2YKFA

Sensor region of a sensor histidine kinase
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
286
structure length
263
Chain Sequence
MSTLGDLLAEHTVLPGSAVDHLHAVVGEWQLLADLSFADYLMWVRRDDGVLVCVAQCRPNTGPTVVHTDAVGTVVAANSMPLVAATFSGGHSVEVSPVRFGDQVVAVLTRHQPELAARRRSGHLETAYRLCATDLLRMLAEGTFPDASRSSPRAGDGFIRLDVDGVVSYASPNALSAYHRMGLTTELEGVNLIDATRPLISDPFEAHEVDEHVQDLLAGDGKGMRMEVDAGGATVLLRTLPLVVAGRNVGAAILIRDVTEVKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE SENSOR HISTIDINE KINASE PDTAS
publication title The Sensor Region of the Ubiquitous Cytosolic Sensor Kinase, Pdtas, Contains Pas and Gaf Domain Sensing Modules.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 76
structure length 263
sequence length 286
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12282 H_kinase_N Signal transduction histidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2ykfA02
3.30.450.280 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2ykfA01
4L9FA 5G4YA 1DP8A 3GDIA 4R3AA 1EW0A 2ZOHA 4H6JA 2QHKA 4HNBA 4KUOA 2QJ5A 3LIFA 2VV6A 3VE4A 3CWFA 2V1BA 3PYPA 1T1CA 1GSVA 1T1AA 3NOUC 4HP9A 4WN5A 1DRMA 2BASA 4WLAA 3LIEA 3RTYA 2WKRA 5HSQA 2D01A 2Z6CA 4LRYC 4HJ3A 4DJ2A 1DP9A 5F68A 3LICA 1V9ZA 3K3DA 2PD7A 2GJ3A 5HWWA 3F1OA 2W0NA 2YKFA 3VE3A 1XFNA 2KX6A 3LIAA 1VB6A 2B02A 1UGUA 3MXQA 3NOTC 1UWNX 3G6OA 4YWZA 1JNUA 3VOLA 1LT0A 4HOIA 2VV8A 4BBUA 2OWHA 2R78A 2I9VA 2WKQA 4EERA 4L9GA 2PR5A 2PR6A 2JHEA 4GCZA 4R6LA 3BWLA 1MZUA 1TS6A 1G28A 1F9IA 1LSWA 4KUKA 5AVFA 3IBRA 1OTEA 3EEHA 3IS2A 1S1YA 2J80A 4B9OA 2ZOIA 3KX0X 5HD3A 2PDRA 1OT6A 1P0ZA 1S1ZA 3MFXA 3SW1A 3K3CA 1GSXA 1D7EA 3UB6A 1X0OA 1DP6A 1XJ2A 2VEAA 1OTBA 3FG8A 4HP4A 4NXEA 2ZBBA 4JGRA 5A8BA 3CLOA 3F1PB 5HDCA 2V9AA 5I5LA 5DKKA 2V0WA 5F6AA 5F5YA 1OJGA 1OTDA 3A0RA 4R38A 3MJQA 1N9LA 2OWJA 2PYRA 4E04A 4GS9B 1Y28A 4XT2B 3F1PA 2K7SA 4MN5A 4GHIB 1LL8A 5HDDA 3E4OA 3C8CA 3OLOA 5DJUA 1ODVA 2YKHA 4GS9A 5EFWA 4XT2A 3UB9A 1GSWA 3E4PA 4EEPA 5F69A 4WL9A 4GHIA 1BYWA 1T19A 3T50A 4EEUA 5DJTA 4EETB 3NHQA 1LSVA 4R70A 3F1NB 4I39A 3FC7A 4BBVA 3PHYA 2L1MA 4KQDA 3B33A 3F1NA 1XFQA 1OT9A 3A0VA 1LSXA 3D72A 3NJAA 4PKYG 4EXOA 2OOLA 1NWZA 2L4RA 4HJ6A 4MN6A 5DKLA 3LI9A 3ULFA 1V9YA 3BY9A 2M1CA 3LYXA 4PKYA 3P7NA 2P7JA 1OTAA 3E4QA 1KOUA 5HWTA 4WUJA 4LRZE 1N9NA 3H7WB 4HH3A 2QKPA 2JN7A 3NOPC 4L9EA 3MQOA 3UMEA 3H7WA 4I3IA 5IU1A 2INWA 2W27A 2EA9A 4HY8A 4BBTA 2VLGA 2PHYA 3A0SA 4HHDA 3LI8A 4JGOA 4M4XA 4NXFA 1OJ5A 4H6JB 3UMDA 3GECA 5J3WA 3HJIA 3MR0A 5HZHA 2H28A 4NXBA 4LRXC 5J7EA 2CMNA 2V1AA 1S4RA 4EESA 4I38A 1TS0A 5HD5A 2PYPA 2A24B 1P97A 4I3AA 4WF0A 2V0UA 4HJ4A 2QWSA 3H82B 5TBMB 3MQQA 2A24A 3F1OB 5HDSA 2L0WA 4HH2A 1N9OA 2WKPA 4NXGA 2HV1A 2PD8A 4F3LB 3H82A 3UE6A 2Z6DA 2D02A 5TBMA 4EQ1A 3EWKA 4I5SA 4F3LA 5J4EA 1XJ3A 4I3JA 2QJ7A 3LUQA 3ICYA 3LIDA 4JGPA 5HWVA 5AVEA 1F98A 1TS8A 4HI4A 1T18A 3HJKA 1S66L 4LLOB 4GW9A 1T1BA 1S67L 5KIZA 1WA9A 1S4SA 3UB7A 4RQ9A 4LPZA 5G4ZA 4JGQA 3BY8A 4HQAA 1XJ4A 3IS2B 4EW7A 2VV7A 3CAXA 1D06A 3ZQ5A 3UB8A 1OTIA 4K08A 4DJ3A 3LIBA 5IS1A 3H9WA 1TS7A 2KDKA 4HIAA 1UWPX 3RH8B 1XJ6A 3C2WA
chains in the Genus database with same CATH superfamily
2ZMAA 1GHMA 4JXVA 1KDSA 5G18A 3OBFA 4M3KA 4DXBA 1ZTUA 1ERMA 1GA9A 2VJWA 4NKPA 5GHYA 2ZOHA 1L0EA 1NRJA 1SKFA 3HLDA 4LV1A 4HNBA 2Y4AA 4BL2A 3CITA 1G6AA 3T1XA 3UY6A 5E43A 2EXBA 3LIFA 2VV6A 3JYIA 3RJUA 3CWFA 4P0MA 2Y79A 1T1CA 4S2MA 1YLJA 3NOUC 2WKEA 4WZ4A 3EGXC 2BASA 1PI5A 1Z09A 1YMSA 1K55C 4OVDA 1XGIA 2Z6CA 2Z2MB 4HJ3A 3LICA 3LGOA 1GA0A 2WKHA 1XA7A 2PD7A 4FSFA 3F1OA 4E3OA 2JKRM 4R4RA 3VE3A 1XFNA 4OPYA 3MXQA 4OONA 5HL6A 3G6OA 4YWZA 4OKPA 1JNUA 3W4OA 1PFLA 2JCHA 1YPRA 4HOIA 2Y2JA 2VV8A 1PW8A 2V8CA 1TVFA 4DF6A 1SCWA 2XD5A 4K91A 2PR6A 2A49A 1WYBA 1MKMA 3IF5A 1P9WA 1FQGA 3DTIA 4LCMA 4KUKA 3T1QB 3CG5A 3CHWP 1M6KA 4X25A 5KZHA 1KGFA 5CTMA 3TSGA 3G35A 3G2ZA 3S4XA 1S1YA 2EFXA 3CZDA 2J80A 1EI5A 1XGJA 2ZOIA 5IT5A 3KX0X 2G2UA 3CPTA 1OT6A 3AGEA 3DWZA 4OLDA 1LI9A 2WYXA 2XGNA 3UB6A 1DP6A 4MN7A 1OTBA 3FG8A 3NULA 3S7PA 5TJJA 4JLFA 1L0FA 2H10A 4JGRA 5A8BA 3CMZA 4OOLA 3CLOA 2JKTM 5I5LA 4Y0OA 3KYQA 5F5YA 3AGFA 2HJ9C 3A0RA 5E2EA 2OWJA 2PYRA 2WK0A 3C7UA 4Q0IA 3HLWA 4GS9B 1Y28A 4GKUA 3VOYA 3C7VA 5CEBA 4C3QA 1LL8A 1K57A 4GS9A 4IVKA 1LHYA 3UB9A 3FYZA 3UE1A 4B88A 3UE3A 3E4PA 3HREA 5F69A 2ACGA 4DE3A 1BYWA 5DF9A 2K2NA 5CTNA 1ZKJA 4Y13A 1DJBA 4EETB 3NHQA 1RCJA 3S7QA 4ZTKA 1W8QA 1XP4A 4I39A 3VP3A 5CGWA 3G32A 2HDUA 3KSIA 3BM6A 4H8RA 4CLCC 4L0LA 4QWOA 3E98A 1HD8A 1KVLA 1LSXA 4KENB 3D72A 4KZ5A 3JPUA 2WKIA 1XKZA 1NLZA 1KGGA 1NWZA 2XFSA 3O87A 5L8MA 2Q0OA 2ZL1B 3ULFA 3T1RA 4OQGA 3ZVTA 3NCKA 4Z9QA 3LYXA 2WGVA 4JBFA 3P7NA 2ZL1A 3DTKA 1KOUA 4Y5FA 3PBNA 4O7DA 1YLYA 4O01A 2EX8A 5EUAA 1Q2QA 2QKPA 3HUOA 4X69A 5TR7A 4GD8A 1H8MA 3MXRA 2O0YA 2W1TB 2EA9A 2VLGA 2O9AA 4ZBEA 4S2JA 2R9WA 2Q9MA 3HVFA 2W1TA 4NXFA 1OJ5A 3PBTA 2ZC4B 3DAVA 3L9KA 5J3WA 3W2ZA 2ZQ8A 4WEJA 1NRFA 2EX6A 2X01A 1Y4OA 5HZHA 3GV9A 1LL9A 4KQRA 1RP5A 1HLUP 1IELA 5HX9A 2Y91A 5FQKA 3ZG5A 3RXWA 2ZQ7A 4LRXC 1HVBA 4O0PA 1STZA 2VA0A 4E3LA 2HZ5A 5EECA 5HW3A 3HLGA 4QJGA 1QMEA 1PYYA 3LY4A 5HD5A 2PYPA 2JBFA 3WWXA 5FSRA 4IJGA 4KZAA 2RL3A 3MMHA 4WMCD 4WF0A 3R4KA 4GJ4A 3H82B 1Y54A 5TBMB 2XA7S 1HZOA 5HDSA 5L2FA 1GHPA 1N9OA 5J8XA 3EGDC 4MDZA 2XEPA 3K2NA 4GD6A 2Y2KA 4F3LB 1MPLA 3H82A 3UE6A 1M40A 2ZC3B 5TBMA 1NYMA 3G30A 5GLDA 3EWKA 4I5SA 4F3LA 3IBJA 4I3JA 2Y55A 3HLEA 3GR2A 4JGPA 2UV0E 1W5DA 1PNEA 1A0KA 2ZQDA 4HI4A 1PWDA 3EOIA 2GDNA 4X68A 1K6RA 2W3EA 4ETZA 1K54A 4OOMA 2CC1A 3JVUA 3S7OA 2J3TC 4A5RA 4S2OA 5G4ZA 4KG5A 4U0XA 1QMFA 1BLCA 2X71A 2IWDA 1NZUA 1U60A 4EW7A 2VV7A 1W79A 5EVIB 1BULA 4DJ3A 1ACFA 3T4JA 2Y2NA 4OPQA 4Y17A 4N92A 4IEDA 4R3BA 3O86A 4LFUA 5EVIA 1TD5A 2PU2A 4RX2A 4HIAA 1UWPX 3BFDA 1XJ6A 3PBOA 4RA7A 2A3UA 1H0MA 3E2KA 5G4YA 1MC0A 2ZC7A 2PBDP 2HGVA 1DP8A 5DF7A 4JPMA 4R3AA 3ZNTA 2WAFA 4H6JA 2P08A 4OLGA 4DE2A 1JWZA 2QJ5A 4N9LA 2GX5A 3HUMA 5CGSA 4WEKA 1ES4A 4KG2A 3VSKA 2E8IA 4LGWA 4AFIA 3T1SA 5FAPA 1KE0A 1K25A 2XLNA 1EROA 3QP8A 4MEZA 1ALQA 3LIEA 1L3LA 1CI9A 3KYZA 5HSQA 3NBLA 3Q7VA 5CEDA 2VK3A 1ES3A 3BJNA 2GJ3A 4BJPA 2A2LA 3IWIA 5GHZA 2BTFP 1WE4A 1UWNX 3O5YA 3MKEA 3VOLA 1LT0A 2Y2HA 4BBUA 3IHAA 3KYEA 2R78A 2XFTA 3VOZA 4EERA 4L9GA 3NIAA 3RFBA 4MBKA 5EVID 3HCYA 3WS4A 5E2FA 4DDSA 3HLBA 3UNWA 3BLSA 1F9IA 3IBRA 3B42A 5JYPA 3ZG8B 2Y2OA 4RYEA 1YMXA 5E2HA 3MQ0A 1VETB 4IVIA 1D1JA 3PR6A 4B4ZA 3UN7A 1PZOA 5DFXA 4MBHA 1P0ZA 1VETA 3SW1A 4EBLA 4BD0A 2J8YA 2Z2LB 1JWPA 1YAXA 2H5SA 4Q0JA 4OQIA 1SDEA 4K0XA 3VP2A 4HP4A 1PWGA 3CI6A 2FFYA 3IF6B 5GLAA 3S22A 3N8LA 2XROA 3F1PB 2EWVA 3HLFA 1H5XA 2HF6A 5DKKA 4QY6A 5F6AA 3Q82A 3ITAA 3MJQA 1N9LA 4UQIS 3F1PA 2K7SA 3VSLA 1BT5A 1YLWA 4FOFA 5HDDA 3E4OA 5C5KA 2HP9A 5I94A 4PM5A 5A92A 5DVAA 5HPFA 4EEPA 4E6XA 5E2GA 1T19A 5FL3A 1E25A 4EEUA 5DJTA 5L07A 2HP6A 1CEFA 4E3NA 4IHQA 3ZVWA 4EBPA 4DE1A 4ZRRA 3F1NB 1FOFA 2B5RA 3FC7A 4FCFA 3ZFZA 2KOIA 1Q2PA 4JXSA 2L1MA 3F1NA 3UE0A 1ZC2A 4R4SA 3LO7A 3A0VA 1K57C 1NXYA 2EWWA 1VM1A 2L4RA 1YKDA 3S1YA 3UPNA 1V9YA 3OPLA 4PAUA 1KGEA 4BENA 2NUPC 2PRFA 3E4QA 1RGZA 2JKFA 4WUJA 4LRZE 4P87A 3GVBA 3TOIA 3WRTA 1F2KA 3VFHA 2GNXA 1L0DA 1DJAA 1YLTA 3M2KA 2JN7A 4L9EA 1W8YA 3R7WB 5DTTA 1SZVA 2J9PA 4KZ8A 4O8GA 5F83A 3V5MA 4BBTA 1IKGA 1MWSA 5FI6A 4HHDA 4ZDXA 3LI8A 2UWXA 5FI7A 5CECA 3EQVA 1CI8A 4GOGA 4BQMA 3IX4A 1CK3A 1CEGA 2O99A 1K55A 1IYSA 3HJIA 1AXBA 3PAGA 2JKTI 3MR0A 4ARZB 4DE0A 1ONHA 4UEYA 2PT7A 1BLSA 4NXBA 4ARZA 4BLMA 3C5AA 2Y2QA 1S4RA 4DRTA 4ME4A 4X1LA 2Y2LA 2FZ0A 4JKTA 3DBAA 1P97A 1L0GA 4I3AA 2V0UA 3N6IA 1P9RA 1K6SA 1K56D 3PBSA 3C4PA 3U2AA 4MNRA 3IQAA 1W7FA 2HV1A 1JTGA 5FATA 3OCLA 3T4OA 3UDFA 4Z1WA 3E2LA 4WMCA 4DKIA 5J4EA 3ZG9B 4PM6A 4Y0TA 1PRQA 3IH9A 4BL3A 1W63Q 4WZ5C 3TE8A 4CJNA 2DMWA 3NECA 1TS8A 3QP5A 2QZ6A 1T18A 4R3JA 3FPWA 4X6TA 2FFFB 4HBUA 2XD1A 3LR3A 2I72A 4LV2A 1PWCA 5KIZA 3UB7A 5FAOA 2KLIA 2ZC5B 1BLHA 4JXGA 1XJ4A 3IS2B 3VP0A 4PPRA 3CAXA 3ZQ5A 2ZJ9A 3WRZA 3M6HA 2IWBA 2XA7M 3SZTA 4WBGA 2BLSA 1MY8A 2JC7A 3C30A 1TS7A 3S7NA 1S6RA 3W8KA 1FCOA 4KZ4A 2W3DA 2JE5A 3RH8B 2QHKA 4D2OA 5FQIA 2R9XA 4P6ZM 3MXSA 5GLCA 3B47A 4C6YA 4S2NA 4N1HA 2Y8HA 5IHVA 1NLYA 3V39A 4U3TA 2GZAA 3ZDJA 3GDIA 4OP8A 3GTCA 1IYQA 4X1MA 5BOHA 1JTDA 2G2WA 2V2FF 4OOYA 3QNCA 3VE4A 3JVVA 3NY4A 2V1BA 2J7VA 4FD8A 4GZBA 2ZQCA 1GSVA 4QU3A 2JKGA 1ERQA 1NJ4A 4WN5A 3HL9A 5FDSA 5CHUA 4WLAA 1WYCA 4B4XA 3PXPA 5CHJA 2ZM2A 4QPRA 1SHVA 3VP1A 4D60A 4LRYC 2PBYA 5KMWA 4DJ2A 5A91A 4KG6A 4XUZA 1DP9A 4JXWA 4CPKA 3K3DA 1MWTA 3LFVA 3LR5A 5HWWA 3SS3A 3DTMA 1MKIA 3UPOA 3W4QA 4KZ6A 2W0NA 2VGKA 2KX6A 3LIAA 1VB6A 4Y0UA 5DFYA 2B02A 3I7JA 1UGUA 1DY6A 2LB5A 4EUZA 5EVLA 2VZWA 2ZMVA 3IX8A 2WGWB 5M1AA 2XQZA 1G6OA 5LBRA 2ZM0A 4HBTA 5GHXA 2I9VA 2WKQA 2PR5A 1EWZA 3LR0A 4GB7A 1YT4A 3BWLA 2EX9A 2V8FA 3GRJA 1NZOA 1TS6A 2VX8A 3ZNYA 2H0YA 1G28A 5FQMA 1H8YA 1LSWA 2DCFA 3QP1A 5K5BA 1AWIA 3T4TA 1XA1A 1BUEA 4OPZA 3Q07A 3EEHA 4DN0A 3NC8A 4PMAA 3OPRA 3A3DA 5EOOA 3EQUA 4GDNA 1JVJA 1DJCA 4BWIA 3ISGA 1PZPA 3MFDA 3IXGA 2ZQ9A 2XDMA 2PDRA 3QP6A 3N4IA 4R23A 1S1ZA 3MFXA 1FILA 2EXAA 3K3CA 1GSXA 2VEAA 1XJ2A 2WAEA 4IUHA 2VKSA 3OC2A 2VGLM 3CJMA 3IX3A 3KSGA 2OLVA 5FAQA 4CLCD 4S2LA 4GLQA 1K4EA 4OQHA 3MS6A 2ZBBA 2WADA 3P98A 4GNUA 5D3OA 2IWCA 4UA9A 3TW8A 5HDCA 4F94A 1TDLA 3PTEA 4RX3A 1CF0A 3BFFA 1OJGA 5EM0A 1OTDA 1L2SA 3Q7ZA 1ES5A 2QYBA 3ZGAB 1K38A 4RVAA 5L09A 2BG1A 3TG9A 4WM9A 2OV5A 4XUXA 3UB5P 3N7WA 4ESPA 1IOUA 4GN2A 3C8CA 5HAIA 1ODVA 5GLBA 2YKHA 3BQAA 3ZG7B 3D9YA 3ZHHA 1GSWA 1O7EA 2PAVP 4ZAMA 1OMEA 3BFCA 1ZG6A 4NETA 3VFFA 1YSPA 2ZMFA 4BBVA 3WS1A 4KQDA 3B33A 3UO9A 3W4PA 1XFQA 2HDQA 3UDXA 1J3WA 2K31A 3NJAA 2E8JA 1MBLA 4EXOA 4NK3A 2ZC6B 4HJ6A 4MN6A 3CUEA 5DKLA 4G3VA 2G7UA 1ESIA 3N8RA 5GL9A 3BY9A 3B3XA 3BLMA 2M1CA 1HTZA 5M18A 3ITBA 4YFMA 3A3JA 2P7JA 5FASA 1VQQA 1YLPA 1OTAA 2XK1A 5EE8A 5HWTA 1FCMA 3WS5A 5AQ7A 3IWOA 3MZDA 3SS5A 4HH3A 2B18A 4QD4A 1YSQA 3MQOA 3G34A 2IA2A 3BRMA 4I3IA 5IU1A 4FH2A 3O3VA 3D3OA 3N8SA 4HY8A 2ZLYA 2PHYA 3A0SA 1PIOA 3O88A 1N4OA 1FIKA 3GECA 5FEGA 3LR4A 5CRFA 4N1XA 4JF6A 3V3RA 3V3SA 3IF6A 1IKIA 3G31A 1KE3A 1VEUB 5DF8A 4B93A 3MKFA 2MJ6A 4HESA 2CMNA 1C3BA 3E0YA 2V1ZA 3OOVA 1FSYA 4HEFA 4EESA 1JWVA 1TS0A 2O9BA 4E6WA 1VEUA 3BECA 2J3TD 4WELA 2FH5A 4X55A 2A24B 1NY0A 4P85A 1FCNA 4EQIA 4Y2FA 4MMNA 4IUKA 2JKRI 4HJ4A 2QWSA 1H3QA 3P01A 2Y2PA 3T12B 1KVMA 3MQQA 4G3KA 2A24A 3F1OB 2L0WA 3GMWA 2WKPA 4HH2A 4UA6A 2PD8A 5CXWA 5TGFA 4ZJ3A 2Z6DA 3VMAA 1OPXA 1KDWA 3PBQA 4EQ1A 2W3GA 4C75A 4BMWA 3UDIA 2DRWA 1XJ3A 1VHMA 5DTKA 1K56A 2QJ7A 3LUQA 4LCLA 3ICYA 3LIDA 4YOFA 5HWVA 5AVEA 3TRCA 5AJGA 1F98A 3MZEA 3ZCZA 4IBRA 5KSCA 1MWUA 4EV4A 3ZG0A 1T1BA 1S67L 5TFQA 2C6WB 3SH9A 2H0TA 4OPRA 4LPZA 5KSHA 1IYOA 3BY8A 2Q9NA 4HQAA 4LV3A 2LB9A 2XRNA 1D06A 3UB8A 1OTIA 4K08A 1BLPA 1BSGA 3CPTB 3C38A 1LL5A 4KQQA 1XPBA 3H9WA 4ZJ2A 4LENA 5FA7A 1N9BA 3R7WA 3SOIA 3T4LA 3C2WA 4OH0A 4Y7PA 4L9FA 3T4SA 2XR0A 2PU4A 1YM1A 1K4FA 3IH8A 1E3UA 3KSHA 4LV0A 3FZCA 1EW0A 5A93A 4S2KA 4KUOA 3LY3A 3SS4A 5MC7A 3QNBA 3HLCA 4QB8A 3BYDA 1IYPA 3PYPA 3T4KA 4Y15A 3C4OA 2J9OA 3RXXA 5FQQA 1T1AA 3HBRA 4HP9A 1DRMA 4S2NC 3A3IA 4NG2A 3IT9A 3RTYA 5HAPA 2WKRA 2D01A 4DDYA 4P6BA 5F68A 5HARA 2M7UA 1V9ZA 5AQ9A 2WGIA 3IXHA 2Y2GA 4G3WA 4PM9A 2YKFA 3NI9A 2Y59A 3NOTC 2ZD8A 4UHUA 1SKOB 1TDGA 2OWHA 1LLBA 2JHEA 4GCZA 2HDRA 4R6LA 1H8ZA 3BEBA 2W3HA 1SKOA 1YLZA 1MZUA 4GDBA 3DWKA 4N9KA 1TEMA 2W3FA 1NYYA 3Q81A 5AVFA 4DXCA 1PI4A 1OTEA 1E3UD 2HDSA 2HP5A 3IS2A 5HFOA 5AQAA 4U0TA 3QP2A 4B9OA 3UPPA 5HL1A 3U4LP 1K54C 5HD3A 3EEAA 3MF0A 4E3JA 2OAQ1 3FWLA 4UAAA 5F1GA 1D7EA 1I2WA 1IFQA 1X0OA 1G68A 1F5MA 3VP4A 5AQBA 1GCEA 3V50A 3KSFA 2V20A 4NXEA 3IXDA 3LEQA 4FTXA 2QMIA 5F82A 5EVIC 3DTEA 2ZQAA 5JYOA 5DTSA 4CLCB 2V9AA 5CERA 2V0WA 5EV0A 4KZ3A 4R38A 4YINA 5CX7A 5HAQA 3P09A 1MXOA 4E04A 4XT2B 4II7A 1FSWA 4CLCA 2X02A 4K0WA 4MN5A 2P04A 4GHIB 3OLOA 3D4FA 5DJUA 2EX2A 5EFWA 2OSUA 4XT2A 4DMZA 4WZ5A 3KO6A 3FKWA 2J3WA 4MBFA 4WL9A 2XH9A 4GHIA 4WYYA 3MZFA 3TJZC 3BW6A 4Q0HA 1FR6A 3T50A 1LSVA 4R70A 1G5UA 1BTLA 1XXMA 1RGYA 3LEZA 5FDHA 5F1FA 4KQOA 1BZAA 4P6ZS 5HPIA 4NEED 3PHYA 1YQSA 3WS2A 2OLUA 2B95A 3BQ8A 5EPHA 1OT9A 3OPHA 3VV4A 2WGWA 4PKYG 1I2SA 1FR1A 2OOLA 3IXBA 1XX2A 2P9VB 3LI9A 4CLCE 2P74A 1E4DA 1W63M 4PKYA 1CQAA 4EWFA 5CHMA 2P9VA 3L7HA 4FH4A 1N9NA 3H7WB 1LI0A 4ZJ1A 4BD1A 2VGJA 3NOPC 3T4QA 3BFGA 4R0QA 4EBNA 5L10A 3UMEA 4KZ7A 1PW1A 5FQJA 3H7WA 2W1RA 2INWA 4X56A 3FV7A 4ID4A 2W27A 3CUEC 3HUNA 3NDEA 1O07A 3AGDA 1S0WA 5A90A 3MSHA 3QHYA 4JGOA 2OAP1 3A3EA 4Y3IA 4M4XA 4OP5A 4E3IA 3M2JA 4H6JB 3UMDA 4JF4A 3IWQA 3Q1FA 2HPBA 4S2IA 3SH7A 1ES2A 3G2YA 2WUQA 1MWRA 2H28A 3V67A 1TF1A 1KE4A 2XSSA 5FQ9A 5J7EA 2V1AA 3QP4A 4I38A 3PBRA 3SH8A 3GQZA 5EVEA 3Q7VB 1IEMA 2DNSA 5CGXA 4EUVA 4NXGA 2M7VA 5U47A 4XXRA 3IF6C 5M19A 3IHBA 4CQHA 4R1GA 4PM8A 2O9CA 2AVXA 2D02A 3OZHA 2C5WB 3GSGA 5FI2A 1ZHHB 4KZBA 1ZG4A 4E3MA 4QY5A 3DW0A 2RCXA 4PM7A 5EM1A 3MBZA 5FEFA 3OCNA 4FUWA 2Y2IA 4YNRA 4Q8IA 3BFEA 4UA7A 4EU0A 2VGLS 1CJFA 3FPVA 1I5QA 3G4PA 1Z6FA 3HJKA 1S66L 4LLOB 2XF3A 4UQIM 4GW9A 4KZ9A 1K0KA 1ONGA 2QPNA 5EOEA 4IBXA 1SDNA 4JF5A 1WA9A 3A3FA 1GHIA 1S4SA 1ESUA 4RQ9A 4PHTA 3WS0A 2HJEA 2NUTC 4E3KA 4JGQA 2WZXA 4MCWA 3PAEA 1J9MA 4ETXA 4MLLA 2EFUA 3LCEA 3M6BA 4OQ0A 4QHCA 4S2PA 3ZYTA 4X53A 3LIBA 2WZZA 3FKVA 5IS1A 2KDKA 2Y2MA 3NDGA 2ZM8A 3OPPA
chains in the Genus database with same CATH topology
4L9FA 4P6ZM 3T4SA 3B47A 3OBFA 5G4YA 2Y8HA 1ZTUA 1MC0A 2HGVA 1NLYA 1DP8A 2GZAA 2VJWA 3GDIA 4NKPA 4R3AA 3KSHA 1EW0A 2ZOHA 4H6JA 2QHKA 2P08A 1NRJA 4HNBA 4KUOA 3CITA 5MC7A 2QJ5A 3LIFA 2GX5A 2VV6A 3VE4A 4WEKA 3JVVA 3CWFA 2V1BA 3PYPA 3T4KA 4AFIA 2Y79A 1T1CA 1GSVA 1T1AA 3NOUC 4HP9A 4WN5A 3EGXC 1DRMA 2BASA 4WLAA 3LIEA 3RTYA 3PXPA 2WKRA 3KYZA 5HSQA 2D01A 2Z6CA 4QPRA 4LRYC 4HJ3A 4DJ2A 1DP9A 5F68A 3LICA 2M7UA 3BJNA 1V9ZA 3K3DA 2PD7A 3LFVA 2GJ3A 3LR5A 4BJPA 2A2LA 5HWWA 4FSFA 3F1OA 2W0NA 4G3WA 2JKRM 2YKFA 3VE3A 1XFNA 2KX6A 3LIAA 1VB6A 5DFYA 2B02A 1UGUA 3MXQA 3NOTC 1UWNX 2LB5A 5HL6A 3G6OA 3O5YA 4YWZA 1JNUA 3VOLA 2VZWA 2ZMVA 1LT0A 4HOIA 2VV8A 4BBUA 2OWHA 1G6OA 2R78A 5LBRA 2I9VA 2WKQA 4EERA 4L9GA 2PR5A 2PR6A 3RFBA 2JHEA 4GCZA 4R6LA 3LR0A 1MKMA 3HCYA 2W3HA 3BWLA 1MZUA 1P9WA 1TS6A 2VX8A 1G28A 1F9IA 1LSWA 4KUKA 2W3FA 5K5BA 5AVFA 3IBRA 3T4TA 3B42A 1OTEA 3EEHA 4DN0A 3IS2A 1S1YA 3MQ0A 2J80A 3EQUA 3PR6A 4B9OA 2ZOIA 5IT5A 3KX0X 4BWIA 5DFXA 5HD3A 2PDRA 3EEAA 1OT6A 3MF0A 1P0ZA 1S1ZA 3MFXA 3SW1A 3K3CA 1GSXA 2OAQ1 1D7EA 3UB6A 1IFQA 1X0OA 1DP6A 1XJ2A 1YAXA 2VEAA 4IUHA 2VKSA 4MN7A 3OC2A 4Q0JA 1OTBA 3FG8A 2VGLM 1F5MA 3S7PA 3KSGA 4HP4A 5TJJA 3KSFA 4CLCD 4GLQA 4NXEA 3CI6A 2ZBBA 4JGRA 5A8BA 2XROA 4OOLA 3CLOA 3F1PB 2JKTM 3TW8A 5HDCA 4CLCB 2EWVA 2V9AA 5I5LA 2HF6A 3KYQA 5DKKA 2V0WA 5F6AA 5F5YA 1OJGA 2HJ9C 1OTDA 3A0RA 4R38A 3MJQA 1N9LA 5CX7A 2OWJA 2PYRA 4Q0IA 4UQIS 2QYBA 4E04A 4GS9B 1Y28A 4XT2B 4II7A 3F1PA 2K7SA 4CLCA 4MN5A 2P04A 4GHIB 1IOUA 1LL8A 4FOFA 5HDDA 3E4OA 3C8CA 3OLOA 5C5KA 5DJUA 1ODVA 2YKHA 3BQAA 4GS9A 5EFWA 4XT2A 3UB9A 4DMZA 1GSWA 3KO6A 3UE3A 3E4PA 5HPFA 4EEPA 2J3WA 5F69A 4WL9A 4GHIA 1BYWA 5DF9A 3TJZC 2K2NA 1T19A 3BW6A 5FL3A 4Q0HA 3T50A 4EEUA 5DJTA 4IHQA 4EETB 3NHQA 1LSVA 4R70A 3S7QA 4ZRRA 3F1NB 4I39A 3FC7A 1YSPA 2ZMFA 2KOIA 3KSIA 4BBVA 4KQOA 4P6ZS 5HPIA 4CLCC 4NEED 3PHYA 4L0LA 2L1MA 3E98A 4KQDA 3B33A 3F1NA 3BQ8A 1XFQA 1OT9A 3A0VA 1LSXA 2K31A 3D72A 3NJAA 3VV4A 2EWWA 4PKYG 4EXOA 1NLZA 2OOLA 1NWZA 2L4RA 1YKDA 4HJ6A 4MN6A 3CUEA 5L8MA 5DKLA 3LI9A 4G3VA 3ULFA 2G7UA 1V9YA 4CLCE 1W63M 3BY9A 4PAUA 2M1CA 3LYXA 4PKYA 2NUPC 3P7NA 2P7JA 1OTAA 3E4QA 1KOUA 4Y5FA 5HWTA 3PBNA 4WUJA 4LRZE 1N9NA 3H7WB 4HH3A 4O01A 2B18A 2QKPA 2GNXA 2JN7A 1YSQA 3NOPC 4L9EA 3T4QA 3MQOA 3UMEA 3R7WB 2IA2A 1H8MA 3H7WA 4I3IA 5IU1A 2W1RA 4O8GA 2O0YA 2W1TB 2INWA 3D3OA 2W27A 2EA9A 4HY8A 3CUEC 4BBTA 2VLGA 2O9AA 2PHYA 3A0SA 4HHDA 3LI8A 3EQVA 4JGOA 2OAP1 4Y3IA 4M4XA 2W1TA 4NXFA 1OJ5A 3PBTA 4H6JB 3UMDA 2O99A 3GECA 5J3WA 3LR4A 3W2ZA 3HJIA 4WEJA 2JKTI 3MR0A 4ARZB 5HZHA 2H28A 3V67A 4UEYA 1TF1A 2PT7A 2XSSA 4B93A 4NXBA 4ARZA 2MJ6A 4LRXC 5J7EA 2CMNA 4O0PA 1STZA 3E0YA 3OOVA 2V1AA 2VA0A 1S4RA 4EESA 4I38A 3PBRA 1TS0A 4ME4A 2O9BA 2FZ0A 2J3TD 4WELA 5HD5A 2PYPA 2FH5A 2A24B 3DBAA 1P97A 4IJGA 4I3AA 4Y2FA 4MMNA 3MMHA 4WF0A 2V0UA 4IUKA 2JKRI 3R4KA 4GJ4A 1P9RA 4HJ4A 2QWSA 3H82B 1H3QA 3P01A 3PBSA 5TBMB 2XA7S 3MQQA 4G3KA 2A24A 3F1OB 3U2AA 5HDSA 2L0WA 4EUVA 4HH2A 1N9OA 2WKPA 4NXGA 2M7VA 3EGDC 4MDZA 3K2NA 2HV1A 2PD8A 4F3LB 4CQHA 3OCLA 3T4OA 3H82A 3UE6A 2O9CA 2Z6DA 2D02A 5TBMA 1OPXA 1ZHHB 3PBQA 4EQ1A 4Z1WA 2W3GA 3EWKA 4I5SA 4F3LA 5J4EA 3OCNA 4BMWA 3IBJA 4YNRA 1XJ3A 4I3JA 1VHMA 2QJ7A 3LUQA 3ICYA 3LIDA 4EU0A 1W63Q 4JGPA 2VGLS 3TE8A 4YOFA 5HWVA 5AVEA 3FPVA 3TRCA 5AJGA 2DMWA 1F98A 1TS8A 4HI4A 3EOIA 1T18A 3HJKA 3FPWA 1S66L 4LLOB 2W3EA 4UQIM 4GW9A 3LR3A 1T1BA 4ETZA 1S67L 4OOMA 5KIZA 1WA9A 3JVUA 1S4SA 3S7OA 3UB7A 4RQ9A 2J3TC 4PHTA 2HJEA 2NUTC 4LPZA 5G4ZA 5KSHA 4JGQA 2KLIA 3BY8A 4MCWA 4HQAA 4ETXA 1XJ4A 3IS2B 4EW7A 2LB9A 2VV7A 3CAXA 2XRNA 1D06A 3ZQ5A 3UB8A 1OTIA 4K08A 4DJ3A 3T4JA 3ZYTA 3LIBA 3C38A 2XA7M 5IS1A 3H9WA 3C30A 1TS7A 3S7NA 2KDKA 1TD5A 4HIAA 3R7WA 3T4LA 1UWPX 2W3DA 3RH8B 3PBOA 1XJ6A 3C2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L9F A;  5G4Y A;  1DP8 A;  3GDI A;  4R3A A;  1EW0 A;  2ZOH A;  4H6J A;  2QHK A;  4HNB A;  4KUO A;  2QJ5 A;  3LIF A;  2VV6 A;  3VE4 A;  3CWF A;  2V1B A;  3PYP A;  1T1C A;  1GSV A;  1T1A A;  3NOU C;  4HP9 A;  4WN5 A;  1DRM A;  2BAS A;  4WLA A;  3LIE A;  3RTY A;  2WKR A;  5HSQ A;  2D01 A;  2Z6C A;  4LRY C;  4HJ3 A;  4DJ2 A;  1DP9 A;  5F68 A;  3LIC A;  1V9Z A;  3K3D A;  2PD7 A;  2GJ3 A;  5HWW A;  3F1O A;  2W0N A;  2YKF A;  3VE3 A;  1XFN A;  2KX6 A;  3LIA A;  1VB6 A;  2B02 A;  1UGU A;  3MXQ A;  3NOT C;  1UWN X;  3G6O A;  4YWZ A;  1JNU A;  3VOL A;  1LT0 A;  4HOI A;  2VV8 A;  4BBU A;  2OWH A;  2R78 A;  2I9V A;  2WKQ A;  4EER A;  4L9G A;  2PR5 A;  2PR6 A;  2JHE A;  4GCZ A;  4R6L A;  3BWL A;  1MZU A;  1TS6 A;  1G28 A;  1F9I A;  1LSW A;  4KUK A;  5AVF A;  3IBR A;  1OTE A;  3EEH A;  3IS2 A;  1S1Y A;  2J80 A;  4B9O A;  2ZOI A;  3KX0 X;  5HD3 A;  2PDR A;  1OT6 A;  1P0Z A;  1S1Z A;  3MFX A;  3SW1 A;  3K3C A;  1GSX A;  1D7E A;  3UB6 A;  1X0O A;  1DP6 A;  1XJ2 A;  2VEA A;  1OTB A;  3FG8 A;  4HP4 A;  4NXE A;  2ZBB A;  4JGR A;  5A8B A;  3CLO A;  3F1P B;  5HDC A;  2V9A A;  5I5L A;  5DKK A;  2V0W A;  5F6A A;  5F5Y A;  1OJG A;  1OTD A;  3A0R A;  4R38 A;  3MJQ A;  1N9L A;  2OWJ A;  2PYR A;  4E04 A;  4GS9 B;  1Y28 A;  4XT2 B;  3F1P A;  2K7S A;  4MN5 A;  4GHI B;  1LL8 A;  5HDD A;  3E4O A;  3C8C A;  3OLO A;  5DJU A;  1ODV A;  2YKH A;  4GS9 A;  5EFW A;  4XT2 A;  3UB9 A;  1GSW A;  3E4P A;  4EEP A;  5F69 A;  4WL9 A;  4GHI A;  1BYW A;  1T19 A;  3T50 A;  4EEU A;  5DJT A;  4EET B;  3NHQ A;  1LSV A;  4R70 A;  3F1N B;  4I39 A;  3FC7 A;  4BBV A;  3PHY A;  2L1M A;  4KQD A;  3B33 A;  3F1N A;  1XFQ A;  1OT9 A;  3A0V A;  1LSX A;  3D72 A;  3NJA A;  4PKY G;  4EXO A;  2OOL A;  1NWZ A;  2L4R A;  4HJ6 A;  4MN6 A;  5DKL A;  3LI9 A;  3ULF A;  1V9Y A;  3BY9 A;  2M1C A;  3LYX A;  4PKY A;  3P7N A;  2P7J A;  1OTA A;  3E4Q A;  1KOU A;  5HWT A;  4WUJ A;  4LRZ E;  1N9N A;  3H7W B;  4HH3 A;  2QKP A;  2JN7 A;  3NOP C;  4L9E A;  3MQO A;  3UME A;  3H7W A;  4I3I A;  5IU1 A;  2INW A;  2W27 A;  2EA9 A;  4HY8 A;  4BBT A;  2VLG A;  2PHY A;  3A0S A;  4HHD A;  3LI8 A;  4JGO A;  4M4X A;  4NXF A;  1OJ5 A;  4H6J B;  3UMD A;  3GEC A;  5J3W A;  3HJI A;  3MR0 A;  5HZH A;  2H28 A;  4NXB A;  4LRX C;  5J7E A;  2CMN A;  2V1A A;  1S4R A;  4EES A;  4I38 A;  1TS0 A;  5HD5 A;  2PYP A;  2A24 B;  1P97 A;  4I3A A;  4WF0 A;  2V0U A;  4HJ4 A;  2QWS A;  3H82 B;  5TBM B;  3MQQ A;  2A24 A;  3F1O B;  5HDS A;  2L0W A;  4HH2 A;  1N9O A;  2WKP A;  4NXG A;  2HV1 A;  2PD8 A;  4F3L B;  3H82 A;  3UE6 A;  2Z6D A;  2D02 A;  5TBM A;  4EQ1 A;  3EWK A;  4I5S A;  4F3L A;  5J4E A;  1XJ3 A;  4I3J A;  2QJ7 A;  3LUQ A;  3ICY A;  3LID A;  4JGP A;  5HWV A;  5AVE A;  1F98 A;  1TS8 A;  4HI4 A;  1T18 A;  3HJK A;  1S66 L;  4LLO B;  4GW9 A;  1T1B A;  1S67 L;  5KIZ A;  1WA9 A;  1S4S A;  3UB7 A;  4RQ9 A;  4LPZ A;  5G4Z A;  4JGQ A;  3BY8 A;  4HQA A;  1XJ4 A;  3IS2 B;  4EW7 A;  2VV7 A;  3CAX A;  1D06 A;  3ZQ5 A;  3UB8 A;  1OTI A;  4K08 A;  4DJ3 A;  3LIB A;  5IS1 A;  3H9W A;  1TS7 A;  2KDK A;  4HIA A;  1UWP X;  3RH8 B;  1XJ6 A;  3C2W A; 
#chains in the Genus database with same CATH topology
 2ZMA A;  1GHM A;  4JXV A;  1KDS A;  5G18 A;  3OBF A;  4M3K A;  4DXB A;  1ZTU A;  1ERM A;  1GA9 A;  2VJW A;  4NKP A;  5GHY A;  2ZOH A;  1L0E A;  1NRJ A;  1SKF A;  3HLD A;  4LV1 A;  4HNB A;  2Y4A A;  4BL2 A;  3CIT A;  1G6A A;  3T1X A;  3UY6 A;  5E43 A;  2EXB A;  3LIF A;  2VV6 A;  3JYI A;  3RJU A;  3CWF A;  4P0M A;  2Y79 A;  1T1C A;  4S2M A;  1YLJ A;  3NOU C;  2WKE A;  4WZ4 A;  3EGX C;  2BAS A;  1PI5 A;  1Z09 A;  1YMS A;  1K55 C;  4OVD A;  1XGI A;  2Z6C A;  2Z2M B;  4HJ3 A;  3LIC A;  3LGO A;  1GA0 A;  2WKH A;  1XA7 A;  2PD7 A;  4FSF A;  3F1O A;  4E3O A;  2JKR M;  4R4R A;  3VE3 A;  1XFN A;  4OPY A;  3MXQ A;  4OON A;  5HL6 A;  3G6O A;  4YWZ A;  4OKP A;  1JNU A;  3W4O A;  1PFL A;  2JCH A;  1YPR A;  4HOI A;  2Y2J A;  2VV8 A;  1PW8 A;  2V8C A;  1TVF A;  4DF6 A;  1SCW A;  2XD5 A;  4K91 A;  2PR6 A;  2A49 A;  1WYB A;  1MKM A;  3IF5 A;  1P9W A;  1FQG A;  3DTI A;  4LCM A;  4KUK A;  3T1Q B;  3CG5 A;  3CHW P;  1M6K A;  4X25 A;  5KZH A;  1KGF A;  5CTM A;  3TSG A;  3G35 A;  3G2Z A;  3S4X A;  1S1Y A;  2EFX A;  3CZD A;  2J80 A;  1EI5 A;  1XGJ A;  2ZOI A;  5IT5 A;  3KX0 X;  2G2U A;  3CPT A;  1OT6 A;  3AGE A;  3DWZ A;  4OLD A;  1LI9 A;  2WYX A;  2XGN A;  3UB6 A;  1DP6 A;  4MN7 A;  1OTB A;  3FG8 A;  3NUL A;  3S7P A;  5TJJ A;  4JLF A;  1L0F A;  2H10 A;  4JGR A;  5A8B A;  3CMZ A;  4OOL A;  3CLO A;  2JKT M;  5I5L A;  4Y0O A;  3KYQ A;  5F5Y A;  3AGF A;  2HJ9 C;  3A0R A;  5E2E A;  2OWJ A;  2PYR A;  2WK0 A;  3C7U A;  4Q0I A;  3HLW A;  4GS9 B;  1Y28 A;  4GKU A;  3VOY A;  3C7V A;  5CEB A;  4C3Q A;  1LL8 A;  1K57 A;  4GS9 A;  4IVK A;  1LHY A;  3UB9 A;  3FYZ A;  3UE1 A;  4B88 A;  3UE3 A;  3E4P A;  3HRE A;  5F69 A;  2ACG A;  4DE3 A;  1BYW A;  5DF9 A;  2K2N A;  5CTN A;  1ZKJ A;  4Y13 A;  1DJB A;  4EET B;  3NHQ A;  1RCJ A;  3S7Q A;  4ZTK A;  1W8Q A;  1XP4 A;  4I39 A;  3VP3 A;  5CGW A;  3G32 A;  2HDU A;  3KSI A;  3BM6 A;  4H8R A;  4CLC C;  4L0L A;  4QWO A;  3E98 A;  1HD8 A;  1KVL A;  1LSX A;  4KEN B;  3D72 A;  4KZ5 A;  3JPU A;  2WKI A;  1XKZ A;  1NLZ A;  1KGG A;  1NWZ A;  2XFS A;  3O87 A;  5L8M A;  2Q0O A;  2ZL1 B;  3ULF A;  3T1R A;  4OQG A;  3ZVT A;  3NCK A;  4Z9Q A;  3LYX A;  2WGV A;  4JBF A;  3P7N A;  2ZL1 A;  3DTK A;  1KOU A;  4Y5F A;  3PBN A;  4O7D A;  1YLY A;  4O01 A;  2EX8 A;  5EUA A;  1Q2Q A;  2QKP A;  3HUO A;  4X69 A;  5TR7 A;  4GD8 A;  1H8M A;  3MXR A;  2O0Y A;  2W1T B;  2EA9 A;  2VLG A;  2O9A A;  4ZBE A;  4S2J A;  2R9W A;  2Q9M A;  3HVF A;  2W1T A;  4NXF A;  1OJ5 A;  3PBT A;  2ZC4 B;  3DAV A;  3L9K A;  5J3W A;  3W2Z A;  2ZQ8 A;  4WEJ A;  1NRF A;  2EX6 A;  2X01 A;  1Y4O A;  5HZH A;  3GV9 A;  1LL9 A;  4KQR A;  1RP5 A;  1HLU P;  1IEL A;  5HX9 A;  2Y91 A;  5FQK A;  3ZG5 A;  3RXW A;  2ZQ7 A;  4LRX C;  1HVB A;  4O0P A;  1STZ A;  2VA0 A;  4E3L A;  2HZ5 A;  5EEC A;  5HW3 A;  3HLG A;  4QJG A;  1QME A;  1PYY A;  3LY4 A;  5HD5 A;  2PYP A;  2JBF A;  3WWX A;  5FSR A;  4IJG A;  4KZA A;  2RL3 A;  3MMH A;  4WMC D;  4WF0 A;  3R4K A;  4GJ4 A;  3H82 B;  1Y54 A;  5TBM B;  2XA7 S;  1HZO A;  5HDS A;  5L2F A;  1GHP A;  1N9O A;  5J8X A;  3EGD C;  4MDZ A;  2XEP A;  3K2N A;  4GD6 A;  2Y2K A;  4F3L B;  1MPL A;  3H82 A;  3UE6 A;  1M40 A;  2ZC3 B;  5TBM A;  1NYM A;  3G30 A;  5GLD A;  3EWK A;  4I5S A;  4F3L A;  3IBJ A;  4I3J A;  2Y55 A;  3HLE A;  3GR2 A;  4JGP A;  2UV0 E;  1W5D A;  1PNE A;  1A0K A;  2ZQD A;  4HI4 A;  1PWD A;  3EOI A;  2GDN A;  4X68 A;  1K6R A;  2W3E A;  4ETZ A;  1K54 A;  4OOM A;  2CC1 A;  3JVU A;  3S7O A;  2J3T C;  4A5R A;  4S2O A;  5G4Z A;  4KG5 A;  4U0X A;  1QMF A;  1BLC A;  2X71 A;  2IWD A;  1NZU A;  1U60 A;  4EW7 A;  2VV7 A;  1W79 A;  5EVI B;  1BUL A;  4DJ3 A;  1ACF A;  3T4J A;  2Y2N A;  4OPQ A;  4Y17 A;  4N92 A;  4IED A;  4R3B A;  3O86 A;  4LFU A;  5EVI A;  1TD5 A;  2PU2 A;  4RX2 A;  4HIA A;  1UWP X;  3BFD A;  1XJ6 A;  3PBO A;  4RA7 A;  2A3U A;  1H0M A;  3E2K A;  5G4Y A;  1MC0 A;  2ZC7 A;  2PBD P;  2HGV A;  1DP8 A;  5DF7 A;  4JPM A;  4R3A A;  3ZNT A;  2WAF A;  4H6J A;  2P08 A;  4OLG A;  4DE2 A;  1JWZ A;  2QJ5 A;  4N9L A;  2GX5 A;  3HUM A;  5CGS A;  4WEK A;  1ES4 A;  4KG2 A;  3VSK A;  2E8I A;  4LGW A;  4AFI A;  3T1S A;  5FAP A;  1KE0 A;  1K25 A;  2XLN A;  1ERO A;  3QP8 A;  4MEZ A;  1ALQ A;  3LIE A;  1L3L A;  1CI9 A;  3KYZ A;  5HSQ A;  3NBL A;  3Q7V A;  5CED A;  2VK3 A;  1ES3 A;  3BJN A;  2GJ3 A;  4BJP A;  2A2L A;  3IWI A;  5GHZ A;  2BTF P;  1WE4 A;  1UWN X;  3O5Y A;  3MKE A;  3VOL A;  1LT0 A;  2Y2H A;  4BBU A;  3IHA A;  3KYE A;  2R78 A;  2XFT A;  3VOZ A;  4EER A;  4L9G A;  3NIA A;  3RFB A;  4MBK A;  5EVI D;  3HCY A;  3WS4 A;  5E2F A;  4DDS A;  3HLB A;  3UNW A;  3BLS A;  1F9I A;  3IBR A;  3B42 A;  5JYP A;  3ZG8 B;  2Y2O A;  4RYE A;  1YMX A;  5E2H A;  3MQ0 A;  1VET B;  4IVI A;  1D1J A;  3PR6 A;  4B4Z A;  3UN7 A;  1PZO A;  5DFX A;  4MBH A;  1P0Z A;  1VET A;  3SW1 A;  4EBL A;  4BD0 A;  2J8Y A;  2Z2L B;  1JWP A;  1YAX A;  2H5S A;  4Q0J A;  4OQI A;  1SDE A;  4K0X A;  3VP2 A;  4HP4 A;  1PWG A;  3CI6 A;  2FFY A;  3IF6 B;  5GLA A;  3S22 A;  3N8L A;  2XRO A;  3F1P B;  2EWV A;  3HLF A;  1H5X A;  2HF6 A;  5DKK A;  4QY6 A;  5F6A A;  3Q82 A;  3ITA A;  3MJQ A;  1N9L A;  4UQI S;  3F1P A;  2K7S A;  3VSL A;  1BT5 A;  1YLW A;  4FOF A;  5HDD A;  3E4O A;  5C5K A;  2HP9 A;  5I94 A;  4PM5 A;  5A92 A;  5DVA A;  5HPF A;  4EEP A;  4E6X A;  5E2G A;  1T19 A;  5FL3 A;  1E25 A;  4EEU A;  5DJT A;  5L07 A;  2HP6 A;  1CEF A;  4E3N A;  4IHQ A;  3ZVW A;  4EBP A;  4DE1 A;  4ZRR A;  3F1N B;  1FOF A;  2B5R A;  3FC7 A;  4FCF A;  3ZFZ A;  2KOI A;  1Q2P A;  4JXS A;  2L1M A;  3F1N A;  3UE0 A;  1ZC2 A;  4R4S A;  3LO7 A;  3A0V A;  1K57 C;  1NXY A;  2EWW A;  1VM1 A;  2L4R A;  1YKD A;  3S1Y A;  3UPN A;  1V9Y A;  3OPL A;  4PAU A;  1KGE A;  4BEN A;  2NUP C;  2PRF A;  3E4Q A;  1RGZ A;  2JKF A;  4WUJ A;  4LRZ E;  4P87 A;  3GVB A;  3TOI A;  3WRT A;  1F2K A;  3VFH A;  2GNX A;  1L0D A;  1DJA A;  1YLT A;  3M2K A;  2JN7 A;  4L9E A;  1W8Y A;  3R7W B;  5DTT A;  1SZV A;  2J9P A;  4KZ8 A;  4O8G A;  5F83 A;  3V5M A;  4BBT A;  1IKG A;  1MWS A;  5FI6 A;  4HHD A;  4ZDX A;  3LI8 A;  2UWX A;  5FI7 A;  5CEC A;  3EQV A;  1CI8 A;  4GOG A;  4BQM A;  3IX4 A;  1CK3 A;  1CEG A;  2O99 A;  1K55 A;  1IYS A;  3HJI A;  1AXB A;  3PAG A;  2JKT I;  3MR0 A;  4ARZ B;  4DE0 A;  1ONH A;  4UEY A;  2PT7 A;  1BLS A;  4NXB A;  4ARZ A;  4BLM A;  3C5A A;  2Y2Q A;  1S4R A;  4DRT A;  4ME4 A;  4X1L A;  2Y2L A;  2FZ0 A;  4JKT A;  3DBA A;  1P97 A;  1L0G A;  4I3A A;  2V0U A;  3N6I A;  1P9R A;  1K6S A;  1K56 D;  3PBS A;  3C4P A;  3U2A A;  4MNR A;  3IQA A;  1W7F A;  2HV1 A;  1JTG A;  5FAT A;  3OCL A;  3T4O A;  3UDF A;  4Z1W A;  3E2L A;  4WMC A;  4DKI A;  5J4E A;  3ZG9 B;  4PM6 A;  4Y0T A;  1PRQ A;  3IH9 A;  4BL3 A;  1W63 Q;  4WZ5 C;  3TE8 A;  4CJN A;  2DMW A;  3NEC A;  1TS8 A;  3QP5 A;  2QZ6 A;  1T18 A;  4R3J A;  3FPW A;  4X6T A;  2FFF B;  4HBU A;  2XD1 A;  3LR3 A;  2I72 A;  4LV2 A;  1PWC A;  5KIZ A;  3UB7 A;  5FAO A;  2KLI A;  2ZC5 B;  1BLH A;  4JXG A;  1XJ4 A;  3IS2 B;  3VP0 A;  4PPR A;  3CAX A;  3ZQ5 A;  2ZJ9 A;  3WRZ A;  3M6H A;  2IWB A;  2XA7 M;  3SZT A;  4WBG A;  2BLS A;  1MY8 A;  2JC7 A;  3C30 A;  1TS7 A;  3S7N A;  1S6R A;  3W8K A;  1FCO A;  4KZ4 A;  2W3D A;  2JE5 A;  3RH8 B;  2QHK A;  4D2O A;  5FQI A;  2R9X A;  4P6Z M;  3MXS A;  5GLC A;  3B47 A;  4C6Y A;  4S2N A;  4N1H A;  2Y8H A;  5IHV A;  1NLY A;  3V39 A;  4U3T A;  2GZA A;  3ZDJ A;  3GDI A;  4OP8 A;  3GTC A;  1IYQ A;  4X1M A;  5BOH A;  1JTD A;  2G2W A;  2V2F F;  4OOY A;  3QNC A;  3VE4 A;  3JVV A;  3NY4 A;  2V1B A;  2J7V A;  4FD8 A;  4GZB A;  2ZQC A;  1GSV A;  4QU3 A;  2JKG A;  1ERQ A;  1NJ4 A;  4WN5 A;  3HL9 A;  5FDS A;  5CHU A;  4WLA A;  1WYC A;  4B4X A;  3PXP A;  5CHJ A;  2ZM2 A;  4QPR A;  1SHV A;  3VP1 A;  4D60 A;  4LRY C;  2PBY A;  5KMW A;  4DJ2 A;  5A91 A;  4KG6 A;  4XUZ A;  1DP9 A;  4JXW A;  4CPK A;  3K3D A;  1MWT A;  3LFV A;  3LR5 A;  5HWW A;  3SS3 A;  3DTM A;  1MKI A;  3UPO A;  3W4Q A;  4KZ6 A;  2W0N A;  2VGK A;  2KX6 A;  3LIA A;  1VB6 A;  4Y0U A;  5DFY A;  2B02 A;  3I7J A;  1UGU A;  1DY6 A;  2LB5 A;  4EUZ A;  5EVL A;  2VZW A;  2ZMV A;  3IX8 A;  2WGW B;  5M1A A;  2XQZ A;  1G6O A;  5LBR A;  2ZM0 A;  4HBT A;  5GHX A;  2I9V A;  2WKQ A;  2PR5 A;  1EWZ A;  3LR0 A;  4GB7 A;  1YT4 A;  3BWL A;  2EX9 A;  2V8F A;  3GRJ A;  1NZO A;  1TS6 A;  2VX8 A;  3ZNY A;  2H0Y A;  1G28 A;  5FQM A;  1H8Y A;  1LSW A;  2DCF A;  3QP1 A;  5K5B A;  1AWI A;  3T4T A;  1XA1 A;  1BUE A;  4OPZ A;  3Q07 A;  3EEH A;  4DN0 A;  3NC8 A;  4PMA A;  3OPR A;  3A3D A;  5EOO A;  3EQU A;  4GDN A;  1JVJ A;  1DJC A;  4BWI A;  3ISG A;  1PZP A;  3MFD A;  3IXG A;  2ZQ9 A;  2XDM A;  2PDR A;  3QP6 A;  3N4I A;  4R23 A;  1S1Z A;  3MFX A;  1FIL A;  2EXA A;  3K3C A;  1GSX A;  2VEA A;  1XJ2 A;  2WAE A;  4IUH A;  2VKS A;  3OC2 A;  2VGL M;  3CJM A;  3IX3 A;  3KSG A;  2OLV A;  5FAQ A;  4CLC D;  4S2L A;  4GLQ A;  1K4E A;  4OQH A;  3MS6 A;  2ZBB A;  2WAD A;  3P98 A;  4GNU A;  5D3O A;  2IWC A;  4UA9 A;  3TW8 A;  5HDC A;  4F94 A;  1TDL A;  3PTE A;  4RX3 A;  1CF0 A;  3BFF A;  1OJG A;  5EM0 A;  1OTD A;  1L2S A;  3Q7Z A;  1ES5 A;  2QYB A;  3ZGA B;  1K38 A;  4RVA A;  5L09 A;  2BG1 A;  3TG9 A;  4WM9 A;  2OV5 A;  4XUX A;  3UB5 P;  3N7W A;  4ESP A;  1IOU A;  4GN2 A;  3C8C A;  5HAI A;  1ODV A;  5GLB A;  2YKH A;  3BQA A;  3ZG7 B;  3D9Y A;  3ZHH A;  1GSW A;  1O7E A;  2PAV P;  4ZAM A;  1OME A;  3BFC A;  1ZG6 A;  4NET A;  3VFF A;  1YSP A;  2ZMF A;  4BBV A;  3WS1 A;  4KQD A;  3B33 A;  3UO9 A;  3W4P A;  1XFQ A;  2HDQ A;  3UDX A;  1J3W A;  2K31 A;  3NJA A;  2E8J A;  1MBL A;  4EXO A;  4NK3 A;  2ZC6 B;  4HJ6 A;  4MN6 A;  3CUE A;  5DKL A;  4G3V A;  2G7U A;  1ESI A;  3N8R A;  5GL9 A;  3BY9 A;  3B3X A;  3BLM A;  2M1C A;  1HTZ A;  5M18 A;  3ITB A;  4YFM A;  3A3J A;  2P7J A;  5FAS A;  1VQQ A;  1YLP A;  1OTA A;  2XK1 A;  5EE8 A;  5HWT A;  1FCM A;  3WS5 A;  5AQ7 A;  3IWO A;  3MZD A;  3SS5 A;  4HH3 A;  2B18 A;  4QD4 A;  1YSQ A;  3MQO A;  3G34 A;  2IA2 A;  3BRM A;  4I3I A;  5IU1 A;  4FH2 A;  3O3V A;  3D3O A;  3N8S A;  4HY8 A;  2ZLY A;  2PHY A;  3A0S A;  1PIO A;  3O88 A;  1N4O A;  1FIK A;  3GEC A;  5FEG A;  3LR4 A;  5CRF A;  4N1X A;  4JF6 A;  3V3R A;  3V3S A;  3IF6 A;  1IKI A;  3G31 A;  1KE3 A;  1VEU B;  5DF8 A;  4B93 A;  3MKF A;  2MJ6 A;  4HES A;  2CMN A;  1C3B A;  3E0Y A;  2V1Z A;  3OOV A;  1FSY A;  4HEF A;  4EES A;  1JWV A;  1TS0 A;  2O9B A;  4E6W A;  1VEU A;  3BEC A;  2J3T D;  4WEL A;  2FH5 A;  4X55 A;  2A24 B;  1NY0 A;  4P85 A;  1FCN A;  4EQI A;  4Y2F A;  4MMN A;  4IUK A;  2JKR I;  4HJ4 A;  2QWS A;  1H3Q A;  3P01 A;  2Y2P A;  3T12 B;  1KVM A;  3MQQ A;  4G3K A;  2A24 A;  3F1O B;  2L0W A;  3GMW A;  2WKP A;  4HH2 A;  4UA6 A;  2PD8 A;  5CXW A;  5TGF A;  4ZJ3 A;  2Z6D A;  3VMA A;  1OPX A;  1KDW A;  3PBQ A;  4EQ1 A;  2W3G A;  4C75 A;  4BMW A;  3UDI A;  2DRW A;  1XJ3 A;  1VHM A;  5DTK A;  1K56 A;  2QJ7 A;  3LUQ A;  4LCL A;  3ICY A;  3LID A;  4YOF A;  5HWV A;  5AVE A;  3TRC A;  5AJG A;  1F98 A;  3MZE A;  3ZCZ A;  4IBR A;  5KSC A;  1MWU A;  4EV4 A;  3ZG0 A;  1T1B A;  1S67 L;  5TFQ A;  2C6W B;  3SH9 A;  2H0T A;  4OPR A;  4LPZ A;  5KSH A;  1IYO A;  3BY8 A;  2Q9N A;  4HQA A;  4LV3 A;  2LB9 A;  2XRN A;  1D06 A;  3UB8 A;  1OTI A;  4K08 A;  1BLP A;  1BSG A;  3CPT B;  3C38 A;  1LL5 A;  4KQQ A;  1XPB A;  3H9W A;  4ZJ2 A;  4LEN A;  5FA7 A;  1N9B A;  3R7W A;  3SOI A;  3T4L A;  3C2W A;  4OH0 A;  4Y7P A;  4L9F A;  3T4S A;  2XR0 A;  2PU4 A;  1YM1 A;  1K4F A;  3IH8 A;  1E3U A;  3KSH A;  4LV0 A;  3FZC A;  1EW0 A;  5A93 A;  4S2K A;  4KUO A;  3LY3 A;  3SS4 A;  5MC7 A;  3QNB A;  3HLC A;  4QB8 A;  3BYD A;  1IYP A;  3PYP A;  3T4K A;  4Y15 A;  3C4O A;  2J9O A;  3RXX A;  5FQQ A;  1T1A A;  3HBR A;  4HP9 A;  1DRM A;  4S2N C;  3A3I A;  4NG2 A;  3IT9 A;  3RTY A;  5HAP A;  2WKR A;  2D01 A;  4DDY A;  4P6B A;  5F68 A;  5HAR A;  2M7U A;  1V9Z A;  5AQ9 A;  2WGI A;  3IXH A;  2Y2G A;  4G3W A;  4PM9 A;  2YKF A;  3NI9 A;  2Y59 A;  3NOT C;  2ZD8 A;  4UHU A;  1SKO B;  1TDG A;  2OWH A;  1LLB A;  2JHE A;  4GCZ A;  2HDR A;  4R6L A;  1H8Z A;  3BEB A;  2W3H A;  1SKO A;  1YLZ A;  1MZU A;  4GDB A;  3DWK A;  4N9K A;  1TEM A;  2W3F A;  1NYY A;  3Q81 A;  5AVF A;  4DXC A;  1PI4 A;  1OTE A;  1E3U D;  2HDS A;  2HP5 A;  3IS2 A;  5HFO A;  5AQA A;  4U0T A;  3QP2 A;  4B9O A;  3UPP A;  5HL1 A;  3U4L P;  1K54 C;  5HD3 A;  3EEA A;  3MF0 A;  4E3J A;  2OAQ 1;  3FWL A;  4UAA A;  5F1G A;  1D7E A;  1I2W A;  1IFQ A;  1X0O A;  1G68 A;  1F5M A;  3VP4 A;  5AQB A;  1GCE A;  3V50 A;  3KSF A;  2V20 A;  4NXE A;  3IXD A;  3LEQ A;  4FTX A;  2QMI A;  5F82 A;  5EVI C;  3DTE A;  2ZQA A;  5JYO A;  5DTS A;  4CLC B;  2V9A A;  5CER A;  2V0W A;  5EV0 A;  4KZ3 A;  4R38 A;  4YIN A;  5CX7 A;  5HAQ A;  3P09 A;  1MXO A;  4E04 A;  4XT2 B;  4II7 A;  1FSW A;  4CLC A;  2X02 A;  4K0W A;  4MN5 A;  2P04 A;  4GHI B;  3OLO A;  3D4F A;  5DJU A;  2EX2 A;  5EFW A;  2OSU A;  4XT2 A;  4DMZ A;  4WZ5 A;  3KO6 A;  3FKW A;  2J3W A;  4MBF A;  4WL9 A;  2XH9 A;  4GHI A;  4WYY A;  3MZF A;  3TJZ C;  3BW6 A;  4Q0H A;  1FR6 A;  3T50 A;  1LSV A;  4R70 A;  1G5U A;  1BTL A;  1XXM A;  1RGY A;  3LEZ A;  5FDH A;  5F1F A;  4KQO A;  1BZA A;  4P6Z S;  5HPI A;  4NEE D;  3PHY A;  1YQS A;  3WS2 A;  2OLU A;  2B95 A;  3BQ8 A;  5EPH A;  1OT9 A;  3OPH A;  3VV4 A;  2WGW A;  4PKY G;  1I2S A;  1FR1 A;  2OOL A;  3IXB A;  1XX2 A;  2P9V B;  3LI9 A;  4CLC E;  2P74 A;  1E4D A;  1W63 M;  4PKY A;  1CQA A;  4EWF A;  5CHM A;  2P9V A;  3L7H A;  4FH4 A;  1N9N A;  3H7W B;  1LI0 A;  4ZJ1 A;  4BD1 A;  2VGJ A;  3NOP C;  3T4Q A;  3BFG A;  4R0Q A;  4EBN A;  5L10 A;  3UME A;  4KZ7 A;  1PW1 A;  5FQJ A;  3H7W A;  2W1R A;  2INW A;  4X56 A;  3FV7 A;  4ID4 A;  2W27 A;  3CUE C;  3HUN A;  3NDE A;  1O07 A;  3AGD A;  1S0W A;  5A90 A;  3MSH A;  3QHY A;  4JGO A;  2OAP 1;  3A3E A;  4Y3I A;  4M4X A;  4OP5 A;  4E3I A;  3M2J A;  4H6J B;  3UMD A;  4JF4 A;  3IWQ A;  3Q1F A;  2HPB A;  4S2I A;  3SH7 A;  1ES2 A;  3G2Y A;  2WUQ A;  1MWR A;  2H28 A;  3V67 A;  1TF1 A;  1KE4 A;  2XSS A;  5FQ9 A;  5J7E A;  2V1A A;  3QP4 A;  4I38 A;  3PBR A;  3SH8 A;  3GQZ A;  5EVE A;  3Q7V B;  1IEM A;  2DNS A;  5CGX A;  4EUV A;  4NXG A;  2M7V A;  5U47 A;  4XXR A;  3IF6 C;  5M19 A;  3IHB A;  4CQH A;  4R1G A;  4PM8 A;  2O9C A;  2AVX A;  2D02 A;  3OZH A;  2C5W B;  3GSG A;  5FI2 A;  1ZHH B;  4KZB A;  1ZG4 A;  4E3M A;  4QY5 A;  3DW0 A;  2RCX A;  4PM7 A;  5EM1 A;  3MBZ A;  5FEF A;  3OCN A;  4FUW A;  2Y2I A;  4YNR A;  4Q8I A;  3BFE A;  4UA7 A;  4EU0 A;  2VGL S;  1CJF A;  3FPV A;  1I5Q A;  3G4P A;  1Z6F A;  3HJK A;  1S66 L;  4LLO B;  2XF3 A;  4UQI M;  4GW9 A;  4KZ9 A;  1K0K A;  1ONG A;  2QPN A;  5EOE A;  4IBX A;  1SDN A;  4JF5 A;  1WA9 A;  3A3F A;  1GHI A;  1S4S A;  1ESU A;  4RQ9 A;  4PHT A;  3WS0 A;  2HJE A;  2NUT C;  4E3K A;  4JGQ A;  2WZX A;  4MCW A;  3PAE A;  1J9M A;  4ETX A;  4MLL A;  2EFU A;  3LCE A;  3M6B A;  4OQ0 A;  4QHC A;  4S2P A;  3ZYT A;  4X53 A;  3LIB A;  2WZZ A;  3FKV A;  5IS1 A;  2KDK A;  2Y2M A;  3NDG A;  2ZM8 A;  3OPP A; 
#chains in the Genus database with same CATH homology
 4L9F A;  4P6Z M;  3T4S A;  3B47 A;  3OBF A;  5G4Y A;  2Y8H A;  1ZTU A;  1MC0 A;  2HGV A;  1NLY A;  1DP8 A;  2GZA A;  2VJW A;  3GDI A;  4NKP A;  4R3A A;  3KSH A;  1EW0 A;  2ZOH A;  4H6J A;  2QHK A;  2P08 A;  1NRJ A;  4HNB A;  4KUO A;  3CIT A;  5MC7 A;  2QJ5 A;  3LIF A;  2GX5 A;  2VV6 A;  3VE4 A;  4WEK A;  3JVV A;  3CWF A;  2V1B A;  3PYP A;  3T4K A;  4AFI A;  2Y79 A;  1T1C A;  1GSV A;  1T1A A;  3NOU C;  4HP9 A;  4WN5 A;  3EGX C;  1DRM A;  2BAS A;  4WLA A;  3LIE A;  3RTY A;  3PXP A;  2WKR A;  3KYZ A;  5HSQ A;  2D01 A;  2Z6C A;  4QPR A;  4LRY C;  4HJ3 A;  4DJ2 A;  1DP9 A;  5F68 A;  3LIC A;  2M7U A;  3BJN A;  1V9Z A;  3K3D A;  2PD7 A;  3LFV A;  2GJ3 A;  3LR5 A;  4BJP A;  2A2L A;  5HWW A;  4FSF A;  3F1O A;  2W0N A;  4G3W A;  2JKR M;  2YKF A;  3VE3 A;  1XFN A;  2KX6 A;  3LIA A;  1VB6 A;  5DFY A;  2B02 A;  1UGU A;  3MXQ A;  3NOT C;  1UWN X;  2LB5 A;  5HL6 A;  3G6O A;  3O5Y A;  4YWZ A;  1JNU A;  3VOL A;  2VZW A;  2ZMV A;  1LT0 A;  4HOI A;  2VV8 A;  4BBU A;  2OWH A;  1G6O A;  2R78 A;  5LBR A;  2I9V A;  2WKQ A;  4EER A;  4L9G A;  2PR5 A;  2PR6 A;  3RFB A;  2JHE A;  4GCZ A;  4R6L A;  3LR0 A;  1MKM A;  3HCY A;  2W3H A;  3BWL A;  1MZU A;  1P9W A;  1TS6 A;  2VX8 A;  1G28 A;  1F9I A;  1LSW A;  4KUK A;  2W3F A;  5K5B A;  5AVF A;  3IBR A;  3T4T A;  3B42 A;  1OTE A;  3EEH A;  4DN0 A;  3IS2 A;  1S1Y A;  3MQ0 A;  2J80 A;  3EQU A;  3PR6 A;  4B9O A;  2ZOI A;  5IT5 A;  3KX0 X;  4BWI A;  5DFX A;  5HD3 A;  2PDR A;  3EEA A;  1OT6 A;  3MF0 A;  1P0Z A;  1S1Z A;  3MFX A;  3SW1 A;  3K3C A;  1GSX A;  2OAQ 1;  1D7E A;  3UB6 A;  1IFQ A;  1X0O A;  1DP6 A;  1XJ2 A;  1YAX A;  2VEA A;  4IUH A;  2VKS A;  4MN7 A;  3OC2 A;  4Q0J A;  1OTB A;  3FG8 A;  2VGL M;  1F5M A;  3S7P A;  3KSG A;  4HP4 A;  5TJJ A;  3KSF A;  4CLC D;  4GLQ A;  4NXE A;  3CI6 A;  2ZBB A;  4JGR A;  5A8B A;  2XRO A;  4OOL A;  3CLO A;  3F1P B;  2JKT M;  3TW8 A;  5HDC A;  4CLC B;  2EWV A;  2V9A A;  5I5L A;  2HF6 A;  3KYQ A;  5DKK A;  2V0W A;  5F6A A;  5F5Y A;  1OJG A;  2HJ9 C;  1OTD A;  3A0R A;  4R38 A;  3MJQ A;  1N9L A;  5CX7 A;  2OWJ A;  2PYR A;  4Q0I A;  4UQI S;  2QYB A;  4E04 A;  4GS9 B;  1Y28 A;  4XT2 B;  4II7 A;  3F1P A;  2K7S A;  4CLC A;  4MN5 A;  2P04 A;  4GHI B;  1IOU A;  1LL8 A;  4FOF A;  5HDD A;  3E4O A;  3C8C A;  3OLO A;  5C5K A;  5DJU A;  1ODV A;  2YKH A;  3BQA A;  4GS9 A;  5EFW A;  4XT2 A;  3UB9 A;  4DMZ A;  1GSW A;  3KO6 A;  3UE3 A;  3E4P A;  5HPF A;  4EEP A;  2J3W A;  5F69 A;  4WL9 A;  4GHI A;  1BYW A;  5DF9 A;  3TJZ C;  2K2N A;  1T19 A;  3BW6 A;  5FL3 A;  4Q0H A;  3T50 A;  4EEU A;  5DJT A;  4IHQ A;  4EET B;  3NHQ A;  1LSV A;  4R70 A;  3S7Q A;  4ZRR A;  3F1N B;  4I39 A;  3FC7 A;  1YSP A;  2ZMF A;  2KOI A;  3KSI A;  4BBV A;  4KQO A;  4P6Z S;  5HPI A;  4CLC C;  4NEE D;  3PHY A;  4L0L A;  2L1M A;  3E98 A;  4KQD A;  3B33 A;  3F1N A;  3BQ8 A;  1XFQ A;  1OT9 A;  3A0V A;  1LSX A;  2K31 A;  3D72 A;  3NJA A;  3VV4 A;  2EWW A;  4PKY G;  4EXO A;  1NLZ A;  2OOL A;  1NWZ A;  2L4R A;  1YKD A;  4HJ6 A;  4MN6 A;  3CUE A;  5L8M A;  5DKL A;  3LI9 A;  4G3V A;  3ULF A;  2G7U A;  1V9Y A;  4CLC E;  1W63 M;  3BY9 A;  4PAU A;  2M1C A;  3LYX A;  4PKY A;  2NUP C;  3P7N A;  2P7J A;  1OTA A;  3E4Q A;  1KOU A;  4Y5F A;  5HWT A;  3PBN A;  4WUJ A;  4LRZ E;  1N9N A;  3H7W B;  4HH3 A;  4O01 A;  2B18 A;  2QKP A;  2GNX A;  2JN7 A;  1YSQ A;  3NOP C;  4L9E A;  3T4Q A;  3MQO A;  3UME A;  3R7W B;  2IA2 A;  1H8M A;  3H7W A;  4I3I A;  5IU1 A;  2W1R A;  4O8G A;  2O0Y A;  2W1T B;  2INW A;  3D3O A;  2W27 A;  2EA9 A;  4HY8 A;  3CUE C;  4BBT A;  2VLG A;  2O9A A;  2PHY A;  3A0S A;  4HHD A;  3LI8 A;  3EQV A;  4JGO A;  2OAP 1;  4Y3I A;  4M4X A;  2W1T A;  4NXF A;  1OJ5 A;  3PBT A;  4H6J B;  3UMD A;  2O99 A;  3GEC A;  5J3W A;  3LR4 A;  3W2Z A;  3HJI A;  4WEJ A;  2JKT I;  3MR0 A;  4ARZ B;  5HZH A;  2H28 A;  3V67 A;  4UEY A;  1TF1 A;  2PT7 A;  2XSS A;  4B93 A;  4NXB A;  4ARZ A;  2MJ6 A;  4LRX C;  5J7E A;  2CMN A;  4O0P A;  1STZ A;  3E0Y A;  3OOV A;  2V1A A;  2VA0 A;  1S4R A;  4EES A;  4I38 A;  3PBR A;  1TS0 A;  4ME4 A;  2O9B A;  2FZ0 A;  2J3T D;  4WEL A;  5HD5 A;  2PYP A;  2FH5 A;  2A24 B;  3DBA A;  1P97 A;  4IJG A;  4I3A A;  4Y2F A;  4MMN A;  3MMH A;  4WF0 A;  2V0U A;  4IUK A;  2JKR I;  3R4K A;  4GJ4 A;  1P9R A;  4HJ4 A;  2QWS A;  3H82 B;  1H3Q A;  3P01 A;  3PBS A;  5TBM B;  2XA7 S;  3MQQ A;  4G3K A;  2A24 A;  3F1O B;  3U2A A;  5HDS A;  2L0W A;  4EUV A;  4HH2 A;  1N9O A;  2WKP A;  4NXG A;  2M7V A;  3EGD C;  4MDZ A;  3K2N A;  2HV1 A;  2PD8 A;  4F3L B;  4CQH A;  3OCL A;  3T4O A;  3H82 A;  3UE6 A;  2O9C A;  2Z6D A;  2D02 A;  5TBM A;  1OPX A;  1ZHH B;  3PBQ A;  4EQ1 A;  4Z1W A;  2W3G A;  3EWK A;  4I5S A;  4F3L A;  5J4E A;  3OCN A;  4BMW A;  3IBJ A;  4YNR A;  1XJ3 A;  4I3J A;  1VHM A;  2QJ7 A;  3LUQ A;  3ICY A;  3LID A;  4EU0 A;  1W63 Q;  4JGP A;  2VGL S;  3TE8 A;  4YOF A;  5HWV A;  5AVE A;  3FPV A;  3TRC A;  5AJG A;  2DMW A;  1F98 A;  1TS8 A;  4HI4 A;  3EOI A;  1T18 A;  3HJK A;  3FPW A;  1S66 L;  4LLO B;  2W3E A;  4UQI M;  4GW9 A;  3LR3 A;  1T1B A;  4ETZ A;  1S67 L;  4OOM A;  5KIZ A;  1WA9 A;  3JVU A;  1S4S A;  3S7O A;  3UB7 A;  4RQ9 A;  2J3T C;  4PHT A;  2HJE A;  2NUT C;  4LPZ A;  5G4Z A;  5KSH A;  4JGQ A;  2KLI A;  3BY8 A;  4MCW A;  4HQA A;  4ETX A;  1XJ4 A;  3IS2 B;  4EW7 A;  2LB9 A;  2VV7 A;  3CAX A;  2XRN A;  1D06 A;  3ZQ5 A;  3UB8 A;  1OTI A;  4K08 A;  4DJ3 A;  3T4J A;  3ZYT A;  3LIB A;  3C38 A;  2XA7 M;  5IS1 A;  3H9W A;  3C30 A;  1TS7 A;  3S7N A;  2KDK A;  1TD5 A;  4HIA A;  3R7W A;  3T4L A;  1UWP X;  2W3D A;  3RH8 B;  3PBO A;  1XJ6 A;  3C2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...