2YKLL

Structure of human anti-nicotine fab fragment in complex with nicotine-11-yl-methyl-(4-ethylamino-4-oxo)-butanoate
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
210
structure length
200
Chain Sequence
b'ELTQPPSASGTPGQRVTISCSGSSSNIGSNYVYWYQQLPGTAPKLLIYRNNQRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCAAWDDSLSAWVFGGGTQLDILGQPKAAPSVTLFPPSSATLVCLISDFYPGAVTVAWKADSSPGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB FRAGMENT, HEAVY CHAIN
publication title Different Binding Modes of Free and Carrier-Protein-Coupled Nicotine in a Human Monoclonal Antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 40
structure length 200
sequence length 210
ec nomenclature
pdb deposition date 2011-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2yklL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2yklL01
2NCMA 1RAMA 4NUJB 1K8IB 5BQ7B 4ODSL 2ZP0T 5HHNA 2Q6WA 1CL7H 1K2DA 2FYYB 3DIFA 4KQ4L 1I3RA 3IF1B 4YXLL 2AXGB 1VFAA 3O2WL 3PDGA 2LTQB 5SV3A 3MA7B 1S7RB 2ICEA 4OCMC 5DJ6A 1YYLH 1QYGH 1EBPA 3U48A 5FYJE 3H9YA 3NIGE 4KKNA 5I15H 5C86A 5GHWH 4U05A 2AJSL 3T4YB 2VUYA 4JAMA 1D5XA 3PHSA 3HC3L 3V5KB 1IJ9A 2CO6B 1LP9F 2YKLL 1AP2A 1LNUA 4FFYH 1KYOJ 1P1ZA 4NN5C 4D0DA 3ARGD 4MS8C 4XBPB 5AUMB 1RZJL 4MHHG 4DTGL 1G6RL 3VXMB 3NZHL 5EWIH 2EDBA 4Z95H 1HINL 5L2KA 5BS0B 4OB5H 5HGAB 1QFWL 1NUNB 5CINH 2EE2A 3N1GC 1A9BA 4F9PA 1C16B 1FLRH 4O4YH 1EAPA 2Q8BL 5DC9B 3ISWA 4NZUL 4DZBA 4ELKA 5I1LA 3WE6B 3Q0HA 4AM0A 2VSCA 4F8TA 2DIJA 4WFHD 4NDMB 2PYFA 4JZOB 5E08L 5GS1A 1KPVA 4X4MA 4MWFA 5J12C 2WM0A 2OI9B 3O9WC 4Z7WA 2A9NL 3H3PH 4CNIB 3LDBB 3RDTD 2V7HB 5CP7B 4JZNB 3OKLB 2B7DT 1U3JA 3IFOB 4NRZA 2OX5A 4JHAH 1QR1B 4XTRD 1HXYB 3N9GH 3SBWA 5LGHL 4KUCD 3KPOA 1FRGL 5J4MA 5ESAB 1P7QD 1F58H 5FGCE 1KNOA 1U2CA 5GS1C 5HHMB 4XP1L 3V7MA 1CFSA 4NHUA 3QXDB 5HYFA 1LK3L 5GIRA 2YSSA 4R6UA 3TO2B 1MAJA 1SEBA 3MJGX 2X40A 5HGBA 2V2TA 3LEXB 4NNPH 1J11A 4BZ2H 4GSDL 3CPLB 4RAUA 5EC2A 5KVEH 1ZLWK 2ZUSA 3QFJB 5I19L 1HDMA 4XBGB 3VI3E 4YBQC 3BGMA 2N4IA 4BH7A 4IIQB 4YIQB 2VE6B 3BP5B 5HYQB 2XZAH 5EU7E 4F33A 1EFXB 3VFVB 4P5TA 3VXUB 3V4PL 3BKML 4GXUM 1YC7A 1CD1A 3O6FB 1EJ6A 5FKAA 1GSMA 3CVHH 4ODTH 4PGBB 5HD8C 2AJXL 1A7NH 5EU5A 4ZUVB 5EB9A 1FDLL 5DQDL 2ZUXA 3VGFA 2HLFC 1ZT4B 2DM2A 2HKHH 2R69L 4D9RE 2A6DB 1P7HL 1KYOK 4HXBH 2Z35B 5J1TC 3SQOL 2CLVB 3O11B 2QQKH 4PJIA 3KYKH 4HT1L 4KKBC 3UTSD 3IRZA 3Q6GH 1J1XL 1NFIB 1VADB 5MEPA 2NY4D 3QUXA 1W0VA 3V4VH 1ZTXL 2D0FA 3MLYH 3CFJB 3M45A 9CGTA 1CICB 1WF5A 2R0KH 2B8OT 1HWHB 1KJ2A 3SE8H 5HYJE 1ACYL 3RIFK 3TA3B 1ERNA 3S4SA 3D39D 1HHKB 2PKDA 4U1IB 1S7QB 3FRUA 3E8UL 4MSWB 3EYOA 5B8CB 5F7KC 5CFHA 3WFBH 1RJLA 3PF2A 3MQIA 3QIWA 1OARL 2DLGA 2Y36H 5I8EB 1SBSL 3HRZB 3O4OC 3ULUH 4Z8FL 3ME0A 2LABA 1JGLL 3ARYA 4ACPA 1KCVH 1J5OL 4LVHB 1ZWIB 5I1GH 4TVPH 4GAGL 1M7IB 5BMFL 1EEYB 2XZQH 1BJ8A 1FGVH 3C60B 4MCZA 2NY6C 4JO1L 4P9ML 4PGCB 2DQIH 4X5LA 5BV7B 4XVUC 4MJ4A 4ENEC 1DR9A 3QIWC 2BSSB 2X89A 1KB5B 5C0ND 4PJDE 2WWMD 1C5BH 2BC4A 3ULVF 3NAAL 4G9FB 3GSXA 2A6IA 2A2QT 2NXZC 4PRHA 1D3CA 3MXVH 1BQSA 3FL7A 1X4XA 1U3YA 4QWWD 3BKYL 2ICES 4K3DL 4PJ9A 3U6RB 4J3VA 4LCCA 4Q9RH 3NACH 4ETQB 5CEZD 3TN0B 4IHOB 5DMYA 4YXHH 4WWKA 5INDB 3CDFA 4N8VA 3PWNA 2B1HL 1NSNH 4X8XA 2QEJA 1IGML 4YDVB 3NH7L 5CBEB 2HJKB 1IQDB 3ARWA 2DRUA 2K1MA 4JKMA 3VXRB 1INDL 4ZFOB 2XTJD 5ITBH 5JOFA 3OGCB 3BAEL 5ID1A 3BH8B 1VA9A 1I3VA 1XGQB 3PWLB 3C5ZB 4Q2ZA 3L3IA 3PNWA 4HMDA 4XAWH 4OD1L 1VESA 4ZO7A 4WWKC 5D7JA 2HP4A 3GK8L 1UXSA 3LIZL 3ARTA 3VXME 2PO6B 4OD3H 3OG6B 2OR7A 3GM0A 5F93C 1MCBA 5BS0E 1CR9L 1OAYH 3C9NB 3A6BL 3T2QA 1OGTB 2QSCL 3UYRL 2D7TH 4N1HB 1U8PB 5F96L 3M8OL 4G8IB 3E2HC 2R0LL 1JJUA 2QADD 2W60A 3GSUA 4WW1B 1S7TB 4HHAA 3KPRB 2QKIB 2W9EH 3PUCA 3VXSA 4OJFH 4TSBL 4Y5XB 1V8HA 4R4FL 4EI6B 4LGSB 4Z7NF 2X4SA 5HDOA 1CFNB 5E24E 4XCCH 2C9AA 2JKXA 2V9TA 1LK2B 3KPNB 4OV5B 3KLHC 4ERSL 2QHRL 1BFSA 1CFQB 2VXSH 5FM5O 5IVXF 4M1DH 3UJIH 1FVEA 3P9LB 3FN3A 3MACH 2YMXL 1J8HA 5F88B 3MTRA 3H8NA 3GHBH 1BLNA 4TYUA 3OGOE 4FQJH 1WBYB 3QIBC 3WBDA 2APFA 4HIIB 2BHYA 1LO2L 1IM9D 2XWTB 3GMMB 3GMRB 3D9AL 5C0IB 5C92A 5AZEH 4NJAL 2WWKT 5FDYA 1IGTA 4MD0B 3SO5A 2GTZB 3WFEL 1KCRH 2UWEA 1CGUA 1OP3H 3VFRA 4R9HA 4KROD 4X7EC 3VXUE 4HQQH 1JNLH 1HHIA 3NCYP 1MWAL 1MJ8H 4P9HL 4RRPG 3SDAB 1HZHH 4X6DA 3X14B 3QFDA 2CDFA 5AEAA 5FECB 2AI0L 1JYXA 2FZ3A 4YEEA 2WUBH 5F9OL 3FQWB 5SV4A 4JO4H 5ACZB 4Z7QF 5EBMB 1UB6A 1JZ3A 1F3DH 5FIEA 4ZFGH 3WNPA 3UC0L 4PJ5D 1BX2A 1V5JA 5D2LF 2VLLA 1GIGH 1GJIA 4YC2C 1OY3B 3BJLA 3SKMA 5SWSD 4K55A 2HMIC 1Q9OA 4X7TA 3V0AC 2PN5A 2YK1H 1YQVH 4JM4H 5EZJB 3I75A 1IKNC 2GAZB 3FT4A 3IU4L 3HI1B 2BFVL 2NY1B 1EXUA 3ZTNH 1MPAL 2G9HA 1CE1H 2OMNA 4BZ1H 2DOCA 4KI5C 4V1DD 2XY2A 2X1PA 2IANB 3IS0X 2JELH 1ONQB 8FABB 4NQDB 1NAML 2MFNA 1A7PL 1RZIB 2ARJA 1JK8B 1XR9B 2ADGA 2HRLA 1F6AB 5SWZB 4GG8A 1QBML 4D2NA 4DGYL 4WWID 3KPLA 3KR3H 4XXCA 3CJJA 1FV1A 3G5XB 3S34L 2DQTL 2E9BA 4GRLB 2YN5A 4OF5A 4YGAB 2YPLD 4XP6H 2ADIB 3L3OA 5FO9B 2VXTL 1S78D 4KJYA 4NKMB 3AY4A 3DHMA 3KS0J 4DAGH 5IESH 2AGJL 4A2MA 2WINA 5IB4A 2BSRB 1M7DB 4HFUL 2ICWA 3U30C 4E41D 4OQTA 5IKCB 1R3HB 1WEJH 3ARGA 2F74A 4WI4A 3D2UD 1OTUD 1A6PA 3GIVA 3ZE1F 4L3AA 4I18B 1A22B 2HLAA 4PD4J 4GQ9H 4K2UH 1G0DA 3DSFH 5ALCH 4QRQB 4C56B 4NM8H 4LDOB 3KYOA 4XNZC 2GUOB 4X80L 5C9JA 5F7WC 1X6LA 4U0QB 4PJCE 4HKJA 4F3FA 3L1OL 3DURA 5EU4A 1C12A 1N7MH 2AABL 3VJ6B 3MBED 3C8KB 3O8XB 1KPUA 3SGEI 4JANA 4H8WH 2P8LB 4LU5L 3B3IB 2GT9B 2CRMA 1UM4H 2IPTL 3UTTB 3ZDYF 3MUGA 2AV7A 1XGYL 3BYYA 3C5SA 3W0WB 3BWAB 5D96B 4GAYA 3DYMA 5MERB 4Z5RB 5GS0H 1O0VA 3M1BB 4WW2A 1BVLB 4ELMF 1RD6A 3MV8B 2OR9H 2HFEA 4UINH 3T09A 5D93C 4HW6A 1P7QA 4AG4L 1KSRA 3LD8C 4QHMA 4OFDA 4IRSC 1A14L 3VFPA 3NGBC 5E8NA 4HX1B 1CXHA 3KPRE 4POZC 4UV7L 5A16B 3G6AA 3PQYD 4TNVK 5EO9A 3K4ZA 1T2QH 3T1WA 5TQ0H 4JGMA 4ONHA 1DBJL 1OP5K 2J12B 1DSFH 3GNML 5J6GB 4G6MH 1T4KA 2H32A 12E8L 1YEDA 5BJTA 2CDGB 4N0UE 3U36A 2FL5B 3RPKA 3P0VL 2N56A 5TDNA 4FZEH 3DOSA 3S37L 4LPXA 4YHZL 3TJHC 4YNYA 1XGRB 4G42A 4PREB 5CD3B 5K9OB 5A2JH 4OIAA 4L1HA 2F54E 4U0RC 3LN9A 4GBXB 4TQEL 3TH4T 5C09A 1U2HA 5GGSA 2VLKD 4QYOB 2XXCB 1EUTA 1NLDL 2EO9A 3NFPA 2KZ1B 3SO3C 4FQLH 4Y2OA 4ONGH 4ODWB 3UTSA 4R2GB 2YEZB 4LHQB 2Q76B 4NKQB 1U93B 5D1ZC 5F3HB 1T5XA 3HPLB 4PD4K 4Y19B 4I2XB 1VACA 4XNUH 5JUEH 1OCWL 1GGUA 3ARBD 3H9SD 1PY9A 3WHE0 4U2YA 3G5YB 5HYSB 4PFEA 4FG6C 3MLVH 1JF6A 4L29B 4DK3A 2FEEL 1NJ9A 1HNFA 4NNXA 5CAYB 3D39A 2VC2L 5IOPB 5CGYD 3TYFA 4JG1L 1DTUA 3HMXA 1WUNT 2JB5L 3MGAA 5I16A 2XZCL 3U2SB 1INQB 2E27L 1RJYA 2CIIB 4FQHB 4FQQA 1MRDL 4P4RA 1RU9L 4BA8A 4X7SH 5A2FA 1AO7B 1A1OA 3LZFL 3UBXI 3OKKB 4FQPA 1DVFD 4KK9C 2C1PA 3VCLA 5T1MB 1NEZB 3O3DA 5D7KD 2NNAB 5GGTL 3RZCB 5M95B 4P48A 1I8MA 2I9LB 3D69B 3I2CH 3B5GA 1G6RA 1CQKA 1PSKL 3FB5B 2DQUL 3L95B 5CBAA 2DQJL 3VD3A 3TCLB 3WLBB 5HDQL 2IANE 5BZWB 3V6OA 4Q97A 4WEMB 3I50H 4APQD 4NQDE 3VGAB 4S1RL 2CKBH 4U1NB 5HVHB 4QY8B 1FL6A 4WHDA 2V7NB 4IRJD 4HIEB 2EDNA 4L9LB 3NTCH 1TCRB 2HKFL 1H3TA 2WQ8A 4NKIL 1DE4B 4LPCA 1TTGA 1T2JA 4F7EA 4UOW1 4XHJD 3SEPA 2AEQL 5C0BD 4OZHE 3V6OC 1OM3H 3QIUC 1T89A 3MJ7B 4LLYB 1NUGA 4QRSB 5CIPA 1D5ZA 2Q7YB 5A43C 1LO4H 1JPTH 3DHJA 4S2SB 4UAOB 1F6LL 4H25A 1XZ0B 5DUPL 5T3ZE 1OGAB 2EIZA 3FRPA 4D0CB 3QO1B 3KYMB 3CNKA 2D4FA 5E9DB 2EXYD 3L3DB 1XH3B 1DQML 1ETZA 4D94A 5J8OA 1KC5L 1MQKL 1EK3A 2HG5B 4XP4L 4HFWA 2FCBA 2D3VA 1H3XA 3FZUC 1A4JA 1FNEA 3THMH 1Y0LA 2H3NB 3FQRA 3M17A 5FYKE 3FT2B 5DK0A 4PGDB 4MCYB 4KJWC 4WUUD 1UYWH 4H1LA 3WXVL 3LH2H 1RFDL 5DWUH 4F37K 3L5XH 3N85L 2IAMB 1NC4D 1RUAL 4YK4C 4Y5YB 1D7FA 2VXQL 4OCSH 4U6HA 3DSNA 3QRGH 3RWDA 1ULVA 1WWCA 5TQ2L 1ZLUH 2RJMA 2FX7H 1U58A 4ZPTB 3FO0L 3UJJH 3EW3B 1MVFA 1YY9C 3FO1B 5T1KD 3UZVB 5EZLA 3GFUA 1LEIA 1AIFA 3MV8E 1CF8L 1A6VH 1CFTB 5I6XC 3O6LL 3I3DA 1R24A 5DGRA 5ID0A 1OHQA 2VWEC 5AZ2H 3IFLH 4FXLA 1DN0A 1IM9A 1R5VB 3WS3A 4KDTA 5KSAB 4KK6C 1NMBH 3CSBA 2BRQA 3HAEG 3W9EA 1V3LA 3RL2A 3BEVB 1B0RA 2COQA 1I7UB 2APBA 3MMEA 5GS3A 1QFHA 3BPLB 1R3LB 1UG9A 2HFGH 4OCYH 5GGUA 2DICA 3KPMA 3F7VA 1X3DA 5GGRB 2BSED 1ZLSH 5EORL 5GQBA 4NQCE 2QR0A 2DBJA 3ZKSD 3BW9A 2BVPB 4NPYA 1I8IB 5F9JB 5IB5B 3T1FA 4MJIB 1JPGA 4LPYA 1C7SA 5CEZE 1N5AB 4AQ1B 1WCBB 5DYOB 2G60H 1ZA3B 5F6HJ 5EO1B 1Q9KB 3WN5B 4P2OD 4O5LL 4PJ5A 4RAVB 3R8BB 5IBTL 4AEHH 4GG6A 2L4OA 3BSZL 2JCCB 5SWSA 3BQUB 5BW7A 3MPCA 3SKOA 1J10A 4OLYL 1JZ2A 1NBYA 5C3TA 4GW5B 1SBBA 5E6IB 1TIUA 5KVGH 3CU7A 1KF9B 4WUKH 4V1DA 1QO3B 4M7JH 3UYOD 4C59B 4LSQH 2F15A 2E3VA 2IADB 4CN1A 1W8OA 1PJ9A 3WFDH 4LCYB 4P46B 3Q6FA 3SGKC 1FG2B 1FNLA 1ZOXA 1PDKA 1D5BA 1F4YH 2ICCA 1H3UA 2FBJH 5DHVH 3VRLF 2NXYC 1R3KA 5H2BB 1SJVA 2ZPKH 3MO1A 4DKFL 2AQ3A 1I7TB 3KWWB 5A2LH 2VIRB 4KXZI 4QOKB 3HE6C 5HDBF 4XP9L 1LVEA 1M1SA 2ADFH 5BV7L 1AGFB 2YPLA 3FT3B 2OP4H 5E4IA 4LF3B 3QXTA 1KB5L 4DUXA 4WV1C 3HI5L 3LRSA 3I9GH 4H88L 4Y4FB 4B7IA 2D31A 3BX7C 4R96B 3GI8L 1PLGH 1MJJB 2G75B 4E41A 2MOVA 4YUEL 3OSKA 1XMWA 1PBYA 1AD0A 5TH2A 3MNVA 3BH9B 1BQHA 2FJFB 2VKWA 3D2UA 4XMPH 5FCUH 2RR3A 3T3PF 5D6CA 5E8OA 3TO4B 3OJMB 3B2VL 2PCPA 2W65A 2VLRD 4PIRF 1CD8A 5JMRA 1ITCA 3PABB 2EXWD 4M1CC 2B0SL 3LKQA 4I9WE 3V8OA 1U6AH 2ZG3A 4HK3N 2O61A 4PY8J 3B5TA 3MBEA 4KJPD 5EUOF 2FATL 2GITB 4UNVA 5HHMD 5D1XC 3TBTA 3RIAF 2MMXA 5E9DE 2VN4A 2GI7A 5K9KA 2PR4L 4FQ2H 1HHJB 1MRCL 3IU3A 5IHZB 4Z7UB 1JV5A 2YPKA 5KBNC 3RUGF 4Y1AD 2NY0D 1IC5L 4PGJA 1W72H 1SMAA 2K9UA 4JDTH 1TQCB 4U7SA 1EHXA 4XVJL 4RWYL 4KC3B 5BCAA 1QEWB 5I76B 5E4EB 3QQNA 1EFXD 1VGKA 3CVHB 3PQYA 5FFLA 4M8VA 1MWAA 2OSLB 3EO0A 4NOFA 1KB9K 4TNWF 1UVQA 4X7FC 4NRXA 1H8SA 2DWDB 1XIWC 4NN6C 4P2RB 4RGNE 5DMJB 1AC0A 4HUXB 1CE6B 4HJJL 2OLDA 4MA8H 4KI5F 1U8JA 4NN7B 3IDXH 4OIIH 1YJDL 2BJMH 5JIHA 1H3PL 1WFNA 4MMXC 5SX5H 1HCFX 5FCSH 1YEKL 4I1NB 3BPCA 2JE8A 4G6FD 1TJGH 2YUZA 2XNAB 3GHEH 3BD5A 3WIHH 1CGTA 4YHPA 4P9HC 3FTGA 3P0YH 3MOBH 1CLZH 5DJYB 5FM4A 1MF2H 3W82A 2R23B 4M7ZB 1CICD 4MZ3A 2VLKA 2ESVD 3MFFA 4PJBE 1W0WA 5JW3L 1JE6A 4AIZB 1DEDA 4GMTL 1HSBB 3AM8A 5F1SA 2FH8A 2H2PD 2NY5L 3BMVA 3QSKB 1LE5A 4OGYL 3LQZA 3ARBA 4MQSB 3IDMB 3HI6L 2D9CA 3BZ4A 3LEVH 3OZ9H 3KLAB 3HE7B 4MJIE 4Z76B 4R90H 3BO8B 4JJ5B 3WYRA 2H6PA 3G04B 3AM8C 2XWBB 3FB6B 1MHPH 4HKBB 4YHLL 4I3GA 3TH3T 1RURL 4DJMA 1HKLL 2MCPH 1NCCH 3WUWB 1UQSB 1YMHB 1JGVH 4U1LB 5B39G 3VFTB 4HIJB 1PKQB 4YHYC 2ZCKH 2DI8A 5GSRA 1OT1A 4G9FD 1T1ZA 1DVFA 4EBQL 4QNPE 4MXWL 4UILL 2DKUA 4BQ8A 1V7NL 2CPCA 4H20H 4PV9A 2FIKB 2XPGB 1V05A 2VDKH 4PB9H 3L3HB 2OZ4L 1IEAB 4JM2C 3P11H 3EYFA 4UIMB 3I3EA 1KJ3H 1M71B 3SY0A 5CJXA 1F90H 4RISH 3VXRD 1E4XL 2VDRL 4APQA 2XFXB 3ARFB 4EQ3A 3IDIB 2R1XA 3V95A 4IRJA 1JPSH 2VABA 4BKLB 4HC1L 1QFPA 4PRPB 4FMKA 2HVKA 3AXLB 3IKCA 2GFBB 1BAFH 1U95B 5D71H 1QR4A 2P8PA 2ZSVB 3MV7B 4QOKE 2AKRB 3B9KB 4ZS7L 2PO6D 3Q2CA 5C0BA 5JQHC 5BVJB 2HRPH 2C1OB 3HZVB 5T3XL 3QDGB 3V0VA 2AQ2A 3I02B 1BVZA 2C5DC 4ZXBB 4ZO8A 3QUMH 3DRTB 1DLFL 2P8MB 4IOSD 4HWEH 1G7LB 3GJFA 2Z4QA 4EJ1C 4CW1B 3REWA 1LP9B 3GSVA 5F1KC 3HUJA 5F7EH 3RL1A 4HK0B 3OKEA 4TULH 4CJ0A 1NGQH 1I1AD 5C0AA 2H9GB 2FECL 4ODHL 2APXA 3X3FL 4NIKB 4CMMA 5HSFA 1MI5D 4HUVA 1UFUA 3WFHB 4DVBA 5E2TH 4WI5A 1BM3H 35C8L 1NC2D 3DVNB 3JV4A 5DQ9A 5DFTA 3BZEB 5FYKL 5D7IF 1Q94A 5IGXL 2DWEA 1AXSA 5ESQA 4WUUA 4JKPL 1G7JB 1G7IB 3H9SE 2X7LB 2F8XC 1A4KB 1NC4A 3V5DB 1FL3A 4OAWB 4LL9A 3RTQD 1MLBA 3HC0A 4I5BA 5DVMA 1CDHA 4LSVH 1FVDB 4I48B 4HMEA 1JF5A 2APWA 3BEWB 4NQTA 3QNXB 5DMIL 4Z7UE 3UAJD 3P30L 1KPRA 5E8EA 3SGEH 3LQAC 3VXOA 1Q0XH 5T1KA 3EDDA 3P4NA 5F89A 1S7VA 3MOAH 4F9LA 1JZ4A 1UACL 1CG9A 5DFVD 5EU7C 4MA7H 2EZ0C 4U6VL 5IJVA 4JVUA 3ZSTA 3S5LG 2NLJB 4ZS6C 3SE3C 3HG1B 3QR2A 2ADJB 1KBGL 5ALBH 4P23B 3T4AB 1NPUA 4JDVA 5CS7A 1K5NB 3RNQA 4YAQA 5E8PB 4NFBA 5C0FA 1RUQH 3D85B 4HPYH 2AEPH 3QNYB 2CXGA 4PR5B 4RDQF 5EFIB 2FX9L 5T1LB 4OD2A 4MNGB 3KYAA 2EH8L 1DBKH 4DFIA 2J8UB 1GRWA 3U7YH 3PL6C 3Q3GA 3I6LE 4YEFA 1FFRA 5E5MA 2FRGP 2IMNA 5EUKB 2GSIB 4OZIF 3F6IA 4XHQA 5BOZG 3K2UH 1T1XA 3LY6A 4EN3C 3CLEH 2FJGB 2DQFB 3OF6D 5GGTA 3GMLA 2OYPA 1HSAA 4Q6IC 4P2OA 4NWTH 5ENWB 3VWKB 5DEGB 4WU7B 3K8MA 3DVGB 3RGVB 1TZIB 1VEMA 1K8IA 1AR2A 1FFOB 3RWCA 2YC1B 4RFNC 4KH2A 2FYYA 5D2NA 2R15A 4JO3H 3UTQB 1TZGH 2BRRL 1X4YA 3IF1A 4GAJH 2AXGA 2H26B 3LEYL 4L3EB 3IJYB 2ZOLB 3MV9B 2KL6A 4P2OC 3A0OA 4KAQL 1AHWB 1EO7A 5HHQB 4L8CA 3CCHB 3ARUA 3QDJD 3DETC 4FFVD 2NYYD 4P2QE 1D9KB 4XPAH 4YQXH 1MCCA 3VE0B 3MRNB 4HULB 3O4LB 1U8OA 3CFKB 5T3XD 2Z91A 4R7NB 4PBXA 1PKQE 3N50A 2NX5D 2WUCL 3ETBF 1ZS8B 4KMLB 5ECJE 2DLHA 3EYQD 5ESVA 3UEZA 2P24A 3MLTB 1WFOA 3MRDB 2Z8WC 5HI4D 3H42H 4NQXA 2ZG1A 1DDHB 1DP0A 3IDJA 4WY7H 3IGAB 4ZAKD 3TFKC 3L5WA 5KSBE 1SVCP 4M6NH 3L3KA 2ED9A 3RWFB 4HLZG 3TV3H 1UM5L 4C56D 5ISZB 4QGTA 2C7UB 3T2NH 4MQTB 4LCUB 1HN1A 5JZ7C 2EYRA 1C16A 1QFUH 2J88L 4Z9KB 5K59F 3FB8B 4ZTPL 2VZ1A 3O8XD 3X17A 1LWRA 3S35L 1PY4A 3LQMA 1YEJH 3SE4C 4JZOA 4KKAD 3RU8L 1MNUH 2Y6SD 4UV4L 2VN7A 4Z0BH 2PW2A 1YYML 5I75B 2V7HA 2XWJA 2VLRA 4JZNA 3OKLA 4M7KH 2KQNA 3IFOA 4X6CE 3NCJH 1DFBL 1HXYA 1XGPB 4YWGH 4R4BB 1FG9C 5ESAA 5CD5D 2O5XH 3D5OF 3QNZB 1LP9E 3BE1H 5JR1L 3QXDA 3C09C 5HY9B 3AGVA 3TO2A 3LDBC 4YHKL 1FIEA 1QRNB 1FNHA 1NCBL 3LEXA 4G5ZH 4OLUH 2J7LA 5FO7B 3BD3A 1FNSL 1MAMH 4U1MB 4DN3L 4QEGA 4Y1AA 5A3ID 1CGVA 3AC0A 5FOBA 3TP4A 1S9WB 5I1KH 1PZ5A 3QFJA 4DCQB 4XBGA 2WP3O 3ZKMC 5DQJB 1HNGA 1JFQL 1BGXL 1RHHB 1UXWB 4IIQA 4YIQA 3BDYH 5HYQA 1TTUA 3GB7B 1DBMH 5I1JL 1EFXA 3VFVA 1IGFL 4YGVB 4F15C 4QRTA 1FYTD 1FE8L 1OAKH 5F70A 1OL0A 3BP7B 3EOBB 5I8OL 3EUUA 3C2AL 1MFAH 1PVHA 2VR4A 1KIQB 4OGXH 1EMTH 4EUPG 3QDME 1OP9A 2HT2D 5KOVC 1ZT4A 3TNNB 4OUOA 3JWDC 2Z35A 2VQTA 3QJFB 4L5FH 4IIQC 1KJVA 2Q20A 4EIZC 1N6QH 4R2GD 1A1NA 2BOBB 1FGNL 4AH2A 5IVXB 2CKNA 2B4CL 2D7MA 1YEGL 4NZRH 1VADA 3O6FC 1C1EL 3OAYK 4Y19D 3SDCD 1Q0YL 1IAOA 4U1KA 4EEEA 1G7QA 4NCDA 4JPKL 5E2WH 2NY2B 4NJ9H 3LPGA 3CFJA 4WI8A 5IG7B 2D0HA 1CICA 2VDNL 2VR5A 5HI3D 2VZTA 2ESVA 3VRJB 1T7VA 4NBXB 2R39A 4KFZC 3RVTC 4JPVH 1QNZL 4LPWA 1S7QA 4MSWA 4MNGE 3ET9F 3BYTA 1CU4H 3MRGA 2WNGA 5FYLL 1E6OH 4AT6B 1ADQL 5IW1A 1H8NA 4WGVB 1AO7D 3GBNL 4X7CC 1MFCL 3HRZA 5FGBC 1OAZH 3HR5A 3RAJH 2NZIA 5F7DA 3TA3C 1MCFA 3GJEB 1UWGH 2WZPD 2HFTA 5B8CC 4PGCA 4G8GD 4Y4KC 5L88H 5IMLA 4GKOA 2ATKA 2BSSA 1KB5A 5ICYA 1BJ1J 4YHOH 5HHOD 2PTVA 3RY5A 2CKBB 4B5EA 1KIUA 5GGVL 3AMKA 4G9FA 1MCKA 3ULSB 3V5HA 4K7PX 2X5PA 3WNMA 2OTWA 3FKUS 1LEGA 3A67H 3RBGA 1YYLL 3C60C 1IE5A 1QYGL 1B0GA 1XF2A 1NGPH 2XV6B 4L3EE 4ETQA 3MV9E 5I1AB 4IHOA 5I15L 1EA9C 5GHWL 1MVUB 4JKWA 4TUKL 1JWSB 1GOGA 3MRCA 1J05B 5JW4Q 2Z92B 4ISVB 1QTYT 5CBEA 3STLA 1IQDA 1MHEB 3VXRA 5GGRY 5C7XH 5C2UB 3ILQC 3O4LE 3ZT6A 4FZ8H 4FFYL 4JZJA 4P5KB 1XGQA 5BVPH 3PWLA 1CDGA 2DI9A 4XVTH 4XPGH 5KG9B 4KHXL 4BSVB 4QXWA 5JXAH 3TN0C 1OGAD 3G5ZB 4QHKI 5EWIL 4KGLA 4C83A 1MFBH 3O2DH 1QKZH 4Z95L 1A2YB 4HV8B 1NDGB 4JO2H 4N90D 4OB5L 2PO6A 4LIQE 4QHUA 3X11A 2JJSC 3D48R 2V9QA 5CINL 5K9JH 2IG2H 2IEPA 3CMOH 3VFOB 2HT4C 1FLRL 4O4YL 1VSCA 4FNLH 3EOAA 3C5ZC 1F02I 5B38B 4P4KB 4KXZH 3BKJH 3CFIC 3HNVH 4IRZH 2P43B 3ULVE 5GGVY 3K80A 4JFXB 1S7TA 4IJ3B 4WW1A 1K8DB 1F2QA 2FGZA 3SDDB 4U49A 3H3PL 2IAMD 3ARDD 3BDXA 3QZWB 3SE9H 1I1AA 4RRPA 1I9JH 2Y5TA 3U9UA 1MI5A 3QCTH 1CFNA 3L5HA 4JHAL 1N8ZB 3N9GL 1S8DB 1LK2A 3CMGA 1MFEH 1NC2A 3GMPA 5H8DA 1F58L 3IXTB 1CFQA 5GPRA 3WO4B 5FV1L 2XN9B 3QUZB 4Y2DD 4Y5XC 1T3FA 5F88A 3ABZA 4S10A 4HKXB 5JDSB 3B9DA 1F4HA 3RTQA 2LVCA 1WBYA 4NNPL 4BZ2L 2Z31B 4HIIA 3Q5YA 4F7MA 4X4YA 2XWTA 3GMMA 1QRNE 5KVEL 5KSAD 5JOPE 3F7RA 3LCYA 2IQAA 4JFZH 1YJDC 5HBBA 4MD0A 3GM8A 2XZAL 2GTZA 2JIXB 4ELMB 1U8KB 2PXYC 1WBZA 4YFDB 2R9HD 5FYLD 3CVHL 1CDCA 4ODTL 2X4PA 4PJAA 4U1SB 1A7NL 3SDAA 3O3UN 4ZTOH 1RUKH 4OFPA 2HKHL 1I1FB 4HXBL 5DD5H 1YPZA 5IVZB 2QQKL 5LGJA 3KYKL 1WZLA 5ACZA 4WDIB 3WO3B 4Z7NE 1TJHH 4PTTB 2HA1A 2D4DA 5GGQH 1EO8H 3Q6GL 3K81A 3OKYA 4HWZB 3MRRB 3B5HA 4ODXA 2DL9A 5L2JB 1CXKA 3V4VL 1N3NB 5IVXE 1HHHA 5DS8B 3DNKA 3SDAC 1AFVH 3MLYL 5FB8B 2R0KL 2E7HA 3IFPA 3BQUD 3SE8L 1T22B 2Y72A 2K7QA 2W0LA 1AGEB 4ZDHA 2FD6H 3OF6A 1CVSC 5E6ID 3SJVD 5FAAA 4G8FB 4KQ3H 5IB3A 1B4JH 1VKXB 3WFBL 4O02H 4G3YH 5EIQA 1T21A 4FQXB 5CEYB 1OLLA 2Y36L 1Y6KR 3ULUL 1ONQA 3H3BC 4WJ5B 4GKNB 1KCVL 2Y07H 4YHIA 5I1GL 1UJ3B 1RZIA 4TVPL 4LLVB 1JK8A 1XR9A 5DHVB 1F6AA 5SWZA 2XZQL 2NY1C 1FGVL 3LOWA 1JNNL 5C6TH 3RWIB 1N59B 2DQIL 4HC1A 2I25N 1HH9B 3G5XA 2VZOA 1EH9A 3BPNB 1A6AB 5KS9A 3ZE2F 3BD4A 4Z7QE 1HKFA 5F7HA 2WV3A 4NKMA 2SEBB 4OM1H 1IAKB 2NX5A 3MXVL 1U8LB 5D2LE 4HWBH 3RX7A 3QUYD 3BESR 3QXWA 2BCKA 5L6YH 3NACL 5IKCA 4Q9RL 3AU1B 1AY1H 2HJFA 4YXHL 4GRLC 3MJ8A 1UENA 1NSNL 3W5NA 3UX9B 1JN6B 4ZAKA 3DROB 4I18A 4WHYG 4PJHF 5ITBL 2AEIT 3ARSA 3TO4D 1A6TB 4C56A 2F8VA 4V2CB 5AD0B 2GUOA 4AYFA 3OXRA 4LSTH 3VI3F 5H37G 2JK5B 4XAWL 4UUJA 4QRPB 4H5SA 5C07E 5CHNA 3C8KA 3O8XA 3S36H 3MZGB 5FHBH 3PWPD 3MJ9H 2BNRD 4OD3L 1K6QH 2GT9A 2ZUUA 1H0DB 4PYGA 5JIKA 1OAYL 3UTTA 2KDGA 2VSDA 4OZGA 5IFHH 2D7TL 1BOYA 5CZXD 3W0WA 3BWAA 4D9QD 5I73B 5L9DH 2XZZA 3LKNB 1S7XB 1W72B 1QLEH 3M1BA 1BVLA 4N9GA 2W9EL 4OJFL 4XP5H 4J4PC 3LHPH 3P4LA 2VO5A 4HX1A 3FO2B 3U0TB 1GGCH 5A16A 5CJQH 2AJZA 2X4TA 1EEUA 4XCCL 4G7VH 5IQ9B 2EECA 3LB6D 5D96C 4A6YH 3ZE1E 1BD2B 1G7PB 1AI1H 4JY6A 2VXSL 4M1DL 5J6GA 3UJIL 4E9LA 2PW1B 2ICWI 2IBZX 2VISB 3MACL 1EEQA 1RV6X 3EOTH 2Y7QB 3GHBL 4UU9A 4NUGH 4FQJL 4JHWH 2DIBA 1FYTA 4PREA 4WCYH 5J11C 5K9OA 3QXUA 2GJZB 4OLWH 4CVZB 4GBXA 5AZEL 5DRNA 4TVSa 3K0WA 4QYOA 4XVSH 1BVKB 2OJEB 4Z7WF 3QDJE 1KCRL 1VGEH 1WBXA 3S8WA 1JNJA 3OJDB 4CADB 4ODWA 3QISA 2Q76A 3CX5K 1JNLL 4HQQL 4UB0H 5F3HA 1F8TH 1MJ8L 1YY8A 1QQDA 5C71A 1IKFH 1HZHL 3HPLA 3EO1B 3BRFA 4Y19A 4I2XA 3SDCA 2IF7A 3ULUD 2WUBL 3RP1A 4GBXC 3CDGA 3V79C 3WLWD 1FFPA 4P5MB 4JO4L 2R2HB 4YO0A 1H9VA 4TVPD 3BN9D 5HYSA 2A1WH 3AS0A 4CMHC 2CR6A 1ZHBB 2P44B 1SJHB 4LOUC 4L29A 4ZFGL 4N5ED 4G7YH 1GIGL 4G6AC 2GYSA 2AK1H 3ZHDA 4NZJA 4GRWH 4DEPB 4N0YH 3DV4B 3U2SA 4FQHA 2CIIA 4RNRB 2YK1L 1YQVL 4JM4L 5IIEB 5JORB 1AO7A 3KXFB 4LNVA 3OKKA 3CVIH 2OTUA 3WS6A 3ZTNL 3QRFM 3KLDA 2VZ3A 4BZ1L 1NEZA 3RWGA 3VH8G 3MGTB 3RZCA 1YNLH 3MV01 4G8EB 4MNQD 2I9LA 3D69A 4XZUB 4FFZH 4G8GA 3ZKNC 1PEWA 2JELL 1ZGLB 3L95A 4IMLB 4B7LA 1QSFB 4PJIF 5HHOA 3I6KB 3TCLA 5BZWA 4BH8B 2NW2B 5GZNC 5J3HC 3ARFD 4HZLA 4U1NA 4QY8A 4XPFL 3RVVC 2V7NA 3KR3L 1IRAY 2OL3H 3RZCC 4L9LA 1TCRA 1I7ZB 4PRPD 4XP6L 4OZFG 2AS5M 3S4SG 3JWOC 3SKUD 3MV7D 2M1KA 3DUSB 2ZUYA 3B9KD 3VFSA 4X9IA 4OSUH 3ALWA 4R4ND 4DAGL 5IESL 1IFHH 4IOIB 4R97B 3LMJH 3VGAC 4LLYA 5HVHC 1X7QA 3JXAA 4QRSA 2Q7YA 1WEJL 4ZXBD 1FL5B 1RJZB 4NRYB 4O9HH 4L9LC 3IFNL 1MOEA 1UA6H 1XZ0A 3FQTA 4MX7B 1OGAA 4M3JA 3E2HB 4D0CA 4GQ9L 3KYMA 3OKOB 4K2UL 3DSFL 5ALCL 4BSWB 3PDOB 4NM8L 1UADC 3FOMB 4KRPB 3VWJB 4X98B 3OKNA 1AXTH 4Z78B 4LAJH 3VFGH 3FO9B 3O6MH 5FM8A 1CDJA 3HAEA 4WU5B 4X6BB 4TTDC 4UAOC 4HSQA 2H3NA 3MJ6A 1B3JA 2YWYA 4PJFE 4H8WL 1LE9B 3FT2A 5JW4N 2IBGA 1UM4L 4PGDA 4MCYA 1GZQA 1ORSB 3AFLA 3VXQB 2IAMA 3ARDA 3VFWA 4Y5YA 1PG7H 1C08A 5TF1H 5CMAB 3QG6B 1PYWA 2Y23A 4ZPTA 2BMKB 5GS0L 2OR9L 4UINL 1QFWI 3SPVB 5DJ0B 1PW3A 2EDXA 4WNQB 5JNYB 3WL9A 2I9TA 2DTMH 1U8NA 5E5UB 2XKNB 4KK8C 2AVGA 4Y2DA 1A3RL 3VXPB 2HN7A 2DYPB 3HG1D 3LQAH 2PTUA 1T2QL 3BGFB 4P23D 5TQ0L 3RJQB 1MHCB 5EOCJ 4LRIC 5EUOB 2FX8H 1HQ4B 5D72H 5DD1H 4RGNC 2V5YA 3QO0B 5I17B 1DSFL 4KKCD 5KSAA 4G6ML 3ROLA 3G08A 3MRQA 4LCWD 4JQVC 1I7UA 3CXHJ 3SKJH 3FAXA 4FZEL 5I2IA 1R3LA 5T1LD 1KEMH 5GGRA 4DW2H 1MCHA 4NO2B 2BVUA 1A9EB 3ZE0E 1EDQA 2BVPA 5JW4R 1I8IA 3TZVD 4YDIH 4LKXA 5IB5A 4FQLL 4NO0D 4OFYD 4ONGL 5IHUH 1WCBA 5DYOA 1BFOA 3BPLC 1Q9KA 1JPFB 5BRZB 2ERJC 4UBDC 5C0CB 2WBJD 4OKVB 4XNUL 5DK2B 5JUEL 1O5DT 1QBLH 5HVFB 3O0RH 4Y7MA 2JCCA 3NZ8A 4X5XA 5LGKA 3BQUA 3MLVL 5GJSH 3MNWB 4Z0XB 1NGYB 3IDNB 4PJGB 2DBLH 5E6IA 3SJVA 3IVKB 3WN5C 3JBG7 4IM8A 3OHXA 1QSED 3L3JB 3QHFH 3WJJA 3BKCH 1KXQE 5IBUG 3QEQB 4MD5B 5B4MC 4X7SL 4O58H 1D9KD 1EAJA 1DUYB 4MQXC 3WDIA 3NN8B 1J9CT 3JVGC 3MRHB 3FFCD 3RWJB 3ZKQD 3G6JE 2Z93B 2FH6A 2HJLA 4D3CH 5H2BA 4YJZL 2P42B 4Z7VB 3I2CL 4X6DF 2R1WB 2CUIA 3U30B 4PJ8D 1I7TA 4JFYB 2VIRA 3UBXB 1XCTB 1OAQH 4OI7A 1T1WB 5EZIH 1JHLL 1I1YB 3I50L 4P46C 3V6BR 1QSFE 1REIA 5ISZD 2VYRE 4D8PA 4UQ2B 1AGDB 4WTZA 3QUYA 5FHAH 3NTCL 2A0LC 2NZ9D 3CXHK 3PWUB 3BH9A 1B88A 2IH1B 1HOCB 2FJFA 2N7AA 3SGJC 4P3DA 5GRJH 5DSCB 1YNKH 2VLJB 2FO4B 1OM3L 4LLQA 2RCSH 3ZDZE 4LNRB 4C57C 3TO4A 2P5EB 4Y4FC 3WJLA 5DD0H 5GS0D 1JPTL 1P9MA 3MUHL 3PABA 3WXWH 5TGBB 3OX8B 1SJXA 1ZAGA 2AEWA 2JJWA 4QKXB 4M8QB 1KFAH 3QQ3A 2HWZH 4PRAB 1RZ8B 3TH2T 4M7LH 2ILLA 3PWPA 2GSGB 2BNRA 2QHLA 5DHYB 5LCVH 3D0VA 2D0GA 3F12B 3VRLE 5HPMB 4DZ8A 1A02N 1E4KA 1B0WA 4XT1C 3HS0B 1WWWX 1YMMB 5C0JB 1CGYA 5HDBE 3DX7B 4UDUB 1S7UB 4X9GA 3THML 1KJ2H 3UP1A 3QWQB 1R6VA 4IOFD 3LN5B 4RZCA 3QUKB 5EPMB 1JF1B 1YECH 3DVFA 3KG5A 1UYWL 4HJ0D 3LH2L 3TIDB 5DWUL 3IETA 2V2WB 4GMSH 2ZJSH 3L5XL 5L7XH 4W6WB 1MFDL 4OCSL 2M2DA 1KUMA 1G9MH 3CC5B 1QUNA 5I76A 4V2BA 4JFFE 3CVHA 4R0LB 2ZKHH 2FX7L 1QP1A 2YD6A 4X9BA 3UJJL 5CWSB 5E00B 5CUSH 1QPPA 4P2RA 3MNZB 3T3PE 3DGGB 4ZQKA 4HUXA 2IALA 4K3EH 4HCRH 3VFMB 1TQCC 1QA9B 5DJDB 1IT9L 3MGOA 5E4EC 5D7IB 1J86A 2C3VA 3IFLL 5AZ2L 4KJQC 2XNAA 3QPXH 3JWDH 2YD4A 4CVXB 5B39A 4CN6A 3P4MA 1R3JB 1NMBL 4WTWA 2R23A 1ZMYA 1F3JB 3WIIH 1FLTX 5MI0C 5C0DB 4Q9QH 1S9KC 4K3HA 3SOBH 1ZSDB 1MAKA 2HFGL 4NN7C 4OCYL 2ITDB 2GHWB 4JB9H 5DUMH 4AIZA 5EA0H 3MCLH 1ZLSL 5DMKB 3QT2A 1GGIH 4C4KT 3RUGE 1I9RH 2CUMA 3GRWH 4WW2F 4KUCF 1I85A 3HZYB 1T66D 1WTGT 1KTLB 1KJMA 4M7ZC 4NBYB 1V3MA 4Y16B 5JHDD 4JVWA 2NTFA 2G60L 1J12A 4JJ5A 2AXFB 3G04A 5E2UH 3FB6A 4HKBA 5BRZE 1KELH 3ALXA 3NA4A 4L4VB 2P46B 4AEHL 5C0CE 4G6JH 2W1NA 3WUWA 4UDTB 1YMHA 2VH5H 2ZSWB 4U1LA 4HIJA 3VW3H 1A3QA 43CAB 2YWZA 4HUWA 4PRIB 5I0DA 1AH1A 1LD9B 3HE7C 5KVGL 5E6ZA 3ARZA 4WUKL 5J9PB 4OZIB 1MCRA 1WICA 3OB8A 4M7JL 2XPGA 3OL2A 1BZ9B 4LP4A 4LSQL 3L3HA 1IEAA 3WFDL 2CH8A 1M71A 1PZUB 5KN5B 2YZ1A 1G7MA 3EJZD 1RK0B 4MLIA 1F4YL 4X6FB 5HYIA 3ARFA 2FBJL 4O2FB 3WNLA 2CGRH 1U8HA 3K3QA 2ZPKL 3V6ZA 1FZKB 2NW3B 3QA3B 4ZSOB 4BKLA 5KW9H 4PRPA 2ADFL 1KLUA 2E9IA 2B1AH 1U95A 2VERN 2OP4L 2AJ3A 3VXNA 1P4IH 3VI4E 3MV7A 4XWOC 1A5FH 3B9KA 5BO1H 2HT3D 5DVOA 1BIIA 3I9GL 2X70A 2C1OA 5CZVH 3BIKA 1NLBH 1PLGL 1IAMA 1P7KA 3QDGA 4ODUB 4WFFE 3I02A 1D5IH 2CIKB 5FDWB 4ZXBA 1UH4A 3DRTA 43C9A 1CD9B 2P8MA 2K7PA 4JFED 3SKNA 1G7LA 5DTFB 5B3JF 4XMPL 5FCUL 2UV3A 5IB1A 1A3LH 3K7UA 3QJHB 5MP6H 4HBQA 1G1YA 1NGZB 1KTDB 5FA3B 3SDDD 4YX2H 4WEBH 1ZK9A 1ZHKB 3VGHA 2H9GA 5JPMB 4YK4B 4NNYB 4XNXH 4FQ1H 4Z6AT 3VGEA 5FA4B 1U6AL 4CU8A 5J0BA 2PETA 3IAQA 3DVNA 3CSYB 1Z5LB 1JYVA 3ARED 1GZPA 4H26B 1G7JA 2EEBA 1G7IA 3C87A 3W2DH 2X7LA 2GJ6B 1A4KA 4DK6A 2AJYH 3L3GB 1TZHB 4FQ2L 1U3HD 1U8MA 3KPSB 4LLDA 2V5RA 4NQEB 1YMME 2CLRA 5IJKA 3BEWA 3SCMD 1F11B 1W72L 5DD6B 1HIMH 2X4QB 4JDTL 1ZVYA 1IEBB 1K9TA 3MREA 3QI9B 2DAVA 4N1CA 1OWRM 4JN2A 5GRXG 3HG1A 3FRPG 4P23A 4MAYB 3HB3D 1HYRC 1K5NA 4X8JA 1AKJD 3C6LD 3J7HA 4MNQE 5C08B 4MA8L 3ZHKA 4R7DB 4LCWA 3IDXL 4OIIL 2J3SA 4ORGB 2BX5A 2BJML 4PR5A 4LGRB 2EDDA 1CDBA 3JWNC 4QHNB 1OTSD 1JBJA 1H5BC 5T1LA 1TJGL 5MEOA 1DQLH 1T03H 2J8UA 3MRPB 3P0YL 3MOBL 2L0DA 4L3CA 1CLZL 4H1LG 2A74B 1MF2L 1C5DB 4MB3A 1S9YB 5EUKA 2MPAH 2GSIA 3TZVA 3UTZA 3T04D 3RIFF 2E7LA 1SYSB 5EULV 4XCFH 4NO0A 2X9YA 4M4RA 3TBWB 2FJGA 4OFYA 1C7TA 2DQFA 1AE6H 3K8LA 2E6JA 5IQ7H 1G7HB 2BP3A 4WFED 4CL7A 1T5WA 2IBZY 3WIFA 1GAFH 2WBJA 3GBMH 3DV6B 3BVNA 1SM3H 5MENB 1AGBA 5IW6A 2EDOA 3DVGA 4UNUA 4PJEA 5MHSD 5ILTH 1FFOA 4R26H 4RFOH 5SX5K 2E7LC 4Y8DC 3LEVL 3OZ9L 4JKKA 5J7CC 4LHUG 3GMOB 4NCC1 3BUYB 4R90L 1JGDB 1EJOH 1ES0A 1FP5A 1VCAA 1MHPL 3BRDA 4PLJC 5K93A 3MFGB 3U0PB 4G43B 1SJEB 1SY6H 3VWKC 5HHQA 2MCPL 1NCCL 2NXYB 4W68A 4F58H 3CCHA 1JGVL 1S7SA 4MS8D 4L4VE 3VRIB 4P49A 3RGVC 2JLLA 1D9KA 2ZCKL 3FONA 3HE6B 1T20A 4JFQB 5HGDB 1JGEB 3FQXB 2JJVA 4R7NA 3UPRB 1NCUA 3L7EB 3RZWA 1U8QB 1MCNA 3KAAA 4WV1B 3FFCA 1ZS8A 4PRIE 3ZHLA 4W6YB 4H20L 3HR6A 3MLTA 3H7BA 3GMQB 1AHWC 3GDBA 4PJ8A 2VDKL 4GKSA 5C8JB 4PB9L 4S1QH 3P11L 4DGVH 2DMCA 1RI8A 1D9KC 1KJ3L 5JA8B 1F90L 4WO4B 4RISL 1VFBB 4BFIB 2CR3A 4JHBA 5DJXB 4P2YA 5ISZA 2DJ4A 3TIEB 3NBNA 2DQCH 3O9WD 1JPSL 3QDAA 2I07A 2Z0BA 4HAFA 4OI8A 4GG6F 1IZJA 3BMWA 1R5IB 4LEXH 3SGDI 4OFKA 1BAFL 2H32H 5D71L 1NCAH 4ZSOE 4QRPD 3FB8A 4M61B 4PBVC 4ZUTB 2BXYA 5C0GB 2FWOA 4POUB 4RA3A 4YDKH 3R1GL 5D8JH 3TF7C 2HRPL 5T3ZH 3ZYOA 4MHHI 5E7BA 2G2RA 3H0TB 1KCLA 1AD9B 4LLMB 3AS1A 1LDSA 1IQWH 1CIUA 3CH1B 2WIIB 5BOPA 5D1XB 1YN6B 3ZZ1A 3QUML 1N0XH 2PYEB 4HWEL 4YE4H 3RHWF 2Y9RT 2H2SC 1JWMA 3ULVC 4H8WC 4Y4HB 3HMWH 4XH2B 3RKDC 1JP5A 1Z2KA 5F7EL 1U0QA 4TULL 1NGQL 4YBQD 4HJGB 1WWBX 4N8PA 3T0WA 3LS5H 5E5RB 2W59A 3B8SA 5I75C 5E2TL 2BOCA 4BELD 2V2XB 1DQJB 1BM3L 1BD2D 5DR5H 4KQ4H 2OMBA 3TJEH 2YHGA 1S9WA 1XIWB 5HD8D 4K3JH 4DCQA 4X6EA 4ZO9A 2A77H 3GMNB 4KMTH 1YDPA 3MR9A 1FO0B 2HLFD 3O3BB 1TVBB 3HMXH 4MXQC 4PJXE 2WBWB 1DLHB 1CBVH 3RVXC 4YGVA 4KKBD 2GJ6E 3T0XA 5K59E 2EDKA 3LKRA 2DQHH 4LSVL 1TNMA 3EOBA 2H1PH 1KIQA 3EFFB 1Q0XL 4NQEE 1RPQA 3MOAL 2KQMA 1P2CB 1QSEE 2XA8H 3TNNA 1WGOA 4MA7L 4Z77B 1N2RB 4UIKH 4JEGB 2C4FT 4DTGH 5ALBL 2X1WL 2CK0H 3FN0H 1ORQB 2BOBA 1HINH 1WZMA 4ZUWB 2AK4D 2L7UA 3X3GH 1RJCA 1DEEB 1VEOA 3D3VB 4FS0A 4JFDD 3PG2A 5GS2H 3VDBA 3UYPA 1E27A 1RUQL 3OAZK 4HPYL 5IG7A 2AEPL 2UZYB 4EVNA 1RIHH 3EJYC 3VRJA 7CGTA 3S7GA 4IEFB 1DBKL 5J1SC 2X44D 5CEZH 3U7YL 5D7LD 4E5XB 3PHQB 4KZEH 1ZLWH 3T0EB 4OF0A 2NY6D 5DUBB 4EDXA 5FEBA 1RMFH 4WENB 3QCVH 4UNTA 3RA7H 4XVUD 4JQXC 1W0YT 2NY2C 3STZB 3KXFD 4ENED 3K2UL 3QIWD 5JHDA 3CLEL 5CIPH 5ETUB 3INUH 1KG0B 5AG9A 4LBEA 1KCKA 3U46B 4NWTL 1FRGH 2NXZD 2X9WA 3ZYJA 1EIBA 3D18B 2BNQE 1K4DB 4EDWH 4U1HA 5F3BB 5D1QB 4ZUUA 3QEHB 5MENE 4WI7A 4JO3L 1ED3A 3FFDB 3ULSA 4GAJL 2CDEB 4XNMB 5BXFB 1ZEAH 5E1AB 1V3JA 3ES6B 5TDOB 1MIMH 3D0LA 3CUPA 4PRHD 2X2YA 2DIAA 4QTIH 1N26A 2PNDA 4XPAL 1INEH 4YQXL 1MVUA 3TVMB 1JWSA 2BY2A 4HUUB 1J05A 2Z92A 3Q48A 4WWKD 1JZ7A 3U4BH 2H8PB 2FEDC 1I75A 2IC2A 3JWOH 2XA3A 5KAQF 4CUCA 1HQRB 3H42L 4GRMA 1Z6JT 3C8DA 2BHZA 3RFZC 4MNHB 1P84J 4BSVA 4NO5A 4WY7L 3OMZA 3G5ZA 3DXAE 4I0CC 2J1KA 4M6NL 4L4TE 2KKQA 1A2YA 4QRUB 1NDGA 1UB5B 3TV3L 4M03A 4N9OB 4KPHH 3GSRB 1MCWM 3O41A 1QFUL 1Z9OA 1PD6A 1ACYH 5B38A 2X4UB 4W4OA 1BMGA 2R0ZH 3EYUH 1R0AH 1YEJL 2XXMB 3KLHD 4JFXA 2E5EA 2R2BB 4I0KA 1K8DA 5FGCB 1MNUL 4IMKA 2HT3C 3SDDA 3PGCA 3ILPB 1WSST 4M48H 3GGWA 4Z0BL 1MCJA 2VMFA 3LN4B 4M7KL 5EU6D 1WT5A 5F6HI 3HLAB 3DX8B 3REVB 3NCJL 2HFFA 3QIBD 5JXEC 1QBAA 4PJHB 4YWGL 4P4KC 4W4OC 1S8DA 2PYEE 4RQQA 1DZBA 1D5MA 3FQNA 1FIGH 3AREA 5JIIA 3BE1L 4NQVB 1Z9SA 2XN9A 3QUZA 3S9DB 2HTKC 4TNVF 4U2ZA 3ZSSA 1TPXB 4HKXA 1G1CA 5JDSA 1GHFH 4NYLA 4G5ZL 1U3HA 4OLUL 1ZVHA 5INCA 1MAML 3TGXA 4YPJA 5I1KL 3DO3A 4XB8A 2V9RA 3SCMA 3F58H 1ITBB 4QXTB 2ICEB 4RMVA 2CD0A 3QUZC 3BDYL 1DBML 3DRQA 1JL8A 5EZOH 3PXJA 4ELMA 1YNTB 3WSQH 1OAKL 4JAMB 1D5XB 3TEUA 3UO1H 2Z31C 3Q1SH 3LSOB 3TWCH 1MFAL 2AXJA 4U1SA 2JB6A 4OGXL 3Q5OA 1EMTL 2FGWH 4M9OA 3NMEA 1AP2B 1LNUB 1AKJA 1NCNA 1B4RA 4D0DB 3HUJF 2HMID 4I3SH 5IVZA 1NUDA 3ARXA 4L5FL 2DM3A 5ADOH 3C6SB 2NY7H 1P84K 1N6QL 4EN3B 4NZRL 4G80B 3LIZH 4HWZA 3MRRA 4KI5D 3B2UC 1N3NA 5E2WL 5DS8A 4NJ9L 4XX1G 4KZDH 2GK2A 2ITCB 3A6BH 1T22A 2JTDA 4OF8A 4DZBB 2VZSA 5F9DC 1T83C 5M94B 1AGEA 5I1LB 4AM0B 4P59H 4JPVL 1RIVH 2R0WH 5KSBF 1QLRA 1EEZB 2OQJB 2PYFB 4RCAA 4G8FA 1CU4L 2V5TA 3GKZA 1XCQA 1E6OL 1TETH 4Z7WB 3KDMB 3QEQD 1VFUA 3K4DA 4PP1C 5J13B 4WJ5A 1OAZL 5EN2A 4YFLI 4NRZB 3RAJL 4PJDB 4JFEE 4PY8I 4ZFFA 3RVUC 4LLVA 2A83A 5DHVA 3KPOB 1UWGL 3UTPD 3U79A 1H8OA 1FNGB 1KNOB 1ZV5A 4YBHA 3RWIA 5L88L 4KU1A 1FSKB 1CFSB 4M4PA 4NHUB 5CP3A 5IMOB 4GAFB 5GIRB 3NPSB 3O3AA 4XI5C 1SEBB 4FQXC 1A6AA 5DJAB 2V2TB 2VDOL 1UJ3C 4X6CF 4NZDA 4RAUB 5EC2B 2SEBA 5CJBA 1IAKA 3V2AR 3A67L 1NGPL 3AU1A 1ZLVH 1NCDH 4OLVH 2XI9A 3PE9A 3ECBA 4F33B 4P5TB 4RMRA 3BPNC 4LPVA 2YD5A 3BUTA 1JN6A 6CGTA 3DROA 2E6PA 5EU3A 2MKWA 2GCYB 2MWCA 1CXEA 3RJDA 5C7XL 5EU5B 5EDXA 4FZ8L 5FUOH 1S9VA 5IMMA 4KWUA 1ZA6A 1UZ6E 5AD0A 5BVPL 4XVTL 1IM3A 3O9WA 3T77A 4XPGL 3V7AE 4PJIB 5C6PB 2BVOB 4M6OH 4X99B 4JRXD 5I8KH 3RWHB 1MFBL 3O2DL 4QRPA 4GW1A 1QKZL 4U1GB 4OF3A 3ZYZA 4JO2L 3CZFA 4Q9BA 1W0VB 2B2XH 5K9JL 2IG2L 3CMOL 4JFPA 1KLGA 3T3MF 4D9LH 4IRSD 1QPXA 1OF2A 1KJ2B 5HPOA 4POZD 4FNLL 3C09B 4U3XA 2IGFH 2VB5A 3BKJL 3LRGA 3HNVL 3CLFH 3LKNA 1UKSA 3ZE2E 1W72A 4IRZL 4KI1A 3PV6A 1EX0A 3QQ4B 3CXDH 3N06B 4J12A 4F37F 1KEGH 1CK0H 1VHPA 1RJLB 3HN3A 3SE9L 1BJMA 4H0GA 3QBTB 5GISL 3FO2A 1I9JL 2GY5A 2CRZA 1PEZA 2VDLH 2C3WA 3A6CH 3DX9A 3MRBA 3QCTL 3N0PB 3SDYL 3TJHD 4F15B 1MFEL 2VQ1A 5I73C 1BD2A 4GQPH 4GKZA 4B41A 4JRYE 4PJHE 4FTVD 5D6DC 5I1IH 1T7YA 5KZCD 2BVEA 3F7YB 3MXWH 4HXAH 2F53E 3I85A 4C4KO 1WVZA 1YEEH 2F8OA 4ZYKA 4Z7OE 1FVCA 3EYSH 4XPHH 4CVZA 2GJZA 5D1ZD 2AP2A 5HI5C 3LV3B 4PJ9B 4LCCB 4QT5B 3H3KA 5C09D 4I0PB 1BVKA 5JO5B 3VH8A 2OJEA 1I7RB 5TPWL 4FG6D 1FCGA 3OJDA 4CADA 4N8VB 3PWNB 2YPVH 4M1GH 3NFSH 1HXMA 4NKOA 4ZTOL 1RUKL 3EO1A 2AK4A 4JFDA 1HYSC 5DD5L 5I1HH 4Q2ZB 3IDYB 4F7CB 1TJHL 5GGQL 2FB4H 1EO8L 5IM7B 1OP5H 4KK9D 2D7NA 1UXSB 2ZOKB 4OZFA 5D7LA 4WFGE 3KGRA 2MQ3A 5DZOA 4N8CH 2FO1A 1MEXH 5L2KE 3DV4A 5HXMA 3TESA 2YD3A 5CCKH 3BN3B 4Y4KB 4PV8B 5JORA 3KXFA 2FD6L 1U36A 3QAZB 3KYNB 1RZGB 2W0KA 1CS6A 2W60B 3VD4A 2I60H 4E0RB 3B9VA 3KS0H 4KQ3L 4XNQA 1B4JL 2Y5EA 3RKPA 3MGTA 3VXSB 4ZFZA 3UZEA 1BF8A 4HUMB 5JW5B 4O02L 4G3YL 5HHPB 3HZKB 4XZUA 4JCMA 3C5JA 4DEPC 4X4ME 5E99H 1F5WA 2Y1VA 1ZGLA 4IMLA 2X4SB 4F57H 4LSRH 4Z7WE 5MEQA 1WWAX 4ODVH 4PRNA 3OKMA 2YR3A 4BH8A 1XF5A 2NW2A 1RK1B 2MCG1 1WITA 2WIMA 5C6TL 3QIUD 3T8XA 5A2IH 2P45B 1GPOH 1CXFA 1I7ZA 3PIQB 2BY1A 1OQXA 4L8DB 5JOEA 3SDXA 4OM1L 1I1RA 4F7PA 3UPCA 4HWBL 4IOIA 3CZJA 4JRWA 1TVHB 2C4XA 2J6EH 3QUMA 5E94B 5L6YL 4WVRA 1CDYA 4PJCB 1AY1L 1RJZA 1FH5H 4L4JA 3FZUD 4MX7A 2VZUA 1NGXA 3OKOA 2D7QA 4X6DB 4BSWA 3PDOA 3QFDB 4KJWD 3X13B 1Z0MA 4R97C 4X98A 4LSTL 1S9XB 4Z78A 1FAIH 3FO9A 4PGEB 3F5WA 2MQ0A 3QPQC 4PJIE 3S36L 1MCDA 5FHBL 3MJ9L 3B6SB 1LE9A 2HVJB 2YBRA 2LE9A 1BX2B 5A40E 1K6QL 2VLLB 4OI9A 3RHWK 4KRLB 2WQRA 1YY9D 4JG1H 4KVCH 1ORSA 4J3SA 4NSKA 3SKMB 4KRPC 4N5UA 3VWJC 5IFHL 4LRNH 5CJOH 3I75B 2IQ9H 4O2CB 5B3NA 5EU6A 1P5UA 5L9DL 3HHRB 4LEOB 4NP4H 2KPNA 4OFIA 1EXUB 1QLEL 3SGDH 4CJ1A 3QIBA 2G9HB 3EBAA 5DJ0A 1S5HB 3RWEA 5JNYA 2VKXA 4XP5L 4XXDB 4KK6D 1L4IA 3LHPL 1MH5A 1X5YA 2XKNA 1GGCL 4N0UB 4XGZA 5IB2B 3IJHA 5CJQL 4G7VL 2VL4A 3DO7B 2ARJB 5EUOA 4A6YL 2ADGB 3MBXH 4PTUA 1CT8B 3MV11 2PXYB 3E6HB 5KANG 5I17A 3QO0A 4ETYA 3MOQA 1AI1L 2F54B 4LHUD 5D5MA 15C8H 1GVIA 3KPLB 5C08D 4OGAC 3OG4B 3EOTL 4NUGL 4FFWC 3OKDB 4JHWL 1RUMH 4KJYB 3BGFC 4BUHA 4WCYL 1UJTA 4NO2A 2DJSA 4OLWL 1AXIB 2W0FB 2P5WD 2WINB 1A9EA 1YUHA 2EKJA 2ICWB 2VAJA 3QXAA 4XVSL 5ANMA 4PRHE 3ARGB 1VGEL 2F74B 4HIXH 4BM7A 2YA2A 3QH3A 1IKNA 1FHGA 1LILA 4FHBD 1MIEH 4M93B 4DGIH 1B2WH 3QQ9C 4UB0L 3TPUB 1F8TL 1EFQA 1IKFL 3S88H 1NH6A 1OAUH 5DK2A 4OCRH 3H9HA 3KYOB 1MCQA 3P3YA 5DJ8A 2A1WL 4NFCA 4UQ3B 1X5GA 3EKCA 3DURB 3MNWA 1OOAA 4YFLF 3EHBC 4JFHE 1A6ZA 4PJGA 1KPUB 4G7YL 4JANB 3WDHA 4KDVA 3IVKA 2AK1L 4NZTH 4K71B 4MJ2A 1PGRB 1Q9LB 2NXYD 2X1QA 3MUGB 3P2TA 2AV7B 1JGUH 3QEQA 3RDTB 1FNFA 3C5SB 1IGYA 4LK4A 1T7WA 3HE6D 1A64A 1J0HA 3CVIL 4GAYB 1CZ8L 1N6UA 5DC0A 3PHOA 4WW2B 1DUYA 4UTBH 4DOHE 4P3CH 5KVFH 1YN7A 3MRHA 3RWJA 4PP2A 1H3GA 1P7QB 3IT8D 1YNLL 2Z93A 3MUJA 5AG8A 2I5YH 4PJAF 4QHMB 4FFZL 3B4NA 3MSPA 5E8NB 4Z7VA 1ZANH 4F7TB 3X12A 5HVWA 3VXSE 3G6AB 3MRLB 3NCCB 4JY5H 4K9EC 4JHZA 3L9RA 1YPZF 5EG6C 5FYJL 1QACA 3UROR 4ONHB 4NGHH 1I1YA 4KY1H 2VITA 4OZHB 2BSTA 5T1DH 2X6MA 2ORBH 3DGCR 4UQ2A 2OL3L 1T4KB 2D7PA 2H32B 1YEDB 5TFSH 4GLRI 1J7VR 3O6KH 5TDNB 2I24N 4M1CD 1JHKH 1J8HE 4YNYB 1J0YA 2IH1A 1BZ7A 1HOCA 4OSUL 5DSCA 1Q9WB 1IFHL 3IJSB 2VLJA 2FO4A 3PWVB 3L5IA 1G6VK 3LMJL 1BF2A 1IC7H 1ZT7A 5GGSB 2P5EA 5D1XD 4LIQH 3C2SA 4O9HL 4PJ7A 3NFPB 5T5NG 1UA6L 4LGPB 5TGBA 4JRXA 3DTXB 3UTSB 2R2CA 1IAII 4PRAA 1RZ8A 4N0CD 2UWEE 1T5XB 4HG4J 4QHLA 3L5JA 4QRRD 4OM0H 3PV7A 2NY4B 5DHYA 3MRMA 4AJ0A 4HS3A 3ULVH 25C8H 4TTGA 3F12A 1AXTL 4X6DE 4IRSA 4MJ5B 3VFGL 3O6ML 4TSAH 3OJ2C 4F80A 32C2A 5DDHA 4NNXB 5KS9F 2BZDA 3LN5A 5GRVL 3QUKA 5EPMA 1KCUH 2W0PA 1ZT1A 4P3WA 1XIWD 1VB9A 3TYFB 4NC0B 5L0QB 2AJVH 5EBWA 5I16B 2V2WA 1PG7L 1RJYB 4FQQB 4P4RB 5CSGA 5TF1L 3U4AA 1UGNA 5I8CA 2J4WH 1JUFA 2C1PB 1WQVT 3VCLB 4F2MA 5F9WB 5HGGS 3CSGA 1NEUA 3O3DB 5J11B 1XGUB 4J3UA 3NFNA 4FTVA 5K9QG 2DTML 2DM4A 4MDJB 3CFBB 2A73B 4DUWA 1I9IH 4HUNB 1G6RB 5IBLC 5J6HB 1FFQA 3VD7A 1DL7H 5I1CH 2H45A 3LQAL 2ENSA 1IGCH 5D7IA 2VDQH 2FX8L 4R0LC 5D72L 5DD1L 1BBJB 4FXGA 4NQCB 4CVXA 3TNMB 3P0GB 5GRVK 5DXWA 5D9SB 3D3VD 5D1ZA 4FQCH 1BEYH 1R3JA 3MROA 5I18L 1L0YA 3GJFK 5C0DA 4XAKD 3SKJL 4KTEH 4UI2A 4CRPA 3TCXA 4CMHB 4F7EB 4OZGF 1NDMB 1KEML 1QSZA 2VL5B 2FHFA 4DW2L 5DMKA 2VRAA 5EOTA 4YDIL 4TUJA 5D70H 5CIPB 1KTLA 1D5ZB 4XCEA 5L8LB 2QJDA 1UT9A 3EO9H 4Y16A 4H25B 1Q72H 1X5JA 4EKXA 5ITFA 2EIZB 3BI9X 5DMGC 2R2EB 5LAXA 3VFUB 4HZAA 1QBLL 4HG4K 5IV2B 2EIDA 3BHBA 1ETZB 3O0RL 5FYJD 4HFWB 1DUZB 1WAAA 4UDTA 5GJSL 1A4JB 1FNEB 4Y16C 43CAA 1Y0LB 4JM2D 3M17B 2DBLL 1RZ7H 2QADB 1FC1A 4RBPK 3S96A 3QWOB 5DEFA 1IGJA 1J88A 4WFHE 3QHFL 3BKCL 4YHNB 4HH9A 4O58L 2EYSA 5F1OB 3RWDB 3W39B 1U58B 1CN4A 1CLOH 4M6MH 5F7LB 5KN5A 4PJFF 1EV2E 4S1DC 4N68A 1LEIB 5ICZA 3QIUA 3AUVA 2NW3A 5HYSG 1KXTB 3P4OA 4PBWD 3IAPA 4ZPVA 3DUUB 3O2DA 1R24B 5ID0B 4M9PA 1OAQL 4LVEA 5DJ2B 5F44A 5EZIL 1FN4A 1PQZB 1DN0B 3MLUH 4MVBC 2RHEA 3DMMC 4BQBA 5JA9A 1MLCA 4JN1H 4YDJB 3CH8A 3I6GB 2BXZA 5FHAL 3W9EB 1CDUA 5J57B 4LKCB 1B0RB 4K23H 3MMEB 4LSPH 5FDWA 5IK3B 1AGCB 5I9QB 3IYLW 3EGSB 3PDDA 4HKZB 5GGUB 3KPMB 4GUPB 3F7VB 5DTFA 2YXMA 5GRJL 1NEZG 4KROB 2QR0B 1V7MH 1YNKL 3F7QA 3FJTA 5J1AB 1OQOA 2RCSL 1W2KT 1L0XA 3CFCH 4XCNB 4NPYB 4BQ6A 4J3WA 1RVFH 4MDIB 5DD0L 1U91A 3NA9H 1BWWA 3T1FB 1XR8A 5C09E 1JPGB 2WANA 3S35X 3WXWL 4KV5F 4NNYA 5C0AD 2QBWA 1KFAL 4OGZA 3NVQA 5E6YA 1XGTB 2HWZL 2NY3C 1QFOA 4M5YH 1FBIH 4NKDA 4M7LL 3CSYA 1Z5LA 4PJ5B 5LCVL 3UTSE 1WZ1H 4MXVE 2YRPA 2EKSA 4H26A 2EDJA 2QQQA 3HKFA 4JPWH 3ZE0F 3FB7B 5FYJU 4E42B 2EZ0D 2EC8A 2EO1A 1TZHA 1TQBC 4ZS6D 1KJ2L 1NBYB 3KPSA 1JZ8A 2HTLC 2CLZB 1A47A 1YECL 4RGNB 2GW5A 3ROOB 3D39E 1IL1B 5L7XL 2ZJSL 4D9RD 4V1DB 2DQDH 4ZOBA 1G9ML 1P6AB 2IFGA 4BQCA 5C0RH 2ZKHL 1CCZA 2B20A 2RB8A 3Q6FB 2EE9A 3GZKA 5B3JE 1UCBH 1D5BB 1O7VA 4LHUA 3PL6D 4ZD3H 1X5AA 1R3KB 3HNTH 2B39A 5C08A 4HCRL 5HYJD 3RI5K 3QI9C 4PJBB 1N5YH 4QHNA 1T0NA 4EN3D 3KPQA 4X9FA 3QPXL 3JWDL 3OBAA 4QXUH 2ERJB 4MAYC 2FLBT 2P5WA 2D31B 3V6OE 4D0BA 3MYZA 1S9YA 2OK0H 3G6JF 3WIIL 4L8SC 4E41B 5I1EH 5LJYH 4Q9QL 4CVUA 1SYSA 3GSWA 5DUML 5TH2B 5TE6H 2UZIH 1S5IH 3OPZH 4JB9L 5GZOC 5EA0L 3TBWA 4DN4H 1BQHB 4MZ2A 3D2UB 3MRKB 1GGIL 1G7HA 5D6CB 1I9RL 2O26U 3GRWL 4IDLA 5E8OB 1WC7A 4X5WB 1UEMA 1U8IA 3JTSA 1MJUH 2P7TB 3DV6A 2Q3ZA 3ALPA 4R8WH 2FSEB 2XTJE 1R5WB 3DETD 5ACMA 3BRGC 2O61B 3PGDB 3DARA 3MBEB 1TTFA 3NIDE 3SGKA 5F6IC 1KELL 2IPKA 4RMQA 4HEPG 3U0PA 4KDWA 4G6JL 3ZDZF 1KENH 4KTYA 5FV2A 2VH5L 1NFDA 2BHUA 3IXAB 1OAXH 3VW3L 5H94B 2XOTA 4YLQT 3HE6A 3TT1H 3IU3B 2I27N 2ZCLH 3FQXA 1JV5B 3TFKD 1KCSH 4HWBA 4EIGB 1KB9J 4L1DA 1U8QA 4KTDH 2XRAH 5DMIH 2Z9TA 1Z9LA 2W07A 3MRJB 4WV1A 4OV6F 3F65A 5IVNA 2XQBH 1LEKB 5JZ7D 3GMQA 1ZHLB 5C8JA 1M6OA 3PQYB 1UZ8B 5IT2H 1JHTA 1LO5B 2X4RA 2X1OA 4NRXB 3TM6A 3VXMD 1VFBA 5FGSA 3RVWC 4BFIA 5GRYA 2BVTA 3KPTA 2BDNH 2CGRL 5BS0D 4PRDB 2UYLA 1EGJH 5B21A 4BFEA 4YPGA 1RZFH 1OTTC 2JCCF 2JJUA 3MJ9A 2B1AL 4AQOA 5AWNH 4M61A 1P4IL 3LAFA 3GO1H 3IRPX 1A5FL 2EC9T 3OXSB 4YHPB 5BO1L 2R56H 3MZTA 4WO4C 2LAGB 1KIRA 5CZVL 1AD9A 1NLBL 3O45A 1G0XA 3TBYB 3BXNB 3CH1A 3OB0K 1D5IL 2YD1A 5D1XA 1W0WB 4NO3A 4ZFOL 5DRZB 1A3LL 4XH2A 5MP6L 4JLRB 4UOJA 4YX2L 1LE5B 4WEBL 1TVDA 4QRRA 1XAUA 3LQZB 4FXKA 1NGWA 3ZKMD 3ARBB 3H9SB 3OV6A 3CK0H 4K94C 1DANT 5F8RC 5HYEA 4XNXL 4FQ1L 4A6YA 4S0SD 1U92A 5EO0A 2V2XA 1MQ8A 2H6PB 4Y4HC 1XIWA 4WTZG 4N0CC 2XT1B 4HIHB 3W2DL 3QFJD 4PJ5E 2AJYL 1TVBA 4EXKA 4GG6E 3VG0H 3F62A 5SWSE 4ZNEA 4XNYH 5GSRB 1OW0A 3W11C 1T1ZB 3QXVA 1JPST 3VXUD 1LMKA 4WRLA 5FXCH 3O6FD 4XBEL 1HIML 1MCOH 4HBCH 4PV9B 2V6HA 1UWEH 1ROWA 5MI0B 4V1DE 4B50A 1BFTA 3T2PA 3EYFB 4TUOB 5IR1A 4UT9H 1VDGA 3RVTD 4FMFA 4JQIH 1OW0C 5LXGH 4ZUWA 3RY6C 1GGTA 1DEEA 2EDWA 3D3VA 2R1XB 3HZMA 3BJ91 3EFDH 2X4NB 4IRJB 5IROC 1KN2H 4PLKC 2MQCA 4J2XA 2HVKB 1A0QH 2J5LB 3IKCB 4ONFH 2J88H 4CKVX 1DQLL 3U1SH 1T03L 2BVQB 3TA3D 2YPLE 2Z8RA 5C0BB 3PHQA 3OAUH 1Z3GH 3T0EA 3ZKXC 4LCIH 2MPAL 5CJ8A 4W6XB 5I71B 3V0VB 4Y4KD 3ARRA 1GGYA 4JGUA 3STZA 3S3SA 4XCFL 4EI5B 4E41E 2W91A 1AE6L 1NAMA 2Z4QB 5IQ7L 1DFBH 4ORZC 5JPNB 4J3XA 4ZOAA 3KJ4B 1EVTC 3GSOB 3VI4F 2RQ8A 2VAAA 3HUJB 1GAFL 5GSVA 3GBML 2XG5A 3T0EC 1SM3L 2X41A 3C60D 5ILTL 3HPJA 1UKTA 4NC1E 4NHCH 1QFWM 5F3BA 4HUVB 4R26L 4RFOL 3HTLX 4TRPH 1FORH 2CXKA 3O3EA 4P2QB 1OT2A 3QP3A 4JM2A 5DJZB 1EJOL 3FFDA 1F4WH 1Q94B 2OL3A 3OAYH 1I8LC 2DWEB 5BXFA 5ESQB 3ILQD 5IHBA 5E1AA 4BUGA 1SY6L 3ES6A 3E6FB 5TDOA 4F58L 3N1QC 2QL1A 1NC4B 1OB1A 2R8SH 4LASL 1ZVSA 1MLBB 3LVEA 4G6KH 5D1QC 4HF5H 3HC0B 5KSBB 3TN0D 4HUUA 3VG9B 1JTTA 4POYA 4PY7A 5IEKB 2H8PA 4OCLC 1KPRB 5E8EB 4Q58C 3W9DB 5T1KB 3P4NB 1W8NA 5F89B 1HEZB 1HQRA 1CG9B 2EEAA 1YEHH 2HT4D 3ULUF 4S1QL 3G5VB 4A2LA 4DGVL 1YEFH 3C5ZD 4YZFF 3TVMC 3PQYE 3K2MC 4JDVB 3UTOA 1TFHA 3RNQB 1UB5A 5IWLC 3QULA 5DO2C 5C0FB 2DQCL 4PG2C 1X5IA 3GSRA 4WI3A 2FHBA 3K1DA 3WUWG 4J1UA 3TBVB 4KKLC 4LEXL 1UWXH 4RWHA 1NCAL 1WTLA 1WFTA 4OD2B 4X6CB 2X4UA 4LQFH 4YDKL 5D8JL 3BT2H 5T3ZL 3O2VH 1JIBA 5E5MB 1IQWL 4KHTH 3KPRD 3ZL4H 4XC3H 2FJHA 1N0XL 4JREB 1J8KA 4YE4L 1T1XB 3MA9H 3NABH 4GLRH 2VLKE 3DX8A 1IMHC 5E8DH 5I30H 1U3ZA 3HMWL 1AR1C 4PG9B 1HSAB 3WDJA 2YRZA 4NQVA 2WWKO 1FZOB 3S98A 3LS5L 4JR9H 5DJCA 3RWCB 4MB4A 5FO8A 5D2NB 3SE3A 1XF1A 4U4BA 4YXKH 2NMSA 5DR5L 1AC6A 1DBBH 2PXYD 4RMWA 3TJEL 4BZYA 1XFPA 1J1PH 2DD8H 4I3RH 5DRXA 2F54D 5GGVH 1IAIH 4EOWH 2JJTC 4K3JL 3ZTJH 3ZT5A 3QDMB 2A77L 4KMTL 4QXTA 4L8CB 2NR6C 3HMXL 2WSKA 1ODAA 1CBVL 4M6AA 4X0KB 4TUKH 1TPXC 1YNTA 1MCPH 4Q6YA 4JG0H 2DQHL 4XPTH 1S7WB 1H5BB 1U8OB 2E7MA 3DX6A 2Z91B 4JFOB 3DPBA 2H1PL 3LSOA 1BOGA 4HDIA 3PL6A 3VD5A 5ESVB 2P24B 3SDAD 2YA0A 2XA8L 4KK5C 5CLTA 5D7KE 4NQXB 4UIKL 5HYJA 5H35A 4KHXH 5GGSY 3IDJB 3C6SA 3L5WB 2CK0L 5CSBA 2DLTA 3FN0L 4EN3A 3L3KB 4RMUA 5E2VH 4G80A 5IEHB 3X3GL 4Q6IA 3PGFH 2EYRB 1A7OH 2ITCA 2UVFA 1RIHL 3KLSA 4PS4H 4OLEA 1J0IA 1BJ1H 5CEZL 3PP3K 4KZEL 1EEZA 2OQJA 2NY1D 4NWUH 1P4LB 2DLFH 1HK6A 3RNKB 3V8CA 2FHCA 5C0BE 1RMFL 3QCVL 3RA7L 1DJSA 5CGTA 3KDMA 2PW2B 4U6YA 3GUTB 4F9PC 2XWJB 2VLRB 3TYGH 1NMCC 4NUJA 4PJDA 4Y88A 2IAND 3INUL 5BQ7A 3MRFB 1KN4H 4I4WB 4NQDD 3BPOB 4Q0XH 1KACB 4O51B 3NCYS 4W4NA 1FNGA 1A7QH 5SWZD 3FQUB 3RRQA 3HUJE 5IMOA 4EDWL 4L8BB 3MA7A 2VDPH 1S7RA 1CGSH 5C0AE 2DB8A 4RFEB 4GRLD 5DJAA 5J13C 3TPKA 4K9EH 2P1YA 4Y1AB 5FOBB 3SBWC 2NY0B 1X5HA 3C08H 3ARPA 3T4YA 1PZ5B 1ZEAL 2J8UF 4HGKC 4RMTA 1MIML 2O5ZH 3V5KA 4QTIL 2HYMA 1FSKC 4WUUE 1INEL 3NPSC 4XX1E 5T3ZD 4QRTB 4XBPA 5AUMA 1TMCB 2H41A 3U4BL 5IFAH 2GCYA 3VXMA 4CGTA 3JWOL 3SE4A 3L6FB 5DLMH 5BS0A 1UM6H 4QCIB 5HGAA 2BVOA 4PJEF 4X99A 1KJVB 4PJXF 3RWHA 4G6FB 1A1NB 4P5TC 4AH2B 5FYKD 1VPOH 1GH7A 3WE6A 4KPHL 4U1KB 1IAOB 1G7QB 4NDMA 3VXTB 3OR6B 5EBLB 4J4PD 4NC2B 4PUBH 1Q1JH 2ESVB 3BGAA 3UTTD 4LFHG 5C2BH 4CNIA 2IPUK 2QSQA 5CP7A 3V52H 2R0ZL 3EYUL 1R0AL 3W0WD 4U1GC 1QR1A 3QQ4A 2EIBA 3MRGB 1NBQA 2UUDK 3MV8D 4M5ZL 3VFNB 3QUXC 4M48L 5LWYH 5IW1B 2WLYA 1D6VH 2DM7A 3HR5B 5JQ6L 5F7DB 1RSFA 3FOLB 3AB0C 3MLZH 1FIGL 4HCRA 1JNNH 3WD5H 3CPLA 3S3JA 1G9MC 5IMLB 2ATKB 5C70A 3F7YA 1GHFL 4ZOEA 5ICYB 3EIFA 5DT1H 5GS2D 2VE6A 3BP5A 3T2OA 4NQCD 1T1YB 1A8JH 2VDMH 3V5HB 3VXUA 5D2NE 2OTWB 3LV3A 4DQOH 3O6FA 3F58L 3KVQA 1LEGB 3KPPB 4PGBA 4FP8H 1Y18B 4GBXD 1VEPA 4QT5A 1B0GB 1XF2B 3T3ME 4I0PA 4ZUVA 5JO5A 4XMKH 1I7RA 5EZOL 1AJ7H 1C5CH 2A6DA 1LO0H 4LOUD 3GRWA 3WSQL 3MRCB 3C8HA 4ZO6A 2CLVA 3O11A 4MD4B 4JPIB 3UO1L 3Q1SL 3TWCL 5HDLA 3STLB 4MQ7B 1F4XH 4NQSB 4G6AD 2FGWL 2MHAB 3CX2A 2UVEA 3DVIA 1NFIA 4JZJB 3QG7H 4I3SL 4Y0GA 4PJ9C 5CILH 3BDBA 3GI9H 3OQ3B 4LCCC 1OPGH 5LQBH 4AMKH 4F7CA 4I0PC 5ADOL 2NY7L 3STBA 3P73B 4HS6B 5FGBA 4C83B 5IM7A 4K8RC 5FYKU 2ZOKA 3TA3A 1DBAH 3X11B 4QHUB 1TJIH 1HHKA 4U1IA 1NBZB 4KZDL 3V0WH 5B8CA 4Y4KA 3ZKND 4UMGA 3TBSB 4PV8A 3EOAB 1A21A 3IDYC 3B8YA 4P59L 3KYNA 5F9AC 1D6EB 1RIVL 3BP6B 3V4UH 1RZGA 2WW8A 1I8KB 5I8EA 2R0WL 4E0RA 5D7JC 1ZWIA 3LPFA 5GZND 5J3HD 2E8YA 1RZKC 1M7IA 5LG1A 5DI8B 3RVVD 5JW5A 1TETL 1EEYA 3VA2C 5HHPA 3RZCD 3HZKA 1I1AB 2K3TA 3C60A 2Q1EA 3CDCA 2M26A 2Y5TB 3U9UB 1MI5B 2F5AH 4MJ6B 4LVNC 4FABH 2E9JA 4JY4B 1MSPA 2VLRE 3QAZC 4N0FB 3GMPB 1NC2B 1CL7L 1RK1A 2F5BH 3KNBB 3RGHA 5TDPB 5D2LB 4MA1B 1LQSR 1T3FB 1TITA 3PIQA 3QHTC 5HHME 3RTQB 3HFMH 3QCUH 3U6RA 5BZDB 2FLRT 2GEEA 4L8DA 3TN0A 4F7MB 4X4YB 2VOTA 4U3CA 1FAKT 4NM4H 3QEUB 5INDA 1IC4H 1QG3A 1KOAA 1TVHA 4YDVA 5ADPH 4Y1AE 2HJKA 2JJSA 5E94A 2OJZH 2IQAB 2X4OB 2A6KB 1CLYH 3QFJE 1NCDL 4PJCA 4OLVL 4ZFOA 2DKSA 3OGCA 2DQGH 4I9WD 3BH8A 3S97C 2P49B 3VMNA 3C5ZA 1XEDA 3D25B 4TTDD 1WBZB 2DMBA 1I4FB 5C07B 4CBPA 2X4PB 4PJAB 4AEIH 5FUOL 1XT5A 1IARB 3CFEB 3X13A 4I8DA 1S9XA 1YPZB 2EYTB 5E9DD 5LGJB 3V6FB 4M6OL 4F8QA 4PGEA 5I8KL 3C9NA 3W81A 1OGTA 1G9NH 1BQLH 4HWUA 3B6SA 1KIPB 2HVJA 1U8PA 1URLA 4MLSA 2AV1B 4G8IA 4ODXB 2B2XL 1HHHB 2DI7A 4D9LL 7FABH 3IFPB 2QKIA 3KPRA 4KUZH 4KK8D 1ZLVK 4Y5XA 2IGFL 4MMZC 1TCMA 4O2CA 4BYHA 4ZDHB 4EI6A 4IBLT 3KJ6H 3CLFL 4LEOA 2ESVE 2A6JB 1AQKH 2F58H 4LLWB 4RGND 4Y5VB 3CXDL 1S5HA 5IB3B 1KEGL 3BP4B 3H9ZA 4XXDA 3KPNA 1CK0L 2HH0H 4HMCA 4OV5A 1GOHA 1T21B 3VGDA 4N0UA 5IB2A 3S3PA 2VDLL 2WBKA 3A6CL 2VQUA 3P9LA 4YHIB 1SQ2N 4HLZH