2YKFA

Sensor region of a sensor histidine kinase
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
286
structure length
263
Chain Sequence
MSTLGDLLAEHTVLPGSAVDHLHAVVGEWQLLADLSFADYLMWVRRDDGVLVCVAQCRPNTGPTVVHTDAVGTVVAANSMPLVAATFSGGHSVEVSPVRFGDQVVAVLTRHQPELAARRRSGHLETAYRLCATDLLRMLAEGTFPDASRSSPRAGDGFIRLDVDGVVSYASPNALSAYHRMGLTTELEGVNLIDATRPLISDPFEAHEVDEHVQDLLAGDGKGMRMEVDAGGATVLLRTLPLVVAGRNVGAAILIRDVTEVKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Sensor Region of the Ubiquitous Cytosolic Sensor Kinase, Pdtas, Contains Pas and Gaf Domain Sensing Modules.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords PROBABLE SENSOR HISTIDINE KINASE PDTAS
total genus 76
structure length 263
sequence length 286
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12282 H_kinase_N Signal transduction histidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2ykfA02
3.30.450.280 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2ykfA01
1OTIA 2VV6A 4BBUA 1G28A 1EW0A 1GSWA 2QKPA 4NXEA 2JHEA 3F1OB 3MQQA 1OJ5A 2WKQA 4HJ4A 4WUJA 4WF0A 1XJ2A 3UMDA 5HWTA 1OJGA 2OWHA 5TBMB 2PDRA 5A8BA 1T1BA 4WN5A 2K7SA 4HH3A 4EEPA 3NOTC 1T18A 2JN7A 2L0WA 2VEAA 2WKRA 3A0VA 3A0RA 1DRMA 2A24A 4LRXC 2PR5A 2INWA 4H6JA 3F1NA 4L9GA 4GW9A 2PD7A 5HD5A 4LRZE 4HIAA 5DKLA 3LICA 2V1AA 3UB7A 5J4EA 2VV7A 2PHYA 5DKKA 1T1AA 1VB6A 2J80A 2YKFA 3PYPA 4GHIB 3NHQA 4NXGA 5EFWA 3C2WA 5F6AA 4NXBA 3FG8A 3G6OA 3H82B 1UWNX 3T50A 3IS2B 4XT2B 4B9OA 2PYRA 2HV1A 2PR6A 1S4RA 4YWZA 3NJAA 4JGRA 4XT2A 1XJ6A 4F3LA 3KX0X 1DP8A 4BBTA 1F98A 1S67L 1WA9A 3F1PA 3A0SA 5HZHA 4LRYC 5KIZA 2V9AA 5IS1A 4LLOB 2Z6DA 4HI4A 1UGUA 3MJQA 3IBRA 3P7NA 4K08A 1N9NA 4HHDA 2CMNA 5AVEA 4KUKA 1D7EA 1OTBA 1LSXA 2KDKA 4HY8A 4L9FA 3VE3A 5HWVA 4EEUA 2L1MA 3NOPC 3RTYA 4HJ6A 1XJ3A 3CLOA 1TS8A 5TBMA 4R38A 1TS6A 4R70A 2BASA 3UB9A 3C8CA 5I5LA 1DP9A 4DJ3A 3SW1A 3VE4A 4EETB 3LIBA 5HDCA 3RH8B 2W0NA 2A24B 5AVFA 2QHKA 3LIDA 4E04A 4EXOA 1S4SA 4HP4A 3BWLA 3D72A 1LT0A 4WLAA 1TS7A 3GDIA 1Y28A 2D02A 2M1CA 2PD8A 2OWJA 1T1CA 4GS9B 3HJIA 1N9OA 1TS0A 2V0UA 3MQOA 4BBVA 1N9LA 2R78A 3LYXA 3HJKA 4GS9A 3MXQA 3IS2A 3LIFA 4DJ2A 2B02A 1OTDA 3E4OA 1KOUA 1DP6A 2YKHA 4PKYG 4JGOA 1LL8A 1P97A 1X0OA 1ODVA 2VV8A 3EEHA 4F3LB 5HDSA 1BYWA 4KQDA 4MN6A 4KUOA 1D06A 5G4ZA 4I3AA 3H9WA 1GSXA 1V9ZA 2QJ5A 3FC7A 4M4XA 1LSVA 3E4QA 3UB6A 2V1BA 3MR0A 3E4PA 3MFXA 5IU1A 5J3WA 1S1YA 1NWZA 1XFNA 3LI8A 5HD3A 3ZQ5A 3LI9A 2QWSA 2GJ3A 4HQAA 3UMEA 4LPZA 3VOLA 1LSWA 1GSVA 4EERA 1OTAA 2Z6CA 3BY9A 5HDDA 3ICYA 4EQ1A 5HSQA 2EA9A 2OOLA 3NOUC 3UE6A 4I3JA 2KX6A 4WL9A 5F68A 3F1PB 4HH2A 1MZUA 3PHYA 2W27A 1JNUA 4HOIA 2ZBBA 4JGPA 3BY8A 3LUQA 3GECA 4R6LA 5DJTA 1OT6A 3EWKA 4MN5A 5DJUA 2WKPA 3K3DA 3B33A 1OT9A 3F1NB 4H6JB 1S66L 3H82A 2PYPA 1T19A 4GCZA 4I38A 4JGQA 4NXFA 5F5YA 1F9IA 3H7WA 4I3IA 5F69A 3ULFA 4PKYA 2P7JA 4EW7A 4GHIA 2H28A 3CAXA 4RQ9A 1S1ZA 3CWFA 2V0WA 1P0ZA 4I39A 4EESA 3H7WB 5G4YA 1UWPX 2L4RA 5HWWA 3LIEA 3UB8A 3F1OA 5J7EA 2VLGA 3LIAA 3OLOA 2ZOHA 4HJ3A 2D01A 4HP9A 3K3CA 4R3AA 4L9EA 4I5SA 1V9YA 1OTEA 2I9VA 1XFQA 4HNBA 1XJ4A 2QJ7A 2ZOIA
chains in the Genus database with same CATH superfamily
5L10A 4BMWA 1MC0A 4F94A 1G28A 1ACFA 1OJGA 3QP8A 1YLTA 2UV0E 2IWBA 4HH3A 3OCNA 3NOTC 2VEAA 4LRXC 4ETZA 2QYBA 3BJNA 5DKKA 4YNRA 3HLGA 2ZC6B 5TFQA 1TEMA 3FG8A 4N9KA 4ZRRA 3IS2B 5DF7A 4JF4A 4YOFA 3S7NA 4HI4A 4LV2A 4KUKA 3RTYA 1TS8A 3VOZA 3KYQA 2OSUA 1BLSA 1W79A 4S2MA 3GDIA 2WGIA 3V3SA 3W4OA 2H0YA 3S22A 3HJIA 2EWVA 3IWOA 4GS9A 1W7FA 1KOUA 3PTEA 4KQQA 1F2KA 2LB9A 4GD6A 3IF6B 1XFNA 2VGJA 3MMHA 5HD3A 4K0XA 3LI9A 2GJ3A 3U4LP 2V8FA 5M1AA 3R7WB 3PAEA 1ERMA 3MFDA 3BY8A 4FTXA 4H6JB 1S66L 4R0QA 3BFDA 2D01A 4FH4A 3K3CA 2H0TA 4HP9A 4L9EA 4PM8A 4ZAMA 4DE1A 2W3EA 2ZOIA 2PU4A 1FR6A 5EV0A 4PM5A 5CECA 4KG6A 4HJ4A 3LO7A 3R4KA 2OWHA 4G3KA 3PXPA 2WAEA 3ZFZA 2IA2A 2K2NA 4H6JA 3IX8A 3GTCA 1VB6A 1NRFA 3ZVWA 1GHMA 4YWZA 4WYYA 1PWCA 3A0SA 4ZJ1A 4IVIA 1CI9A 2JC7A 3VP1A 3KYZA 3M6HA 2FFFB 4HHDA 1YLJA 2AVXA 4L9FA 2R9WA 5EM0A 3IT9A 2B95A 5HDCA 1FCMA 4O01A 3GMWA 1MY8A 2Y2OA 2V0UA 3ZGAB 3VP2A 4N1XA 1KGEA 1GHPA 2VV8A 4GDNA 5G4ZA 1ALQA 3A3DA 5FAQA 1K57A 2DCFA 4E3NA 5FEGA 2MJ6A 5HSQA 1E3UA 1H3QA 4R6LA 2IWDA 5DJUA 2EX2A 4I38A 3TE8A 4ZJ3A 1F9IA 2P7JA 4OKPA 1IYQA 1QMFA 5FA7A 4DN0A 4OPZA 3C4PA 2JKFA 4KQRA 3S4XA 3LIAA 1K38A 1FR1A 4LFUA 2QJ7A 3WRZA 2WAFA 3PBSA 3CPTA 5KZHA 4JXSA 2BTFP 4WN5A 3SH8A 1DRMA 3P98A 3OPPA 5J4EA 1H8MA 2Q0OA 3LEQA 3H82B 3MXRA 3T4TA 1MBLA 2WKHA 3KX0X 4JPMA 4BBTA 1WYBA 1IEMA 1G68A 5GHXA 3E2LA 3LR0A 4YINA 3C5AA 2QPNA 3VSLA 1HZOA 5FI2A 1RP5A 1HVBA 4KQOA 4DJ3A 4S2OA 5HARA 1EROA 4LV1A 4UA6A 1IKIA 3MZDA 2VX8A 3RXWA 3L7HA 3HVFA 5L2FA 3BYDA 4P6ZS 5J3WA 1G6AA 4R3BA 3FPWA 4CLCA 2LB5A 4EQ1A 4LCMA 1MWRA 4O8GA 3UPOA 5L8MA 4YFMA 3PBTA 3HLCA 3PHYA 2ZLYA 4HOIA 1BZAA 2EFXA 2JKRM 3IH8A 2VKSA 4Q0JA 5AJGA 2HJEA 3H82A 2V8CA 3H7WA 3ZYTA 2RCXA 4EW7A 5KSCA 4PKYA 1NYMA 2RL3A 2Y2MA 3OCLA 2BLSA 1ZC2A 1KGFA 3RJUA 3HBRA 1PZOA 2JHEA 3T1XA 4ARZB 2EX9A 1IELA 3BM6A 5EUAA 2JN7A 2FZ0A 2PR5A 4AFIA 4HEFA 4ID4A 2PHYA 2YKFA 3E2KA 4DDSA 3S1YA 5KMWA 3NDGA 4N9LA 4XT2A 4EBLA 1FILA 4BD1A 3LFVA 4IEDA 3P7NA 1JTDA 4QJGA 1XJ3A 2EXBA 1TS6A 3C30A 3P09A 4OPQA 1HD8A 4EXOA 4X69A 2C6WB 1S4SA 4FH2A 4WLAA 1FSWA 1JWPA 5AQ9A 1L2SA 1D1JA 4PM6A 3CJMA 3HLBA 1OTDA 3NY4A 3ZCZA 1TVFA 1ERQA 2WKIA 4QU3A 2FFYA 3FC7A 3UB6A 4BENA 2ZQ7A 2R9XA 4IJGA 5A92A 5IU1A 3LI8A 2QWSA 3MS6A 3NBLA 3EGXC 2OOLA 3F1PB 2EFUA 3IXGA 3GECA 5DJTA 4GDBA 3EGDC 1F5MA 3MF0A 3N6IA 2ZM2A 4GHIA 3WS5A 3ITBA 1GHIA 3H7WB 3LIEA 3DBAA 3CI6A 3F1OA 5J7EA 3T4OA 1VETB 2ZOHA 4OOYA 3OOVA 4N92A 3IWIA 1OTIA 3T4KA 4QY5A 4XUXA 4P87A 5CXWA 4RA7A 2OLVA 4MNRA 5HX9A 3BQ8A 4L9GA 4GZBA 5DKLA 4RX2A 5EFWA 1UWNX 3T50A 4B93A 4KZ3A 3NECA 4UA7A 1WA9A 4X1LA 2J3TD 5L07A 2FH5A 3MJQA 3TG9A 2CMNA 1D7EA 2L1MA 1EWZA 1SZVA 1E25A 3SW1A 1TF1A 2HZ5A 1C3BA 1TS7A 1FOFA 2D02A 2M7VA 1WYCA 3OZHA 3MXQA 3LIFA 5FAOA 3C38A 5TGFA 4U3TA 2OAQ1 4NG2A 3TSGA 3MR0A 1KDWA 4FCFA 3BY9A 4ETXA 4X55A 3CPTB 1K6RA 4WL9A 5HAPA 1ZKJA 3O87A 1OPXA 1K6SA 1KVLA 2A2LA 1MXOA 2J7VA 3BECA 4M3KA 1L0DA 1E3UD 3CWFA 1YLWA 5G4YA 4JBFA 2A3UA 4B4XA 5FDHA 4U0XA 1XGJA 4R4SA 3JPUA 2HJ9C 4BBUA 3MBZA 4S2JA 3HREA 4X56A 5GHZA 5K5BA 3S7OA 4WELA 5HD5A 4GW9A 2PD7A 2Y79A 4ME4A 3OPRA 3IHBA 4G3VA 3A3IA 1YLYA 1FCNA 2DNSA 4ZDXA 2ZM8A 4XUZA 1NZUA 2J3WA 3G6OA 3TRCA 4FUWA 1I2WA 4S2LA 5U47A 3O86A 2H5SA 1XXMA 2Q9MA 2V1ZA 1YMXA 4JXVA 4KG5A 1IKGA 1DP8A 1RCJA 3S7QA 4K08A 3HLFA 3B42A 2ZQAA 1PW8A 4PM9A 1XP4A 2O99A 4IBRA 2O9CA 1J3WA 5GLCA 4P6ZM 3BW6A 3UNWA 4D2OA 4Y0TA 3BEBA 1K54A 3DTEA 4R4RA 3HJKA 2OV5A 3UO9A 4PKYG 4IHQA 1PRQA 4E3JA 4PMAA 3MKEA 1MWSA 1ODVA 4F3LB 3LCEA 2V2FF 3P01A 4KZ5A 3JYIA 3FKWA 2P9VB 3Q7VB 5HDDA 3VV4A 1GCEA 1DJAA 5TJJA 3WS1A 5JYOA 3HCYA 4Y5FA 2Y4AA 1MZUA 1SDEA 3DTMA 4Y0UA 4MBKA 2G7UA 5F69A 1N4OA 1W63M 3ZDJA 4I5SA 4X68A 4DKIA 3F1OB 3UMDA 2Y2HA 1NLYA 2XFTA 2ZQDA 2W3DA 3HUMA 1IYOA 3BRMA 3RXXA 3AGEA 4NXBA 3QP4A 4X25A 3JVVA 2X02A 1XJ6A 4B4ZA 2NUTC 2ZQ8A 2HGVA 1KGGA 3IWQA 1ESIA 2JKRI 1Q2QA 3B3XA 4OOMA 3IXDA 3IF5A 5FI7A 3WS0A 2Y2NA 2PT7A 5CHMA 4KZBA 2W1TB 2XDMA 4E04A 3VSKA 2H10A 1T1CA 3ZG8B 3LY4A 2XROA 2Z2LB 1CK3A 3IS2A 5EVIB 1ONGA 5HAQA 3SH7A 2ZMFA 1PWGA 1GSXA 1LLBA 4Z9QA 2PBDP 1LSVA 4IVKA 1SKOB 4OOLA 4X1MA 1M6KA 1MPLA 5DFXA 1AXBA 4EBPA 4ESPA 1BLHA 5A91A 4FD8A 1LHYA 1U60A 3W4PA 1NY0A 3K3DA 4R3AA 1YAXA 2PYPA 4EWFA 1YKDA 4OPYA 3CITA 3PBOA 5E2GA 3QP2A 3SS4A 3QNCA 4ARZA 1V9YA 4WEKA 3HLEA 2XF3A 3DW0A 1O07A 5FASA 2VV6A 2WZZA 2QKPA 1CF0A 3DWKA 2JKGA 2I72A 5TBMB 1T1BA 3O88A 1T18A 1BT5A 3A0RA 1DY6A 2INWA 3F1NA 5CEDA 1XKZA 1T1AA 4KZ4A 2EX8A 1TD5A 1L0EA 3B47A 2W1RA 2ZC7A 4E3KA 5EOEA 1DJCA 5F82A 3G32A 4LLOB 1ONHA 5DF9A 1OTBA 2G2WA 3VE3A 5HWVA 1CI8A 3IF6A 3WRTA 2BASA 1VETA 3V3RA 5AQAA 1VHMA 4UQIM 2M1CA 3G31A 4HESA 4MBFA 2M7UA 2C5WB 2WGWA 2EWWA 4FOFA 5GL9A 3GSGA 3JVUA 4EV4A 1ZTUA 4KUOA 1K54C 2Y2KA 5CTMA 2W3FA 2V1BA 3M2KA 4S2NA 1S1YA 2WUQA 4DF6A 5KSHA 1VEUB 1G6OA 2NUPC 2Z6CA 4EERA 1IYSA 3UE6A 4JLFA 3ISGA 5GLDA 2W27A 5FL3A 3LUQA 2P08A 3V50A 3T1SA 5FAPA 3ULFA 2ZC4B 4NKPA 1ZHHB 3CUEA 4MCWA 4HJ3A 3UE1A 4S2IA 1J9MA 5L09A 1RGZA 4KZ9A 1XJ4A 4Q0IA 1K25A 4CLCC 3LR3A 1KVMA 1XJ2A 4GNUA 1GA0A 3BLSA 1FSYA 1NJ4A 2A24A 3D9YA 2HP9A 3C7UA 1TDLA 2W1TA 5HL1A 4EUVA 3PAGA 1BULA 3C2WA 4U0TA 3NDEA 1AWIA 1H0MA 3WWXA 4JGRA 1FCOA 4DE3A 2PBYA 4OLDA 2X01A 5GLBA 1UGUA 1LSXA 4OP5A 5JYPA 3VOYA 3ZG5A 1VQQA 3UB9A 5I5LA 4WZ5C 4EETB 3CMZA 4HP4A 3G2YA 2PD8A 4NETA 4P85A 1CEGA 3Q7ZA 4HBUA 4JF5A 3MQOA 2Z2MB 4UEYA 2YKHA 1X0OA 3N8LA 1D06A 4O7DA 1KE3A 2HF6A 2KLIA 2WYXA 5CTNA 3ZQ5A 4MLLA 2B5RA 3S7PA 3VOLA 5DF8A 3E0YA 4ZTKA 2Y2PA 2BG1A 4MDZA 3TOIA 4HH2A 3DTKA 5EVLA 4JGPA 2ZBBA 4H8RA 3M2JA 2XR0A 3R7WA 3QP6A 1HLUP 3SS3A 1S1ZA 4BWIA 1I2SA 3FWLA 5C5KA 1W8YA 1L3LA 3ZG9B 4B9OA 3O5YA 4PPRA 2DMWA 1P9RA 1Z09A 3GR2A 3OPLA 3ZNYA 2HDQA 2K7SA 3N4IA 3IH9A 5GLAA 4C6YA 2WKRA 4BD0A 4LRZE 5FSRA 2VGLM 5CHUA 3OBFA 2J80A 5DTSA 3NHQA 5F6AA 5I94A 4P0MA 1STZA 4S2NC 3WS4A 3T1RA 2Y2IA 1LI0A 5KIZA 5MC7A 4KENB 2O9BA 3Q1FA 5HW3A 2J9PA 1BTLA 2A49A 4K0WA 5FQKA 1EI5A 4HJ6A 4R38A 3RH8B 2A24B 3BWLA 4E3MA 5EVIA 4N1HA 4IUHA 3DAVA 4GOGA 2ZQ9A 4S2KA 3HLWA 3V5MA 4CPKA 3E4OA 3V67A 5LBRA 5EE8A 3T1QB 3EEHA 2Y59A 4MN6A 3H9WA 4OLGA 1PFLA 4OVDA 3NIAA 3G34A 4QY6A 4ZJ2A 2KX6A 2JKTI 1JWZA 3FZCA 1FQGA 1NYYA 2XGNA 4MMNA 5FDSA 2V0WA 2KOIA 1PIOA 3BQAA 5E2FA 3OLOA 1OTEA 1K56A 3T4LA 2PYRA 1ES4A 1GSWA 4B88A 4Y3IA 4OQ0A 2ZC5B 5A8BA 1PI5A 3A0VA 5FEFA 4OQHA 4Q8IA 2J9OA 5G18A 2VV7A 1LI9A 4NXGA 2HP5A 3OPHA 2JE5A 1Y4OA 3NJAA 2WADA 3V39A 5HZHA 2V9AA 2ZD8A 3NULA 3IXHA 3G4PA 2J3TC 1YQSA 2K31A 3ITAA 5DVAA 4LENA 2GZAA 3C8CA 2OLUA 1MWUA 2WGWB 5TR7A 1LT0A 3AGDA 1NRJA 3LR5A 4Y7PA 3PBRA 3VP4A 2QZ6A 4DJ2A 1FIKA 3IXBA 4UHUA 1KE0A 1BLCA 3DWZA 1BYWA 4WEJA 3EOIA 1YLZA 3HUNA 2Y2GA 2QJ5A 5J8XA 3E4QA 2P9VA 3Q7VA 3E4PA 4OP8A 5HPIA 1PYYA 2VK3A 5DTKA 3NOUC 4EUZA 3IHAA 3UDXA 3VMAA 5FQQA 3BFGA 3HUOA 1MWTA 1KDSA 3CAXA 2ZMVA 3KYEA 3UE3A 5IT5A 4DRTA 5IHVA 1ZG4A 3QHYA 4QB8A 4CQHA 5FQ9A 1QMEA 4RVAA 3Q81A 2PDRA 1IFQA 4JXGA 4LV0A 4E3OA 4CJNA 1PNEA 3QP1A 5F5YA 2L0WA 1LL5A 4NEED 5FQIA 4XT2B 2HDRA 4PAUA 3FKVA 4X6TA 5IS1A 2XD1A 1N9NA 5AVEA 1ES2A 4KZ7A 4QHCA 2ZMAA 2B18A 3PBNA 4R70A 3D4FA 3ZVTA 2ZC3B 4HBTA 3T12B 1ZG6A 4GKUA 3QP5A 1Y28A 4DE2A 5DFYA 1NZOA 3UDIA 4Z1WA 4OH0A 2R78A 3GRJA 2O0YA 2JBFA 4BL3A 1PWDA 4JGOA 3BFFA 1W63Q 3C4OA 4WBGA 3RFBA 2O9AA 5GHYA 5F83A 3BLMA 3MSHA 4Q0HA 5CHJA 5A90A 3U2AA 3ICYA 4I3JA 4BL2A 3ZG7B 3G2ZA 4G3WA 2Q9NA 2IWCA 4EQIA 4PHTA 5M19A 2WKPA 1JTGA 1H8YA 4BJPA 1T19A 4NXFA 3D3OA 3IX3A 5HWWA 4WZ4A 2HPBA 1ES3A 3N8SA 3MQ0A 2VLGA 4CLCD 3K2NA 3AGFA 3IF6C 3IQAA 1XFQA 5FI6A 1K4FA 3EQUA 2WKQA 2ZQCA 3A3EA 2P04A 4EEPA 2Y2LA 1M40A 3Q82A 3CZDA 3VP3A 1IYPA 4ZBEA 5BOHA 2V1AA 3UB7A 3DTIA 3TW8A 4GHIB 2XK1A 2HV1A 2XH9A 1PW1A 3LY3A 3WS2A 4F3LA 1S6RA 4Y17A 1VM1A 1F98A 2Y55A 1JWVA 3F1PA 1G5UA 1K4EA 4EU0A 2ACGA 2PAVP 3IBRA 1L0GA 2KDKA 3OC2A 3ZHHA 3ZNTA 3PBQA 2W3GA 4Y0OA 5TBMA 3N7WA 1DP9A 4A5RA 3KSGA 1K55A 2WKEA 3D72A 3CUEC 2OWJA 1N9OA 2VGLS 4DMZA 3QNBA 2PRFA 5CGSA 3MZFA 5FATA 3HL9A 1V9ZA 4OQIA 4KG2A 2E8IA 4HQAA 4DXBA 4WM9A 1ESUA 4EBNA 2G2UA 1KE4A 1OT6A 1P9WA 4LCLA 2W3HA 1OT9A 4JGQA 1K0KA 3MXSA 1P0ZA 4EESA 2L4RA 3UB8A 1CEFA 3UB5P 5E2HA 2J8YA 1XGIA 3W8KA 4LRYC 2HDUA 4R3JA 2V20A 3E98A 2OAP1 5CRFA 4WF0A 1NLZA 1Q2PA 5HWTA 5EOOA 3EEAA 4K91A 3VFHA 5EPHA 2VZWA 4KZ6A 4HIAA 3VP0A 3LICA 1CJFA 3PYPA 1W5DA 5CERA 5EVID 4E6WA 2PR6A 5A93A 1S67L 3N8RA 2WGVA 2VGKA 4NK3A 2Z6DA 1RGYA 4GB7A 1S0WA 5E43A 1HTZA 3BFEA 2GNXA 3SZTA 5CGWA 3UDFA 2XEPA 4L0LA 3KSFA 2UWXA 1Y54A 4PM7A 1PZPA 3GVBA 5AVFA 3NI9A 1YMSA 4OQGA 4WMCD 4MEZA 5EVEA 4X53A 4Y13A 3O3VA 2VA0A 5AQ7A 2XA7M 1I5QA 3LYXA 4BBVA 2EXAA 3MZEA 4OONA 2EX6A 4GN2A 1JVJA 4JF6A 1LL8A 5HDSA 3M6BA 4I3AA 3SS5A 4CLCB 1YM1A 3MFXA 3L9KA 1NWZA 3PR6A 3UMEA 1OTAA 3T4SA 5F68A 4KZ8A 5FQJA 3EWKA 4MN5A 2ZM0A 1H5XA 2ZJ9A 2JKTM 3B33A 3F1NB 5HPFA 3T4QA 2JCHA 4I39A 3SOIA 3LGOA 4LGWA 4RQ9A 1OMEA 1EW0A 2P74A 4NXEA 3MQQA 1OJ5A 4BQMA 4LV3A 4FSFA 3NCKA 4UA9A 2Y2QA 3IBJA 2Y91A 3TJZC 4E6XA 4KZAA 4MN7A 1K55C 1MKIA 2Y2JA 1E4DA 3G35A 1SCWA 5M18A 2GDNA 1YLPA 1GA9A 5F1GA 3UPPA 1IOUA 1YSPA 3LEZA 4C3QA 1SHVA 3G30A 4HY8A 1MKMA 3NOPC 4XXRA 4WMCA 1SDNA 4O0PA 1N9BA 1YSQA 3UPNA 4C75A 3ZG0A 3VE4A 3EQVA 2PU2A 2QHKA 4R23A 1XX2A 3SH9A 4R1GA 1TS0A 1N9LA 3C7VA 3A3FA 2B02A 5EECA 1CQAA 1DP6A 4II7A 4IBXA 1DJBA 4KQDA 4P6BA 2X71A 5EVIC 4DE0A 3KSIA 5E2EA 1VEUA 4UQIS 4GCZA 4I3IA 4GJ4A 5DTTA 2H28A 1BSGA 4Y2FA 5HL6A 1UWPX 2CC1A 3GV9A 2ZL1A 4JXWA 5HFOA 4MBHA 4JKTA 3MKFA 5F1FA 4WUJA 4OPRA 5EM1A 1Z6FA 2XQZA 1BLPA 5AQBA 4S2PA 2HDSA 2DRWA 3I7JA 4UAAA 4GD8A 3A3JA 1O7EA 1W8QA 1XPBA 1S4RA 1K57C 2XRNA 2WZXA 3BFCA 4IUKA 1BUEA 3VFFA 1SKFA 4BLMA 4DXCA 2VJWA 2XSSA 3FPVA 1LL9A 2Y8HA 4EEUA 1L0FA 3CG5A 3FV7A 1H8ZA 3CLOA 4DDYA 5FQMA 3LIBA 2W0NA 3LIDA 2XLNA 1NXYA 1K56D 3T4JA 5HAIA 3NC8A 4GS9B 3CHWP 3GQZA 1PI4A 2WK0A 1XA1A 4RX3A 3KSHA 3Q07A 5CGXA 2XD5A 5CEBA 2ZL1B 1P97A 3W2ZA 4E3LA 4QD4A 4M4XA 3KO6A 4D60A 4RYEA 4QPRA 2XA7S 3LR4A 4Y15A 2QMIA 1ES5A 4LPZA 2GX5A 1LSWA 1GSVA 3UE0A 4WZ5A 2EA9A 1SKOA 4E3IA 1JNUA 2XFSA 4GLQA 3IX4A 1A0KA 2HP6A 1YPRA 3W4QA 4CLCE 1TDGA 1XA7A 3HLDA 3FYZA 5D3OA 5CX7A 4QWOA 1WE4A 2E8JA 3UN7A 2I9VA 4HNBA 3UY6A 1YT4A
chains in the Genus database with same CATH topology
4Q0IA 1OTIA 1MC0A 3T4KA 4BMWA 4CLCC 1G28A 3EQUA 3LR3A 2WKQA 1XJ2A 1OJGA 4HH3A 2P04A 4EEPA 3OCNA 3NOTC 2VEAA 4LRXC 2A24A 3BQ8A 4L9GA 4ETZA 2W1TA 5DKLA 4EUVA 2QYBA 2V1AA 3UB7A 3BJNA 3TW8A 5DKKA 4YNRA 4GHIB 5EFWA 3C2WA 3FG8A 4ZRRA 1UWNX 3T50A 3IS2B 2HV1A 4JGRA 4YOFA 4B93A 4F3LA 1F98A 1WA9A 3F1PA 2J3TD 3S7NA 4EU0A 4HI4A 1UGUA 2FH5A 3MJQA 3IBRA 2CMNA 4KUKA 1D7EA 2KDKA 1LSXA 3OC2A 2L1MA 3PBQA 3RTYA 2W3GA 1TS8A 5TBMA 3UB9A 3KYQA 5I5LA 1DP9A 3SW1A 1TF1A 4EETB 3KSGA 4HP4A 3D72A 1TS7A 3GDIA 2D02A 2M7VA 2PD8A 3CUEC 2OWJA 3HJIA 1N9OA 2VGLS 3MQOA 2EWVA 4GS9A 3MXQA 3LIFA 4DMZA 4UEYA 3C38A 1KOUA 2YKHA 1X0OA 2OAQ1 2LB9A 1D06A 1V9ZA 2HF6A 2KLIA 3MR0A 1XFNA 3MMHA 5HD3A 3ZQ5A 3LI9A 2GJ3A 4HQAA 3S7PA 3VOLA 3E0YA 3R7WB 3BY9A 4ETXA 4MDZA 4WL9A 4HH2A 5J7EA 1OPXA 4JGPA 2ZBBA 3BY8A 1OT6A 1P9WA 2A2LA 2W3HA 3R7WA 1OT9A 4H6JB 1S66L 4JGQA 1S1ZA 3CWFA 4BWIA 1P0ZA 4EESA 5G4YA 2L4RA 3UB8A 5C5KA 2D01A 4HP9A 3K3CA 4L9EA 2W3EA 4LRYC 4B9OA 2ZOIA 3O5YA 2HJ9C 2DMWA 3E98A 4BBUA 2OAP1 4HJ4A 1P9RA 4WF0A 1NLZA 5HWTA 3R4KA 2OWHA 4G3KA 5K5BA 2K7SA 3EEAA 3PXPA 3S7OA 2VZWA 2WKRA 2IA2A 4WELA 2K2NA 4H6JA 5HD5A 4GW9A 2PD7A 2Y79A 4LRZE 4ME4A 4HIAA 2VGLM 3LICA 4G3VA 3OBFA 1VB6A 2J80A 3PYPA 3NHQA 5F6AA 2J3WA 3G6OA 3TRCA 2PR6A 1STZA 4YWZA 1DP8A 1S67L 3A0SA 5KIZA 3S7QA 5MC7A 2Z6DA 2O9BA 3KYZA 4K08A 4HHDA 3B42A 4L9FA 2GNXA 4HJ6A 2O99A 2O9CA 4L0LA 4R38A 3KSFA 5HDCA 4P6ZM 3RH8B 2A24B 5AVFA 3BW6A 3BWLA 4O01A 4IUHA 2VA0A 2V0UA 2XA7M 3LYXA 4BBVA 3HJKA 3E4OA 3V67A 4PKYG 4IHQA 5LBRA 1LL8A 1ODVA 2VV8A 3EEHA 4F3LB 5HDSA 4MN6A 5G4ZA 4I3AA 3H9WA 4CLCB 3MFXA 1NWZA 3P01A 3PR6A 3UMEA 1OTAA 5HDDA 3VV4A 3T4SA 2MJ6A 5TJJA 5HSQA 2KX6A 2JKTI 5F68A 3HCYA 4Y5FA 1MZUA 1H3QA 4MMNA 4R6LA 3EWKA 4MN5A 5DJUA 2JKTM 3B33A 2G7UA 3F1NB 4I38A 5HPFA 3TE8A 5F69A 1F9IA 3T4QA 2P7JA 2V0WA 4DN0A 4I39A 1W63M 2KOIA 3BQAA 3LIAA 3OLOA 4I5SA 1OTEA 3T4LA 2PYRA 2QJ7A 4RQ9A 1EW0A 1GSWA 3PBSA 4NXEA 3F1OB 3MQQA 1OJ5A 4FSFA 3UMDA 4Y3IA 1NLYA 5A8BA 4WN5A 2W3DA 3IBJA 3A0VA 3TJZC 1DRMA 4MN7A 5J4EA 2VV7A 4NXGA 1H8MA 4NXBA 3H82B 3JVVA 3T4TA 3NJAA 1XJ6A 3KX0X 4BBTA 2NUTC 2HGVA 4OOMA 2JKRI 5HZHA 2V9AA 1IOUA 3LR0A 1YSPA 4HY8A 1MKMA 2J3TC 3NOPC 2K31A 2PT7A 4O0PA 4KQOA 2GZAA 3C8CA 4DJ3A 1YSQA 2W1TB 3VE4A 3EQVA 4E04A 2QHKA 1LT0A 1NRJA 1T1CA 3LR5A 1TS0A 3PBRA 2XROA 1N9LA 3IS2A 4DJ2A 2B02A 1DP6A 2VX8A 4II7A 4WEJA 1BYWA 4KQDA 3EOIA 2ZMFA 1GSXA 2QJ5A 1LSVA 3E4QA 4P6ZS 3E4PA 5J3WA 4OOLA 3FPWA 5HPIA 4CLCA 5DFXA 2LB5A 4EQ1A 3KSIA 3NOUC 4O8GA 5L8MA 3PBTA 3PHYA 4HOIA 2JKRM 2VKSA 3K3DA 4Q0JA 5AJGA 2HJEA 4R3AA 4UQIS 3H82A 1YAXA 2PYPA 4GCZA 3H7WA 4GJ4A 4I3IA 3ZYTA 4EW7A 4PKYA 2H28A 3CAXA 2ZMVA 1YKDA 4Y2FA 3CITA 5HL6A 3PBOA 1UWPX 4ARZA 3OCLA 3UE3A 5IT5A 1V9YA 4WEKA 2VV6A 4CQHA 2QKPA 2JHEA 4WUJA 4ARZB 5TBMB 2PDRA 1IFQA 1T1BA 1T18A 2JN7A 2L0WA 3A0RA 5F5YA 2FZ0A 2PR5A 2INWA 3F1NA 4AFIA 2PHYA 1T1AA 2YKFA 4NEED 1TD5A 3B47A 4XT2B 1S4RA 2W1RA 2XRNA 4XT2A 4PAUA 4IUKA 5IS1A 3LFVA 4LLOB 5DF9A 3P7NA 2VJWA 1N9NA 5AVEA 1OTBA 2XSSA 3FPVA 3VE3A 2Y8HA 5HWVA 4EEUA 2B18A 1XJ3A 3CLOA 1TS6A 3PBNA 2BASA 4R70A 3C30A 3LIBA 4EXOA 2W0NA 3LIDA 1VHMA 4UQIM 1S4SA 4WLAA 1Y28A 2M1CA 3T4JA 5DFYA 2M7UA 4GS9B 4Z1WA 2EWWA 2R78A 3KSHA 2O0YA 1OTDA 4FOFA 4JGOA 1P97A 1W63Q 3W2ZA 3JVUA 1ZTUA 4KUOA 4M4XA 3FC7A 3UB6A 3KO6A 2W3FA 4IJGA 2V1BA 3RFBA 2O9AA 4QPRA 2XA7S 1S1YA 3LR4A 3LI8A 5IU1A 2QWSA 5KSHA 4LPZA 2GX5A 1LSWA 4Q0HA 1GSVA 1G6OA 3EGXC 2NUPC 2Z6CA 4EERA 3U2AA 3ICYA 2EA9A 2OOLA 3UE6A 4I3JA 4G3WA 3F1PB 2W27A 1JNUA 5FL3A 3LUQA 3GECA 4GLQA 5DJTA 2P08A 4PHTA 2WKPA 3EGDC 4BJPA 1T19A 4NXFA 1F5MA 3MF0A 3ULFA 4GHIA 4CLCE 3D3OA 3H7WB 4NKPA 5HWWA 1ZHHB 3DBAA 3LIEA 3CI6A 3CUEA 3F1OA 3MQ0A 2VLGA 4MCWA 3K2NA 2ZOHA 4HJ3A 5CX7A 3T4OA 4CLCD 3OOVA 2I9VA 1XFQA 4HNBA 1XJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OTI A;  2VV6 A;  4BBU A;  1G28 A;  1EW0 A;  1GSW A;  2QKP A;  4NXE A;  2JHE A;  3F1O B;  3MQQ A;  1OJ5 A;  2WKQ A;  4HJ4 A;  4WUJ A;  4WF0 A;  1XJ2 A;  3UMD A;  5HWT A;  1OJG A;  2OWH A;  5TBM B;  2PDR A;  5A8B A;  1T1B A;  4WN5 A;  2K7S A;  4HH3 A;  4EEP A;  3NOT C;  1T18 A;  2JN7 A;  2L0W A;  2VEA A;  2WKR A;  3A0V A;  3A0R A;  1DRM A;  2A24 A;  4LRX C;  2PR5 A;  2INW A;  4H6J A;  3F1N A;  4L9G A;  4GW9 A;  2PD7 A;  5HD5 A;  4LRZ E;  4HIA A;  5DKL A;  3LIC A;  2V1A A;  3UB7 A;  5J4E A;  2VV7 A;  2PHY A;  5DKK A;  1T1A A;  1VB6 A;  2J80 A;  2YKF A;  3PYP A;  4GHI B;  3NHQ A;  4NXG A;  5EFW A;  3C2W A;  5F6A A;  4NXB A;  3FG8 A;  3G6O A;  3H82 B;  1UWN X;  3T50 A;  3IS2 B;  4XT2 B;  4B9O A;  2PYR A;  2HV1 A;  2PR6 A;  1S4R A;  4YWZ A;  3NJA A;  4JGR A;  4XT2 A;  1XJ6 A;  4F3L A;  3KX0 X;  1DP8 A;  4BBT A;  1F98 A;  1S67 L;  1WA9 A;  3F1P A;  3A0S A;  5HZH A;  4LRY C;  5KIZ A;  2V9A A;  5IS1 A;  4LLO B;  2Z6D A;  4HI4 A;  1UGU A;  3MJQ A;  3IBR A;  3P7N A;  4K08 A;  1N9N A;  4HHD A;  2CMN A;  5AVE A;  4KUK A;  1D7E A;  1OTB A;  1LSX A;  2KDK A;  4HY8 A;  4L9F A;  3VE3 A;  5HWV A;  4EEU A;  2L1M A;  3NOP C;  3RTY A;  4HJ6 A;  1XJ3 A;  3CLO A;  1TS8 A;  5TBM A;  4R38 A;  1TS6 A;  4R70 A;  2BAS A;  3UB9 A;  3C8C A;  5I5L A;  1DP9 A;  4DJ3 A;  3SW1 A;  3VE4 A;  4EET B;  3LIB A;  5HDC A;  3RH8 B;  2W0N A;  2A24 B;  5AVF A;  2QHK A;  3LID A;  4E04 A;  4EXO A;  1S4S A;  4HP4 A;  3BWL A;  3D72 A;  1LT0 A;  4WLA A;  1TS7 A;  3GDI A;  1Y28 A;  2D02 A;  2M1C A;  2PD8 A;  2OWJ A;  1T1C A;  4GS9 B;  3HJI A;  1N9O A;  1TS0 A;  2V0U A;  3MQO A;  4BBV A;  1N9L A;  2R78 A;  3LYX A;  3HJK A;  4GS9 A;  3MXQ A;  3IS2 A;  3LIF A;  4DJ2 A;  2B02 A;  1OTD A;  3E4O A;  1KOU A;  1DP6 A;  2YKH A;  4PKY G;  4JGO A;  1LL8 A;  1P97 A;  1X0O A;  1ODV A;  2VV8 A;  3EEH A;  4F3L B;  5HDS A;  1BYW A;  4KQD A;  4MN6 A;  4KUO A;  1D06 A;  5G4Z A;  4I3A A;  3H9W A;  1GSX A;  1V9Z A;  2QJ5 A;  3FC7 A;  4M4X A;  1LSV A;  3E4Q A;  3UB6 A;  2V1B A;  3MR0 A;  3E4P A;  3MFX A;  5IU1 A;  5J3W A;  1S1Y A;  1NWZ A;  1XFN A;  3LI8 A;  5HD3 A;  3ZQ5 A;  3LI9 A;  2QWS A;  2GJ3 A;  4HQA A;  3UME A;  4LPZ A;  3VOL A;  1LSW A;  1GSV A;  4EER A;  1OTA A;  2Z6C A;  3BY9 A;  5HDD A;  3ICY A;  4EQ1 A;  5HSQ A;  2EA9 A;  2OOL A;  3NOU C;  3UE6 A;  4I3J A;  2KX6 A;  4WL9 A;  5F68 A;  3F1P B;  4HH2 A;  1MZU A;  3PHY A;  2W27 A;  1JNU A;  4HOI A;  2ZBB A;  4JGP A;  3BY8 A;  3LUQ A;  3GEC A;  4R6L A;  5DJT A;  1OT6 A;  3EWK A;  4MN5 A;  5DJU A;  2WKP A;  3K3D A;  3B33 A;  1OT9 A;  3F1N B;  4H6J B;  1S66 L;  3H82 A;  2PYP A;  1T19 A;  4GCZ A;  4I38 A;  4JGQ A;  4NXF A;  5F5Y A;  1F9I A;  3H7W A;  4I3I A;  5F69 A;  3ULF A;  4PKY A;  2P7J A;  4EW7 A;  4GHI A;  2H28 A;  3CAX A;  4RQ9 A;  1S1Z A;  3CWF A;  2V0W A;  1P0Z A;  4I39 A;  4EES A;  3H7W B;  5G4Y A;  1UWP X;  2L4R A;  5HWW A;  3LIE A;  3UB8 A;  3F1O A;  5J7E A;  2VLG A;  3LIA A;  3OLO A;  2ZOH A;  4HJ3 A;  2D01 A;  4HP9 A;  3K3C A;  4R3A A;  4L9E A;  4I5S A;  1V9Y A;  1OTE A;  2I9V A;  1XFQ A;  4HNB A;  1XJ4 A;  2QJ7 A;  2ZOI A; 
#chains in the Genus database with same CATH topology
 5L10 A;  4BMW A;  1MC0 A;  4F94 A;  1G28 A;  1ACF A;  1OJG A;  3QP8 A;  1YLT A;  2UV0 E;  2IWB A;  4HH3 A;  3OCN A;  3NOT C;  2VEA A;  4LRX C;  4ETZ A;  2QYB A;  3BJN A;  5DKK A;  4YNR A;  3HLG A;  2ZC6 B;  5TFQ A;  1TEM A;  3FG8 A;  4N9K A;  4ZRR A;  3IS2 B;  5DF7 A;  4JF4 A;  4YOF A;  3S7N A;  4HI4 A;  4LV2 A;  4KUK A;  3RTY A;  1TS8 A;  3VOZ A;  3KYQ A;  2OSU A;  1BLS A;  1W79 A;  4S2M A;  3GDI A;  2WGI A;  3V3S A;  3W4O A;  2H0Y A;  3S22 A;  3HJI A;  2EWV A;  3IWO A;  4GS9 A;  1W7F A;  1KOU A;  3PTE A;  4KQQ A;  1F2K A;  2LB9 A;  4GD6 A;  3IF6 B;  1XFN A;  2VGJ A;  3MMH A;  5HD3 A;  4K0X A;  3LI9 A;  2GJ3 A;  3U4L P;  2V8F A;  5M1A A;  3R7W B;  3PAE A;  1ERM A;  3MFD A;  3BY8 A;  4FTX A;  4H6J B;  1S66 L;  4R0Q A;  3BFD A;  2D01 A;  4FH4 A;  3K3C A;  2H0T A;  4HP9 A;  4L9E A;  4PM8 A;  4ZAM A;  4DE1 A;  2W3E A;  2ZOI A;  2PU4 A;  1FR6 A;  5EV0 A;  4PM5 A;  5CEC A;  4KG6 A;  4HJ4 A;  3LO7 A;  3R4K A;  2OWH A;  4G3K A;  3PXP A;  2WAE A;  3ZFZ A;  2IA2 A;  2K2N A;  4H6J A;  3IX8 A;  3GTC A;  1VB6 A;  1NRF A;  3ZVW A;  1GHM A;  4YWZ A;  4WYY A;  1PWC A;  3A0S A;  4ZJ1 A;  4IVI A;  1CI9 A;  2JC7 A;  3VP1 A;  3KYZ A;  3M6H A;  2FFF B;  4HHD A;  1YLJ A;  2AVX A;  4L9F A;  2R9W A;  5EM0 A;  3IT9 A;  2B95 A;  5HDC A;  1FCM A;  4O01 A;  3GMW A;  1MY8 A;  2Y2O A;  2V0U A;  3ZGA B;  3VP2 A;  4N1X A;  1KGE A;  1GHP A;  2VV8 A;  4GDN A;  5G4Z A;  1ALQ A;  3A3D A;  5FAQ A;  1K57 A;  2DCF A;  4E3N A;  5FEG A;  2MJ6 A;  5HSQ A;  1E3U A;  1H3Q A;  4R6L A;  2IWD A;  5DJU A;  2EX2 A;  4I38 A;  3TE8 A;  4ZJ3 A;  1F9I A;  2P7J A;  4OKP A;  1IYQ A;  1QMF A;  5FA7 A;  4DN0 A;  4OPZ A;  3C4P A;  2JKF A;  4KQR A;  3S4X A;  3LIA A;  1K38 A;  1FR1 A;  4LFU A;  2QJ7 A;  3WRZ A;  2WAF A;  3PBS A;  3CPT A;  5KZH A;  4JXS A;  2BTF P;  4WN5 A;  3SH8 A;  1DRM A;  3P98 A;  3OPP A;  5J4E A;  1H8M A;  2Q0O A;  3LEQ A;  3H82 B;  3MXR A;  3T4T A;  1MBL A;  2WKH A;  3KX0 X;  4JPM A;  4BBT A;  1WYB A;  1IEM A;  1G68 A;  5GHX A;  3E2L A;  3LR0 A;  4YIN A;  3C5A A;  2QPN A;  3VSL A;  1HZO A;  5FI2 A;  1RP5 A;  1HVB A;  4KQO A;  4DJ3 A;  4S2O A;  5HAR A;  1ERO A;  4LV1 A;  4UA6 A;  1IKI A;  3MZD A;  2VX8 A;  3RXW A;  3L7H A;  3HVF A;  5L2F A;  3BYD A;  4P6Z S;  5J3W A;  1G6A A;  4R3B A;  3FPW A;  4CLC A;  2LB5 A;  4EQ1 A;  4LCM A;  1MWR A;  4O8G A;  3UPO A;  5L8M A;  4YFM A;  3PBT A;  3HLC A;  3PHY A;  2ZLY A;  4HOI A;  1BZA A;  2EFX A;  2JKR M;  3IH8 A;  2VKS A;  4Q0J A;  5AJG A;  2HJE A;  3H82 A;  2V8C A;  3H7W A;  3ZYT A;  2RCX A;  4EW7 A;  5KSC A;  4PKY A;  1NYM A;  2RL3 A;  2Y2M A;  3OCL A;  2BLS A;  1ZC2 A;  1KGF A;  3RJU A;  3HBR A;  1PZO A;  2JHE A;  3T1X A;  4ARZ B;  2EX9 A;  1IEL A;  3BM6 A;  5EUA A;  2JN7 A;  2FZ0 A;  2PR5 A;  4AFI A;  4HEF A;  4ID4 A;  2PHY A;  2YKF A;  3E2K A;  4DDS A;  3S1Y A;  5KMW A;  3NDG A;  4N9L A;  4XT2 A;  4EBL A;  1FIL A;  4BD1 A;  3LFV A;  4IED A;  3P7N A;  1JTD A;  4QJG A;  1XJ3 A;  2EXB A;  1TS6 A;  3C30 A;  3P09 A;  4OPQ A;  1HD8 A;  4EXO A;  4X69 A;  2C6W B;  1S4S A;  4FH2 A;  4WLA A;  1FSW A;  1JWP A;  5AQ9 A;  1L2S A;  1D1J A;  4PM6 A;  3CJM A;  3HLB A;  1OTD A;  3NY4 A;  3ZCZ A;  1TVF A;  1ERQ A;  2WKI A;  4QU3 A;  2FFY A;  3FC7 A;  3UB6 A;  4BEN A;  2ZQ7 A;  2R9X A;  4IJG A;  5A92 A;  5IU1 A;  3LI8 A;  2QWS A;  3MS6 A;  3NBL A;  3EGX C;  2OOL A;  3F1P B;  2EFU A;  3IXG A;  3GEC A;  5DJT A;  4GDB A;  3EGD C;  1F5M A;  3MF0 A;  3N6I A;  2ZM2 A;  4GHI A;  3WS5 A;  3ITB A;  1GHI A;  3H7W B;  3LIE A;  3DBA A;  3CI6 A;  3F1O A;  5J7E A;  3T4O A;  1VET B;  2ZOH A;  4OOY A;  3OOV A;  4N92 A;  3IWI A;  1OTI A;  3T4K A;  4QY5 A;  4XUX A;  4P87 A;  5CXW A;  4RA7 A;  2OLV A;  4MNR A;  5HX9 A;  3BQ8 A;  4L9G A;  4GZB A;  5DKL A;  4RX2 A;  5EFW A;  1UWN X;  3T50 A;  4B93 A;  4KZ3 A;  3NEC A;  4UA7 A;  1WA9 A;  4X1L A;  2J3T D;  5L07 A;  2FH5 A;  3MJQ A;  3TG9 A;  2CMN A;  1D7E A;  2L1M A;  1EWZ A;  1SZV A;  1E25 A;  3SW1 A;  1TF1 A;  2HZ5 A;  1C3B A;  1TS7 A;  1FOF A;  2D02 A;  2M7V A;  1WYC A;  3OZH A;  3MXQ A;  3LIF A;  5FAO A;  3C38 A;  5TGF A;  4U3T A;  2OAQ 1;  4NG2 A;  3TSG A;  3MR0 A;  1KDW A;  4FCF A;  3BY9 A;  4ETX A;  4X55 A;  3CPT B;  1K6R A;  4WL9 A;  5HAP A;  1ZKJ A;  3O87 A;  1OPX A;  1K6S A;  1KVL A;  2A2L A;  1MXO A;  2J7V A;  3BEC A;  4M3K A;  1L0D A;  1E3U D;  3CWF A;  1YLW A;  5G4Y A;  4JBF A;  2A3U A;  4B4X A;  5FDH A;  4U0X A;  1XGJ A;  4R4S A;  3JPU A;  2HJ9 C;  4BBU A;  3MBZ A;  4S2J A;  3HRE A;  4X56 A;  5GHZ A;  5K5B A;  3S7O A;  4WEL A;  5HD5 A;  4GW9 A;  2PD7 A;  2Y79 A;  4ME4 A;  3OPR A;  3IHB A;  4G3V A;  3A3I A;  1YLY A;  1FCN A;  2DNS A;  4ZDX A;  2ZM8 A;  4XUZ A;  1NZU A;  2J3W A;  3G6O A;  3TRC A;  4FUW A;  1I2W A;  4S2L A;  5U47 A;  3O86 A;  2H5S A;  1XXM A;  2Q9M A;  2V1Z A;  1YMX A;  4JXV A;  4KG5 A;  1IKG A;  1DP8 A;  1RCJ A;  3S7Q A;  4K08 A;  3HLF A;  3B42 A;  2ZQA A;  1PW8 A;  4PM9 A;  1XP4 A;  2O99 A;  4IBR A;  2O9C A;  1J3W A;  5GLC A;  4P6Z M;  3BW6 A;  3UNW A;  4D2O A;  4Y0T A;  3BEB A;  1K54 A;  3DTE A;  4R4R A;  3HJK A;  2OV5 A;  3UO9 A;  4PKY G;  4IHQ A;  1PRQ A;  4E3J A;  4PMA A;  3MKE A;  1MWS A;  1ODV A;  4F3L B;  3LCE A;  2V2F F;  3P01 A;  4KZ5 A;  3JYI A;  3FKW A;  2P9V B;  3Q7V B;  5HDD A;  3VV4 A;  1GCE A;  1DJA A;  5TJJ A;  3WS1 A;  5JYO A;  3HCY A;  4Y5F A;  2Y4A A;  1MZU A;  1SDE A;  3DTM A;  4Y0U A;  4MBK A;  2G7U A;  5F69 A;  1N4O A;  1W63 M;  3ZDJ A;  4I5S A;  4X68 A;  4DKI A;  3F1O B;  3UMD A;  2Y2H A;  1NLY A;  2XFT A;  2ZQD A;  2W3D A;  3HUM A;  1IYO A;  3BRM A;  3RXX A;  3AGE A;  4NXB A;  3QP4 A;  4X25 A;  3JVV A;  2X02 A;  1XJ6 A;  4B4Z A;  2NUT C;  2ZQ8 A;  2HGV A;  1KGG A;  3IWQ A;  1ESI A;  2JKR I;  1Q2Q A;  3B3X A;  4OOM A;  3IXD A;  3IF5 A;  5FI7 A;  3WS0 A;  2Y2N A;  2PT7 A;  5CHM A;  4KZB A;  2W1T B;  2XDM A;  4E04 A;  3VSK A;  2H10 A;  1T1C A;  3ZG8 B;  3LY4 A;  2XRO A;  2Z2L B;  1CK3 A;  3IS2 A;  5EVI B;  1ONG A;  5HAQ A;  3SH7 A;  2ZMF A;  1PWG A;  1GSX A;  1LLB A;  4Z9Q A;  2PBD P;  1LSV A;  4IVK A;  1SKO B;  4OOL A;  4X1M A;  1M6K A;  1MPL A;  5DFX A;  1AXB A;  4EBP A;  4ESP A;  1BLH A;  5A91 A;  4FD8 A;  1LHY A;  1U60 A;  3W4P A;  1NY0 A;  3K3D A;  4R3A A;  1YAX A;  2PYP A;  4EWF A;  1YKD A;  4OPY A;  3CIT A;  3PBO A;  5E2G A;  3QP2 A;  3SS4 A;  3QNC A;  4ARZ A;  1V9Y A;  4WEK A;  3HLE A;  2XF3 A;  3DW0 A;  1O07 A;  5FAS A;  2VV6 A;  2WZZ A;  2QKP A;  1CF0 A;  3DWK A;  2JKG A;  2I72 A;  5TBM B;  1T1B A;  3O88 A;  1T18 A;  1BT5 A;  3A0R A;  1DY6 A;  2INW A;  3F1N A;  5CED A;  1XKZ A;  1T1A A;  4KZ4 A;  2EX8 A;  1TD5 A;  1L0E A;  3B47 A;  2W1R A;  2ZC7 A;  4E3K A;  5EOE A;  1DJC A;  5F82 A;  3G32 A;  4LLO B;  1ONH A;  5DF9 A;  1OTB A;  2G2W A;  3VE3 A;  5HWV A;  1CI8 A;  3IF6 A;  3WRT A;  2BAS A;  1VET A;  3V3R A;  5AQA A;  1VHM A;  4UQI M;  2M1C A;  3G31 A;  4HES A;  4MBF A;  2M7U A;  2C5W B;  2WGW A;  2EWW A;  4FOF A;  5GL9 A;  3GSG A;  3JVU A;  4EV4 A;  1ZTU A;  4KUO A;  1K54 C;  2Y2K A;  5CTM A;  2W3F A;  2V1B A;  3M2K A;  4S2N A;  1S1Y A;  2WUQ A;  4DF6 A;  5KSH A;  1VEU B;  1G6O A;  2NUP C;  2Z6C A;  4EER A;  1IYS A;  3UE6 A;  4JLF A;  3ISG A;  5GLD A;  2W27 A;  5FL3 A;  3LUQ A;  2P08 A;  3V50 A;  3T1S A;  5FAP A;  3ULF A;  2ZC4 B;  4NKP A;  1ZHH B;  3CUE A;  4MCW A;  4HJ3 A;  3UE1 A;  4S2I A;  1J9M A;  5L09 A;  1RGZ A;  4KZ9 A;  1XJ4 A;  4Q0I A;  1K25 A;  4CLC C;  3LR3 A;  1KVM A;  1XJ2 A;  4GNU A;  1GA0 A;  3BLS A;  1FSY A;  1NJ4 A;  2A24 A;  3D9Y A;  2HP9 A;  3C7U A;  1TDL A;  2W1T A;  5HL1 A;  4EUV A;  3PAG A;  1BUL A;  3C2W A;  4U0T A;  3NDE A;  1AWI A;  1H0M A;  3WWX A;  4JGR A;  1FCO A;  4DE3 A;  2PBY A;  4OLD A;  2X01 A;  5GLB A;  1UGU A;  1LSX A;  4OP5 A;  5JYP A;  3VOY A;  3ZG5 A;  1VQQ A;  3UB9 A;  5I5L A;  4WZ5 C;  4EET B;  3CMZ A;  4HP4 A;  3G2Y A;  2PD8 A;  4NET A;  4P85 A;  1CEG A;  3Q7Z A;  4HBU A;  4JF5 A;  3MQO A;  2Z2M B;  4UEY A;  2YKH A;  1X0O A;  3N8L A;  1D06 A;  4O7D A;  1KE3 A;  2HF6 A;  2KLI A;  2WYX A;  5CTN A;  3ZQ5 A;  4MLL A;  2B5R A;  3S7P A;  3VOL A;  5DF8 A;  3E0Y A;  4ZTK A;  2Y2P A;  2BG1 A;  4MDZ A;  3TOI A;  4HH2 A;  3DTK A;  5EVL A;  4JGP A;  2ZBB A;  4H8R A;  3M2J A;  2XR0 A;  3R7W A;  3QP6 A;  1HLU P;  3SS3 A;  1S1Z A;  4BWI A;  1I2S A;  3FWL A;  5C5K A;  1W8Y A;  1L3L A;  3ZG9 B;  4B9O A;  3O5Y A;  4PPR A;  2DMW A;  1P9R A;  1Z09 A;  3GR2 A;  3OPL A;  3ZNY A;  2HDQ A;  2K7S A;  3N4I A;  3IH9 A;  5GLA A;  4C6Y A;  2WKR A;  4BD0 A;  4LRZ E;  5FSR A;  2VGL M;  5CHU A;  3OBF A;  2J80 A;  5DTS A;  3NHQ A;  5F6A A;  5I94 A;  4P0M A;  1STZ A;  4S2N C;  3WS4 A;  3T1R A;  2Y2I A;  1LI0 A;  5KIZ A;  5MC7 A;  4KEN B;  2O9B A;  3Q1F A;  5HW3 A;  2J9P A;  1BTL A;  2A49 A;  4K0W A;  5FQK A;  1EI5 A;  4HJ6 A;  4R38 A;  3RH8 B;  2A24 B;  3BWL A;  4E3M A;  5EVI A;  4N1H A;  4IUH A;  3DAV A;  4GOG A;  2ZQ9 A;  4S2K A;  3HLW A;  3V5M A;  4CPK A;  3E4O A;  3V67 A;  5LBR A;  5EE8 A;  3T1Q B;  3EEH A;  2Y59 A;  4MN6 A;  3H9W A;  4OLG A;  1PFL A;  4OVD A;  3NIA A;  3G34 A;  4QY6 A;  4ZJ2 A;  2KX6 A;  2JKT I;  1JWZ A;  3FZC A;  1FQG A;  1NYY A;  2XGN A;  4MMN A;  5FDS A;  2V0W A;  2KOI A;  1PIO A;  3BQA A;  5E2F A;  3OLO A;  1OTE A;  1K56 A;  3T4L A;  2PYR A;  1ES4 A;  1GSW A;  4B88 A;  4Y3I A;  4OQ0 A;  2ZC5 B;  5A8B A;  1PI5 A;  3A0V A;  5FEF A;  4OQH A;  4Q8I A;  2J9O A;  5G18 A;  2VV7 A;  1LI9 A;  4NXG A;  2HP5 A;  3OPH A;  2JE5 A;  1Y4O A;  3NJA A;  2WAD A;  3V39 A;  5HZH A;  2V9A A;  2ZD8 A;  3NUL A;  3IXH A;  3G4P A;  2J3T C;  1YQS A;  2K31 A;  3ITA A;  5DVA A;  4LEN A;  2GZA A;  3C8C A;  2OLU A;  1MWU A;  2WGW B;  5TR7 A;  1LT0 A;  3AGD A;  1NRJ A;  3LR5 A;  4Y7P A;  3PBR A;  3VP4 A;  2QZ6 A;  4DJ2 A;  1FIK A;  3IXB A;  4UHU A;  1KE0 A;  1BLC A;  3DWZ A;  1BYW A;  4WEJ A;  3EOI A;  1YLZ A;  3HUN A;  2Y2G A;  2QJ5 A;  5J8X A;  3E4Q A;  2P9V A;  3Q7V A;  3E4P A;  4OP8 A;  5HPI A;  1PYY A;  2VK3 A;  5DTK A;  3NOU C;  4EUZ A;  3IHA A;  3UDX A;  3VMA A;  5FQQ A;  3BFG A;  3HUO A;  1MWT A;  1KDS A;  3CAX A;  2ZMV A;  3KYE A;  3UE3 A;  5IT5 A;  4DRT A;  5IHV A;  1ZG4 A;  3QHY A;  4QB8 A;  4CQH A;  5FQ9 A;  1QME A;  4RVA A;  3Q81 A;  2PDR A;  1IFQ A;  4JXG A;  4LV0 A;  4E3O A;  4CJN A;  1PNE A;  3QP1 A;  5F5Y A;  2L0W A;  1LL5 A;  4NEE D;  5FQI A;  4XT2 B;  2HDR A;  4PAU A;  3FKV A;  4X6T A;  5IS1 A;  2XD1 A;  1N9N A;  5AVE A;  1ES2 A;  4KZ7 A;  4QHC A;  2ZMA A;  2B18 A;  3PBN A;  4R70 A;  3D4F A;  3ZVT A;  2ZC3 B;  4HBT A;  3T12 B;  1ZG6 A;  4GKU A;  3QP5 A;  1Y28 A;  4DE2 A;  5DFY A;  1NZO A;  3UDI A;  4Z1W A;  4OH0 A;  2R78 A;  3GRJ A;  2O0Y A;  2JBF A;  4BL3 A;  1PWD A;  4JGO A;  3BFF A;  1W63 Q;  3C4O A;  4WBG A;  3RFB A;  2O9A A;  5GHY A;  5F83 A;  3BLM A;  3MSH A;  4Q0H A;  5CHJ A;  5A90 A;  3U2A A;  3ICY A;  4I3J A;  4BL2 A;  3ZG7 B;  3G2Z A;  4G3W A;  2Q9N A;  2IWC A;  4EQI A;  4PHT A;  5M19 A;  2WKP A;  1JTG A;  1H8Y A;  4BJP A;  1T19 A;  4NXF A;  3D3O A;  3IX3 A;  5HWW A;  4WZ4 A;  2HPB A;  1ES3 A;  3N8S A;  3MQ0 A;  2VLG A;  4CLC D;  3K2N A;  3AGF A;  3IF6 C;  3IQA A;  1XFQ A;  5FI6 A;  1K4F A;  3EQU A;  2WKQ A;  2ZQC A;  3A3E A;  2P04 A;  4EEP A;  2Y2L A;  1M40 A;  3Q82 A;  3CZD A;  3VP3 A;  1IYP A;  4ZBE A;  5BOH A;  2V1A A;  3UB7 A;  3DTI A;  3TW8 A;  4GHI B;  2XK1 A;  2HV1 A;  2XH9 A;  1PW1 A;  3LY3 A;  3WS2 A;  4F3L A;  1S6R A;  4Y17 A;  1VM1 A;  1F98 A;  2Y55 A;  1JWV A;  3F1P A;  1G5U A;  1K4E A;  4EU0 A;  2ACG A;  2PAV P;  3IBR A;  1L0G A;  2KDK A;  3OC2 A;  3ZHH A;  3ZNT A;  3PBQ A;  2W3G A;  4Y0O A;  5TBM A;  3N7W A;  1DP9 A;  4A5R A;  3KSG A;  1K55 A;  2WKE A;  3D72 A;  3CUE C;  2OWJ A;  1N9O A;  2VGL S;  4DMZ A;  3QNB A;  2PRF A;  5CGS A;  3MZF A;  5FAT A;  3HL9 A;  1V9Z A;  4OQI A;  4KG2 A;  2E8I A;  4HQA A;  4DXB A;  4WM9 A;  1ESU A;  4EBN A;  2G2U A;  1KE4 A;  1OT6 A;  1P9W A;  4LCL A;  2W3H A;  1OT9 A;  4JGQ A;  1K0K A;  3MXS A;  1P0Z A;  4EES A;  2L4R A;  3UB8 A;  1CEF A;  3UB5 P;  5E2H A;  2J8Y A;  1XGI A;  3W8K A;  4LRY C;  2HDU A;  4R3J A;  2V20 A;  3E98 A;  2OAP 1;  5CRF A;  4WF0 A;  1NLZ A;  1Q2P A;  5HWT A;  5EOO A;  3EEA A;  4K91 A;  3VFH A;  5EPH A;  2VZW A;  4KZ6 A;  4HIA A;  3VP0 A;  3LIC A;  1CJF A;  3PYP A;  1W5D A;  5CER A;  5EVI D;  4E6W A;  2PR6 A;  5A93 A;  1S67 L;  3N8R A;  2WGV A;  2VGK A;  4NK3 A;  2Z6D A;  1RGY A;  4GB7 A;  1S0W A;  5E43 A;  1HTZ A;  3BFE A;  2GNX A;  3SZT A;  5CGW A;  3UDF A;  2XEP A;  4L0L A;  3KSF A;  2UWX A;  1Y54 A;  4PM7 A;  1PZP A;  3GVB A;  5AVF A;  3NI9 A;  1YMS A;  4OQG A;  4WMC D;  4MEZ A;  5EVE A;  4X53 A;  4Y13 A;  3O3V A;  2VA0 A;  5AQ7 A;  2XA7 M;  1I5Q A;  3LYX A;  4BBV A;  2EXA A;  3MZE A;  4OON A;  2EX6 A;  4GN2 A;  1JVJ A;  4JF6 A;  1LL8 A;  5HDS A;  3M6B A;  4I3A A;  3SS5 A;  4CLC B;  1YM1 A;  3MFX A;  3L9K A;  1NWZ A;  3PR6 A;  3UME A;  1OTA A;  3T4S A;  5F68 A;  4KZ8 A;  5FQJ A;  3EWK A;  4MN5 A;  2ZM0 A;  1H5X A;  2ZJ9 A;  2JKT M;  3B33 A;  3F1N B;  5HPF A;  3T4Q A;  2JCH A;  4I39 A;  3SOI A;  3LGO A;  4LGW A;  4RQ9 A;  1OME A;  1EW0 A;  2P74 A;  4NXE A;  3MQQ A;  1OJ5 A;  4BQM A;  4LV3 A;  4FSF A;  3NCK A;  4UA9 A;  2Y2Q A;  3IBJ A;  2Y91 A;  3TJZ C;  4E6X A;  4KZA A;  4MN7 A;  1K55 C;  1MKI A;  2Y2J A;  1E4D A;  3G35 A;  1SCW A;  5M18 A;  2GDN A;  1YLP A;  1GA9 A;  5F1G A;  3UPP A;  1IOU A;  1YSP A;  3LEZ A;  4C3Q A;  1SHV A;  3G30 A;  4HY8 A;  1MKM A;  3NOP C;  4XXR A;  4WMC A;  1SDN A;  4O0P A;  1N9B A;  1YSQ A;  3UPN A;  4C75 A;  3ZG0 A;  3VE4 A;  3EQV A;  2PU2 A;  2QHK A;  4R23 A;  1XX2 A;  3SH9 A;  4R1G A;  1TS0 A;  1N9L A;  3C7V A;  3A3F A;  2B02 A;  5EEC A;  1CQA A;  1DP6 A;  4II7 A;  4IBX A;  1DJB A;  4KQD A;  4P6B A;  2X71 A;  5EVI C;  4DE0 A;  3KSI A;  5E2E A;  1VEU A;  4UQI S;  4GCZ A;  4I3I A;  4GJ4 A;  5DTT A;  2H28 A;  1BSG A;  4Y2F A;  5HL6 A;  1UWP X;  2CC1 A;  3GV9 A;  2ZL1 A;  4JXW A;  5HFO A;  4MBH A;  4JKT A;  3MKF A;  5F1F A;  4WUJ A;  4OPR A;  5EM1 A;  1Z6F A;  2XQZ A;  1BLP A;  5AQB A;  4S2P A;  2HDS A;  2DRW A;  3I7J A;  4UAA A;  4GD8 A;  3A3J A;  1O7E A;  1W8Q A;  1XPB A;  1S4R A;  1K57 C;  2XRN A;  2WZX A;  3BFC A;  4IUK A;  1BUE A;  3VFF A;  1SKF A;  4BLM A;  4DXC A;  2VJW A;  2XSS A;  3FPV A;  1LL9 A;  2Y8H A;  4EEU A;  1L0F A;  3CG5 A;  3FV7 A;  1H8Z A;  3CLO A;  4DDY A;  5FQM A;  3LIB A;  2W0N A;  3LID A;  2XLN A;  1NXY A;  1K56 D;  3T4J A;  5HAI A;  3NC8 A;  4GS9 B;  3CHW P;  3GQZ A;  1PI4 A;  2WK0 A;  1XA1 A;  4RX3 A;  3KSH A;  3Q07 A;  5CGX A;  2XD5 A;  5CEB A;  2ZL1 B;  1P97 A;  3W2Z A;  4E3L A;  4QD4 A;  4M4X A;  3KO6 A;  4D60 A;  4RYE A;  4QPR A;  2XA7 S;  3LR4 A;  4Y15 A;  2QMI A;  1ES5 A;  4LPZ A;  2GX5 A;  1LSW A;  1GSV A;  3UE0 A;  4WZ5 A;  2EA9 A;  1SKO A;  4E3I A;  1JNU A;  2XFS A;  4GLQ A;  3IX4 A;  1A0K A;  2HP6 A;  1YPR A;  3W4Q A;  4CLC E;  1TDG A;  1XA7 A;  3HLD A;  3FYZ A;  5D3O A;  5CX7 A;  4QWO A;  1WE4 A;  2E8J A;  3UN7 A;  2I9V A;  4HNB A;  3UY6 A;  1YT4 A; 
#chains in the Genus database with same CATH homology
 4Q0I A;  1OTI A;  1MC0 A;  3T4K A;  4BMW A;  4CLC C;  1G28 A;  3EQU A;  3LR3 A;  2WKQ A;  1XJ2 A;  1OJG A;  4HH3 A;  2P04 A;  4EEP A;  3OCN A;  3NOT C;  2VEA A;  4LRX C;  2A24 A;  3BQ8 A;  4L9G A;  4ETZ A;  2W1T A;  5DKL A;  4EUV A;  2QYB A;  2V1A A;  3UB7 A;  3BJN A;  3TW8 A;  5DKK A;  4YNR A;  4GHI B;  5EFW A;  3C2W A;  3FG8 A;  4ZRR A;  1UWN X;  3T50 A;  3IS2 B;  2HV1 A;  4JGR A;  4YOF A;  4B93 A;  4F3L A;  1F98 A;  1WA9 A;  3F1P A;  2J3T D;  3S7N A;  4EU0 A;  4HI4 A;  1UGU A;  2FH5 A;  3MJQ A;  3IBR A;  2CMN A;  4KUK A;  1D7E A;  2KDK A;  1LSX A;  3OC2 A;  2L1M A;  3PBQ A;  3RTY A;  2W3G A;  1TS8 A;  5TBM A;  3UB9 A;  3KYQ A;  5I5L A;  1DP9 A;  3SW1 A;  1TF1 A;  4EET B;  3KSG A;  4HP4 A;  3D72 A;  1TS7 A;  3GDI A;  2D02 A;  2M7V A;  2PD8 A;  3CUE C;  2OWJ A;  3HJI A;  1N9O A;  2VGL S;  3MQO A;  2EWV A;  4GS9 A;  3MXQ A;  3LIF A;  4DMZ A;  4UEY A;  3C38 A;  1KOU A;  2YKH A;  1X0O A;  2OAQ 1;  2LB9 A;  1D06 A;  1V9Z A;  2HF6 A;  2KLI A;  3MR0 A;  1XFN A;  3MMH A;  5HD3 A;  3ZQ5 A;  3LI9 A;  2GJ3 A;  4HQA A;  3S7P A;  3VOL A;  3E0Y A;  3R7W B;  3BY9 A;  4ETX A;  4MDZ A;  4WL9 A;  4HH2 A;  5J7E A;  1OPX A;  4JGP A;  2ZBB A;  3BY8 A;  1OT6 A;  1P9W A;  2A2L A;  2W3H A;  3R7W A;  1OT9 A;  4H6J B;  1S66 L;  4JGQ A;  1S1Z A;  3CWF A;  4BWI A;  1P0Z A;  4EES A;  5G4Y A;  2L4R A;  3UB8 A;  5C5K A;  2D01 A;  4HP9 A;  3K3C A;  4L9E A;  2W3E A;  4LRY C;  4B9O A;  2ZOI A;  3O5Y A;  2HJ9 C;  2DMW A;  3E98 A;  4BBU A;  2OAP 1;  4HJ4 A;  1P9R A;  4WF0 A;  1NLZ A;  5HWT A;  3R4K A;  2OWH A;  4G3K A;  5K5B A;  2K7S A;  3EEA A;  3PXP A;  3S7O A;  2VZW A;  2WKR A;  2IA2 A;  4WEL A;  2K2N A;  4H6J A;  5HD5 A;  4GW9 A;  2PD7 A;  2Y79 A;  4LRZ E;  4ME4 A;  4HIA A;  2VGL M;  3LIC A;  4G3V A;  3OBF A;  1VB6 A;  2J80 A;  3PYP A;  3NHQ A;  5F6A A;  2J3W A;  3G6O A;  3TRC A;  2PR6 A;  1STZ A;  4YWZ A;  1DP8 A;  1S67 L;  3A0S A;  5KIZ A;  3S7Q A;  5MC7 A;  2Z6D A;  2O9B A;  3KYZ A;  4K08 A;  4HHD A;  3B42 A;  4L9F A;  2GNX A;  4HJ6 A;  2O99 A;  2O9C A;  4L0L A;  4R38 A;  3KSF A;  5HDC A;  4P6Z M;  3RH8 B;  2A24 B;  5AVF A;  3BW6 A;  3BWL A;  4O01 A;  4IUH A;  2VA0 A;  2V0U A;  2XA7 M;  3LYX A;  4BBV A;  3HJK A;  3E4O A;  3V67 A;  4PKY G;  4IHQ A;  5LBR A;  1LL8 A;  1ODV A;  2VV8 A;  3EEH A;  4F3L B;  5HDS A;  4MN6 A;  5G4Z A;  4I3A A;  3H9W A;  4CLC B;  3MFX A;  1NWZ A;  3P01 A;  3PR6 A;  3UME A;  1OTA A;  5HDD A;  3VV4 A;  3T4S A;  2MJ6 A;  5TJJ A;  5HSQ A;  2KX6 A;  2JKT I;  5F68 A;  3HCY A;  4Y5F A;  1MZU A;  1H3Q A;  4MMN A;  4R6L A;  3EWK A;  4MN5 A;  5DJU A;  2JKT M;  3B33 A;  2G7U A;  3F1N B;  4I38 A;  5HPF A;  3TE8 A;  5F69 A;  1F9I A;  3T4Q A;  2P7J A;  2V0W A;  4DN0 A;  4I39 A;  1W63 M;  2KOI A;  3BQA A;  3LIA A;  3OLO A;  4I5S A;  1OTE A;  3T4L A;  2PYR A;  2QJ7 A;  4RQ9 A;  1EW0 A;  1GSW A;  3PBS A;  4NXE A;  3F1O B;  3MQQ A;  1OJ5 A;  4FSF A;  3UMD A;  4Y3I A;  1NLY A;  5A8B A;  4WN5 A;  2W3D A;  3IBJ A;  3A0V A;  3TJZ C;  1DRM A;  4MN7 A;  5J4E A;  2VV7 A;  4NXG A;  1H8M A;  4NXB A;  3H82 B;  3JVV A;  3T4T A;  3NJA A;  1XJ6 A;  3KX0 X;  4BBT A;  2NUT C;  2HGV A;  4OOM A;  2JKR I;  5HZH A;  2V9A A;  1IOU A;  3LR0 A;  1YSP A;  4HY8 A;  1MKM A;  2J3T C;  3NOP C;  2K31 A;  2PT7 A;  4O0P A;  4KQO A;  2GZA A;  3C8C A;  4DJ3 A;  1YSQ A;  2W1T B;  3VE4 A;  3EQV A;  4E04 A;  2QHK A;  1LT0 A;  1NRJ A;  1T1C A;  3LR5 A;  1TS0 A;  3PBR A;  2XRO A;  1N9L A;  3IS2 A;  4DJ2 A;  2B02 A;  1DP6 A;  2VX8 A;  4II7 A;  4WEJ A;  1BYW A;  4KQD A;  3EOI A;  2ZMF A;  1GSX A;  2QJ5 A;  1LSV A;  3E4Q A;  4P6Z S;  3E4P A;  5J3W A;  4OOL A;  3FPW A;  5HPI A;  4CLC A;  5DFX A;  2LB5 A;  4EQ1 A;  3KSI A;  3NOU C;  4O8G A;  5L8M A;  3PBT A;  3PHY A;  4HOI A;  2JKR M;  2VKS A;  3K3D A;  4Q0J A;  5AJG A;  2HJE A;  4R3A A;  4UQI S;  3H82 A;  1YAX A;  2PYP A;  4GCZ A;  3H7W A;  4GJ4 A;  4I3I A;  3ZYT A;  4EW7 A;  4PKY A;  2H28 A;  3CAX A;  2ZMV A;  1YKD A;  4Y2F A;  3CIT A;  5HL6 A;  3PBO A;  1UWP X;  4ARZ A;  3OCL A;  3UE3 A;  5IT5 A;  1V9Y A;  4WEK A;  2VV6 A;  4CQH A;  2QKP A;  2JHE A;  4WUJ A;  4ARZ B;  5TBM B;  2PDR A;  1IFQ A;  1T1B A;  1T18 A;  2JN7 A;  2L0W A;  3A0R A;  5F5Y A;  2FZ0 A;  2PR5 A;  2INW A;  3F1N A;  4AFI A;  2PHY A;  1T1A A;  2YKF A;  4NEE D;  1TD5 A;  3B47 A;  4XT2 B;  1S4R A;  2W1R A;  2XRN A;  4XT2 A;  4PAU A;  4IUK A;  5IS1 A;  3LFV A;  4LLO B;  5DF9 A;  3P7N A;  2VJW A;  1N9N A;  5AVE A;  1OTB A;  2XSS A;  3FPV A;  3VE3 A;  2Y8H A;  5HWV A;  4EEU A;  2B18 A;  1XJ3 A;  3CLO A;  1TS6 A;  3PBN A;  2BAS A;  4R70 A;  3C30 A;  3LIB A;  4EXO A;  2W0N A;  3LID A;  1VHM A;  4UQI M;  1S4S A;  4WLA A;  1Y28 A;  2M1C A;  3T4J A;  5DFY A;  2M7U A;  4GS9 B;  4Z1W A;  2EWW A;  2R78 A;  3KSH A;  2O0Y A;  1OTD A;  4FOF A;  4JGO A;  1P97 A;  1W63 Q;  3W2Z A;  3JVU A;  1ZTU A;  4KUO A;  4M4X A;  3FC7 A;  3UB6 A;  3KO6 A;  2W3F A;  4IJG A;  2V1B A;  3RFB A;  2O9A A;  4QPR A;  2XA7 S;  1S1Y A;  3LR4 A;  3LI8 A;  5IU1 A;  2QWS A;  5KSH A;  4LPZ A;  2GX5 A;  1LSW A;  4Q0H A;  1GSV A;  1G6O A;  3EGX C;  2NUP C;  2Z6C A;  4EER A;  3U2A A;  3ICY A;  2EA9 A;  2OOL A;  3UE6 A;  4I3J A;  4G3W A;  3F1P B;  2W27 A;  1JNU A;  5FL3 A;  3LUQ A;  3GEC A;  4GLQ A;  5DJT A;  2P08 A;  4PHT A;  2WKP A;  3EGD C;  4BJP A;  1T19 A;  4NXF A;  1F5M A;  3MF0 A;  3ULF A;  4GHI A;  4CLC E;  3D3O A;  3H7W B;  4NKP A;  5HWW A;  1ZHH B;  3DBA A;  3LIE A;  3CI6 A;  3CUE A;  3F1O A;  3MQ0 A;  2VLG A;  4MCW A;  3K2N A;  2ZOH A;  4HJ3 A;  5CX7 A;  3T4O A;  4CLC D;  3OOV A;  2I9V A;  1XFQ A;  4HNB A;  1XJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...