1WA 4LR9A 3NCRA 4ELUA 3CJ4A 5ETNA 4RJVA 2HZVA 1FX4A 2LXUA 2AX0A 4RU9A 3FZBA 4QIWD 2DNRA 2B6AB 3BSOA 2JVRA 4CRJA 2CPEA 5KG5A 2UXBF 2VODA 2MLZA 2J0WA 2E5JA 3V4IB 1YI2S 1OIAA 2KI2A 5BYRA 2ASJA 2F65A 4ED6A 3VQTA 3L3CA 5L1IA 1JLFA 2MEWA 2ILZA 1RWXB 2KT5A 4R8UB 3AD9C 1M5SA 2GHVC 4YQWA 3RG6A 1RTJA 2IRUA 3OW2R 5HBMA 3ILOA 1NJIT 4FF1A 1NMEB 2XEXA 3DHXA 4ANEA 2HWIA 5IQQA 2QRRA 4EGLA 3QJJA 3MCSA 1S99A 1R8HA 2WONA 2J7WA 1WOSA 2AYEA 2M8DB 1C0UA 1ZM3A 2HBRB 5AE2A 5GADU 4JI3F 4LF4J 2VQEF 3G9CA 2GAHC 1BWVA 5LM7E 1SB6A 4MIAA 3S6EA 3GG1A 2NQPA 2KB2A 1GMUA 4DR6F 4LFAF 2DGSA 1VHIA 4P2XA 1RTDA 2FJAB 4CCHA 2HKEA 2JC0A 1Q7YT 4J9QA 4AL5A 4CWBA 1K73T 1EP4B 1RT7B 4WTOB 2PIIA 1LWXA 2J8SA 3DOLB 3QIDA 4QPTA 4TY8B 3SQOP 3KK1B 2OD6A 3BKUA 4EYIB 1DY3A 1TL5A 1TMMA 1LXJA 5L9NA 2DNYA 1D3WA 2MSTA 3KJQB 4HL9A 4C98A 1X5PA 3RUBL 2GJIA 3A8JA 3CXCR 1WHVA 2APOA 2V2QA 1U24A 2Z4PA 3O1LA 3HSDA 3KLIB 4J9SA 1ZM2A 2LXIA 2WCXA 3PJ9A 3UO0A 2KKHA 3H5UA 4KGKA 1Z2ZA 3K89A 5T7LB 1IKYA 3QT7A 2DH7A 1RT3A 2CZ4A 5A8RA 4CO0A 2DYAA 3LP2A 1HBNB 2H51B 4LSNB 3HT0A 3POTB 2CQBA 3FFIA 5D0RA 5GMDA 3T19A 1YHQS 2K7JA 2AIRB 1QD1A 1H7XA 1RTHB 2C2EA 2CA9A 3DLLQ 2EFVA 3OL9A 1LV5A 2YY3A 3ULHA 4CLWA 2RQMA 2CQCA 3SDEB 4G1QA 3D9BA 2KU7A 2OIHA 5F8MA 4FXWA 1YZ7A 2IRYA 3D68A 3KG0A 5HK4A 3IM8A 1FEEA 4OV1A 3B54A 2XSFA 4IYQA 1SI9A 3OL6A 3K5MA 4JV2A 4XPCA 3BEGB 3FRYA 1U47A 2L41A 1L3UA 1N0UA 1P8GA 1OSCA 3M8WA 4U67Q 4GVBB 2BW2A 2DY1A 3DYAB 3W62A 1YTYA 2O67A 1Q5VA 3M2VB 2GZOA 4WE1A 2KFNA 4M5MA 3M8ZA 2BE2B 4QIEA 4V1Ak 2XBPA 4ZP7A 4M5DB 4JI8F 1WKJA 2Y1RI 1HI1A 5F8HA 1ZA1B 1QAJA 1WNEA 2OTJS 1FF2A 2DR8A 3EGVA 4HTJA 1M1GA 3TVZA 5L1KA 4MJKA 3IXQA 2QV6A 2A2CA 3AT1B 3NGKA 4LRAA 5KFEA 1YIJS 2EKYA 5KG1A 4F3OA 4C4WA 4PKDB 1RBOB 1JK9B 2W1BA 2D3OR 2FLLA 3QGPA 1D9FA 3EZUA 1T9XA 4C0OC 1RA6A 2E1MC 4KH0B 2G4BA 4JI1J 4JV5J 3PJXA 4X66F 3TI0A 4I56A 2CDQA 3M2RA 1FNOA 4ZPBA 1WEZA 1U2FA 2G2OA 1VBXA 1FD8A 1KRPA 1N88A 1MMDA 3MPVA 5CHCB 2E5LJ 2QSWA 2BEFA 4RL1A 1S6UA 4JI4J 1PYOB 2B6AA 6AT1B 2V4QA 3KLHB 3S8SA 1R0CB 3TWZA 2F7VA 2ZC3A 5ETMA 3PIOQ 1KONA 2RRNA 4ID5A 3VZHA 4K4TA 1DQ9A 2DGXA 1HWIA 1ZBTA 3LH2S 4N7TA 3BQ0A 1KFSA 3EGZA 3TAQA 1KVJA 1SH0A 3NNCA 1NH8A 1YBAA 2H3EB 2JJ4D 3DKDA 3QNWB 4NYZA 4KKOA 4WXWA 5CZVA 5LJ3Y 1NJWA 1RWVB 2CQ3A 1SCJB 4OX8A 4ZVOB 3TNVA 4HHUA 4TQRA 1QVGR 2I6WA 2KVIA 2AZ3A 2OO4A 3HHNB 3F73A 5CXTA 3R9LA 3VGTA 2CQ2A 1FKPA 4ZVFA 4QPXA 4CIOA 4ZVSB 1QDUB 2L3MA 3N5BA 1WF2A 2OPQA 1HMVB 2C1EB 4WPAA 3ZTOA 3V6KA 3HVAA 1XK8A 1A0OB 2UUAF 3MAAA 1S9EA 3EPGA 3RAQA 2V94A 2AGQA 2GA7A 4QWDA 4OX9J 4YHHF 4K4YA 4X65F 2HW3A 1K1QA 2JVOA 3W1YC 2IM2A 2MJUA 4AT1B 2OP5A 2GGPB 3H98A 8ATCB 5FDLA 4KH1B 3CUNA 3SV3A 2D3O1 1U1LA 3J7AN 2IY5B 1EP4A 1LW0A 1RT7A 4USKA 4F4ZA 2CPFA 4IH6A 4A8WA 4N76A 3BKTA 2GVDA 3KNGA 1XR7A 3BM7A 3F44A 1S0MA 4M5GA 2X51A 4NZ0A 1MMNA 3CCVS 3BN7A 3HLUA 2CQIA 1JWWA 1JIHA 2YX4A 4WYWA 1MU2B 2LQ8A 3W9IA 1SKWA 1X0PA 3OPKA 1HMVA 5B0GA 2MQOA 3MR3A 2KHDA 3M6WA 4MKBA 3MFHA 2VJVA 3H42A 3CDEA 4ZVQB 2F8EX 3FJ2A 3DU6A 2LFVA 1FVQA 4KHMA 1V9OA 3BF4A 2BJEA 2YWEA 2KXNB 1U1OA 2V67A 3QJLA 3P8BB 3B4MA 2DD8S 3I0SB 4MYTA 3VAGA 4V19J 4A4JA 4BBYA 2ZH6A 4RW9A 4OZJA 3C3LA 2KDOA 4DL5A 3JTNA 2AKWB 3R7SB 4DL0C 3OT9A 3I9V9 3CCLS 2POKA 1YBTA 2XG8A 3SQGB 4WKYA 4F4WA 1U7LA 4TY8A 4K2JA 5A2QU 3QAUA 3FCVA 4OZ0A 4DV1J 1FE4A 3GE9A 4X65J 4PWDA 4PXCA 3DLKA 2J9DE 2PGCA 4NLSA 2YWGA 2YX1A 1HNWJ 1JXEA 1F2GA 3CIMA 3WHIA 2GCFA 1U1KA 3TRGA 3ZTPA 1CC8A 4DV5F 2BANA 2F63A 4DQPA 3HHEA 1N36F 1Q7LB 3I9ZA 2FJBB 4C11A 1FTCA 4FKXA 1RT4A 1PG5B 4P7TA 4C97A 2MKCA 4NXNJ 3K5NA 3Q2TC 5DGBA 4DXLA 3MECB 1P9QC 2LECA 2DR7A 1IQTA 2HG4A 2YWKA 4P71A 2E5IA 4CZCA 1W7WA 3NWGA 1KN6A 3MTKA 1HPZA 5CH7B 3B82A 3CCMS 3EVOA 4KTQA 4X4OA 4TXSA 1R43A 2FY8A 3PO5A 1YJTA 3U7JA 4Y6IA 6FDRA 1LK7A 3AODA 1REVB 5ETLA 3THVA 4A8YA 4W92B 3RW7A 4ID8A 4RPFA 4F2SA 1S72S 2HURA 5KAKA 3FC9A 4IRDA 2QSFA 1SPBP 5LSLA 2LA6A 1SC4B 2IC3A 4DCPB 4DR7F 2OELA 3UN5A 3W61A 2YTCA 5DQHA 3BO3A 4Q45A 1N5YB 4B3OB 4X64J 3RTVA 1VQLS 1VR6A 1IKXA 4IH5A 3DDIA 5BYQA 3V6HA 3FFIB 2W2QP 4E2FB 2MXYA 2B3TB 1LNQA 4DR3J 4OI3A 1WC3A 4NLPA 1Y5NB 1YX2A 2LXFA 1HYSA 4QQBA 2BOPA 3A12A 5A8WB 1RU1A 1NJZA 2RQKA 3KG4A 4AL7A 1EQ0A 4XDCA 5B7WA 2OKQA 1KQGB 4X4NA 2VQFJ 3IN5A 4JI0J 3R5JB 4WFZA 1SJRA 3K8WA 4KAIA 4WFYA 1YJRA 2PDAA 2ZBIA 3UNGC 1BGXT 3GYXB 3CJ8A 1HQ2A 3D6TB 3R5GA 2AF6A 4LF2A 3M8QB 2R7XA 1P1TA 3D1OA 3IBFB 4A8FA 1F60B 2VKRA 4OHVA 4J5OA 4J9UE 2H9ZA 4TU7A 3J80Y 1CBKA 2KL8A 1V3ZA 2FVQA 3MTJA 1SUQB 1RT3B 3BZQA 2P6TA 3K58A 4BWMA 5E33A 3ENWA 2BQUA 2HAIA 1H6KX 1CG2A 1TL7A 2VPWB 4X4SA 3HXMA 5J1EB 2V4JA 1Q16B 3MEKA 3QLHB 3TR5A 5KT2A 1EAYC 3DM2A 1ZAXA 2QLFB 3G2XA 5JUMA 2C2ZB 4NOHA 3NY0A 3OV7A 1H38A 3MM5A 3BQ2A 3V81A 3GYGA 1Q81T 3ADAC 2G2ZA 4DUYJ 2R4FA 1WOPA 1TFYA 2IBKA 3QT5A 5IC4B 3IS9B 2DXFA 5ETRA 2W2NP 1J5EJ 5DDPC 4A8QA 1UVMA 2MHNA 2J8AA 3J7A1 5D0GA 1UVLA 2VHGA 3JSMA 4LBPA 1HHSA 1OPZA 1RB0A 2PO4A 2A6MA 1S6PB 2RIJA 2EPIA 4TY9A 2D3UA 4OJGA 2W9AA 4LQ3A 1X5OA 2XMKA 1IJEB 1JJ2R 2EW9A 4ZVHA 3TUZC 1EARA 2KRBA 2K2PA 4RW7B 2VBZA 2VFRA 1EJ7L 1RA7A 1GX5A 3FRZA 3G87A 4CLYA 1KTQA 2ZKUA 4C3LA 1WC5A 3KLFB 2BACA 4M95A 3R2CJ 2JLGA 2HSEB 4TVAB 1NK8A 3RZAA 1R31A 2IJNA 2G1HA 1HQEA 2RH3A 3DGPB 5GADI 2VL1A 3J7Z5 4NI2A 2MZSA 2ZBCA 3SCJE 3DLEB 5F8NA 1U1NA 1WC4A 1MG7A 3OTOF 4EBCA 3H4DA 5IZHA 1U6BA 5FLXU 4QWBA 3N01A 1G6BA 3DHWC 4OZNA 3MOJB 4IG3B 2V9WA 2R42A 2FHJA 1U6ZA 1RHMB 3GWCA 4PQAA 1S49A 2ILYA 3TA1A 3KLEA 5CA5A 4RWXA 1E6VA 4DU8A 4YDXA 3BGUA 1M90T 3HULA 3VAFA 2I5JB 3E8OA 4TYBA 4NE9C 3C6UA 1KQFB 4DN0A 5KG2A 2XHCA 1U1QA 4K0KF 2XY6A 4XIUA 5DS7A 3FSYA 2M70A 3MM6B 3WX4A 1RT5B 4DX5A 4ZS6A 1UWBA 4EBDA 4ZJOA 2EBEA 1JJCB 3ZZZA 3I96A 1KR4A 2DH9A 4I2QA 5H9FJ 5C25A 5C7PA 1SL2A 4F02A 2ZBQA 2HHSA 3EMTA 2CJ9A 2LYVA 3MECA 2VA2A 3RR7A 4FF2A 4ILLA 4PPDA 3PACA 2YKOA 3GJRB 5KFLA 1S1VA 1S97A 1NU4A 3GMGA 2ATCB 2W2MP 3AD8C 4EZ6A 2YQ1A 3K0JA 3OBIA 5HBMB 1I94J 1NM2A 1O6XA 3BYPA 2W9BA 2E5LF 1RAIB 1CS4B 3I87A 3C46A 4ECZA 1RT1B 1VRUB 1JLAB 4DUYF 3DLKB 2MZTA 4C0BA 4U8YA 3VAMA 1RT5A 4F4AA 4O44B 5FDLB 1S9GA 3AJ1A 3LQVA 4X4TA 1JNZB 5AXKA 3T41A 3GFXA 4JI5F 1MWYA 3OSNA 3FK4A 3QIPB 4M5LA 2R7UA 1GFWB 4ZPTR 2F1FA 3ZZUA 5BYSA 4U6PA 3CC2S 2XLKA 2K1RB 3M32A 4KFBA 4USJC 3UI3A 3EE3A 3BSCA 2VIHA 5J2NA 4URSA 2DNHA 2W4DA 5HL7Q 1H2TZ 4PCQA 4RW6A 1G3OA 2P8IA 2VC1A 2JFKA 2XWYA 5B0EA 2V34A 3MCNA 2HVIA 2W9BB 5L8RC 3A8KA 3FMWA 3HJVA 3FBCA 2GC8A 1RHQB 1CQMA 3A3OB 1D8YA 2J6UA 3HPOA 2PE8A 5DGAA 4ED4A 1IR1A 2WK4A 4JI2F 2VG5A 2YKQA 3D1QA 3CJTA 3PRDA 2B4PA 2L9NA 1FFWB 3DNCA 4NLTA 1FE0A 2XSJA 3HKZD 3U1MA 2VDIA 5LL6d 4RUHA 3LWLA 1AUDA 1HWUA 3ITHB 4ZP9A 4GRSA 2MZJA 1TUGB 1HL6A 2X3DA 3NP5A 3V2UC 4OI0A 3CJQA 4JB8B 2OPRB 2QZ8A 4NZ7A 2B56A 2OI2A 3M2UB 4QIFA 2VASA 1R8AA 2JDJA 1E6YB 4NEYA 4B3SF 1ZH5A 2J0SD 1M1KT 4IQXA 4IOAQ 1NK0A 1M5PC 2KFZA 3D6FB 4DR5F 4DR1J 3FKBA 4ICLB 3LUYA 2ZM6J 4BCAA 3PHEA 3KLGA 2RKIB 2YH0A 1RSCA 3KMSA 1XNQJ 4UZCA 2A18A 5B0BA 1IBKJ 2K3IA 3KLVA 3T1HJ 2LDIA 4LIRA 1MN7A 3DRYA 3FEZA 2HRYA 5JMNA 1NRKA 1NB7A 5AE1A 3L7OA 1CJVB 3QSIA 4DI6A 4RNMA 2DRBA 1S76D 2R8KA 1AW0A 2F5GA 4OYWA 5CYMB 5D15A 1K44A 2HHTA 2MZ1A 1QM9A 1DURA 1T95A 1MMLA 1IKWB 2DNOA 3CJ2A 3NLCA 2BE2A 1OS5A 4KIAA 2C3MA 2KJWA 4LRFA 1Y9OA 4X4PA 1GMWD 3FZ2A 1D9DA 2DB1A 4B9MA 1Z4UA 1HNXJ 4OJ3A 1ZM4A 2MKIA 3NBPB 3ISND 2XMTA 3EX7B 2OH2A 1L3SA 4HR2A 2CJQA 4J9VA 4PG5A 1B70B 2NXNA 2AGPA 3NGRA 2ZZNA 1CJVA 1KD1T 1RUSA 1VRQC 4Y2AA 3DRRB 2DHHA 1SC6A 1FJCA 2G9OA 4B3OA 4ZVPB 2M3DA 3IG1A 3AQOA 3JQKA 3EVWA 4PABA 4OZ2A 1RTHA 3OXGA 4ETZA 1MN9A 4RNNA 2LQ9A 3J81Y 1BE4A 4IDKB 5KFUA 5EDWA 2HBQB 4YN3B 4QU7A 5E3PA 3QYYA 2ZUGA 3KDNA 3QLHA 4DV3J 3H4BA 4UY8T 3KYLA 3WC2A 1FTRA 4PR6A 3SEOA 1W25A 3IWNC 3R6GB 5LXYA 1Q0NA 2QO3A 3L09A 1V3SA 3HF5A 2UUBF 3C6TB 2CG4A 4A46A 2R7QA 1Q8IA 3MR2A 3MZIA 2UP1A 1UWAA 2IAJB 3NAIA 5KFKA 1SJFA 2UU9J 3PRVA 3G96A 4C8ZA 1QVFR 2N82B 4USUA 5LXRA 1XERA 2D74B 5IT0A 4ED0A 1P9YA 3GJTB 4NRUA 4PXEA 4X84A 3CCRS 3M6UA 3CD6S 2EBGA 2I5JA 2B4OA 3MAAB 1JLGB 3W8PA 1OPIA 5I3PA 5A6WA 3GILA 4IFYB 1VYAA 2ACYA 4Y3CA 1FERA 1V6HA 4N77A 4LRBA 2JOQA 3IRXB 3AXKA 4UF4A 2OGUA 4Y2KA 3BDPA 1KEKA 4WZMA 2MGZB 1BD6A 5KFCA 4A48A 2IAJA 3DMJA 3DOKB 2HVDA 2MYFA 5J1EA 1J27A 4ZJLA 1FDNA 2WONB 4C8NA 1R8CA 3EXCX 2IFXA 1F0XA 1IM4A 1NDCA 1RAOA 3M9NB 4MAKA 4A8MP 4N8OA 1TVRB 4MYUA 5F0UA 3W8GA 5I3UB 3NMRA 3R2DJ 2VBWA 1F5BA 1VK3A 2DHGA 4HHJA 1RAEB 3HD1A 1MROA 2NLWA 1XR6A 1Q53A 3C16B 3X1LB 5A0YA 1S0NA 4I0WA 2XYHB 5K8PA 3JQMA 1RWOB 2DNMA 1NHKL 1UEKA 2PSZA 5CZXA 2UVUA 4ZLLA 3JSMB 4JI5J 4OL8A 3PG9A 1U0HB 2HNYB 3D2WA 4UTGA 5DG8A 2QLBB 2KG1A 2PFDA 4OZLA 3RRHA 2D9PA 1XMQJ 3CULA 2OSRA 2XZDB 3RB0A 3B8HA 4KHPF 1WORA 1KQKA 3LF0A 1CJKB 2HBZB 4DJBA 2BRLA 3H2LA 1S1UA 2ZBPA 4H4KA 2DR9A 2DITA 1F9EB 3JQJA 1KDNA 1VS3A 5E7OB 3W3SA 3VAJA 3MD3A 2ZHAA 1IXKA 1X4BA 5HMYA 2CQHA 2AX1A 1HWKA 1JXLA 4DG1A 2R8JA 5IM0A 1VC6A 4YMEA 3BGRB 1CVJA 3LP2B 1KP6A 3HT3A 4F4XA 4DV4J 4PUOA 4OHXA 1RT4B 1S1TB 4ZP8A 3OUYB 1U49A 4QWEA 2LEBA 2LKZA 2BRKA 3ETOA 2DGVA 2CVIA 2J5AA 3EGWB 3KUHA 4X66J 2AT1B 2DY9A 1NSQA 2CPYA 2COLA 1GMWA 1SH3A 2AJ0A 5C42A 4FPIA 1NXIA 1FDDA 3CCSS 2QTWA 5C24B 1T05A 2FJXA 4M1KA 3QRRA 4MK8A 3HX9A 3A3PB 1D0EA 3CIZA 1FDAA 1LW2B 1HKAA 2B8PA 2BJDA 4DR1F 3UCUP 3EICA 2DGUA 2H4YB 1YDLA 2DO4A 1SJQA 3IR6B 4MKVA 5K8MA 4RLEA 3VAIA 5D8HB 1NLKL 2HQFA 2OFHX 3QQCD 4O23A 5D0EA 3HFVA 3IAS9 4KR0B 1FWKA 3SSRA 3KXDA 1N6QA 1NZAA 2MJNA 4RU2A 1FJGF 1FA0A 4A8OA 1CJTA 3HFKA 3MM9A 5DLGA 1HA1A 2U1AA 2Z2LA 4J9RA 3IR7B 2JZ5A 2R2UA 4DSFA 4AXIA 2Q3PA 1FRIA 1S1WB 2B43A 2I9SA 5L1LA 3R1HA 4IFVB 3LP0B 1RI7A 1TZ0A 2HS0A 4LVOP 3W9HA 4WFAQ 3HJFA 3NAHA 3DRSB 2HVHA 5ETOA 1D09B 2L48A 2KO1A 1UFKA 5CQGA 2XMUA 3L7UA 4TN2A 5J2QA 1PCAA 4C11B 2W4PA 1U09A 4A8XA 3JS9A 2KXHA 2VFVA 4XDDA 3G6ES 4PQUB 4WF9Q 1HARA 3WX8A 4TLRA 4W90B 1IBKF 4NCAA 2HPUA 1UCNA 2KN4A 4J9OA 1VJQA 1O8BA 3GFZA 1VQ4S 3W2WB 1TMJA 1FI4A 3D6HB 2CPZA 3OLAA 3KDOA 3LP1B 4B3SJ 1OJ4A 2RVJA 1Y3JA 3BKFA 2WSFC 4I6WA 4LFCF 2PFFB 3P5BP 2HS4A 2R7VA 4KQZA 1JLGA 2XO7A 4B3RF 1B3TA 1Y4ZB 2CFXA 2BZ2A 2XGQA 1REVA 1K47A 1IN0A 2OAUA 1UETA 3CT9A 4QBUA 1PAUB 2UUCF 4B17A 2EKNA 4GKKF 1OSDA 1OY6A 3NBPA 5L1JA 2HVEA 5H9EJ 1WG4A 4WYLA 1LQ9A 2DTJA 2G0CA 2JRSA 4XAKA 3TUPA 2HHXA 3RBDA 3M30A 2CKWA 3G4SS 4DOZA 3N6MA 2KM8B 3ZXWA 1SUQA 1RCXB 1TL3B 2EVZA 2GHWA 2MLYA 3PRBA 4JI6F 2DNPA 2VBYA 4ANDA 3EPIA 4DF8A 4NRTA 4YR3A 4H54A 2W7PA 1RYSA 3G6VA 3P3DA 1NUEA 3MDFA 1D9AA 2DO0A 4PAAA 3PZPA 2HRTA 2YNGA 3CCZA 4RX6A 5KFDA 5CD4H 1GX6A 2VQEJ 1T7PA 2FZGB 3DI6B 5HATA 5L39A 3JAMY 1KVIA 1RJJA 3I0RB 1F9HA 4B9LA 4ZVUB 4DFPA 1QUVA 2Z30B 2BJ8A 2E5GA 3NGSA 4EMDA 3AOBA 2ZJPQ 2QA2A 4HACA 3WZ0A 1ZA2B 3ZZ0A 1T9VA 4WP9A 4X62F 3MFIA 3V6DA 4ZPCA 3V4MA 2YKMA 5KFPA 3POTA 1UA0A 4ZOSA 2V63A 3IR5B 1HBMA 2KH9A 3ONQA 5F8JA 5E41A 2U2FA 3I82A 2FY1A 4HT5A 1IBCB 5C2CA 5IWAF 1IWGA 5IT9Y 3G71S 1DLOB 2ALZA 2ADCA 5IM0B 2EC2A 2R8IA 1JX4A 2HGNA 2YNHB 3PHTA 2VJUA 2KZZA 1RXOB 3GLJA 3TQEA 5M2UA 1LWCA 2UUBJ 3PY8A 2MZRA 1RE1B 2KT2A 3EWGA 2HWTA 2KZMA 4DR7J 2OFGX 1HWLA 3VVUA 4YR0A 5HP1A 1BUXA 2WBMA 3LGHA 3R7NB 4IOCQ 2D69A 2PC6A 3CE8A 3PIPQ 2GO9A 2A6OA 3GZ7A 1ZPVA 5C42B 4NLRA 4RNHA 1JJ4A 1YRXA 1EHWA 2ZOMA 1WSRA 2HHVA 4IUFA 5IV4A 1TKXB 3KLEB 2M2BA 2RF2B 2XM3A 4F36A 2CWKA 4LJMA 1S0VA 2YNHA 2X7IA 2OTLS 4B9VA 2DGQA 1RBLA 2AEMA 3VCDA 3H40A 1CC7A 1WC1A 4WU2A 1WHXA 2ZDOA 2CJYB 4M5IA 3BYRA 1J5OA 1BC6A 3BGRA 1AT1B 3AA9A 1AZSB 3UE2A 4R5PA 3DFEA 2MQLA 1S9FA 1FXLA 2IDEA 4OYOA 1NK4A 1VQKS 2FVCA 4R25A 4L3NA 4OMFG 4NCBA 2UUWA 4EO8A 2NZ4A 1X5TA 3OUYA 2HHUA 1N32J 4C8OA 1BQMA 2HS3A 5U47A 3US5A 1JMTA 3BGFA 3DRSA 4DR2F 4C2MA 2LLZA 3MMCB 1WF1A 1JB0C 2AEJA 5DDOC 2N4DA 3KLHA 1U4BA 4CTAB 2ERRA 2W25A 4DV6J 3ICLA 3UQSA 4H4OA 1FK9B 1HQUA 3M8SA 4DR4J 2VA3A 2IC3B 2ZZMA 1VHFA 3H25A 2UV8A 4ECWA 4I4BA 2HHHJ 4NLDA 5IT4A 2CPDA 2NPFA 3EZ5A 1TKDA 2RUGA 2XYGB 4LUBA 2ZD1B 1WEXA 2ZWOA 3UFCX 3QGGA 1R0BG 1WACA 4RW9B 5KT4A 2BXJA 3UD4P 4UOHA 2VONA 4NLQA 1IKVB 1U8WA 5DG9A 2GAGC 1SIWB 2LQ5A 3OR2A 4OI4A 3Q83A 1FX2A 5SUHA 1T02A 3Q8QB 1HNZJ 1XNQF 3GJSB 1B99A 3H5XA 2FVSA 2FJEB 4FYYB 4CLPA 4GMKA 4OZ1A 4OHZA 2NYIA 4DUTA 4UUXA 1VQ7S 1VBYA 3MURP 3W5ZA 4D3HA 4HT7A 1TL3A 5FD1A 3BQ1A 3RB6A 3CDBA 1JLQB 3FUYA 3C15A 3W66A 3BBBA 2UV8G 2BE9B 2KTQA 4BS2A 4DN9A 3OR2B 4EWTA 2IHR1 3IAM9 5L9XA 2UUAJ 4ENOA 4JYAF 1Q86T 1L3TA 2V4RA 1X4HA 1VRUA 4G3IA 2WW8A 1SKRA 1BXNA 1A6LA 3UDVA 2JL9A 2HFOA 3CJRA 5KG0A 4Q8EA 4C8MA 5EHHA 3JTOA 5D6GA 2V8GA 2E66A 2GQ2A 2MB0B 3AQPA 3T1YJ 1SV5A 1TL7B 2XYPB 1JLEB 3CO0P 5KFFA 2VDHA 2ZEJA 4WE1B 4DSLA 1FVSA 1CJUA 3VTIA 1HNIB 1MW7A 2HFNA 4ZHRB 3CCJS 1NKBA 4B3RJ 5F41A 3SCLE 3ZFVA 4C3MA 1M5VC 3A4TA 4W4MA 3EYZA 4NL5A 4BC7A 1QLNA 2CG8A 3SFGA 1FFSB 1UFLA 2BA9A 4JI4F 2WVDA 1LWEB 1RAAB 2H65B 1PILA 2MKSA 2LEPA 4G1QB 4DR5J 1VDHA 2BM1A 2FJWA 3I0RA 4WZQA 1QE1A 1HD0A 1PAEX 1NBEB 2IM0A 3HHLA 2D3ZA 3UDEA 3K7RA 2GMLA 5HQMA 3KJVA 4H4KC 4CT9A 1B4SA 2EFQA 2J7UA 1WKLA 2XLIA 4FBUA 2MQNA 4PXDA 5G4DA 3M7VA 2I2YA 2FHOB 3RR8A 4X64F 3H20A 2E7VA 1ITPA 1S48A 3M2UA 3TUJC 4ECVA 3ETMA 2GNKA 4BWJA 2XHWA 3TP2A 3OQ2A 2Y9HA 3CGIA 1RLDA 1GTHA 1JNRB 2HNDB 3MM7A 3GP9A 1OQ3A 4TYAA 1SBRA 4AUKA 5J2QB 4NLYA 5HMWA 5HJYA 2CQGA 4LR8A 4MMOA 1LWCB 1QAYA 5MLCV 4K8RA 3WIVA 3Q8PB 5DG7A 2LMIA 3E01B 3W64A 3H90A 4OFZA 4WKRA 2P5VA 2QN6B 3CJKA 2O5DA 1GMVA 3N5FA 4FS2A 2OPPA 1QAIA 2Q66A 4PRFA 5BR8J 2CQPA 1VQ9S 1U1RA 2CZ9A 3JYTB 2VQFF 2OD4A 4CM2A 4EBEA 2DIUA 1E6VB 1PC5A 3LOUA 4GVBA 2F8HA 4O4GA 3OHBA 4DSIA 3GIIA 3T9ZA 4H4OB 1YBUA 3AB4B 3KG1A 3NRBA 4FP9A 1FESA 2MQQA 4L72B 3WDOA 1M5OC 3HSJA 1UEUA 2IYIA 1RDRA 5A2QY 2RQ4A 3EDQB 3PEJA 3UPFA 4TU9A 3PKMA 2Y1LB 1KS2A 2GW8A 4DR3F 4OZ3A 2DEIA 3IBWA 2W9CA 4DS5A 2VZ9A 4ES3A 5T14A 4C8KA 1X4FA 1C1BA 1I3OB 4R0EA 4AFFA 2YPYA 1WC6A 4LIWA 4ED1A 2V5HG 4KPYA 2PEBA 3MMJA 3OTEA 1WUUA 1U8SA 3W2VB 1RHUB 1CULA 3JYTA 1UVNA 2VOPA 5KG6A 1VQSA 2QMUB 2CADA 5K20B 1BHNA 4CDIA 2QE5A 1BQMB 1GT8A 1U6FA 2KHCA 1S4EA 4K4VA 2QMXA 3MMAB 3QWUA 2JEFA 4CH1A 1NNDA 5F9LA 5ETKA 2XNQA 4DV6F 3MEDB 1FNMA 5ETSA 3NCPA 5IXUA 2IMWP 4PPZA 3PNIA 1NO8A 2MSSA 4FYVB 4G65A 4YDDB 2WSCC 2JHEA 4S0MA 4WFBQ 4N41A 2RUSA 5GMEA 2DKOB 3VV2B 2HMIA 4DSEA 2JWNA 4ED7A 2XI3A 4PWUA 4FPRA 3I4PA 1FJGJ 4J9MA 1T8EA 2E9ZA 1FRKA 2N3OA 3KHLA 2HZAA 2OJ3A 3G8TA 2I38A 1C0UB 4DQIA 4F4YA 2I0XA 4C8LA 1WJ9A 1S57A 2AZ1A 3VAKA 2DEJA 1JJHA 3LAMA 1WG5A 1R27B 1SV5B 2HWHA 4QCLA 3MD1A 5DM6Q 4USIA 4WU3A 1RT6B 1ZZNA 1M5HA 2M8HA 3NOCA 3HHDA 2Z58B 4YY3F 3GTYX 2ZC4A 2RDIA 2UXDJ 2PMHA 1C0TA 3IMQJ 3SMZA 4JP8A 3ZTQA 4USMA 1VQ5S 2XULA 3NEKA 3BN4A 2VICA 4DQQA 2FGCA 2H5IB 4JV1A 1TP7A 1VQYA 1D8ZA 4ECRA 3B4DA 1PO6A 1AB8A 1UKUA 4UY85 3I4HX 3GSDA 3GYNA 4MKAA 4E0DA 4QU6A 1BQNA 1TL1B 2ZE2B 3CJ3A 3BBCA 4G1PA 3M9OB 1HNZF 4OQJA 1VBZA 1EETB 4RW4A 1QJHA 4QOTA 5A0YB 1N5VA 2IMOA 2AV5A 1RHRB 2YQ3A 3AJ2A 4N5SA 2MKJA 2AJ2A 2XTJP 5HVFA 1UVKA 2YWWA 1HW9A 2AJQA 2PEHA 3KK2B 4RKUC 1UJ6A 3O8WA 3PR5B 3KK3A 5EWGA 3T1AA 4A8KA 2JLFA 1B0PA 2XZTB 4EO6A 4ZHRA 3CCES 3OD2A 3MR5A 3GR0A 2XWXA 2F9DA 3RJMB 2NUHA 4Z7CA 3J81U 3PX0A 4UT4A 2J0QD 2QL5B 3NL0A 1SL0A 1RTIA 2Y0BB 2XMJA 2OPSA 3F56A 4M8LA 4IO9Q 2RS2A 3AY0A 2VKZG 3W7BA 4Z2XA 3W63A 2H1YA 3M8PA 4USVA 3W65A 5HSPA 2EWHA 3BO2A 5GAHI 4KJIA 1ZS6A 1H3DA 3QFHA 1IJFB 1YG0A 3AH6A 3GIMA 5CYQB 2RS8A 1H72C 2K7KA 1QSLA 4LMZA 2F9JA 3QATA 2V8DA 3QJPA 4QIGA 1IUJA 2ZH9A 3OHAA 1RWPB 2DNGA 2VG7B 3GIRA 5LSOA 4B3TJ 2VOOA 2ROPA 2HVZA 4L3KA 1HBUB 1H73A 2YQ0A 3AHPA 4UOFA 4WTYA 4AYBD 3RB3A 2B9EA 4NASA 1IR0A 4OI6A 5FIIA 4OYIA 3VALA 4NWBA 4DMZA 4CLKA 5DLFA 3W60A 1NZ8A 1OY9A 1RWUA 3PTWA 3Q2SC 4KBIA 1IBLJ 2F4VJ 3K59A 2A10A 3AJDA 3W2VA 2FVRA 3QZ7A 2B0GA 3UR3C 3X3UA 3L9ZA 2DIVA 3JSYA 4ZJQA 3RBEA 1S6QB 4X4UA 1KQSR 4DFMA 1FRMA 2FYXA 3PR4A 4KFBB 1J5EF 1O5JA 4BLGA 2DNKA 1NHVA 1NDPA 4JV5F 5D0HA 3D3CJ 4IFVA 3HZEA 4P73A 2DNQA 1T03B 4ZVRB 2BKNA 4LFBF 2FZKB 2UVRA 2HFZA 2E1PA 4KGVB 3RU0A 3ZC4A 1T9WA 4AXJA 1ZOTA 3ZNJ1 1VC0A 2RDDA 2FGOA 2MPUA 3CDWA 3TARA 3DI6A 2B9YA 4YB1P 2RHSB 1D1UA 1WWHA 2VG6B 2HZCA 3PV8A 1IWAA 2ZH4A 2HHHF 2QEXS 3OFGA 2HMIB 1MNEA 3B78A 4Y2CA 4P2SA 3PW2A 4N47A 1HYSB 1F1BB 1YSJA 2BE7D 3ITHA 1WDTA 2OEMA 3P5TL 4U95A 4ZLNA 1CULB 2M9KA 2OPPB 4L6V3 5AXMA 4NXNF 3MMBB 4GKJF 2DHAA 1DRZA 4J9KA 3GFHA 3CMQA 2LU1A 4ZCIA 1TVRA 5BR8F 5I3UA 2QLWA 4M5KA 1UFWA 2PT0A 2WVEA 4OYZA 4F7VA 2C22A 3EUNA 3MUTP 2J6TA 2FJDB 1BY9A 5KOXA 4K4SA 2JEIA 1N5SA 2J76E 3OR1B 4QW9A 4UUWA 3I55S 4JUZA 1N4LA 2HIQA 4KHRA 3SSQA 5JVHQ 4DV1F 1ELOA 4PG4A 1R8BA 3O2IA 3TX8A 5F3ZA 4DV2F 3P6YC 1NSPA 1JQGA 4CP5A 1ULRA 2FDNA 3RBXA 1NK5A 5KFAA 1UL3A 4QIVA 2QIFA 1RHJB 3H8YA 2IJFA 2V2VA 3W5XA 1N5QA 4FVCA 2IBOA 2W4CA 4PEOA 5IV3A 4J7CA 4DPYA 2DRDA 2Y0SD 2H48B 3GIJA 2ZJRQ 3TVKA 2B9XA 2J0XA 1IM6A 3HFZB 2LDYA 1GTEA 1VJWA 4QR0A 3SDEA 1G2EA 4ZKAA 3LPYA 4DX8H 2ZH5A 4DV7F 4IR9A 4RR5A 1X5SA 1GEHA 1PYTA 1B64A 3DM2B 4KY3A 1GH8A 5HAOA 1X9MA 1APSA 3D54A 2YBVA 1HQEB 5KFHA 5D78A 1RT6A 4DFKA 4DBQA 2C3UA 2VV5A 1OYDA 4NI2B 5DDRC 2YWFA 2PMWA 1PKUA 1FJEB 1S1VB 4ZLPA 5KFSA 1WI8A 1T9TA 2ZUAA 4OLOA 2CQ1A 4FF4A 3BGLA 2IJRA 5CYJA 5HANA 4ED8A 1KFDA 3H5SA 4M5NA 3SCIE 3UWTA 2A2DA 4CLUA 2EFOA 2ATLA 1LW2A 2GIQA 2NS1B 2BANB 4DL7A 2YH1A 2B9WA 3OXLA 5D4OA 2B5JB 2PA3A 1TK8A 1XWLA 5CYQA 4F0MA 3DXSX 4ZIVA 1AXQA 2XLJA 3C66A 1HNVA 1SJ1A 5EGYA 4NLUA 2UUTA 4OYXA 3G8SA 3Q23A 3CD0A 3C6TA 4BHQA 1VQ8S 4CM0A 4YR2A 1RAJA 1TKZA 2NSBA 3I6PA 4CYUB 1PYSB 2QFIA 2ZH8A 4HDHA 4CQ1A 3DN9A 3CMAS 1Y3KA 4MIWA 5C5JA 4WIIA 2ALYB 3K2YA 2K06A 4PXBA 1W2BR 3CVKA 5EX0A 4IRKA 1Q5YA 3MR6A 1MU2A 4DSJA 2KRRA 3SBMA 5DO2A 4ZN3A 1CLFA 3MPDA 1RKJA 4KPCA 1X9WA 1KC8T 3CDUA 3PW7A 1VQPS 3ISNC 1KOHA 1LWFB 2WOMB 1S6QA 1TAUA 4I6AA 1L5UA 2K3KA 1ZPWX 2WHOA 4KO0A 4DV4F 1P6TA 4F25A 4GC6A 1WEYA 3G82A 1Q1KA 3VHQA 2DR5A 2QMWA 2MGZA 4JI1F 2CPXA 4Q43A 4Y65A 4E8UA 5J1PA 3EJMA 3M2VA 3JSBA 2K1RA 3M32B 3TO8A 4URGA 1E6YA 2R2SA 3PX4A 5J2NB 4C8YA 1Y5LB 4LFBJ 1FO1A 1B0TA 4YB5A 2HQIA 1RWNB 3K8VA 3CPWR 1FWLA 4H4MA 2HBYB 2UZAA 4I2PB 4LF4F 1AA1B 1RTIB 1T9UA 1ACMB 3FEYB 1LWFA 1FXDA 1YGYA 3A3NB 2ZNYA 1NCLA 5KFIA 1ZTWA 1C2PA 3QSYB 2JSXA 2CRLA 2EG2A 4WFXA 5ITHA 4YY3J 5GAHU 2WSEC 1UTAA 3UVJA 5CYMA 2XNRA 3PKYA 1JLEA 1N52B 3V5RA 3AD7C 1A9NB 2DK2A 3UN3A 1HFEL 2HK2A 2Z8QA 1CJUB 1X31C 4TLQA 4WIQA 1NKEA 5HMZA 3R6LB 2N7CA 1CJTB 2E1RA 2E5HA 2HQ3A 4I2PA 4QW8A 2R9LA 5IT9U 1BQNB 1TL1A 5KOWA 5H1SV 4XPEA 1NJXA 1EETA 4FVMA 4RW4B 5FJ4A 1RZMA 4ICLA 4F04B 2OUGA 4IRCA 1X4CA 1RHKB 1N36J 1B0VA 2HFUA 1WKKA 3HHLB 4GKKJ 2FD2A 5HI7A 1FRXA 2YNIA 3HVRA 5K9FA 5ETPA 2GIRA 3GCXP 1ZAVA 3TZZA 3CJSA 3BR9A 3S01A 2M52A 2PA8D 1NKCA 4RUAA 3TQ1A 1UW9A 2W8KA 2BOAA 1N5TA 3P45B 2OPSB 2YWHA 1NAQA 4HKQA 2HFSA 2R7SA 2YKPA 3NG8A 1TFWA 2VH7A 4QZVB 4XK8C 4UZBA 5ETTA 1T94A 5F8LA 1X4DA 2O3DA 5F8IA 5C2GA 1TAQA 5DM7Q 2DHSA 4YB6A 2HNZB 3GFYA 4WK1A 2NZCA 2WVBA 1W2IA 4F0HA 1DBDA 4EYHB 3PYFA 1EQMA 4ZCLA 4LF9F 4OZ5A 1C1CA 3VGSA 1SJ3P 2G0JA 2QL9B 5HQ8A 2GJFA 3TEHB 2X1AA 1RQ0A 5B0FA 4DS4A 2HHWA 1K0TA 3T9NA 2XMAA 3OTCA 2RF2A 2XCPA 4LF7J 3HVWA 4OLPA 2OEJA 1TV6A 1VI7A 3D4JA 3T5LA 2E9TA 4JI3J 3PXGa 3BO4A 3PCOB 1RT2B 5T41A 5M2RA 2HQCA 5JJBA 4K0KJ 1Q82T 3CO9A 4OJHA 3DLEA 1LK5A 3GIKA 5D4LA 4MH8A 4PQUA 2BJ3A 1F2HA 3G6YA 3D3BJ 3PX6A 1YK9A 3CNQP 4J9LA 5JVGQ 1B7YB 4LR7A 1PSDA 2FLPA 4PYAA 3MPYA 1C1BB 1JLBA 1IR2A 5BXIA 1U1MA 1YJUA 1XNRJ 4CO4A 2OLWA 1FRLA 2ZH2A 4J9NA 1QTMA 2FHKA 3CB4A 3CEDA 3FCWA 3HZGA 3NS6A 3C6UB 2YX7A 3OLBA 1HNXF 1YZ6A 3CTRA 5AXNA 1KNZA 2IYGA 4RBTA 1F3VA 1LFPA 4DPTA 3BSNA 1NSAA 2GV1A 2FZCB 3M1VB 3S7RA 5KFQA 2E1CA 2FVPA 4NMXA 2R2RA 2UVVA 4X4QA 4LF6J 5EWEA 5A6PA 4OJ1A 2VG6A 4LRDA 3TANA 2IIHA 2E44A 2DR6A 2OMOA 3FNNA 4IFYA 1RWKB 2JX2A 1Q95G 2BJ9A 4YEAA 1NEEA 3T5KA 2QC3A 2VF3A 4K4UA 1U0SA 4ANCA 2W7AA 3I32A 2XGPA 4U7UD 2DGWA 5IOLA 4CLZA 5HP1B 2F3JA 4HHHA 3D0IE 5KT6A 1SIZA 1JLAA 2F4FA 4M5JA 4AQYJ 3V6JA 3PDNA 2V8PA 3NMAA 1VQMS 4U7CA 4FYXB 2HIYA 4RW8B 3EXYA 1IQZA 3IGVA 4PG6A 2DVIA 4OX7A 1VLYA 2AW0A 3UCGA 3DGPA 2ZHBA 1VISA 3LANA 1GXUA 1Q78A 4URQU 3KHHA 2BW7A 1N32F 3DLGB 3LW5C 4K5SA 2AYMA 4Y34A 4CH7A 2AGOA 5B0AA 4ILRA 2BX6A 3NS7B 4PWWA 1N5YA 1TKTB 1DTTB 1S4FA 3DRPA 4O4RA 1N0VC 2VPXB 5ADZA 1IBMJ 3QT8A 5AJ3F 4L76A 2P9GA 3ZZOA 2BR0A 1XN9A 1J2VA 2RMLA 5GMKa 2RQCA 2XS2A 4ZMMA 3BB5A 1N56A 3NNHA 3MEDA 1GNKA 1RAHB 2V50A 4DV2J 5I3QA 4CI0B 1DTQA 2C2MB 3PW0A 1SKUB 1FFGB 2GQCA 3IS9A 5G0RA 8RUCA 3CCUS 4ZVTB 1K0VA 4KGMA 2UXCJ 1UJ4A 3DLGA 4QYZK 1U25A 1Y5IB 2GX8A 2YKNA 3BPSP 4OI2A 7FDRA 3D0HE 3N6NA 2EFPA 4AL6A 1R89A 1YJNS 1HPZB 4J90A 2YNFA 3ILIA 1S1TA 1V5VA 5KFXA 3U27A 3S1TA 4I2QB 3GV8B 5LMUJ 2D9OA 1KHWA 2DNZA 3PW5A 4B3MJ 4FYDA 2Z2MA 3LPEA 1IKVA 4C0HA 2JNJA 1I94F 1UZHA 2JFDA 1FCAA 3G86A 1HR0F 1SQGA 4Y2MA 1SVDA 1DTQB 2BKOA 1KLNA 1S12A 2DBBA 3GV7B 3L7PA 4H4MB 3FQKA 1S1UB 3OL7A 4GC7A 1NPKA 3BH7B 1UAWA 2JEJA 4ECYA 2MZQA 3QFWA 4O3PA 3TZWA 3QWPA 4OHYA 2J9DA 4O44A 1XC9A 3V4IA 2XCAA 2JC1A 1KVKA 2VUGA 3QIPA 1XTZA 2RDJA 4ZVGA 1CPZA 3L95X 1WHWA 2BVZA 3NKYA 4ZP6A 3TW0A 4ED3A 1S1XB 3RGIA 3HI9A 1TTHB 3KMQA 3EDRB 2CQDA 4B3MF 4XTTA 5HMXA 1QTNB 2ZVSA 4L73A 4ZPWR 1UEVA 4KSEB 1U02A 4FNHA 4K2XA 5E3AA 3VAHA 2Y3YA 1EIYB 5RUBA 3OTDA 5E3QA 1DQAA 1ICEB 1T11A 5J2PB 4DV0F 1NDKA 3DOMB 4C7QA 4YHHJ 5DJBA 2R8HA 1UWBB 4KT0C 2VG5B 3T1YF 4U96A 2A1BA 3O3LA 2HEKA 3M6VA 3OTOJ 1IKYB 3KK3B 1VRTB 3OFHA 4IG0B 4AE5A 4OYAA 5C25B 1YWXA 3UCZP 4DL2A 1QSSA 4JI6J 1S6PA 2CQ4A 2Z57B 1VC5A 3Q89A 1S1XA 5A8KA 2ASLA 2V8VA 4Q7AA 3QZ8A 3W2WA 1M5KC 3R5DA 1UVIA 4FNIA 3TZYA 2V69A 4Q5VA 2FC9A 3LP1A 2AHOB 3T5JA 1VQOS 2V0NA 1VLOA 1VGYA 3HHKA 3TVYA 1VQNS 4KGZB 2B8QA 1N48A 3HVTA 2MDAA 1Q8KA 2FLNA 1KKHA 1N54B 5H9FK 4ED2A 1S9GB 3J80U 2XY7A 2DT9A 2LA4A 1WOOA 1M1HA 3A8IA 1JXVA 2NUUG 1FDBA 4PG8A 4F3QA 1HW8A 5GAEI 5KFBA 3K57A 4Q44A 5A8RB 3KTQA 4F8RA 1YRTA 3MMBA 4NMLA 4WBFA 3IBCB 2MHEA 3N28A 3N9UC 3NOGA 4P7VA 2B7CB 4U8VA 5F3TA 4ZK7M 1V5IB 2J7KA 3R97A 4J9PA 4JI7F 1IKWA 3T3FA 3QPIA 1O0PA 4K50A 3BJYA 2Q6CA 2F8MA 3ET6B 2CDRB 3IC1A 3GQCA 4ECSA 3LA0A 5MAOA 9ATCB 4HYKA 3KFWX 4UQTA 2AD9A 2C42A 1DHMA 3UR0A 2X3GA 2EG1A 3MI7X 1BQXA 1KTVA 2I1RA 2YNIB 4I69A 1G4CA 3WBZA 5K14B 5KT5A 4P6QA 3J7ZT 1RKIA 1T3OA 1WDDA 3M2RB 3P96A 4HLBA 4P74A 4ZA1A 3C14A 2GFFA 2GMHA 5HVGA 2OPQB 2AWZA 5E0OA 3QRPA 4DX6A 1F9FA 3HSGA 1RADB 2KXFA 3R7BB 1C4AA 1S9EB 3Q8VA 4Y0FA 1AFJA 5EN1A 3GG0A 3CDAA 3ISZA 1XNRF 2CNOB 2Z56B 2DCLA 4ZLJA 1RACB 2IVMA 4DZ6A 4DR2J 1K9MT 4DWIA 2HFVA 3DLBA 2UXCF 1KWMA 3TJ8A 5K5MA 3L4BC 4KV8A 4CNZA 3RB4A 3R5AA 2RD5C 4KE5A 5KT3A 1MWQA 4F50A 1JKHA 1N33F 1A7GE 1VIOA 1Z1ZA 2A3JA 3Q0AA 3N6LA 1PJ6A 1NH7A 3C19A 2ROEA 1JLFB 4NLXA 4CO3A 2E7WA 2ZDPA 3AFGA 3T6JA 1TUWA 4RUCA 1SJ4P 1R6YA 2WB4A 3SIPB 4BC9A 1FJ7A 2OEKA 3LO3A 1VIXA 4ECTA 1EZZB 4OYBA 2YKMB 4ZITA 1HBMB 4B9SA 2VFUA 3NS5A 4HEA9 2XI2A 2X1GA 2PI4A 2GGPA 3EGNA 3MAHA 4ERDA 2BABA 4LQ9A 1F3FA 3KJFB 3MM5B 3RRKA 1LW0B 3E01A 4ZPVR 1U2RA 4C3KA 4G1IA 4B02A 2C2NA 1YJ9S 2R7OA 2XSJB 2OSQA 2R2TA 3OL8A 4KKOB 7FD1A 2Q1LA 3MXHP 2Z2YB 3CCQS 1NJYA 5LMUF 3QRQA 2P9EA 1BMQB 2W7OA 4K5RA 4FN5A 2LVWA 3RW6A 5KFTA 1UA1A 3AAWB 3TJAA 1FKPB 4WK3A 3TUIC 2KFYA 1RP5A 3IFEA 3B6BA 4RUBA 3OTBA 3E2EA 4DPXA 1VBKA 4IOBA 2E7XA 5LJ5Y 3KLGB 1YRUA 4M63A 4JI2J 4YS2A 1TKXA 3TA0A 3VGVA 1I1GA 1LFWA 1U26A 4RO0A 3JB9k 2M88A 2J9EA 1EKRA 1GK8A 2VFSA 4R0JA 1FKOB 2V2KA 5G0RB 4EUVA 2XMMA 3R5BA 4B3TF 1TQLA 2QYCA 4CLTA 2ZD1A 2MMYA 3CSKA 3VZIA 1L3KA 3LWMA 3UD3P 3ZTSA 4A47A 1IBMF 2E9RX 1MLAA 1S5ZA 3VF0B 5DQIA 4QYZJ 2DRAA 4LSLA 1AUSL 3F0NA 2QA1A 4C9DA 4I1TA 4EK2A 2L9DA 3F41A 5LSRA 3J81j 4DF4A 1TK0A 4MKYA 4NLGA 3KWMA 4ED5A 1EKSA 1YJ7A 2CVEA 3R3TA 1UVJA 1VOMA 2XB2D 5LMNF 1URRA 3DGVA 3FCHA 4P52A 1X9SA 1RTDB 2MY7A 2GMJA 4DPOA 1GAOA 2Q79A 1YJVA 4WWSA 1Y7PA 2HLUA 4FDFA 4LBHA 4CT8A 6FD1A 1IKXB 2GS8A 4KGXB 4P9SA 4WP8A 3UVJB 1WI6A 2UVWA 2FB0A 5IWAJ 2ASDA 1Y00A 4LSLB 3D7SB 3O5TB 4FKYA 5ETQA 1NK7A 4WCEQ 2V6AA 3NXZA 2RKIA 4DL4A 3CJ5A 4KYZA 4NLWA 4KHPJ 3Q86A 4PWDB 5DDQC 1T05B 2N7YA 4TQSA 2KJVA 4O0NA 3Q8SB 4K7QA 1RT1A 1RWMB 3G82B 4NA1A 4I67A 4DU7A 3PYGA 1FD2A 1YKWA 3MPUB 4LSNA 1C0TB 4PZVA 3THPA 2B51A 1X8DA 4IG0A 5DETA 2HGLA 1RISA 2LQBA 3KUGA 3C15B 3M8YA 3HD2A 1X0FA 1ZZFA 1F5AA 2ZNZA 4ETXA 1R0AB 3ZZTA 4DSKA 1RK8A 4FXVA 3BH6B 2ZHOA 3TA2A 1REGX 1KBRA 1ZAWA 1KSPA 1TUVA 2YXLA 1WF0A 1OMSA 4Z7YA 2DH8A 3C8YA 4CH0S 1IBLF 2RILA 2X1BA 3IWXA 1FRJA 5IC6B 1FT8A 4FBTA 4ZPAA 2CWXA 2MKHA 2P9CA 1DJ0A 2AMCB 4L75A 3R5CA 2M4MA 3BREA 4LF1A 1PGZA 4P75A 1B7FA 1OY8A 5HO4A 3ENVA 1WTFA 2ZITA 2GQQA 4ECUA 3TAMB 1Q8LA 4MTPA 1PC4A 5EX3A 5B08A 5C24A 2RSQA 8AT1B 3KOAA 3GSIA 3M6XA 2IM3A 2HQGA 3D28A 3D0GE 3D5MA 5KFYA 1Z2LA 2CZVC 4KV8B 4X4VA 4MFBA 4LF5J 4WFNQ 5KFNA 4WP3A 2PD1A 3CW2C 4J37A 4MIBA 2FJVA 5THWA 2YKAA 2HRUA 3KLIA 4YOEA 3MEEA 2GHPA 5L38A 4RW7A 1FNXH 4B9UA 1DZ5A 2D1CA 3PYDA 1DQ8A 3K5PA 5DZ6A 5GAGI 4DV3F 2WTFA 3A8EA 3CJ0A 1HR0J 3O44A 2DXEA 3TAMA 2CJXB 2ZWPA 3JSRA 1FEHA 4ID5B 2L9WA 3K17A 4KC5A 2VFTA 3OJUA 5J2MA 4ZCMA 1K8AT 4ALZA 3ENAA 4IH7A 4Q2MA 2WAQD 3FBFA 3HVTB 3KUEA 4Y00A 1SL1A 4BDPA 1U1PA 2UXDF 2CAJA 3NNAA 2AYBA 4RBVA 2QGFB 1QY7A 3MM8B 5K8NA 1C1CB 3PO4A 2C3YA 2ZZTA 2GIFA 1FKAF 4HTIA 4NCGA 4O3NA 2HGMA 4MK9A 3BR8A 3HHLD 3AXMA 4MT1A 1H74A 2HHPA 4JI0F 4XO0A 2CPIA 1XIQA 2IVYA 1HBOA 4IO1A 4F26A 1RWWB 3UN2A 2W01A 4USWA 3TX0A 3BPDA 3ZO7A 4CNYA 4F67A 2XC9A 5D4PA 4DQSA 1T03A 2N3LA 2UXBJ 1S59A 3WIUA 2WOMA 2Y8YA 2J6SA 3HKWA 2KYZA 2RT3A 1FWPA 4IDKA 2WB1D 4NA2A 4U9RA 4DEZA 2ABYA 3FSXA 4DZDA 2CJBA 3R1LA 1QSYA 3IGNA 3RRGA 1H2UX 2NSCA 2X1FA 3DU5A 2JEGA 1O51A 2GVDB 2NXUA 4DL3A 1HI0P 2ZVIA 3PYEA 5E3RA 1ZM9A 3D67A 4ECXA 1HBOB 2ZBRA 3JTPA 4M94A 3C14B 2RU3A 1RLCL 4JI7J 2BV3A 2GO8A 2VBXA 3ENQA 1DTTA 2BYCA 3DRPB 1N34J 3SXLA 4ZDNA 2ZE2A 3CCTA 2KG0A 4ILMA 2XMWA 2YPZA 4Q2LA 5E5NA 3M1VA 2CQ0A 4RZRA 3I5CA 2G1DA 2BKPA 3KHGA 3SV4A 1NK9A 5IQ6A 2JLEA 3NGDA 3FBEA 4ZPDA 1Y10A 3VR1A 2VD3A 1UPPA 1WD6A 3PFOA 4G6VB 4NA3A 5CCMA 3IRWP 1RAFB 4LBIA 2XY5A 2WVCA 5E3CA 2L08A 3H0PA 4P10A 5HQLA 4EZ9A 4JV0A 3HSZA 2B4VA 2LU2A 2B4UA 3LGNA 4CYUA 4JI8J 3UD5A 1P27B 2EK6A 4I68A 2R7TA 2EC0A 2F40A 5J1NA 3KK1A 1JLCA 1P1LA 1C4CA 2XMVA 3CWJA 4DUZJ 2PI5A 2O66A 3MGJA 2ZH1A 1X60A 1S0OA 3TOQA 3GV5B 3Q24A 1RTZA 3MWBA 5B0CA 5KT7A 1AYEA 1MWZA 2NYHA 5KG7A 1EB0A 3GB0A 5I4MA 1HQUB 2AEFA 2W2PP 4LVNP 3I5AA 3HM9A 4CO2A 1G1XA 4UOCA 2VG7A 1PJ5A 2GJ2A 2OPRA 3IP0A 5GVQA 2FIUA 3OJSA 5M2PA 4KO0B 1Q8BA 1CQNA 2KYXA 4RBUA 4DHVA 2RE1A 1F6TA 3E3XA 4OX6A 3TAPA 1XMOJ 4NZ6A 2BQ3A 4ELTA 3H2UB 5CAAA 1U0HA 3LP0A 3I5BA 5IS2A 4F0KA 3D66A 2R7WA 4LF8J 2BUNA 1JLCB 3IM9A 2PN6A 1HWJA 4X2BA 1N34F 1WTBA 1UZDA 2HQDA 3DC2A 3M4XA 4MFBB 4C6AA 5BJRA 2ADBA 3ILJA 2UUCJ 1URNA 2P2CB 4IKAA 4USTA 5CD4A 2KM8C 4FF3A 3M8QA 3H7HB 4HI1A 4DX7A 1MSWD 3DOMA 1RBAA 3T5HA 1TK5A 2FPHX 4ZIWA 5KFMA 5AXLA 2Q43A 2Z2ZA 1HHQA 4HACB 5EUHA 3UDLA 3UW1A 3V6DB 4A8SA 1TV6B 3QGIA 2H5JB 3DYAA 1R8PA 2N4CA 2R3VA 5J2MB 2AJFE 1RT2A 1TU0B 5DQGA 3PW4A 4Q0BB 4C48A 4RW6B 4B08A 2DGTA 2EI5A 3D6MB 3Q8YA 3SQGA 3ZZPA 4F3MA 4O3SA 4JYAJ 3HDSA 3VWSA 1LEOA 1OQ6A 2FHMA 3FDSA 3H59A 3M05A 2BJ1A 4ITSA 4LT6A 1T3NA 2QG9B 3CJKB 4W98A 5K8OA 5A8WA 4P2MA 1X7VA 2A0FB 3M30B 4QJVA 3BSAA 4P2FA 3EZOA 4O3OA 3NCQA 1YQHA 3SYZA 1NK6A 1QAXA 4PYDA 5D77A 2FUG9 2RU9A 1WELA 1S6OA 2R8GA 4I7FB 2VPZB 2IRXA 4N56A 2M7SA 3HP6A 1KHVA 1X4GA 5L46A 5F9NA 2AJ4A 1HBUA 2EEYA 2LEAA 3J7YI 3KLFA 2M0GB 2HYIB 2EFNA 2MKKA 3MF5A 3TEGA 4Y28C 1I5OB 2AU0A 3FQLA 2K8GA 2G0IA 2IA0A 1WC0A 1R7IA 1PJ7A 1WHYA 2RB7A 2YVSA 5F8GA 4DLEA 3T1HF 1SQEA 2AJ1A 2IA6A 3MM8A 1XMBA 4LF9J 5KFOA 4Z37A 3DRRA 1Q4RA 4DQRA 3QO9B 2HK3A 5A8KB 5K14A 4HH1A 5SZTA 3H5YA 4O3QA 4USHA 4CLFA 3G6XA 4EEYA 4IR1A 4F2RA 2RAQA 2W24A 3VVTA 2W2OP 2HAFA 2GVZB 4LF8F 3CC7S 2VC0A 3OVBA 2XQCA 3MOZA 4CO1A 1OWXA 4DV7J 2DGOA 4QYRA 1NSKL 3SZ2A 2F4VF 2DXDA 2AYGA 3OR1A 3MM7B 2XS7A 2RJZA 3MUVP 3IRXA 2H4WB 2E29A 1SC1B 2P6SA 3LAKA 4LF6F 3MCOA 4PG7A 5KG3A 4NX9A 2BDPA 1TR0A 3DCAA 1TL4A 3MCMA 3N79A 3THTA 3Q8UA 4K4ZA 1VFJA 5EWFA 4X62J 2CNNB 2SXLA 1RAGB 1S79A 4MK7A 2QT7A 3W5YA 2GVZA 3CF5Q 4ER8A 3RBZA 2V2ZA 4UQGA 1XMOF 1XMQF 4NXMF 5AJ3J 1WSVA 5F0WA 2WBRA 2ZKTA 4YP3A 1PIEA 1AROP 3ET6A 4LRCA 4RWWA 4ES1A 1LWEA 1CS4A 1HNWF 2V8HA 3SSSA 4DCOB 1YLXA 4UOGA 2AQ4A 1F5CA 2ZH7A 3MHYA 5B0DA 4DV0J 1QE1B 2I8EA 3M9MB 2NR0A 3MEGA 2IDLA 3K5LA 2ROGA 2O01C 2YNFB 3FEXB 3KJVB 3CC4S 3C2PA 5KFZA 4U7UK 5HLFA 2D41A 2BM0A 2C3OA 3JXOA 4UW2A 4GKJJ 3MEEB 2Q6BA 3ILLA 3AOAA 3JAMU 3HCXA 1VCTA 2IM1A 2NXEA 2IVFB 3Q22A 2DPJA 1HD1A 4TNOA 5HROA 3OXFA 5KG4A 2C3PA 3OVAA 2Y1IA 3GCWP 3H2VE 1HIYA 2C28A 1GQEA 1KLMB 1UMJA 3BV8A 1Y0HA 4ZN1A 5IFMA 1RYRA 1OO0B 3PJWA 3R8YA 1U2CA 3VQSA 1H2VZ 4KRWA 2DNLA 2LP4A 3UDCA 2QX0A 2G13A 2B5JA 5JXSA 2B7BB 2BBEA 3U1NA 3MEGB 4ATNA 3IA0A 3WC0A 2Y8WA 1RGVA 1TELA 1AFIA 2IPOB 3IO1A 1BWEA 1YVFA 1HNVB 2QL7B 2XZWA 3RYLA 1KOOA 1FKOA 3J7YU 3TZXA 1UP1A 2BMBA 1M0SA 4NYOA 2VU5A 3SCKE 3AA8A 5AE3A 3Q8RB 2UU9F 4Q0BA 5I42B 2PMZD 1ZETA 2LQJA 1LXNA 4N8NA 1TKTA 1RCOB 4E98A 4P72A 1U45A 1XR5A 3CD7A 1Y11A 2VB6A 5J2PA 3QMQA 1VQ6S 2DNNA 5E2QA 4TKTA 2C2OB 5HJXA 4DPUA 4O0IA 2NREA 3MPWA 1GXLA 3A1YG 3HO1A 5HVHA 3I0SA 1LOUA 2WRMA 1WG1A 3I31A 4OYMA 1JLQA 3ZZYA 2CUYA 2CNKB 4PUOB 4NPOA 2W8LA 1N33J 1NDLA 4ZVEA 4ECQA 5DRKA 2NPIA 3TYTA 3OFEA 1UJ5A 4QR1A 1J5OB 3SI8A 2YKNB 3NWRA 2RNEA 1EX8A 2HNYA 1RU2A 3DLHA 4Q8FA 4OI1A 3DRXA 1TKZB 3SFUA 1CEZA 1DARA 3DXBA 4IG3A 4CLSA 5D3GA 1BLUA 3MMCA 5KFGA 4YUDA 1GXTA 3RAMA 2EFGA 3GPAA 3VGUA 4CTAA 2QA4G 2CXEA 3K5OA 3UNYA 5KFWA 1S10A 1FK9A 3OSPA 3T6BA 1OYEA 3DDNA 3P49B 4WJBA 1HNIA 4RNFA 1LKZA 5CABA 3I56S 4NYPA 4LF7F 2QLJB 4ES2A 4FXDA 4LFAJ 4KB7A 5ETVA 2C2RA 2R7RA 1S7IA 2J9CA 4I7FA 3M8RA 4M5DA 2ACMA 3E51A 4OHWA 5AT1B 1N8RT 1V3RA 2WZ1A 2ZFHA 4DL6A 3BGOP 2CPJA 4QWAA 4LFCJ 4LSZB 1ZTTA 1R0AA 2CYYA 5CCLA 4LF5F 1DFDA 2MKYA 3NGUA 2JH3A 1HHTP 5D4NA 4NLVA 4YFUA 2ZM6F 2BQRA 1SH2A 1HLWA 4IQMA 4EI2A 1Q79A 2MY8A 1NB2A 1QUPA 1UPMB 2OMLA 3QO9A 9RUBA 2ZOGA 2MTLA 3BS9A 4Y2IA 3GONA 3DOLA 3ZTRA 4TU8A 1IVZA 2QLXA 2YNGB 3P4UB 5KFRA 5H9EK 3BDEA 1H0HB 5LOQA 1I6JA 4OX9F 4V19X 1T9YA 1RABB 4X4RA 2V4JB 1XQIA 3CCWA 3MMAA 4D3GA 1NPPA 1CSJA 2ZH3A 1FXRA 2H54B 3MR7A 2MQPA 4DUZF 1S77D 1FHTA 1JKHB 2LCWA 2KT3A 5LT5A 3V81B 2H5EA 3LTOA 4DFJA 2RRAA 4EFAC 5HLFB 2HLTA 2DISA 3GR1A 4L74A 2O1PA 2QFJA 3FBBA 3PFEA 3RAXA 2NCKL 1X4AA 2FLOA 3FVYA 3IG1B 2MLXA 1H98A 4HI2A 2M5YA 3U02A 3R27A 1U48A 1T0TV 3W9JA 5B09A 3OFFA 5KFVA 3DMJB 1XJWB 3DOKA 3CMES 4AD6A 1K1SA 3D1HA 3CD5A 2E1AA 2WW4A 4WXOA 5A76A 5KTQA 2C2KB 1SKSA 4DDFA 1SQFA 3O6QA 4O3RA 2DPIA 2MQMA 2QYGA 4EU0A 4J91A 2DJWA 4JBCA 2NXJA 2G2YA 7AT1B 3FGVA 4QWCA 4FZVA 4OV6A 3FSIA 4NLOA 1DAXA 4AQYF 1MROB 3C16A 2XO6A 3HHLC 2CNLB 4GO5X 5LMNJ 2Y1JA 1VRTA 3MAQA 2D7SA 2CPHA 3EM1A 4GO7X 1L3VA 2HNZA 4F4KA 4I64A 1JLBB 4QR2A 4YB7A 4FYWB 1G7CB 3HK2A 4HH0A 5T7LA 2DHXA 3QAEA 5GAGU 4B9TA 4HVZA 4HDGA 4LREA 1HBNA 1PBUA 3NGTA 1XEZA
chains in the Genus database with same CATH topology
2FC8A 2ASYA 2FTRA 3N0VA 3FMBA 3KHRA 4DR4F 2V9KA 4FS1A 3DLJA 1S7HA 2HNDA 4DG1B 2XS5A 4K4XA 3MM6A 4CO5A 3HMJG 4ELVA 1HI8A 2ZJQQ 2HHQA 5FLXY 3KK2A 1VMBA 2CJKA 3N4WA 3KNAA 1YITS 3QGHA 1FRHA 4K59A 2DCUB 4I6YA 5D3GB 2FHJD 2EK1A 1SXLA 4JOUA 1VK8A 5HROB 4OIXA 3KKFA 2QA4S 4K4WA 5GAEU 4B9NA 3ZZRA 4O4GB 2C2DA 1KLMA 1ROFA 3M8PB 3LGMA 2RRBA 2ZOFA 1DLOA 1H7WA 3DDKA 2AP6A 4RW8A 3U1LA 4RNOA 3MUMP 1YJWS 3OVSA 2CJAA 4R5PB 5HN0A 1ZYQA 4NCGB 3PVXA 1NHUA 3G8QA 3LALA 1X4EA 1XBWA 2W9CB 3IWLA 2CIMA 3PEHA 2VPYB 1N6QB 1R3NA 1UW4A 4R8UA 5KFJA 3MM9B 4ZCKA 4DLGA 3PM9A 1RTJB 3AB2B 2Z0GA 5I42A 1S1WA 4ELUA 3NCRA 3CJ4A 2LXUA 2AX0A 4RU9A 3FZBA 4QIWD 2DNRA 2B6AB 3BSOA 2JVRA 2CPEA 5KG5A 2UXBF 2VODA 2J0WA 2E5JA 3V4IB 1YI2S 1OIAA 2KI2A 5BYRA 2ASJA 4ED6A 3VQTA 3L3CA 5L1IA 1JLFA 2ILZA 4R8UB 2KT5A 1M5SA 2GHVC 4YQWA 1RTJA 2IRUA 5HBMA 1NJIT 4FF1A 2XEXA 3DHXA 2HWIA 5IQQA 2QRRA 4EGLA 3QJJA 3MCSA 1S99A 1R8HA 2WONA 2J7WA 2AYEA 2M8DB 1C0UA 1ZM3A 5AE2A 5GADU 4JI3F 2VQEF 3G9CA 1SB6A 4MIAA 3S6EA 3GG1A 2NQPA 2KB2A 2DGSA 1RTDA 2FJAB 4CCHA 2JC0A 1Q7YT 4J9QA 4AL5A 1K73T 1EP4B 1RT7B 2PIIA 3DOLB 3QIDA 4QPTA 4TY8B 3KK1B 2OD6A 4EYIB 1TL5A 1LXJA 5L9NA 2DNYA 1D3WA 2MSTA 4HL9A 4C98A 1X5PA 2GJIA 3CXCR 1WHVA 2APOA 4J9SA 1U24A 2Z4PA 3O1LA 3KLIB 1ZM2A 2LXIA 2WCXA 2KKHA 3H5UA 4KGKA 1Z2ZA 5T7LB 1IKYA 2DH7A 1RT3A 2CZ4A 5A8RA 4CO0A 3LP2A 1HBNB 3T19A 4LSNB 3POTB 2CQBA 3FFIA 2K7JA 1H7XA 1RTHB 2C2EA 3DLLQ 2EFVA 3OL9A 1LV5A 2YY3A 3ULHA 2RQMA 2CQCA 3SDEB 4G1QA 2OIHA 2KU7A 5F8MA 4FXWA 2IRYA 3KG0A 1FEEA 4OV1A 2XSFA 4IYQA 1SI9A 3OL6A 3K5MA 4JV2A 4XPCA 3BEGB 3FRYA 1U47A 2L41A 1L3UA 1N0UA 1P8GA 1OSCA 4U67Q 2BW2A 3DYAB 1YTYA 2O67A 3M2VB 4WE1A 2KFNA 4QIEA 2BE2B 4ZP7A 2XBPA 4M5DB 4JI8F 2Y1RI 2OTJS 1HI1A 5F8HA 1QAJA 1WNEA 1FF2A 2DR8A 4HTJA 5L1KA 3TVZA 4MJKA 3IXQA 2QV6A 2A2CA 3NGKA 5KFEA 1YIJS 2EKYA 5KG1A 4F3OA 4C4WA 4PKDB 1JK9B 2D3OR 2FLLA 3QGPA 1D9FA 3EZUA 4C0OC 1RA6A 2E1MC 2G4BA 3PJXA 4X66F 3TI0A 4I56A 2CDQA 3M2RA 1FNOA 4ZPBA 1WEZA 1U2FA 1VBXA 1FD8A 1KRPA 1N88A 1MMDA 3MPVA 5CHCB 2QSWA 1S6UA 2B6AA 2V4QA 3KLHB 3S8SA 2F7VA 2ZC3A 3PIOQ 1KONA 2RRNA 4ID5A 3VZHA 4K4TA 1DQ9A 2DGXA 1HWIA 1ZBTA 3LH2S 3BQ0A 1KFSA 3EGZA 1KVJA 3TAQA 1SH0A 3NNCA 1NH8A 1YBAA 2JJ4D 5CZVA 4NYZA 4WXWA 4KKOA 5LJ3Y 1NJWA 4OX8A 2CQ3A 3TNVA 1QVGR 4TQRA 2KVIA 2OO4A 3HHNB 3F73A 5CXTA 2CQ2A 1FKPA 4ZVFA 4QPXA 4CIOA 2L3MA 3N5BA 1WF2A 2OPQA 1HMVB 3V6KA 3HVAA 1XK8A 2UUAF 1S0VA 1S9EA 3EPGA 3RAQA 2V94A 2AGQA 2GA7A 4QWDA 4YHHF 4K4YA 4X65F 2HW3A 1K1QA 2JVOA 1RTDB 2IM2A 2MJUA 2OP5A 2GGPB 3H98A 3CUNA 5FDLA 1U1LA 1EP4A 1LW0A 1RT7A 4N76A 4F4ZA 2CPFA 4IH6A 4A8WA 3KNGA 1XR7A 3BM7A 3F44A 1S0MA 2X51A 4NZ0A 1MMNA 3CCVS 3BN7A 3HLUA 2CQIA 1JIHA 2YX4A 4WYWA 1MU2B 1SKWA 1X0PA 3OPKA 1HMVA 5B0GA 2MQOA 3MR3A 2KHDA 3M6WA 4MKBA 3MFHA 3CDEA 2F8EX 3FJ2A 3DU6A 4KHMA 1FVQA 1V9OA 3BF4A 2BJEA 2YWEA 2KXNB 1U1OA 3QJLA 3B4MA 2DD8S 3I0SB 4MYTA 3VAGA 4V19J 4A4JA 4BBYA 2ZH6A 4RW9A 4OZJA 3C3LA 2KDOA 4DL5A 3JTNA 4DL0C 3I9V9 3CCLS 2POKA 2XG8A 3SQGB 4WKYA 4F4WA 1U7LA 4TY8A 3QAUA 4OZ0A 4PWDA 1FE4A 3GE9A 4PXCA 3DLKA 2J9DE 2PGCA 4NLSA 2YWGA 2YX1A 1F2GA 1JXEA 3CIMA 1U1KA 2GCFA 3TRGA 1CC8A 4DV5F 2BANA 4DQPA 3HHEA 1N36F 1Q7LB 3I9ZA 2FJBB 4C11A 1FTCA 1RT4A 4P7TA 4C97A 2MKCA 3K5NA 3Q2TC 5DGBA 2DR7A 3MECB 1P9QC 2LECA 1IQTA 2HG4A 2YWKA 4CZCA 2E5IA 3NWGA 1KN6A 3MTKA 1HPZA 5CH7B 3B82A 3CCMS 4KTQA 4X4OA 4TXSA 1R43A 3PO5A 1YJTA 3U7JA 4Y6IA 6FDRA 1LK7A 1REVB 3THVA 4A8YA 4W92B 3RW7A 4ID8A 4F2SA 1S72S 5KAKA 4IRDA 2QSFA 5LSLA 4DR7F 2LA6A 2IC3A 2YTCA 5DQHA 3BO3A 4Q45A 1N5YB 4B3OB 3RTVA 1VQLS 1IKXA 4IH5A 5BYQA 3V6HA 3FFIB 2MXYA 2B3TB 4OI3A 4NLPA 1Y5NB 2LXFA 1HYSA 4QQBA 2BOPA 5A8WB 1NJZA 2RQKA 3KG4A 4AL7A 4XDCA 5B7WA 2OKQA 1KQGB 4X4NA 3IN5A 4WFZA 1SJRA 3K8WA 4KAIA 4WFYA 1YJRA 2PDAA 2ZBIA 3UNGC 1BGXT 3GYXB 2AF6A 3M8QB 2R7XA 1P1TA 3D1OA 4A8FA 1F60B 2VKRA 4OHVA 4J5OA 4TU7A 2H9ZA 3J80Y 1V3ZA 2FVQA 3MTJA 1SUQB 1RT3B 3BZQA 2P6TA 3K58A 4BWMA 5E33A 3ENWA 2BQUA 2HAIA 1H6KX 1CG2A 2VPWB 4X4SA 3HXMA 5J1EB 2V4JA 1Q16B 3MEKA 3QLHB 3TR5A 5KT2A 3DM2A 1ZAXA 5JUMA 3OV7A 4NOHA 1H38A 3MM5A 3BQ2A 3V81A 2R4FA 1TFYA 2IBKA 3IS9B 5DDPC 4A8QA 1UVMA 2MHNA 2J8AA 3J7A1 1UVLA 3JSMA 1HHSA 1OPZA 2PO4A 4TY9A 1S6PB 2RIJA 2EPIA 2W9AA 2D3UA 4OJGA 4LQ3A 1X5OA 2XMKA 1IJEB 1JJ2R 2EW9A 4ZVHA 3TUZC 2KRBA 2K2PA 4RW7B 2VBZA 2VFRA 1RA7A 1GX5A 3FRZA 3KLFB 4M95A 1KTQA 2ZKUA 4C3LA 2BACA 2JLGA 1NK8A 3RZAA 1R31A 2IJNA 1HQEA 2RH3A 5GADI 2VL1A 3J7Z5 2MZSA 2ZBCA 3SCJE 3DLEB 5F8NA 1U1NA 3OTOF 4EBCA 3H4DA 5IZHA 1U6BA 4QWBA 3N01A 1G6BA 3DHWC 4OZNA 4IG3B 2V9WA 2FHJA 1U6ZA 4PQAA 3GWCA 3KLEA 1S49A 2ILYA 3TA1A 5CA5A 4RWXA 1E6VA 4YDXA 3BGUA 1M90T 3VAFA 2I5JB 3E8OA 4TYBA 4DN0A 3C6UA 1KQFB 5KG2A 4K0KF 1U1QA 2XY6A