2YKAA

Rrm domain of mrna export adaptor ref2-i bound to hvs orf57 peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
124
Chain Sequence
MASMTGGQQMGRDPDKWQHDLFDSGCGGGEGVETGAKLLVSNLDFGVSDADIQELFAEFGTLKKAAVDYDRSGRSLGTADVHFERRADALKAMKQYKGVPLDGRPMDIQLVASQIDLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA AND EXPORT FACTOR-BINDING PROTEIN 2
publication title Competitive and Cooperative Interactions Mediate RNA Transfer from Herpesvirus Saimiri Orf57 to the Mammalian Export Adaptor Alyref.
pubmed doi rcsb
source organism Mus musculus
molecule tags Rna binding protein/transcription
total genus 13
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2011-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ykaA00
2D9OA 1XN9A 1KC8T 3RW6A 3LPYA 2OIHA 2ADBA 2MQOA 3D2WA 1U6FA 1DBDA 2MKKA 1YJ9S 2EK1A 2MYFA 2KU7A 2CQHA 5HL7Q 2D3OR 3MOJB 2M9KA 1ZZNA 1SJ4P 1DRZA 2DGQA 4WFNQ 2MSTA 4V19X 2KYXA 3CC4S 2KXFA 2DGTA 1VC0A 1OWXA 2VOPA 5IFMA 4C7QA 2MZSA 2FPHX 4F25A 3SDEA 1IQTA 1UW4A 2RUGA 1FNXH 1R8HA 1VQ5S 1B7FA 2CQ2A 1X4AA 2MZRA 4Y00A 3CMAS 1U1QA 1SXLA 1NJIT 2I38A 2DO0A 2E5GA 1P27B 1ZZFA 1WF2A 2JX2A 2V94A 2N82B 2KG1A 3OW2R 1W2BR 3NNCA 2LYVA 1WG5A 1UFWA 1KOHA 4BS2A 2LEAA 1X4EA 2DHSA 2HGMA 5LXYA 2G0CA 2HGLA 3CPWR 3CCLS 1OPIA 1DHMA 3MURP 2DNOA 3CD6S 3CCSS 1YWXA 1VQ4S 1HD0A 1VQMS 3MXHP 1NO8A 5DDRC 4UQTA 1Q82T 3H2UB 1QVGR 1P1TA 2DGXA 2CQ1A 1WG4A 4QPTA 2N3OA 2M2BA 1X5PA 1G2EA 2JVOA 1Q81T 1H2VZ 2HZCA 3MD1A 3Q2SC 2CPYA 3VAGA 1OO0B 1X4BA 4YUDA 2U2FA 3CCES 2AYMA 1YHQS 2VOOA 1WHXA 2M7SA 3DLLQ 1O0PA 2MPUA 3TO8A 3K0JA 1VBZA 3MDFA 1YJWS 2G1DA 2MZJA 1VC5A 5DM7Q 2XSFA 4TU9A 3TP2A 2CQ3A 1VQPS 2KI2A 3R27A 3SDEB 2DNYA 2MJNA 4WKRA 1U1PA 1VQLS 1N8RT 1NU4A 2VONA 2KRBA 2MKCA 4P6QA 1N88A 3UCGA 1YTYA 2KM8B 2J0SD 2M0GB 2M70A 1X4FA 4OZ0A 1M5KC 3BO2A 1X4GA 5GAEU 3IWNC 4WFBQ 5LXRA 2YH1A 3CMES 2DH8A 5DDOC 2L41A 4W90B 2KFYA 1VQKS 2FC9A 2GHPA 3MUMP 1SJQA 2MHNA 2KRRA 2LEBA 2QEXS 2FY1A 1X4HA 1WHYA 4ZKAA 2MZ1A 2PE8A 4LMZA 2CJKA 3THTA 1WF1A 1X0FA 5GVQA 1N54B 2LQ5A 2EK6A 3MUTP 3G4SS 1A7GE 5CA5A 1VQ8S 2LA6A 3J7ZT 2CPHA 2M88A 4OZ1A 3P3DA 3CC7S 4IO9Q 2CPXA 2MKJA 2DGOA 2CQGA 3BS9A 5DM6Q 2RS8A 5GAGU 2DHGA 5GADU 1M5OC 3CCJS 3UCUP 1M5VC 3UD3P 1FXLA 2X1GA 2OTJS 3VAKA 3IRWP 1VBXA 2M52A 4WIIA 5IQQA 3UCZP 2RNEA 2LA4A 3VAIA 2MXYA 2KG0A 1RK8A 1H2TZ 1R8PA 5MLCV 1F9FA 1U6BA 1VQ6S 2KN4A 2EVZA 2MQLA 3CUNA 1YJNS 3CCVS 2CQ0A 2HVZA 3ZZYA 1D9AA 3VALA 2XS2A 3UD4P 2JRSA 1D8ZA 1HL6A 3R1HA 3JB9k 2DGSA 3THPA 3B4MA 3G6ES 3CCQS 1CVJA 1URNA 2LXIA 3VAJA 3FEXB 2DGVA 1AUDA 4QU7A 2MQMA 2X1FA 2CQCA 3VAMA 2AYBA 1QVFR 2RS2A 2KXNB 4C4WA 2ADCA 2DH9A 2DNQA 1QM9A 2D9PA 5D78A 3G9CA 3PIPQ 1N52B 1U1OA 2DHAA 2RRAA 2DNKA 4IOAQ 3U1LA 2HYIB 1HA1A 3NNAA 2MZTA 2YH0A 3S8SA 2RQ4A 2X1AA 1VQOS 2BOPA 2JVRA 5D77A 3R1LA 3BEGB 2M8HA 2KT5A 2MSSA 2CQDA 2O3DA 3S7RA 2DGUA 2QA4S 2CQPA 1U1KA 2SXLA 1DZ5A 2X1BA 2XNRA 5EN1A 1KOOA 4QU6A 3S01A 2F9DA 2J8AA 1X5OA 2A3JA 5DDQC 2OSRA 1WWHA 2ZJQQ 2MQNA 2YTCA 3ULHA 2KVIA 2M4MA 4FXWA 2ERRA 2DNLA 2CPZA 2CPFA 1OIAA 4QQBA 3V4MA 5GMKa 1X4DA 2ZJRQ 4C0OC 2E5JA 1FT8A 3HHNB 2DITA 2HGNA 1U1LA 1FJEB 4ED5A 2XS7A 2KM8C 1YITS 3G96A 3FEYB 3P5TL 2DH7A 2PEHA 2MGZB 4RU2A 2CQ4A 3L3CA 3SMZA 1YIJS 2F9JA 2RVJA 2CPDA 2GO9A 1JJ4A 4F26A 5GAHU 2Q79A 3CCRS 3CULA 3TYTA 1YI2S 3I55S 2LXUA 2XNQA 4EGLA 3UWTA 2F3JA 4F02A 4PKDB 2DISA 5H1SV 1VQ7S 3I56S 5DETA 2M8DB 5JVGQ 3ZZZA 3NMRA 1BY9A 4Y0FA 1K9MT 3J7YU 1WTBA 1Q86T 4UY8T 2J76E 4Z2XA 5IM0B 2YWKA 2QFJA 2DNMA 1ZH5A 3B4DA 3S6EA 1KQSR 2DHXA 1A9NB 3P49B 1SJRA 3MD3A 4TU8A 1K8AT 1RKJA 3G8SA 2DGWA 3G71S 1SJ3P 3U1MA 2RRBA 1X4CA 2FC8A 1H6KX 2CPJA 4LJMA 4WCEQ 2CQIA 2B0GA 1JJHA 1WEXA 2CQBA 1X5SA 2N7CA 2NZ4A 4TU7A 3EGZA 5JVHQ 2RQCA 1JJ2R 3NNHA 2MGZA 1K73T 1WEZA 2LMIA 2DO4A 3EGNA 2DNZA 2DK2A 1S72S 1M1KT 3VAFA 5LSOA 2L08A 3VF0B 2MY8A 2N3LA 3EX7B 2MMYA 5HO4A 4WFAQ 2E5HA 1KD1T 1Q7YT 1UP1A 3NS5A 2NLWA 4YB1P 1U1NA 5BJRA 2ZJPQ 3NS6A 3N9UC 2FHOB 2MB0B 1WEYA 3HI9A 2I2YA 3H2VE 5ITHA 3Q2TC 3UE2A 4PR6A 1U1RA 1S79A 3BO4A 3LQVA 3CCMS 5IM0A 1WI8A 2MQPA 2K8GA 4U67Q 2DIUA 2YKAA 3MUVP 1PGZA 2XS5A 1WHWA 3VAHA 4A8XA 1WELA 2MQQA 1VQ9S 2KXHA 5LJ5Y 2MKIA 2MY7A 2DNGA 3CXCR 2DNNA 2AYGA 1WHVA 4M5DB 2MZQA 2DNPA 5CXTA 4PRFA 1JMTA 2LKZA 2OTLS 4IOCQ 3G8TA 1M90T 2OJ3A 1FHTA 1WG1A 4FXVA 3PIOQ 3US5A 2KH9A 2DB1A 4J5OA 3MI7X 2BZ2A 2RU3A 3SXLA 5FJ4A 3CTRA 2AD9A 4CQ1A 1HD1A 2XB2D 1VBYA 2J0QD 2UP1A 3CC2S 2MKSA 2DNRA 2MKHA 1UAWA 2AYEA 1X5TA 2DIVA 4YOEA 2K3KA 1L3KA 1SJFA 2G4BA 3DXBA 4CH0S 2L9WA 1U2FA 1VC6A 2CPIA 2OSQA 1FJ7A 1WI6A 4IUFA 2CPEA 4WF9Q 1FJCA 1PO6A 1U1MA 4CIOA 1M5PC 2LECA 4TLQA 2JWNA 2U1AA 2LCWA 3BO3A 3P6YC 1H2UX 4CH1A 5LSLA 1FO1A 2E5IA 4ERDA 3CCUS 3CF5Q 2RT3A 4W92B 5CYJA 5DDPC 2VODA 2DNHA 1WF0A 2KHCA 1VQNS 5LJ3Y 2E44A 2MJUA 4LIRA 3RW7A 2WBRA
chains in the Genus database with same CATH superfamily
1WD6A 2COLA 4ELUA 1LWXA 5IT9Y 1VBKA 3BGUA 3LAKA 4AD6A 2VBYA 4DJBA 3D0IE 2ZEJA 4PABA 3D5MA 1VGYA 1NJWA 3M8RA 1CBKA 3HKZD 5IFMA 4EZ6A 3TEHB 5KG5A 2DY1A 4M94A 2B6AB 1SXLA 1KHVA 2GVDA 2BKPA 1JLCB 2UUTA 3DU6A 1U02A 3OW2R 3QPIA 3MMCB 3CCLS 3GLJA 1NJZA 3GONA 3KHHA 3TW0A 1PBAA 2N3OA 4ED1A 2W7AA 4PG5A 2P5VA 2ASYA 3K0JA 5HK4A 3DLBA 1YJWS 4LR7A 1S1UA 4A8YA 2L48A 2XGQA 3MPVA 4X4VA 3DLEB 4Y2CA 1AZSA 3J81j 2VF3A 5IXUA 1XTZA 1NU4A 2KRBA 4JB8B 2R8JA 2WZ1A 3A12A 3AB2B 3C6UB 3NL0A 2C3OA 3PFOA 1UKUA 2X3GA 1FE4A 4R0JA 3KK1A 3GMGA 2QFIA 3ISNC 2MZ1A 5K14A 4AYBD 3OHAA 2UXBF 5M2PA 2BJ8A 3MAAA 1NPPA 2KFZA 2CPHA 1NPKA 3K5MA 2QZ8A 2DHGA 3QZ8A 4EEYA 3TAPA 2IRXA 4PQUA 2J0WA 1JLGB 2ZVSA 4J9LA 1B64A 2PDAA 2AKWB 3SSRA 1F5BA 4TY8B 1D9AA 2Z2YB 2ZBPA 2R7TA 4EBDA 3JB9k 4NLXA 4ZPDA 5HMXA 3KJFB 1EJ7L 5D0GA 1URNA 2LXIA 1WC5A 3FQKA 2CQCA 3CJRA 5FD1A 3WQPA 5D78A 4KR0B 2HNZA 4L3NA 4ECUA 1EKSA 2OP5A 5F8LA 3DNCA 4WZMA 1VFJA 4YDDB 5ETVA 4HACA 2WW8A 1W25A 1HFEL 5HSPA 4NXNJ 3VQSA 5G4DA 1C2PA 1NNDA 1WWHA 2HS0A 4DV3J 1MNEA 1NK9A 4ECVA 2C2MB 1Q5VA 2ERRA 4I2PA 2JLGA 1V9OA 3BPSP 4USTA 2HQDA 1RTIB 2O01C 5K5MA 1WACA 5KAKA 1XNQF 3J81U 4TN2A 3G8QA 3RB4A 3TANA 4ILMA 2RDDA 4HTJA 1H7WA 1VRUA 2AV5A 1C1BB 3DRSB 3MR3A 4OYBA 1YBUA 3GIRA 3U1MA 5SUHA 4DEZA 3MCNA 1CQMA 2O5DA 1FKOB 4ZHRB 5IS2A 2BDPA 2GS8A 2MLXA 2LU1A 4LFAF 2MY8A 4HT5A 4RNHA 1JLAA 2PC6A 4DU7A 3DRPA 4KGMA 4YS2A 4Y3CA 4YB1P 5LMUF 3OUYA 1WEYA 4RLEA 3SCLE 4CRJA 3UPFA 3RRGA 2BM1A 1RTHB 1WI8A 4OI2A 5B0GA 5LMNF 1PGZA 1WHWA 1QE1A 2MKIA 3MM6B 3TEGA 2E9RX 5E2QA 2FVPA 2Y8YA 3KLIA 3I0SA 1DQAA 4WKYA 3EVOA 1E6YA 3T5HA 4AQYF 4UQGA 3W5YA 4FF3A 1I94J 1FJ7A 3KLFB 3AD8C 4CO0A 4KE5A 5B7WA 4OMFG 4CTAA 2RHSB 3PACA 3OJSA 1Q78A 2JC1A 5CYJA 5DDPC 1S1TB 3VWSA 1WF0A 2CJQA 4RW8B 2E1RA 2V0NA 3I5CA 2XQCA 1RE1B 2ZBRA 2AF6A 4ECSA 3TNVA 4U8YA 2ZH5A 1SB6A 1IKVB 2LQJA 1OWXA 4B3OB 1QAIA 4C7QA 2FPHX 1N4LA 1JKHB 2VA2A 1FNXH 1R8HA 1IKWA 3CJQA 4KH1B 1OMSA 4JV0A 1S48A 2V94A 1HQEB 4GMKA 2LYVA 1VI7A 2PT0A 1TUGB 1OSCA 3D66A 3IO1A 4QIVA 2P9GA 1TUWA 1UFKA 4RUCA 2YX7A 4BC7A 2HVEA 1N36F 3OR2B 1RHQB 4OI1A 4B9TA 1HWIA 2GW8A 4J9RA 4WK1A 3DOLB 4PG7A 1RDRA 2VHGA 3H20A 3B6BA 3K58A 4NLPA 1IKXA 4F0MA 3FUYA 1X8DA 3R5BA 1JLFB 1ZM2A 2NYHA 1WC6A 3OL6A 2R2SA 3NS7B 1YTYA 1KQFB 3LWMA 1IXKA 1K44A 3IWNC 4H54A 3NG8A 2PGCA 2FY1A 4M5HA 4GO5X 1RT2B 1FRHA 1UZHA 1FWKA 2EK6A 1OY9A 4G6VB 4WXOA 1P9YA 2BE9B 4NCGA 3H7HB 3KJVA 1TKZA 1N33F 5J1NA 3TZYA 5I42A 3EDQB 4ZLPA 1LW2B 1AXQA 1TELA 3TVZA 3UW1A 5I4MA 1SKWA 1R8PA 5C24A 5A2QU 1XERA 4IH7A 3QFHA 3PRBA 3CO0P 4K4ZA 2JRSA 4OHZA 4IDKA 3Q86A 4IQMA 1NZAA 2UUBF 2AYBA 2E9TA 3I31A 3MM5A 5CH7B 3FFIB 2V8VA 4NYOA 3SI8A 3M2VB 3MPUB 2GCFA 3R1LA 5J1EA 5F8GA 3KK3B 2DRBA 1TTHB 3M1VB 3FSIA 2HZVA 4NLQA 1YG0A 1NDKA 3LP2A 2ZJQQ 2MQNA 4OZ5A 2ZKTA 2VG7A 2UV8A 1X4DA 4KYZA 1KHWA 5L1JA 3ONQA 4RUBA 4GC7A 4USMA 4M5IA 3BBCA 4J90A 5HQLA 4DR1F 3WX4A 3RAXA 4I2QB 3FZ2A 4I7FB 3UWTA 3J7Z5 3W64A 2HSEB 5T7LB 1MWZA 3OFFA 3C2PA 2ROEA 2NPIA 4R8UA 1Q86T 4OX9J 4OHVA 1NDLA 3IGNA 1SJRA 4F3QA 1RKJA 3KK2B 4DPUA 3CB4A 1TAUA 1R0AA 1YBTA 4ZVUB 2RRNA 5DZ6A 4ED8A 1RYSA 1QUPA 1NSAA 2FLLA 5JMNA 2GZOA 2F8MA 4BLGA 1JQGA 1HBNB 1S6QA 4KHRA 1S4FA 3HHLA 3TWZA 3OL8A 1UZDA 1KD1T 2YQ1A 2BQRA 3ELHA 3P96A 2JHEA 3W65A 2DXFA 1HNXF 2DIUA 1Q16B 1HQUB 2GIRA 2FIUA 1WELA 2NZCA 1NH7A 3M9MB 1VQ9S 4JI4F 2MZQA 5AXMA 2V4JA 2OTLS 4IOCQ 3V2UC 1EHWA 4FXVA 5A8KA 4JI7F 4K2XA 2BZ2A 4ID5B 1FDNA 1FX2A 3LW5C 3CTRA 3SXLA 4ANEA 1VBYA 3AQPA 1ZA1B 3CJKA 3CC2S 3LTOA 2B7CB 1L3KA 1SJFA 2L9WA 4R5PB 3PTWA 1RAFB 1DURA 3T5LA 3A3PB 2V67A 5KFRA 1T9TA 4NPOA 4AL7A 1H2UX 4FF4A 3ZZRA 4HI2A 5KFFA 1ZM9A 2JLEA 1S7HA 4WE1B 4R0EA 1IR1A 2MLZA 3JS9A 1YJ7A 4MT1A 1S9EB 4DR7J 1PIEA 1SJ4P 1HI1A 3H2LA 3GPAA 4JI6J 5HROB 2YY3A 4K4UA 1NKBA 1HNWJ 1VIOA 3PHTA 3QIPB 4CLKA 4OLPA 1EIYB 5EUHA 4DWIA 1FF2A 1M1HA 3R2CJ 3KUEA 4K4WA 1NJIT 4W98A 1U25A 2Q66A 4FZVA 3CVKA 2Y8WA 1KBRA 4NCAA 4EYIB 1D0EA 5LOQA 2ZOGA 4IH5A 2F8EX 3W8PA 4B3SF 3Q2SC 1OO0B 1X4BA 3GIMA 1BQNB 3ET6B 5CABA 1S0OA 2U2FA 4MTPA 2P6TA 5KFJA 4O23A 3DLLQ 3C8YA 4LFBF 2FZCB 3PFEA 4XDDA 3DN9A 4TU9A 5A76A 2CQ3A 3DRRB 1E6VA 2OELA 3VR1A 2PEBA 1YJRA 2C2OB 1RISA 2VG5A 2IMOA 3BPDA 3H5UA 2JZ5A 4G1PA 3ZZUA 3JAMU 3KUHA 2M70A 1HNIA 1Q95G 5E3RA 1QSYA 4O4RA 1S6PB 2BKNA 1MW7A 4GO7X 3V6JA 2KRRA 3OFEA 2I6WA 3EPGA 1AB8A 4IOBA 4ZCMA 2PE8A 3BKFA 1VMBA 1WF1A 5GVQA 3HD2A 2P2CB 3J7AN 5A0YB 4L75A 5KG0A 2G2YA 2CQGA 2ZDPA 4RNOA 1U8SA 3D1HA 3UD3P 3HF5A 1MMLA 4A8OA 1Y0HA 2RNEA 5IV3A 2J0XA 4Y34A 2D3O1 1VRTA 2VASA 1VK8A 1KP6A 2D3UA 3IR5B 2D1CA 2OI2A 3R2DJ 2VUGA 3FMBA 1RT3B 2HW3A 2R8KA 4QU7A 3G86A 2I8EA 2ADCA 2CUYA 1Z2ZA 3M8QB 3TUIC 1FFGB 4G1QB 4F4XA 4ECTA 4KFBB 4C0HA 4C8KA 3CJ5A 2VBWA 1HARA 1VHIA 1PYSB 3BSAA 1JLGA 2X1BA 1B0VA 4DV5F 1CC7A 2F9DA 4NLUA 1G4CA 4TY8A 1SKRA 2HNYB 2H3EB 3GSIA 3DGPB 2H4WB 4IG3B 3VGUA 4C48A 2XMMA 3HXMA 2ZHAA 3P5TL 4U6PA 3BYPA 4MKYA 3SMZA 1T9UA 4JI5F 1NPRA 3CT9A 3U27A 4OYOA 4LUBA 3GILA 2H9ZA 2GQQA 5HP1A 4CM0A 1HHSA 3ZZZA 1BY9A 1H7XA 1YX2A 4DV0F 5B0CA 4OYAA 1UJ4A 2X3DA 2QFJA 1S77D 5AT1B 3D68A 1U45A 4EBCA 4UZBA 3RR7A 1GMWA 2MHEA 1F3VA 1Q8LA 2RQCA 4CO3A 5EWGA 2VJVA 2B9EA 4JYAF 2FDNA 1CS4B 3TOQA 3Q8SB 3DU5A 2NLWA 3EZOA 2HBZB 2ZJPQ 3VV2B 2B4VA 2BRKA 5DG7A 4X4SA 4CLPA 5C25B 5HMYA 4QR2A 3CGIA 4U67Q 2QMUB 4O0IA 2UXBJ 2P6SA 3SSSA 4B17A 1KFSA 1T02A 3T6JA 4NA3A 2BKOA 3M30B 4N76A 1RU2A 3G8TA 4K4YA 5DQIA 3US5A 2V2ZA 1RBAA 4P10A 3C15B 3QGIA 4ZHRA 3RAQA 1ZBTA 3K8WA 1X5TA 1RCOB 1IM4A 4P52A 1KLMB 2Q6BA 1S59A 3NWRA 1VISA 4ALZA 2LCWA 3HD1A 1LWEB 4ZVOB 1C0TA 1RTHA 1J27A 2YVSA 1H3DA 5A6WA 1GMWD 3MEDA 4H4MA 4LIRA 1UVLA 1REGX 3CJ8A 4MIAA 1XMBA 4J9PA 2YNFB 3AT1B 1DBDA 4U8VA 2KU7A 4HTIA 3NAIA 5KFBA 1ZZNA 3FBEA 2KYXA 3R6LB 3MTKA 2VOPA 2BACA 1RWOB 5D3GA 4JV1A 1XMOF 3KLFA 3TAMB 3V6DB 2W9BB 3EDRB 1DTQB 1VR6A 5L38A 2RHQB 2DO0A 1Z4UA 4JI2J 1WG5A 5LT5A 2DHSA 1Y4ZB 4QIFA 3AY0A 4K4TA 3MEGB 1VQ4S 1XK8A 4E2FB 1XNQJ 5GAHI 4M5GA 3UQSA 3OXGA 4CLFA 2Z4PA 2UVVA 3ZTRA 3P8BB 3M6WA 2ACMA 5F3ZA 5AJ3F 1HNVA 4B3OA 4K59A 1JJCB 3JQMA 1VQPS 2W9CB 2ZBQA 1SH3A 3HVRA 3V6KA 2NQPA 2K7KA 3D54A 2KM8B 2V2VA 3PX6A 1FWPA 2JFDA 1N32F 2HWHA 4LSLB 1DTTA 1DLOA 4QZVB 4LFAJ 3JTNA 2L41A 3OR2A 3NGKA 1VQKS 4RW4B 4OI4A 3RB6A 4J9QA 4L74A 5LMUJ 4URGA 1HKAA 1HHTP 2BBEA 4YP3A 1EQMA 3AFGA 3GCWP 3OV7A 2B5JA 5LL6d 4FNHA 4ZN3A 2E66A 4ES2A 5DM6Q 2RS8A 4UUXA 4FYYB 1CULA 3FRYA 1LKZA 4MKBA 1FXLA 2XSJB 5K8PA 1WSRA 2X1GA 4M5JA 2LDYA 3KOAA 1L5UA 4HEA9 2MXYA 5HANA 1OYDA 1F0XA 3FGVA 5C2CA 5KFKA 4AQYJ 1S9GA 4YQWA 2A6MA 5KOWA 5A8WB 2HWIA 2XS2A 3Q0AA 2O67A 1ZM3A 4AT1B 3PW2A 2ZHOA 1TVRB 3QGHA 2YBVA 4NLOA 2BJDA 1T94A 4IH6A 4YR2A 1REVB 2DHHA 3QLHB 1HMVA 4B9UA 2RILA 4HDHA 3T1HF 2LFVA 5KFXA 1S49A 1HI8A 5B09A 2DEIA 2ZH4A 2XNRA 2WONB 2GFFA 2CADA 3R5GA 4MYTA 2Q1LA 5DLFA 2ZNYA 4OZLA 2YTCA 3ULHA 2EC2A 3R97A 1RA7A 4B9MA 2ZZTA 4LR9A 3HVAA 1U1LA 2OD4A 4O4GB 4XTTA 4M5KA 1NJXA 1RAJA 4RU2A 1Y00A 1SL2A 4YY3F 2EG1A 4KAIA 5H9EJ 2VH7A 3CWJA 2H54B 3CCRS 3MAQA 4IR9A 1UJ6A 1RWVB 1RYRA 1NK0A 2XNQA 5ETOA 3KK3A 2FHJD 1N36J 3T9NA 1A0OB 3M1VA 1UVKA 1MLAA 5I3PA 2YWKA 2AJ1A 3TQEA 4OYMA 3O44A 3UDVA 4USUA 4TQRA 2Y1JA 2A6OA 5FLXU 2CPJA 4DDFA 3AB4B 1SC3B 4TU7A 5MAOA 1K1QA 1K73T 1SV5A 2DO4A 4ECWA 1T9WA 4Y2AA 1AYEA 3AJ2A 4I2QA 2YWWA 4P73A 3ILJA 3EX7B 3ITHB 2MMYA 3HKWA 2FJAB 4K4XA 4Q8EA 1UVJA 4LBIA 8ATCB 2FVRA 3CDWA 4O3QA 2QL5B 3JTOA 2AP6A 3BO4A 2IDEA 4LT6A 1IWGA 4OJGA 2YNGB 2XS5A 3T6BA 1BC6A 2CA9A 2LDIA 5B0AA 3PG9A 2V68A 2CJ9A 3C14A 1JMTA 2LKZA 1RABB 1FHTA 1WG1A 1N33J 5AXLA 3PIOQ 3MM7A 4Y2KA 4A8QA 1Y10A 1GH8A 2VQFF 2LP4A 3ZTOA 4FDFA 2MKHA 2BW2A 3DC2A 4OL8A 2OEMA 4YOEA 1RTDA 2FD2A 5IV4A 3L7OA 3VGVA 2CPIA 1WI6A 5ETRA 4FYDA 2CJYB 2WBMA 3M8SA 3BO3A 3ZNJ1 4BWJA 1N5YA 3TUJC 3OVBA 3AXMA 4FPIA 5LSLA 2UUBJ 2E1PA 2JC0A 3JQKA 3D3CJ 1F3FA 4KSEB 3PDNA 3TA0A 3DXSX 2GJ2A 3M6XA 3D2WA 4ECXA 2OGUA 1IBLF 1S99A 1KR4A 3UI3A 4ID5A 3HFVA 5E3QA 3K2YA 4K5RA 2B9YA 3KJNB 1RT1B 2ZITA 2KT3A 3MOZA 3W9IA 3LH2S 4R5PA 3Q24A 1IN0A 1UW4A 3TVKA 2HK3A 1FD2A 4FBTA 1S9FA 4KC5A 1U1QA 1ZS6A 1VHFA 1RLDA 1H72C 1UFWA 3SEOA 4WE1A 3CPWR 1RWWB 3L4BC 1WG4A 1FJGF 1KTVA 3HP6A 2WVDA 1TL7B 2BJEA 5GAGI 4RW9A 1WHXA 5KT3A 3TO8A 1TK8A 1TKXB 3TP2A 1RKIA 2ASLA 3DFEA 1VQLS 4Q5VA 2VPYB 1N88A 3QT7A 3LF0A 2DBBA 2J0SD 4Q2MA 3MEEB 1JNZB 3FCVA 1R7IA 3R5JB 2F4FA 1JNRB 4PYAA 3D3BJ 5LXRA 3NWGA 5KFSA 2XO7A 1CQNA 2GHVC 2J6UA 3FBCA 5D15A 2Z0GA 5HBMB 3CCWA 5G0RB 8AT1B 1BQNA 3ET6A 4UF4A 4LMZA 3QRRA 3G4SS 1HNXJ 3ILOA 2M88A 4OI6A 1R0BG 1QAJA 1N5VA 4HH1A 1U24A 3M2UB 4JI1F 4JI4J 1KEKA 3C6TA 2RKIB 3DRRA 4KO0B 3EPIA 3BBFA 4JI7J 3T1AA 3ZTQA 1FNOA 1U6BA 2R9LA 3RZAA 1S6PA 2HVZA 3DLGA 1YSJA 3V4IA 3MZIA 1CVJA 4LBHA 1F5AA 3CD0A 2FLOA 5J2NB 2B4OA 5U47A 2DNQA 8RUCA 2VBZA 2XGPA 1RXOB 2DNKA 1HA1A 4K4SA 4JI3F 1AW0A 4URQU 2YPZA 2ZWOA 2X1AA 2QA4S 4EUVA 3D6HB 4GVBB 4GVLA 3F44A 2B4PA 4E0DA 4IFYA 1LQ9A 2R8GA 3OTEA 4QQBA 2AGQA 1V3SA 5F8HA 1FT8A 3QYYA 1RB0A 1Y3JA 2VKZG 2J6SA 2MGZB 1P6TA 2XWXA 3L3CA 2F9JA 3KLEB 2RVJA 2GO9A 4KFBA 3TYTA 1PKUA 4F4WA 2F3JA 5DQHA 1J5EF 4N8NA 2GVZB 2W2QP 1VK3A 1LXJA 2QLXA 4B3SJ 1LWFB 3OLAA 2J76E 4ZCIA 4ZP8A 4ZVTB 5KT4A 3Q8VA 1ZH5A 2JL9A 4ZMMA 1K8AT 4CWBA 1I1GA 5J2PB 1VJQA 4LFBJ 1HWUA 4DV6F 1TFWA 2E29A 2CQBA 1U6ZA 4OYIA 2FJVA 2HFZA 4XDCA 1RWKB 1M1KT 3VAFA 4DR6F 3H0PA 5HJXA 1NKEA 1C4CA 1UVMA 3NP5A 1BE4A 4Y65A 1XR7A 1Q53A 2I1RA 3PJXA 2IC3A 1N48A 3LQVA 1LWCB 2MQPA 1RT6A 1DARA 4ECZA 3KG0A 5IC6B 4GKJJ 2R7VA 1WHVA 1KRPA 2RF2A 4FVCA 2OMLA 2N7YA 2BRLA 4PWUA 3SYZA 2WOMB 4KB7A 4DV1J 4LRBA 4ZPAA 2J0QD 3M8ZA 2DNRA 4AL6A 2BR0A 3C3LA 5BYSA 1CS4A 4F36A 2DIVA 4ZLNA 3AJDA 2OEKA 2OSQA 4ITSA 5HVGA 3PNIA 2HPUA 1FJCA 2QLJB 4I68A 1RWUA 1NRKA 4DSFA 4G3IA 3D4JA 2YQ0A 1X60A 5JUMA 3CCUS 4CYUB 1WKJA 1HI0P 2MJUA 5DQGA 4H4KC 3OFGA 3R6GB 5HQ8A 1DAXA 3H90A 3EXYA 2M9KA 2R8IA 2D7SA 5L9NA 4DV5J 4O44B 3AXKA 2B9XA 4F25A 4TKTA 4F7VA 3PX4A 3NKYA 3W2WB 3EGWB 1CJUA 3NLCA 2CAJA 5HATA 1FDBA 3DLJA 1CSJA 1KS2A 4ZCLA 5IT9U 3R7NB 5L46A 2HGLA 4RU9A 1FXDA 2C2DA 4DL3A 4JI5J 1YWXA 4FF2A 1VQMS 5DDRC 3OQ2A 2IYGA 1S12A 3AH6A 1QVGR 2OO4A 1FTCA 4KH0B 1G2EA 1Q81T 1H2VZ 3MMBA 1HBMB 3VAGA 4YUDA 2BE2A 4DL7A 1F1BB 4DV0J 3RR8A 1RBOB 4QCLA 5B08A 3TAMA 3V6DA 3GV7B 1N5TA 3KXDA 1ELOA 4TYAA 1W26A 1HHQA 3GWCA 3KFWX 3I87A 3D1OA 3GSDA 5F8MA 2V9WA 3RB0A 5FIIA 4JYAJ 4U7UK 4WFBQ 4ZVSB 4HH0A 2NXJA 2CZ9A 2AX0A 1P9QC 3V81B 1S1WA 4KKOB 4ETXA 5D4PA 1MG7A 5DG9A 3MUTP 2IBOA 5KFIA 2DTJA 2HHXA 5CHCB 2C2EA 1UETA 2YPYA 2L3MA 1TL5A 2IRUA 4QWAA 5KFPA 2QLBB 3MPYA 4WZQA 2HS4A 1YJTA 1GK8A 7AT1B 1GFWB 3IAM9 4ENOA 2VV5A 1F9FA 3Q22A 1IR2A 4JV5F 3ZZ0A 3KYLA 4P72A 4Q44A 3LWLA 3C16A 3FBBA 3UD4P 4DV7F 1QD1A 3SFGA 4DZ6A 4O3OA 5EDWA 3QWPA 4ZP7A 2R42A 3CDAA 4JV2A 1Z1ZA 1S10A 3NBPB 1YQHA 1T05B 3S1TA 1RAIB 3NNAA 3HFZB 2RQ4A 3KLHB 2XSJA 1HPZB 2M8HA 1JLQA 3KNGA 2W8KA 2DGUA 4TXSA 3T19A 1XR6A 2XYGB 3JSBA 2F63A 3UR3C 3UFCX 2J8AA 1X5OA 2VU5A 5AXKA 4X65F 2HIYA 3HCXA 1FKAF 3C19A 4FXWA 2H51B 1XMOJ 1XR5A 2WK4A 3V4MA 4IFVB 2HGNA 5KG1A 1SPBP 3PM9A 5F3TA 4P7TA 2HLUA 3QLHA 1QJHA 3MR5A 1JJ4A 2YQ3A 4ICLB 3CULA 1FRMA 3M2RB 5J2MA 2HHVA 2IM3A 3E2EA 2P8IA 3MCMA 3FZBA 2WONA 1FFSB 2IM2A 4ED4A 1K9MT 1QAXA 1RP5A 3KTQA 4YDXA 2N4DA 3DGVA 3Q83A 1A9NB 4DR5F 4MIBA 5AJ3J 1O6XA 4NX9A 4P9SA 2RRBA 3M4XA 2DPIA 3QO9B 2YWEA 1O51A 3QGGA 2E7XA 3M32B 2R7XA 1HBOB 3R3TA 1S72S 3DLKB 1N32J 5D0RA 2ROGA 1YK9A 4DZDA 3MM8B 3N9UC 2QN6B 4PG4A 1RLCL 5ETSA 4I69A 1L3SA 4N8OA 1U4BA 2QTWA 4ZN1A 3D67A 4RNNA 2UVRA 1Y7PA 5IZHA 2UUWA 2B8PA 2XULA 1ZYQA 1RT7B 1T03A 2NUUG 2IDLA 1ICEB 3A3OB 1UAWA 2IJNA 2VJUA 1U2RA 2G4BA 1XEZA 2C2RA 3K8VA 4NI2B 5DS7A 3MPWA 5IC4B 3P6YC 2PN6A 5FDLB 2R2RA 4WPAA 1KFDA 3GQCA 1CJVB 3RW6A 1AFIA 3LPYA 2AIRB 1GXLA 2ADBA 2I5JB 2L9DA 3UN2A 3MOJB 1T95A 3ZO7A 3VGSA 4C97A 5AE3A 5B0DA 4WFNQ 3GV5B 1LOUA 5J2QB 4IG0B 2EBEA 4C3KA 4X4PA 2HS3A 1VJWA 2RUGA 2NSBA 1LFWA 4Y00A 1IKYB 3W8GA 4LQ9A 2I38A 3FDSA 1W2BR 2CG8A 2B51A 4I56A 4YY3J 2HIQA 3A13A 1NO8A 3H98A 4UQTA 1J5OB 2ZH9A 2HMIA 1NLKL 5DGBA 2HZCA 3A8JA 2J7WA 1RHJB 1YHQS 4ZP9A 1UVNA 2IAJB 4FYWB 3W5ZA 3DYAA 4DR7F 1ZTWA 2LQ8A 1T3NA 2MZJA 2XSFA 2B43A 3OTBA 4ES3A 3AD9C 2OPPA 3C66A 5C42B 2RE1A 1U1PA 3O1LA 4DV4F 4NLRA 2EFGA 3FSXA 3X1LB 2YH1A 3JQJA 2EC0A 4C6AA 5HQMA 1RHUB 3MUMP 1Q5YA 2QEXS 3M7VA 1M5SA 4D3HA 4IO1A 3DOKB 4MFBB 3F56A 4ZVFA 3NEKA 3SBMA 3GTYX 2NUHA 2LA6A 3BZQA 1W7WA 2KZMA 3DKDA 1TKXA 1M5OC 2ZUAA 4CO5A 3BQ1A 3MECB 2RD5C 4ZK7M 4DL6A 2AWZA 3IRWP 3TA2A 2QG9B 1J2VA 3H42A 5L9XA 1F9EB 2VQFJ 4RKUC 3W5XA 2DD8S 3VALA 1ZAWA 4LFCF 1VDHA 2GJIA 2A10A 2HZAA 1RT5B 1M1GA 1RZMA 3IWLA 3E51A 3FJ2A 5G0RA 2BM0A 1C0UB 1AUDA 4LF9F 5DLGA 1SL1A 4HHHA 2RS2A 1WDDA 2VFRA 3J80Y 2ILYA 2BVZA 4AXJA 3JAMY 1RWMB 4C8YA 2AJ4A 2IYIA 1ZPWX 2PI4A 4KO0A 3X3UA 2KO1A 5D77A 2ZH7A 1Q79A 3S7RA 1IBLJ 4QU6A 3IS9B 4OHXA 1OPZA 2YWFA 1BQMB 3NOGA 1X7VA 2CPZA 5GMKa 4GKKF 2R8HA 4N5SA 3PRDA 2KM8C 2FHMA 1GQEA 4NWBA 3P5BP 3O2IA 1HBUB 2A18A 5GAHU 3Q89A 1NH8A 2YKNA 1NK7A 4ZITA 1Q4RA 4QW9A 3W9JA 2YKQA 4EGLA 2CDQA 1EQ0A 4PKDB 1FJGJ 4ANDA 5E0OA 5IM0B 3EVWA 4LR8A 4LF5F 1KQSR 4I0WA 4DHVA 5KFEA 4DX7A 3DOMB 1TMJA 2GC8A 2VPXB 1R31A 2NREA 1ZPVA 1QTNB 2B0GA 1RBLA 3TJ9A 1GXTA 2NZ4A 2JOQA 4KJIA 4OZNA 4CNYA 1JJ2R 2MGZA 4DX5A 6FD1A 1TQLA 2QMWA 3KLEA 5K9FA 3JSMB 2DVIA 3OSNA 2CFXA 4DUYF 2B3TB 4QIGA 4J9MA 2ZDOA 2VG6A 2YKAA 2CG4A 2GHWA 3MMJA 1IQZA 1CEZA 1K0TA 4OYWA 2HHTA 1TP7A 3SQGB 2Q3PA 4QWDA 2C3UA 3ZZPA 4K4VA 4JI1J 2G2ZA 2GAHC 3TA1A 2IJRA 1CJTB 2PSZA 1S76D 5CD4H 3WC0A 1RHKB 1KLNA 4NLVA 2RB7A 3MTJA 1WNEA 1S6OA 1M0SA 4TLQA 1HNZF 2HURA 3Q8PB 3RBDA 1DFDA 2XZWA 2BEFA 4W92B 2ZFHA 4MK8A 3IA0A 4UY85 3RW7A 2Z30B 3OBIA 1C1CB 4JI3J 1YRUA 5EHHA 1YJ9S 2B4UA 2PMWA 4P71A 2J9DA 2CQHA 1RHRB 3NRBA 2AJFE 4V19X 4WYWA 3PVXA 2KYZA 4PG8A 2GMHA 5D0EA 5ETTA 4CLTA 3O8WA 1IQTA 3VHQA 2AZ3A 1PYOB 4ZVGA 2C2NA 3A8EA 1ZZFA 1U0HB 2JX2A 2BXJA 2YNIB 2FVQA 3T1YJ 4PUOA 4KGXB 4CYUA 3I5BA 2IVYA 5CYQB 1MROB 5LXYA 2XLKA 2D3ZA 5JJBA 2KJWA 4DBQA 3UN3A 2J5AA 4O0NA 1DY3A 2HRYA 4BCAA 4QPTA 5A8RB 1J5EJ 3TVYA 4DF8A 4Z7YA 4RUHA 2OUGA 1PYTA 2MPUA 2V8HA 3VGTA 3W2WA 2MLYA 4DR3F 2Z2MA 2EFPA 3W63A 4X2BA 1K47A 4H4OA 4DV6J 5M2UA 1G6BA 4TY9A 4OYXA 1T9YA 1XNRF 2NXUA 3B78A 4NRTA 3R5CA 3GJQB 1G1XA 1V5VA 1XWLA 4FVMA 4CLUA 2GVDB 3EXCX 2ZD1B 4DR6J 2FVCA 3IR7B 4JI2F 3P4UB 2LQ9A 3H4DA 1TL1A 5AE2A 5ETQA 3EVMA 4LF7F 1SJQA 2EXUA 1FVSA 3WC2A 1YRTA 3PW7A 3IM8A 3DHXA 5ETKA 3Q8RB 2AHOB 5CA5A 1N0VC 2FZKB 2CPXA 1SKSA 2DGOA 5HVFA 5ETNA 3VAKA 4RW7B 1X9MA 4FKYA 1MWYA 4WIIA 5CZXA 5IQQA 2MDAA 1S1UB 2XI3A 1AZSB 4DSIA 1IBKF 1T9VA 3ETMA 3IXQA 3BGRB 2RJZA 1FX4A 2FY8A 2QMXA 4RNFA 4DL4A 4KKOA 3D0GE 2W4CA 1Q8BA 5HI7A 4AXIA 3RRHA 5D8HB 1FCAA 3KK1B 3V6HA 4L3KA 3FBFA 1FRIA 2WSCC 1JWWA 2YKMA 2KJVA 2FQQB 3S8SA 1GX6A 2BOPA 2JVRA 3BSNA 2HRUA 3MAAB 3UDEA 2CQPA 3P45B 4J9OA 3WHIA 4CLLA 3GCXP 1NEEA 1RTJA 1BQXA 1NK6A 4PQUB 2J7UA 3R9LA 4QOTA 3TZXA 3E01A 2HRTA 2CPFA 2E5JA 2B8QA 1QDUB 1SQFA 4I4BA 3T9ZA 3FEYB 5KFAA 1F2HA 3M9NB 4DQPA 1B70B 1P8GA 3SQOP 4DPWA 3R8YA 1S1XB 4DFMA 3H5SA 1EB0A 1HPZA 1ZM4A 3G6YA 4Q0BA 4JBCA 3HSJA 3QAUA 4C11B 5DO2A 4NLTA 2C3YA 1LEOA 2PMHA 2VPZB 4IFVA 4FN5A 1JJHA 1X5SA 5HJYA 3CD5A 4I2PB 1WORA 1IR0A 4LF8F 3IG1A 3QWUA 4OX8A 4ICLA 1S1VA 4MKVA 1FRKA 1UP1A 5KFGA 1RWNB 3H2VE 3UDLA 3Q2TC 2XHWA 1EP4A 4FYXB 1U1RA 2B56A 3MUVP 4DR4F 3K5LA 2F65A 2ALZA 2DNGA 4ECQA 1R8CA 3UNGC 3CCZA 4OJ3A 1VRUB 3KG4A 5GMEA 2DT9A 3ADAC 1VYAA 5KFOA 3JTPA 4WP9A 1A6LA 3ZXWA 2RU3A 1ROFA 2H5EA 2XYPB 3ISZA 5HVHA 2ZZNA 1WOPA 5L39A 3LUYA 2HG4A 3QT8A 2PA8D 4JV5J 3MM8A 3POTB 2QIFA 4DX8H 4J37A 1ACMB 4DV7J 4PQAA 4ZVRB 3DRPB 5L1LA 3MHYA 3CIZA 3BDEA 4CT9A 3CF5Q 4DS4A 3OUYB 3AOAA 4B9LA 2KHCA 3IBWA 3KDNA 3DM2B 3GFYA 1QE1B 2MQOA 2XBPA 4QIEA 2QC3A 5HL7Q 1V5IB 1NHVA 3PW4A 3AQOA 4F4YA 3N79A 3I0SB 1PBUA 4X65J 3SDEA 4USHA 1E6YB 1BWVA 2OPRA 2GJFA 2AEFA 3FRZA 3NGDA 2WVFA 1X4AA 2BMBA 2RQKA 4A4JA 1WF2A 3FKBA 4GC6A 2MQ8A 4EK2A 2GA7A 3GIIA 2G0CA 4C8NA 3QBCA 1NUEA 4CTAB 1P1TA 4WXWA 1B0TA 1X5PA 4EO6A 2D74B 2GGPA 3T41A 2W2MP 1F6TA 3IR6B 3CJ3A 1RI7A 4NXMJ 1O0PA 4DQIA 2ZOMA 4JI0F 4DR5J 1T8EA 2G1DA 4A48A 5DM7Q 2H4YB 1JXVA 3UVJA 1UL3A 4I1TA 2XZTB 1IKYA 2ZE2A 3R27A 4LF1A 4LSNB 3KHRA 1IKWB 2BE7D 3ENWA 4LRFA 1X4FA 3BO2A 5GAEU 4LQ3A 3AA8A 4ZDNA 1NK8A 1Q7LB 3GJRB 4ECYA 3MR2A 4KV8A 2LEBA 1EETA 1X4HA 1LW0A 4ZKAA 1HW9A 2Z8QA 3F41A 4LF4F 3GJTB 9ATCB 4DX6A 4KBIA 1RSCA 3CC7S 2C2KB 5J1PA 2WB1D 5GADU 2HBRB 3ZTPA 3RYLA 2PO4A 1SIZA 1IKXB 3D28A 2OTJS 5C42A 3MM9A 2DY9A 1MWQA 4ZVQB 4WJBA 2KG0A 2GQCA 1N5QA 2YNHA 3A3NB 2IA0A 5KG4A 1RK8A 3MMAA 2H65B 1UWBA 4ZVHA 4ZA1A 4UZCA 2ZM6F 2QYGA 4CLWA 4CP5A 3GB0A 2JEFA 1C4AA 6FDRA 2C3PA 3LGMA 3W2VA 1KONA 3VAJA 3HM9A 2Z58B 2VIHA 2OLWA 4RZRA 1Y11A 3ZNUA 3G9CA 1F9HA 3NGTA 1N52B 2DHAA 2VFSA 3HJFA 5IOLA 3EWGA 2YX4A 2JFKA 4DN0A 2HQIA 2KT5A 2CQDA 1RWPB 4QWCA 3KJVB 1TKZB 2GIFA 4DV2F 4PEOA 5I42B 2A3JA 1XC9A 4KHPF 4ANCA 4MKAA 7FDRA 3Q8UA 1U49A 3W62A 4C8ZA 1IVZA 1OIAA 3NAHA 3T3FA 1I5OB 1C0UA 5KFUA 3IM9A 3NCRA 2Y9HA 1SUQB 3DI6B 3G2XA 4BC9A 3M8PA 4ZPVR 4NCBA 3B82A 4LREA 4RPFA 2LXUA 1PCAA 4P2SA 1W2IA 4MJKA 2E9ZA 3MM5B 3J7YU 1WTBA 3IS9A 4Z2XA 4BDPA 2BJ3A 5DGAA 5J1EB 3OPKA 2WAQD 3OR1B 2X51A 2NXNA 1JLEA 3HHLD 2VQEF 6AT1B 4LJMA 1ZAXA 2FLNA 3LP2B 3EGVA 3LP0A 2VG7B 3SIPB 3I6PA 1HBUA 2DNZA 2DK2A 5LSOA 4DV4J 3PKMA 3D0HE 2VDHA 3NCPA 3OLBA 3GIJA 2V8DA 4X4TA 4CCHA 1FKPA 3CMQA 1FXRA 3G87A 5ITHA 2XY7A 4L76A 4A47A 3HVTA 4FNIA 3BGFA 3CCMS 5IM0A 4DSKA 3JXOA 2EFNA 2HK2A 4DL0C 2K8GA 3RGIA 3TX8A 1EARA 2OMOA 4A8XA 3BSCA 2DJWA 1SVDA 2D69A 3CXCR 1QTMA 4R8UB 1HW8A 2DNPA 4YR0A 3B8HA 4PG6A 5BYQA 2B6AA 4FKXA 3N6NA 3W3SA 2Q6CA 2AMCB 1R0AB 2IVMA 3GP9A 2AJ0A 2KZZA 1JLCA 3I5AA 1LNQA 4LFCJ 1PO6A 4P2XA 4LF6F 4B3MJ 4CIOA 3H40A 2LECA 1M5PC 3MMCA 3HHLB 1JIHA 4CLSA 4LF9J 3F0NA 3R5DA 2W25A 3IP0A 4BWMA 2DRAA 3HT0A 3SSQA 5C2GA 3D7SB 4WFYA 2QLWA 4P2MA 2J9CA 4PZVA 4GKJF 1FEEA 1MSWD 2WSEC 2IBKA 2V4JB 1FRJA 4WFZA 2DGQA 2DGTA 1R3NA 3DLEA 4DV1F 1SIWB 3KMQA 2VBXA 3NGUA 5B0EA 2R2UA 5SZTA 1VQ5S 4GKKJ 3C6UA 2QGFB 2XMVA 1NDCA 3NNCA 3A8KA 4HL9A 4EYHB 1TKTB 4OJHA 4ED3A 1DHMA 4KHMA 4QYZJ 4DPYA 1KQGB 4TYBA 2A0FB 2JVOA 2QSFA 3DCAA 4USIA 3BR8A 4ZPBA 1RJJA 2GMLA 2AYMA 2AW0A 2VOOA 3C46A 1WTFA 4LF5J 2V2KA 2XY6A 1BXNA 3VCDA 4I64A 2E5LF 2CNNB 2K2PA 5AXNA 4EZ9A 4HI1A 1U7LA 3MR7A 1FK9B 1ITPA 1X4GA 2WHOA 3QSIA 4UT4A 5EGYA 1NKCA 2POKA 5A8RA 1Z2LA 2L9NA 1RHMB 1IBCB 1DQ8A 2NXEA 3I32A 2XCPA 1H98A 1KWMA 5H9EK 2BOAA 2H48B 4DUYJ 2GNKA 5KFTA 2H1YA 2DKOB 4O3RA 4EBEA 4CM2A 4CDIA 2NXCA 4PXDA 5EWFA 1V3ZA 4UOGA 1EZZB 4JI8J 5CCMA 4DQQA 4USKA 4EMDA 3UCZP 2QRRA 2LA4A 4QR0A 2UVUA 4DL5A 5MLCV 1NMEB 1E6VB 4WWSA 4YN3B 2C22A 2ZD1A 2DR7A 3ZZYA 3R1HA 2VG5B 1RTIA 3HSZA 3THPA 5KFCA 1HNIB 3LP1B 4ZLJA 3G6ES 4DSJA 4RW6B 3KHLA 3FEXB 2DGVA 3I96A 2CZVC 1X9WA 1HNZJ 1OQ6A 3W61A 3N6LA 1QM9A 2D9PA 1KVKA 1U1OA 2HQFA 2ASDA 3MCSA 3BGOP 3D9BA 1C1BA 3PO4A 3DRSA 3FEZA 4RW7A 3LAMA 4RL1A 2ZBCA 4F04B 1U1KA 1NJYA 5EN1A 1KOOA 1JK9B 2NS1B 4M5LA 1S97A 5KFYA 5DDQC 3FNNA 3DDKA 1RQ0A 1KNZA 1FKOA 2KVIA 2RDIA 5DZ7A 3OTOF 2XMJA 3BGRA 5CCLA 4C0OC 4BHQA 1VRTB 2FGCA 2XS7A 5IT4A 1FI4A 4URSA 2DH7A 3VZHA 2VFUA 2PFDA 4NLSA 4QJVA 2R7QA 1D3WA 3M8WA 2W1BA 1IM6A 4LVOP 1NHKL 1S5ZA 2OHDA 3MM6A 4V19J 2ZH6A 2HHQA 2W4DA 2ZVIA 3W1YC 3CW2C 1SKUB 4NLYA 3G71S 1MN9A 4YR3A 4DR3J 3BV8A 2BW7A 2FJWA 3M05A 4ELVA 1KDNA 3ZFVA 3M8YA 4RNMA 5F8NA 5K8OA 1VCTA 4B3TF 3EM1A 4OX7A 1XNRJ 2EPIA 1ZTTA 5K8NA 1S1XA 4QBUA 2EFOA 4ZPCA 4XO0A 3WDOA 4QPXA 1S1TA 4LF7J 2CYYA 1NCLA 1V6HA 4RW8A 5KFHA 5KFLA 2CRLA 1T11A 4NEYA 5BYRA 5HP1B 4C11A 3VAHA 2F5GA 5LJ5Y 4EU0A 1PJ6A 4M5DB 3H5YA 5ADZA 1IKVA 1Q8KA 1Y3KA 4YHHF 4J5OA 4OJ1A 3EUNA 5FJ4A 3H4BA 1JKHA 1HIYA 2G1HA 2XB2D 2BJ9A 5E3PA 4L72B 2P9CA 2DCUB 2HQCA 3QIDA 1KTQA 2XEXA 4DUTA 3DXBA 3PR5B 1HQEA 1IBKJ 4RUAA 2AGPA 4OV1A 2U1AA 2DYAA 1ZOTA 3K57A 4NA2A 5KT2A 2GX8A 1TK0A 1BGXT 3DOLA 5F41A 3OXFA 2WBRA 3L9ZA 3OFHA 3KHGA 4NA1A 1R6YA 1TKDA 2Z2LA 2OIHA 2RAQA 2IM1A 2A1BA 2MKKA 2DEJA 4NLWA 2V34A 1DRZA 1JLFA 4HVZA 1QUVA 2V63A 3IBFB 3RG6A 4P2FA 2ALYB 3N5BA 1Y5IB 3TI0A 5KFNA 3POTA 4B3RF 3KWMA 2HNDB 2RQMA 4QIWD 1NSPA 3CMAS 1LK5A 1P27B 4DR2F 5H9FJ 2RSQA 4IRCA 1X4EA 4C3MA 3DM2A 1C0TB 1RT2A 3BN7A 3GV8B 3H2UB 3HHEA 2KKHA 2W8LA 4HYKA 4DFJA 1FVQA 3MEDB 1FA0A 4H4MB 2CPYA 3K17A 4X66F 1TR0A 2M7SA 1S0MA 3SV3A 1BLUA 5E3AA 1LW2A 4J9SA 3NGSA 3QMQA 3SCIE 3IBCB 4NLDA 3AJ1A 2RDJA 3HZGA 1N6QB 3GIKA 3GFHA 5D3GB 4KGKA 2MJNA 4WKRA 3BKTA 3LO3A 1R43A 4I6YA 2DR5A 4OHYA 2MKCA 2LLZA 2AZ1A 2AQ4A 2V6AA 1VRQC 4IRKA 1M5KC 1GAOA 3PYFA 4LF8J 3IRXB 2OPSB 2DXEA 4KPCA 4ZCKA 2V9KA 1CLFA 4G1IA 3FFIA 1X0FA 3M2VA 3PJWA 4DLEA 4DR4J 4LRDA 3JSRA 3J7ZT 4LRAA 4ELTA 4OZ2A 3P3DA 3TARA 4DOZA 4X64F 3BS9A 4ED7A 5HMZA 3I4HX 1HNVB 4WTYA 4LSNA 3TJAA 5C7PA 3DRYA 2IHR1 3CCVS 4EWTA 2UXCF 1HYSB 3AA9A 2FJBB 3QT6A 2K1RB 2Y1RI 3R7SB 1B4SA 1M5HA 1FFWB 4J9VA 3CCQS 2VC1A 1DTTB 1DLOB 2EWHA 1PAUB 3QT5A 4I67A 2YWGA 3HO1A 3VAMA 3VTIA 4YFUA 4I7FA 2G13A 2DH9A 2ASJA 2AJQA 3QATA 4ZJQA 4H4KA 4XAKA 5T7LA 1S57A 3WBZA 5IWAF 4HDGA 4OHWA 4A8WA 3AOCA 4DCPB 1K1SA 3CJ2A 1RA6A 1VQOS 4X4RA 3BEGB 1IWAA 2B5JB 2DRDA 3KK2A 3PV8A 1NXIA 2PD1A 1CULB 4N41A 2QT7A 4FS2A 2OAUA 4F0KA 5KFWA 5CQGA 2UVWA 1ZA2B 2EEYA 3HPOA 2XMUA 1IBMF 1HBNA 3HHNB 4NLGA 1S9GB 1IJEB 1N34F 3U7JA 2XCAA 5IT0A 4DN9A 3J7A1 4O3PA 3O3LA 4ZIWA 1GT8A 5DG8A 2UUCF 5JXSA 1HQUA 1UCNA 4F02A 5H1SV 1VQ7S 4Q8FA 1HMVB 4KTQA 1NZ8A 4DPTA 2R7WA 3S6EA 2DHXA 4Q7AA 4U7CA 4M5NA 1S0VA 2XY5A 4M5MA 3TX0A 1H73A 2NPFA 4JI0J 4E98A 2VFTA 4X4OA 1UA1A 4A8FA 2N7CA 2WB4A 1SUQA 1WEZA 2LMIA 3DI6A 3VQTA 3EGNA 2W2PP 1NAQA 1P1LA 4U96A 2BQUA 2L08A 3VF0B 4C8LA 2KVQE 4FYVB 4J9UE 3L95X 4PPZA 4J91A 2IPOB 2J9DE 2Y0SD 3R5AA 1H74A 3SCKE 2VICA 3M6UA 4RR5A 1OQ3A 4ID8A 2XC9A 2UXDF 5KG2A 2HWTA 4LF4J 2CZ4A 4DQRA 2EG2A 4TQSA 3OR1A 2KXHA 1SQEA 1S9EA 2AYGA 3OL7A 2EW9A 1SQGA 5HROA 1PC5A 1CJKB 4KGVB 2OJ3A 3AODA 2UUAF 1UMJA 3MI7X 2ZHBA 1HWJA 4ZVEA 3QIPA 4Q2LA 2DR6A 4E8UA 2UP1A 3TZZA 3G82B 1WC0A 2IIHA 3QRPA 2W7OA 4N56A 1X9SA 2ZM6J 1SV5B 2CPEA 1V3RA 2LQBA 2X7IA 1NHUA 2IFXA 1KN6A 2WSFC 2HFNA 1ZETA 2AX1A 2D9OA 1XN9A 2AEJA 4HHUA 1U6FA 2EK1A 2RH3A 2HQGA 3C14B 2XYHB 5C5JA 4R25A 3CC4S 4K2JA 4DV2J 1VC0A 3Q8QB 2QX0A 1I6JA 3NGRA 2Q43A 3MM7B 2XZDB 2KL8A 2JJ4D 4KHPJ 1R8BA 2F4VJ 2HFOA 1RTDB 3EZUA 1CG2A 2KG1A 2Z56B 4FPRA 3EZ5A 1KOHA 2A2DA 2F1FA 1XMQF 4OYZA 1N5YB 5KOXA 4PWWA 3M9OB 2LVWA 1VS3A 4HKQA 3IMQJ 4DCOB 3UO0A 5A0YA 2M2BA 4WP8A 3GYXB 3IC1A 2ZH2A 3UR0A 2FJXA 3FSYA 3HFKA 3PEHA 4V1Ak 2K06A 3MF5A 1ULRA 3D6FB 3MDFA 2PMZD 4C98A 3LGHA 1KQKA 4DSLA 4RBUA 2P9EA 3EYZA 2VQEJ 1LK7A 4XK8C 2A2CA 5HMWA 1TK5A 2VONA 3QRQA 1OYEA 2FHKA 1TKTA 4K0KF 1RT3A 4FS1A 4ILLA 3L09A 3T1YF 2QLFB 3CMES 4NE9C 3M8QA 2E1CA 4G1QA 3W9HA 1SL0A 2D41A 4AFFA 2LQ5A 4ZS6A 2CWXA 1A7GE 3ILIA 5KT5A 4RWWA 3MEKA 2VL1A 2MKJA 2HBYB 4NZ0A 3CCJS 1OS5A 4P75A 4RW9B 2AEMA 3OVAA 3A4TA 2Y3YA 4Q43A 4ZJOA 2R2TA 4WU3A 3W7BA 2HNYA 3PCOB 1YGYA 2GAGC 4EFAC 2XMWA 2CVEA 3DGPA 1GX5A 1FK9A 4WU2A 3N5FA 5L1KA 4IG3A 1JXEA 3THVA 2HBQB 2IY5B 2H5IB 4WTOB 1FERA 3CDEA 1MMDA 4P7VA 3FCWA 2Y1LB 4LF6J 3RAMA 1UEUA 2AGOA 1TAQA 2X1FA 3LPEA 1QVFR 3HK2A 4C4WA 4ZIVA 2V4RA 2UZAA 2RRAA 4CO4A 4RX6A 4ECRA 3GFXA 4F4AA 1R0CB 4LF2A 3MPDA 4QWBA 2EBGA 4XIUA 1R27B 3J81Y 2B9WA 3C6TB 3LGNA 2J7KA 2FLPA 1U26A 2AT1B 3BR9A 3J80U 1T9XA 1RACB 3LP1A 2HVIA 4RW6A 1GMVA 3DLGB 2BANB 3V4IB 2CJBA 3GE9A 1T7PA 2VDIA 1AUSL 2VA3A 4U9RA 3K5OA 2XO6A 3BSOA 2IRYA 1IJFB 4C8MA 5C25A 2V50A 2ZNZA 3NOCA 1AFJA 1TFYA 5F0WA 1U48A 1LXNA 1SC1B 4OZJA 4M95A 3M30A 2DNMA 2VB6A 2QSWA 2BV3A 1RAOA 4NMLA 4CO2A 3C15A 3V5RA 3RTVA 4F2RA 3HHDA 1RUSA 2IJFA 5KFDA 4WCEQ 3FVYA 1WEXA 2FTRA 2Y0BB 3EGZA 2E5LJ 4KGZB 4CT8A 2FJEB 4IFYB 3DRXA 1N56A 3NNHA 1KLMA 5KFMA 1PAEX 3G6XA 4PPDA 2M3DA 1B99A 3RRKA 1LWEA 2GIQA 3NS5A 4HLBA 1GTHA 3H8YA 1HLWA 5KG3A 5DRKA 2YNFA 3HVWA 3N01A 3U02A 1RAGB 4DUZF 2MY7A 4RWXA 4OIXA 2CKWA 3KUGA 4XPCA 3NXZA 3PX0A 4J9KA 2XWYA 3F73A 4FF1A 3D6TB 2W9BA 1DTQA 1PC4A 3ILLA 3PJ9A 2K3KA 4USWA 3SZ2A 1DQ9A 4IUFA 3BB5A 1FESA 1U1MA 3PW5A 1GNKA 2WVCA 4MK9A 3L7UA 1RT4B 1MMNA 1U09A 3MEGA 3U1NA 1FO1A 2E5IA 3SV4A 2IC3B 2VODA 2DNHA 4M5DA 5BXIA 3QJLA 3MCOA 3CO9A 5L1IA 4WIQA 3QZ7A 1RCXB 1RGVA 1RT6B 1WOOA 1YBAA 1VLOA 4MIWA 3K59A 2HQ3A 1D8YA 4DFKA 2C28A 4NZ6A 2WVBA 2QL9B 2JDJA 3PRVA 4PXEA 3PW0A 4DMZA 5E41A 2RF2B 2W9CA 2C42A 4DG1B 1NK5A 2XHCA 3VVUA 2YKOA 4CZCA 2BUNA 4ZOSA 2BJ1A 1AROP 3OTOJ 1B7FA 2CQ2A 4LSLA 3B54A 2E5GA 3LANA 1MN7A 2CXEA 4Y6IA 3KDOA 4RW4A 1OPIA 3DDNA 3MURP 2DNOA 1Q82T 4OQJA 4ED6A 1B7YB 1TV6B 5KT6A 3MD1A 1FRXA 2WCXA 2ZC4A 4F3MA 4NYPA 3CDUA 4S0MA 2EFVA 2JEGA 1GTEA 1YZ6A 3HLUA 1O5JA 4KY3A 2HLTA 1VC5A 2VD3A 2HNDA 1T0TV 5KFVA 5F8IA 2OEJA 2OD6A 5A8WA 4B3TJ 4P6QA 3ETOA 1CJUB 4USJC 3OTCA 3PYGA 1TVRA 3LA0A 3HHLC 4N77A 2KFYA 1UWAA 2FZGB 2GHPA 1REVA 1WHYA 1WSVA 5A2QY 2CJKA 3VVTA 1VQ8S 2NCKL 5I3UB 4OZ1A 1YJVA 3MMBB 4YB7A 1OY6A 2HHSA 2BE2B 1VOMA 4PXCA 1NM2A 2C1EB 4NXMF 3CSKA 5E3CA 1N6QA 4KQZA 3E3XA 1VBXA 2R7SA 4YHHJ 4X62F 3OL9A 1NB7A 1HR0F 3VZIA 3HT3A 3OVSA 4ZPWR 1TZ0A 3KLVA 2CWKA 1YJNS 1X31C 2CQ0A 4O4GA 3IRXA 2OPSA 1LV5A 3TAQA 2ZWPA 4PYDA 2QO3A 2FYXA 2GV1A 2LU2A 1TUVA 2WW4A 2ZH8A 3AOBA 4DL2A 3WX8A 4IOAQ 3GYGA 3U1LA 1S1WB 2HYIB 7FD1A 4ATNA 3CCTA 2ZH1A 3GR1A 5LM7E 4OLOA 3PKYA 4CH7A 2MSSA 2CVIA 2N4CA 2W24A 1VQSA 1HYSA 2K1RA 2M4MA 4LVNP 2ZBIA 4B3RJ 2QA1A 4EI2A 2KDOA 5KG6A 3G96A 3ITHA 3C16B 3TQ1A 4DR2J 4RJVA 4A8KA 2FUG9 4LRCA 2NR0A 2UU9F 1YI2S 3PXGa 3I55S 4MMOA 1YJUA 2YNGA 1G7CB 5LMNJ 2M5YA 2E7VA 2RU9A 3HZEA 2W2OP 1UEVA 3HSDA 2XLJA 2HVHA 5EX3A 2WVEA 5BR8F 2OFGX 4X66J 2JLFA 3P49B 1JLQB 2BA9A 1JLBB 3O5TB 1SJ3P 5F9LA 3LALA 5CYMB 2FHJA 1FRLA 4TVAB 4UOCA 3ISND 1I51B 4QR1A 3EICA 3KLGB 3IWXA 2V2QA 2DXDA 3DDIA 1S4EA 1VLYA 3OHBA 1Y5LB 4C3LA 3HHKA 3WIVA 4C8OA 3NS6A 2MB0B 2FHOB 3FMWA 3HMJG 5IQ6A 4PR6A 1S79A 4NEZA 2VPWB 5J2MB 1R89A 5DJBA 1GMUA 4KT0C 3FK4A 2OH2A 2DNNA 3RJMB 4ER8A 4X64J 3BGLA 3UN5A 3I0RB 1RT1A 2KH9A 2VC0A 4CQ1A 4C2MA 2HEKA 1HD1A 4UUWA 1WDTA 4AUKA 1D1UA 2ILZA 2E1MC 4DF4A 5I3QA 3RBXA 2UXCJ 1U2CA 5RUBA 1D09B 2HFSA 1LFPA 2E7WA 2JNJA 3PZPA 4U7UD 4OV6A 5D6GA 3I4PA 4J7CA 4N47A 5IWAJ 3AD7C 1UFLA 1TL7A 1NBEB 1CJKA 2YX1A 1L3TA 4KIAA 2MYFA 2D3OR 3WIUA 2HHHF 1NK4A 1T03B 3G82A 2R7UA 2JEIA 4OFZA 1X0PA 3EMTA 1U8WA 3FQLA 3MEEA 4YB5A 4DPOA 1IBMJ 3BQ2A 1EAYC 1N34J 2LEAA 4B3MF 1RADB 2ZC3A 4X4NA 5HBMA 1B3TA 4Y28C 3MXHP 1HD0A 1YVFA 5CD4A 1GXUA 2UUCJ 1GEHA 9RUBA 1XQIA 4NL5A 1S0NA 1QY7A 2BABA 3A8IA 3QQCD 3M2UA 3CCES 1MU2B 4WFXA 2RKIA 2UV8G 3FC9A 1BWEA 3RB3A 3OT9A 1RAHB 1NB2A 3QSYB 1Q0NA 4I6WA 4DQSA 4ZLLA 1N8RT 1D9DA 4O3SA 2M0GB 4OZ0A 2YWHA 5J2NA 2DH8A 2FC9A 3BYRA 3N4WA 3N28A 2J9EA 3RUBL 4MK7A 2O1PA 3G6VA 2UXDJ 2HMIB 1FWLA 3KG1A 4IO9Q 4GVBA 4I6AA 3UCUP 4F2SA 1WJ9A 4EO8A 3GYNA 1M5VC 1XBWA 3DYAB 2O66A 2UUAJ 4FBUA 1YRXA 2V8GA 2MQLA 2IMWP 2OPPB 3DMJB 3UD5A 3H59A 2JEJA 2XMAA 3EE3A 4B9SA 4DR1J 1I3OB 2PIIA 1UA0A 1TL3B 2YKPA 3ICLA 2MQMA 4DFPA 1UTAA 2IM0A 2Y1IA 2CIMA 3DLHA 3NY0A 5D4LA 2HFUA 2CDRB 2GVZA 4JUZA 2GMJA 1BUXA 5HLFB 1LWFA 2YXLA 2MZTA 2PA3A 2YH0A 2V8PA 2HVDA 1TMMA 3CJTA 2SXLA 5J2PA 4M63A 3LOUA 4X4QA 1B0PA 3PYDA 4JI8F 1SC6A 1WC1A 1G3OA 4YEAA 3IFEA 3ZZOA 3ZC4A 2NYIA 4TLRA 4ILRA 2ZJRQ 2ZUGA 4ED5A 1KVIA 4D3GA 2CQ4A 3BQ0A 4FP9A 2CPDA 5T14A 4F26A 2Q79A 1SBRA 3CJSA 1XMQJ 4YB6A 1LWCA 3NCQA 5B0FA 2G0JA 2DR8A 1RU1A 4QYRA 2W4PA 4Y0FA 1S7IA 3E8OA 2HFVA 4PWDB 3B4DA 1PG5B 3G8SA 1UPMB 2CJAA 2WOMA 3WZ0A 1X4CA 5E7OB 1U47A 2F7VA 4K50A 3ENQA 2APOA 2K3IA 2BANA 3OTDA 3FCHA 1APSA 5L8RC 3MFHA 4K0KJ 2N3LA 3W60A 4WFAQ 2E5HA 1Q7YT 3Q23A 5T41A 4F67A 3AHPA 1SH0A 3BF4A 3UE2A 3GFZA 2YKNB 4BBYA 4X4UA 3MAHA 4WBFA 2OPQB 3QNWB 3CIMA 2MQQA 3JYTB 4B9NA 3M6VA 3GZ7A 4NZ7A 4F0HA 4UOHA 5CXTA 4PRFA 2R7OA 4F3OA 3HX9A 4L6V3 4O44A 4G65A 4CI0B 4DCJB 4GRSA 3CE8A 2ZOFA 3PY8A 3H5XA 4FXDA 3KJQB 1U0SA 3SFUA 3TZWA 2E1AA 4OI3A 1VC6A 4MAKA 4DXLA 3BKUA 2J8SA 1PILA 1UPPA 4TNOA 4A8SA 4Q45A 1R6VA 2R4FA 4DS5A 4CH1A 2OFHX 2RT3A 4ZPTR 2E44A 3GG1A 1HBMA 3UNYA 2VG6B 2JSXA 3I82A 2KTQA 1FDDA 1PSDA 1K0VA 3L7PA 4NYZA 3EJMA 4NXNF 2MSTA 5F0UA 2EI5A 1WUUA 4DV3F 2MZSA 4O3NA 4F4ZA 1QAYA 4RBTA 1TL4A 2WTFA 2MEWA 1RT4A 5GAEI 1UVIA 3V81A 3CD6S 3RBZA 3CCSS 2FGOA 4NASA 4WP3A 1WC3A 3T5JA 5D0HA 2DGXA 1NDPA 4KPYA 4N7TA 3HULA 2XTJP 5K14B 3HJVA 3SCJE 5GADI 5K8MA 4DG1A 1FD8A 3OJUA 1OJ4A 4Z37A 2XM3A 4Y2MA 1H0HB 1HWKA 2KI2A 4Z7CA 3TJ8A 4AL5A 3CEDA 2HKEA 2F40A 4PUOB 2VFVA 2WRMA 4W90B 3O6QA 2KFNA 3QFWA 4A8MP 3NBPA 4XPEA 2MHNA 1T05A 1TV6A 2QJ3A 1HQ2A 4RO0A 5D4OA 2W7PA 1O8BA 1N54B 3KLHA 3TUPA 5ETPA 3N0VA 1YDLA 4DUZJ 3BBBA 2HNZB 2MKYA 2W2NP 4A46A 2IVFB 5GAGU 4PAAA 5F9NA 1NSQA 2ATCB 4B02A 4WYLA 4UTGA 4CLZA 2BJ7A 3MGJA 4HACB 4PCQA 2M52A 1YZ7A 4H4OB 3GJSB 3IAS9 2G9OA 4L73A 2MTLA 4F50A 1VQ6S 4K5SA 2PI5A 2EVZA 3K5PA 1I94F 1BMQB 4DLGA 2DCLA 2EFQA 1ZAVA 2DGSA 3B4MA 3OXLA 1CPZA 3M2RA 4WK3A 2KXNB 1TL1B 3PIPQ 5I3UA 4NOHA 3PHEA 2HHUA 4HR2A 3J7YI 1SJ1A 4QW8A 3K89A 2XLIA 1S6UA 3PO5A 1XIQA 2O3DA 3QJPA 1KSPA 3R7BB 1RAAB 3QO9A 4CO1A 2OSRA 3M32A 3PR4A 1EKRA 1HBOA 1SCJB 2W01A 4ETZA 3DLKA 3TRGA 3KMSA 1YITS 2QE5A 2PEHA 3JSYA 4UW2A 5FLXY 1QSLA 3K7RA 1JLAB 5CAAA 3I56S 4AE5A 2M8DB 5JVGQ 2XI2A 3TR5A 3H25A 4CNZA 2YKMB 4C0BA 4P74A 1JX4A 1RT7A 4TU8A 2ATLA 1NSKL 4HT7A 3ENAA 4K7QA 4KRWA 1RTJB 1SC4B 3KLIB 4LBPA 5K20B 1URRA 2B7BB 3E01B 4NI2A 2J6TA 1RTZA 2EKYA 1F2GA 4Y2IA 5HO4A 5KFZA 1Y9OA 1U1NA 5FDLA 5AE1A 2K7JA 1Q8IA 1FE0A 3GU0A 3HI9A 1WC4A 1F60B 2V4QA 1WKKA 1CJVA 1SH2A 3D1QA 1EX8A 2QA4G 2FJDB 2I5JA 1JLBA 1OY8A 2DPJA 4Q0BB 4QYZK 5CYMA 2AJ2A 1HWLA 4ED2A 5J2QA 1UJ5A 4IG0A 3KLGA 2R3VA 1PJ5A 4X62J 1HR0J 2MKSA 1R8AA 1QSSA 5F8JA 1VQYA 5D4NA 3I9V9 4RBVA 4CH0S 1U2FA 1YKWA 5EWEA 4QWEA 4ED0A 5KG7A 4WF9Q 4ZVPB 5EX0A 3IG1B 3CJ4A 1S1VB 2QV6A 4ZJLA 1J5OA 5LJ3Y 4J9NA 1EP4B 4ZP6A 1KC8T 4F4KA 1FDAA 2IAJA 3HSGA 3I0RA 3W66A 1AT1B 2KXFA 3RU0A 2ZZMA 2I0XA 1FNMA 4MYUA 1AA1B 5CZVA 3KKFA 2KB2A 1BD6A 2MZRA 4HHJA 2G0IA 4W4MA 3IN5A 2V5HG 2N82B 4BS2A 2HGMA 5B0BA 4F8RA 2C3MA 2GO8A 2VKRA 3DOKA 4IKAA 2UU9J 4MFBA 1Y5NB 2CQ1A 4OX9F 2KT2A 2XG8A 4MH8A 3BH6B 2I9SA 2H5JB 5ETLA 3MECA 5ETMA 5KT7A 3TUZC 5BR8J 1VBZA 5A6PA 4NCGB 3ENVA 3OD2A 4DI6A 4CLYA 3MFIA 3SDEB 4DU8A 2DNYA 1N5SA 2OPRB 3N6MA 3UCGA 2C2ZB 2F4VF 2CNOB 1RT5A 2V69A 5C24B 2XMTA 1XJWB 5DDOC 3RBEA 5THWA 4IDKB 3NMAA 2RIJA 2OKQA 1TU0B 1QLNA 3THTA 1MU2A 4C9DA 3T1HJ 2GGPB 3GR0A 1VIXA 3K5NA 2G2OA 1F5CA 1BQMA 1JXLA 3AAWB 2BX6A 2QL7B 4DPXA 2RUSA 2JH3A 4M1KA 3VAIA 3BJYA 5LSRA 1H2TZ 3KNAA 3UVJB 2FVSA 3HDSA 2KN4A 4NMXA 2ZE2B 3CUNA 4IRDA 1IUJA 3ZZTA 1D8ZA 1HL6A 2ABYA 2KHDA 5E33A 4X84A 3BDPA 3GG0A 3A1YG 4U95A 5HN0A 3QAEA 5GMDA 3CD7A 4KV8B 1EETB 1LW0B 2PFFB 1YLXA 3Q8YA 3DOMA 1DZ5A 2W9AA 4JI6F 2AU0A 4OX6A 3S01A 1HNWF 2HAFA 1L3UA 2HHHJ 3DMJA 3MM9B 5M2RA 4B9VA 2DNLA 2YNHB 2FB0A 3MMAB 4DSEA 2ZKUA 1UWBB 4IYQA 2DITA 1FJEB 1TL3A 2CJXB 1JB0C 5HAOA 2CNLB 4USVA 2F8HA 3JSMA 1YIJS 3W2VB 2Z57B 1S6QB 3BM7A 1FEHA 3QGPA 5HLFA 3I9ZA 3PEJA 2DISA 1WOSA 5DETA 3ZTSA 3NMRA 1KVJA 1L3VA 1T3OA 3CJ0A 2DR9A 2QA2A 4LIWA 3SQGA 4UY8T 1UW9A 3DHWC 2VZ9A 3MR6A 3MD3A 4B08A 4IQXA 1H38A 2DGWA 1D9FA 2FC8A 1H6KX 2CQIA 1CJTA 1SI9A 3CDBA 1FTRA 4IR1A 3QJJA 2XMKA 1N0UA 3D6MB 5A8KB 3OSPA 5JVHQ 3BN4A 4ES1A 4LSZB 3CJKB 1RWXB 4YMEA 2EKNA 1RAEB 2BQ3A 2HHWA 5BJRA 3M8PB 2I2YA 5H9FK 4JOUA 2GQ2A 2HAIA 5KFQA 1Q1KA 1PJ7A 4OZ3A 2HHPA 2LXFA 2R7RA 2BYCA 4PWDA 1C1CA 1BHNA 1DJ0A 3PYEA 1M90T 1OSDA 2DB1A 3BREA 3BH7B 2AD9A 4OYPA 1JLEB 2ROPA 2QYCA 2AYEA 4OI0A 5KTQA 2LEPA 4M8LA 3LP0B 1U0HA 2YNIA 2IA6A 5CYQA 4K8RA 1WKLA 2RMLA 4UOFA 1MROA 4PXBA 2JWNA 4NRUA 1UEKA 3T5KA 2ACYA 5E5NA 1CC8A 1KKHA 2NSCA 2OPQA 3IGVA 4ERDA 2ZH3A 4JP8A 1FKPB 2CNKB 2Z2ZA 3UDCA 3JYTA 3MWBA 1VQNS 3CNQP 3HVTB
chains in the Genus database with same CATH topology
3DM2B 3QJLA 3CO9A 5L1IA 3TA0A 3DXSX 1WD6A 3QZ7A 3GFYA 2GJ2A 1RGVA 1RT6B 2COLA 1QE1B 3M6XA 2MQOA 3D2WA 1YBAA 4ECXA 1IBLF 4ELUA 1S99A 1KR4A 2XBPA 5IT9Y 3UI3A 4ID5A 3BGUA 4MIWA 3LAKA 4QIEA 2HQ3A 5HL7Q 3K59A 1NHVA 1D8YA 4DFKA 2C28A 4NZ6A 3PW4A 5E3QA 2JDJA 2VBYA 3K2YA 4DJBA 3D0IE 4PXEA 3AQOA 4F4YA 3N79A 3D5MA 1VGYA 4K5RA 4DMZA 3M8RA 3PW0A 1NJWA 2B9YA 5E41A 2RF2B 2W9CA 1RT1B 3HKZD 3I0SB 2ZITA 5IFMA 4EZ6A 2C42A 4DG1B 2KT3A 3MOZA 1NK5A 3LH2S 5KG5A 4R5PA 3SDEA 4USHA 3Q24A 1IN0A 1E6YB 2YKOA 2B6AB 2OPRA 4M94A 1UW4A 4CZCA 2BUNA 3TVKA 1FD2A 4ZOSA 3FRZA 3NGDA 1AROP 4FBTA 1B7FA 1S9FA 2CQ2A 4KC5A 1X4AA 4A4JA 2RQKA 4LSLA 1U1QA 1SXLA 1KHVA 2E5GA 3LANA 1JLCB 1WF2A 2UUTA 1VHFA 3DU6A 4GC6A 3OW2R 3QPIA 4Y6IA 2GA7A 3GIIA 1UFWA 4RW4A 3SEOA 2G0CA 4WE1A 4C8NA 3CPWR 3MMCB 3CCLS 1OPIA 3DDNA 3MURP 2DNOA 4CTAB 1NJZA 1Q82T 4OQJA 1P1TA 4WXWA 3KHHA 4ED6A 3TW0A 1WG4A 1B0TA 2N3OA 1FJGF 1X5PA 4EO6A 2D74B 2GGPA 4ED1A 1KTVA 1TV6B 5KT6A 3MD1A 1FRXA 3HP6A 2WCXA 2W7AA 4PG5A 2ZC4A 2P5VA 2BJEA 5GAGI 4RW9A 3IR6B 1WHXA 3CJ3A 1RI7A 4F3MA 1O0PA 5KT3A 4NYPA 2ASYA 3TO8A 3CDUA 4DQIA 3K0JA 2ZOMA 2EFVA 4JI0F 2JEGA 3DLBA 1GTEA 3HLUA 1TK8A 1O5JA 1T8EA 1YJWS 2G1DA 2HLTA 1VC5A 4A48A 2VD3A 5DM7Q 1S1UA 1TKXB 2HNDA 4A8YA 5KFVA 2L48A 3TP2A 5F8IA 1RKIA 2XGQA 1UL3A 2ASLA 4I1TA 3MPVA 1IKYA 4X4VA 2ZE2A 3DLEB 4Y2CA 3DFEA 2OD6A 3R27A 4LSNB 5A8WA 5IXUA 1XTZA 1VQLS 3KHRA 1NU4A 4Q5VA 2KRBA 2VPYB 3ETOA 1N88A 4P6QA 3LF0A 2R8JA 2DBBA 2J0SD 4USJC 4Q2MA 1IKWB 3ENWA 3OTCA 3MEEB 3AB2B 1JNZB 1R7IA 1X4FA 3C6UB 3NL0A 3BO2A 2C3OA 1TVRA 5GAEU 4LQ3A 3PFOA 1UKUA 1JNRB 3AA8A 2X3GA 4ZDNA 5LXRA 1NK8A 3NWGA 1Q7LB 1FE4A 3HHLC 5KFSA 4ECYA 4N77A 2XO7A 2KFYA 3MR2A 1CQNA 2GHVC 2GHPA 1REVA 2J6UA 4KV8A 4R0JA 3KK1A 2LEBA 1EETA 2Z0GA 3GMGA 5HBMB 1X4HA 3ISNC 1WHYA 1LW0A 4ZKAA 3CCWA 5G0RB 5A2QY 1BQNA 2MZ1A 4LMZA 5K14A 4AYBD 3OHAA 2CJKA 1HW9A 2Z8QA 3F41A 4LF4F 2UXBF 5M2PA 3G4SS 1VQ8S 5I3UB 2KFZA 2CPHA 2M88A 4KBIA 4OZ1A 1YJVA 3MMBB 4YB7A 3CC7S 4OI6A 3K5MA 1QAJA 1N5VA 4HH1A 2HHSA 2BE2B 1U24A 3M2UB 5J1PA 2QZ8A 4JI1F 2WB1D 2DHGA 5GADU 1VOMA 1KEKA 3C6TA 4PXCA 3RYLA 2RKIB 4NXMF 3CSKA 2PO4A 3DRRA 4KO0B 1SIZA 1IKXB 3EPIA 5E3CA 1N6QA 4KQZA 3E3XA 3QZ8A 3D28A 4EEYA 3TAPA 2IRXA 2OTJS 5C42A 4PQUA 3MM9A 1VBXA 2J0WA 2R7SA 1JLGB 4X62F 3OL9A 1NB7A 2ZVSA 1HR0F 3VZIA 3HT3A 3OVSA 4J9LA 3T1AA 4WJBA 4ZPWR 2GQCA 2KG0A 1B64A 1FNOA 1N5QA 2YNHA 1TZ0A 2IA0A 2PDAA 3SSRA 1RK8A 3MMAA 5KG4A 1F5BA 3KLVA 1U6BA 1UWBA 4TY8B 1YJNS 2R9LA 4ZVHA 2CQ0A 4O4GA 1S6PA 3RZAA 2HVZA 4ZA1A 3IRXA 1D9AA 2OPSA 2ZM6F 3DLGA 1LV5A 2R7TA 3TAQA 4EBDA 1YSJA 3V4IA 3GB0A 3JB9k 4NLXA 3MZIA 2JEFA 4ZPDA 2QO3A 5HMXA 1C4AA 6FDRA 2C3PA 3LGMA 1CVJA 3W2VA 1URNA 1KONA 2LXIA 1F5AA 3VAJA 3HM9A 3CD0A 2FLOA 2GV1A 3FQKA 5J2NB 2B4OA 2CQCA 2LU2A 2OLWA 5FD1A 1TUVA 5U47A 4RZRA 2ZH8A 2DNQA 5D78A 2VBZA 3G9CA 2XGPA 4DL2A 1N52B 4KR0B 2DHAA 2VFSA 2DNKA 3HJFA 4IOAQ 2HNZA 3U1LA 1S1WB 2HYIB 4L3NA 1HA1A 4ATNA 3CCTA 7FD1A 4ECUA 2ZH1A 2OP5A 4K4SA 4JI3F 3GR1A 1AW0A 5F8LA 2YX4A 4URQU 2JFKA 3DNCA 4OLOA 1VFJA 4WZMA 4DN0A 4YDDB 2HQIA 2X1AA 3PKYA 4CH7A 2KT5A 2MSSA 2CQDA 2QA4S 4EUVA 4QWCA 2CVIA 1TKZB 3KJVB 2WW8A 1W25A 1HFEL 2N4CA 4DV2F 2W24A 3F44A 3VQSA 2B4PA 5G4DA 5I42B 2A3JA 1C2PA 1NNDA 1VQSA 1WWHA 2HS0A 4E0DA 1XC9A 4KHPF 4IFYA 1LQ9A 1MNEA 1NK9A 4MKAA 1HYSA 4ECVA 7FDRA 2K1RA 1U49A 2M4MA 2R8GA 3OTEA 4I2PA 2ERRA 4LVNP 4C8ZA 1OIAA 4QQBA 2JLGA 2ZBIA 3NAHA 1V9OA 2AGQA 1V3SA 5F8HA 1FT8A 2QA1A 3T3FA 3QYYA 1C0UA 5KFUA 2KDOA 5KG6A 3G96A 1Y3JA 3ITHA 3NCRA 2VKZG 2J6SA 1SUQB 3TQ1A 2MGZB 1P6TA 3DI6B 1RTIB 2O01C 2XWXA 1WACA 5K5MA 3L3CA 5KAKA 4A8KA 4BC9A 3M8PA 2F9JA 2FUG9 4ZPVR 2NR0A 3KLEB 2RVJA 2GO9A 4NCBA 4KFBA 1XNQF 2UU9F 3B82A 4TN2A 3TYTA 3PXGa 1YI2S 3I55S 2LXUA 4MMOA 1YJUA 3G8QA 4F4WA 2F3JA 2YNGA 4P2SA 1W2IA 5DQHA 3RB4A 1J5EF 1G7CB 4N8NA 2M5YA 1VK3A 2RU9A 3TANA 3HZEA 1LXJA 4MJKA 2E9ZA 4ILMA 3MM5B 2QLXA 4HTJA 1H7WA 1LWFB 3J7YU 1WTBA 1UEVA 3OLAA 2J76E 4ZCIA 2XLJA 3IS9A 4Z2XA 4ZP8A 4BDPA 2HVHA 5KT4A 5DGAA 1VRUA 1ZH5A 2AV5A 1C1BB 5EX3A 3DRSB 5J1EB 2OFGX 3OPKA 5BR8F 2JLFA 3P49B 2WAQD 2JL9A 1JLQB 2BA9A 4ZMMA 1K8AT 3MR3A 3OR1B 2X51A 1JLBB 1I1GA 3O5TB 5J2PB 1SJ3P 5F9LA 3U1MA 1HWUA 3LALA 4DV6F 1JLEA 3HHLD 5CYMB 2FHJA 2VQEF 1TFWA 4LJMA 1ZAXA 1FRLA 2E29A 2FLNA 2CQBA 5SUHA 3LP2B 4UOCA 1U6ZA 4DEZA 1CQMA 3ISND 4QR1A 2O5DA 1FKOB 3LP0A 3KLGB 2FJVA 4ZHRB 3IWXA 2HFZA 2VG7B 5IS2A 4XDCA 2BDPA 3I6PA 1HBUA 2DNZA 2DK2A 1M1KT 3VAFA 5LSOA 2LU1A 1VLYA 4LFAF 3OHBA 4CCHA 2MY8A 4HT5A 1Y5LB 3PKMA 4RNHA 3D0HE 4DR6F 1JLAA 2PC6A 4C3LA 1NKEA 1C4CA 1UVMA 3NCPA 3DRPA 3OLBA 3HHKA 4KGMA 3NP5A 3GIJA 4Y3CA 2V8DA 4X4TA 4C8OA 4YB1P 3NS6A 2MB0B 2FHOB 4Y65A 1XR7A 5LMUF 1Q53A 1WEYA 1FKPA 3FMWA 3OUYA 1FXRA 2I1RA