2YKMB

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with a difluoromethylbenzoxazole (dfmb) pyrimidine thioether derivative, a non-nucleoside rt inhibitor (nnrti)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
427
structure length
410
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
publication title Difluoromethylbenzoxazole Pyrimidine Thioether Derivatives: A Novel Class of Potent Non-Nucleoside HIV-1 Reverse Transcriptase Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase
total genus 103
structure length 410
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2ykmB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ykmB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ykmB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ykmB03
5KT4A 3IS9A 2DPIA 5KFGA 3IGVA 3MEEA 4RW4B 4Q45A 3I0SA 4NZ0A 1S6QB 1T05A 3LP2B 1QAJA 3M9MB 2W9BB 2W8KA 4G3IA 1N5YB 4NLTA 2J6TA 1C0TA 5KFHA 2WTFA 1JLFA 1ZTWA 4NLYA 1HYSA 1R0AB 3OL7A 4FS2A 3VQSA 3BSCA 3ITHA 4O44B 1HQUA 2HWIA 1EP4A 1RT4A 4RNHA 4O3PA 5KFQA 4J9KA 4URQU 3M9OB 3KJVA 3V6DB 3QIPB 4YR0A 4RW6A 3RBDA 1HMVB 5I3UB 2W9CB 2WONB 3LP1B 4RU9A 3KHGA 3C6UA 4Y2CA 1S10A 1C1BA 4WXWA 1RT2A 2XGQA 3GIIA 2OPSB 4PUOA 4MH8A 3MECB 5F9LA 4TYAA 4R5PB 3HVTA 3PZPA 2C2RA 3JYTA 1RTHB 4JV2A 5FDLB 2FJWA 3IG1B 3JSMA 4EYIB 3LAKA 3LP0A 2FJXA 3MR2A 3G6YA 1RT7B 2F8EX 4KHMA 1S1UB 2E9TA 1DTQB 1RTDA 3BQ2A 1ZTTA 3T5KA 4YP3A 2OPPA 4ZVEA 3NL0A 4QW9A 5L1JA 1OS5A 2UVUA 5DQHA 1WNEA 1S1VB 5KFCA 4H4OB 5HLFA 4ICLA 3DRSB 1FK9B 4FBUA 2I5JB 5KFRA 1VRTB 2YNGB 4IH6A 4H4MB 4ED8A 3RB3A 1S9FA 4DG1A 1HNVA 4NRTA 4ZP7A 2DPJA 3KLHA 5KFUA 1JIHA 3HVWA 5KFTA 4ED6A 4ED0A 3DOLA 4ZP6A 4IH7A 4MK9A 3KMSA 2VG7A 2YNHB 3KLGB 5KFIA 1S9GB 1S1WB 2JC0A 4I7FB 4KO0A 1JLCA 4ZHRA 4ECSA 2IAJB 4KB7A 3CJ3A 3M8QB 3SFUA 5EWEA 4ZPCA 5F8MA 3NBPA 3PVXA 5KG2A 1S9EB 4RNFA 2UVVA 1K1QA 3BJYA 3IRXB 3PR5B 3KHHA 3CWJA 3EPIA 4IG3B 4RW4A 2FVCA 1RT6A 4RNOA 1S6QA 2W9BA 4I2PB 1JLEA 3CVKA 4R0EA 4FS1A 5KFFA 2GC8A 1N5YA 3G6VA 3EZUA 2W9AA 3GV8B 3BSOA 5K14B 2W7OA 5I42B 1R0AA 2V4RA 1IKXB 2B43A 1RYRA 5CYQB 3QGIA 5C24B 3BREA 2UVWA 1DLOA 3MEDA 3FFIB 4IRDA 3OLAA 4O44A 3KK1A 1I6JA 2J6SA 2IC3B 4O3RA 2ASJA 4KAIA 4IH5A 1XR5A 1LWCB 3QIPA 5HBMA 5J1EA 2D3ZA 1RT5B 3KLFB 5I3UA 1HPZB 2WONA 2W9CA 3LP1A 4K4TA 4EBDA 2IM3A 2EC0A 1LWEB 1JLAB 5HP1B 2AWZA 2HNDA 2ZD1B 2C2DA 3MECA 4ECZA 1S49A 4R5PA 4KFBA 1RAJA 3H98A 5FDLA 2ZE2B 3DLKA 1TL3B 4YQWA 4O3OA 1VRUB 4TQRA 4K4UA 3MR3A 1NNDA 4IR1A 4IG0B 1BQNB 4EBCA 4WXOA 2BANB 1BQMA 1S4FA 3QLHB 4ED7A 3DI6B 4ID5B 1C1CA 1N6QB 4HYKA 5EDWA 1S1VA 1TKXA 4ZP9A 4ECRA 4F4YA 1S1TA 5C25A 1N4LA 1W25A 3MTKA 2I5JA 1KHVA 4F4ZA 3DLGB 1QE1B 3N6NA 4J9QA 2VG6A 4K4VA 1GX6A 4TN2A 4K4XA 1HARA 4LQ3A 3NAHA 3BSNA 3OL6A 4WFXA 3OL9A 1MU2A 2RKIB 2HNZB 4LSLB 2YNHA 2QV6A 4QWCA 2AGOA 3OLBA 1DTTA 3CDUA 1S1WA 3PW2A 4O3NA 3DLEB 1J5OB 3MR6A 1TKZB 2UUWA 3M8QA 2RDIA 1RTJB 4KBIA 4PWDA 4IFYA 5EUHA 3N6LA 2C22A 4RW9A 3KLVA 4J9SA 2FLPA 2IBKA 1HNIB 1S9EA 2FVQA 3Q8PB 2YKMB 3IRXA 3TVKA 1IKVB 4EO6A 1EETA 1QUVA 4K50A 2HAIA 3QZ7A 3HHKA 5KT5A 4EYHB 2OH2A 4MK7A 1S0OA 4J9RA 2B5JB 3IN5A 4F50A 4EBEA 1FKOB 2HMIA 5DQGA 4ECXA 5K14A 1IKWB 5I42A 4XPCA 5KG3A 2RF2B 5J2QB 1S1XB 3DM2B 2XCPA 2IJFA 4ED1A 3HVAA 4J9PA 5KT2A 4NLPA 3UPFA 2R8IA 4H54A 1RT3B 2BQRA 2IC3A 1N48A 2OPRB 5KFSA 5J2MB 3FRZA 3PW4A 4K4WA 4JV1A 1RT5A 1SUQA 1XR7A 1QAIA 1HPZA 4ZVFA 4QWBA 1KLMB 4MKAA 2ASLA 3H4BA 5KG1A 1GX5A 3CJ5A 3DYAB 4IFVA 3D5MA 5DG9A 2V9WA 3GIJA 1HQEA 2JC1A 4RW8A 5KFMA 3V4IA 2IM1A 4WYLA 2CJQA 3E01A 1FKPA 3T1AA 3H59A 4IG0A 3KK2B 4WYWA 4QPXA 3KNAA 3KLIB 4R8UA 1LW0A 4MK8A 2BANA 2YNFB 4WE1B 1N56A 4Q43A 1SV5B 3PJWA 3DI6A 4ID5A 4Q0BB 1XR6A 1JKHB 5F8IA 3MFIA 1RT1B 4NLOA 4NCGA 2IM2A 5DG7A 5C5JA 3DLGA 2FVPA 4KV8B 3FSIA 4IOBA 3Q8QB 1RA6A 2HNYB 3G6XA 3H4DA 2GIQA 2YNIA 2D3UA 4B3OB 3I0RA 1NHVA 2ZKUA 4ZPAA 2WOMB 3BSAA 5EWFA 5J2PA 3QZ8A 1ZETA 5DGBA 1TVRB 1TKTB 3MEGB 1TKZA 4I2QA 3CDWA 4JUZA 5KT6A 2O5DA 4ED2A 4MFBB 1RTIB 3PR4A 4Y3CA 1HNIA 4IRKA 2AX0A 3DMJB 3GYNA 2R2SA 5KFLA 2XCAA 2GIRA 4PQUB 2R2RA 4RZRA 5J2NB 5EWGA 3UR0A 3DRRB 3LP2A 1T03B 2R8KA 3IGNA 2WCXA 1K1SA 3CIZA 1FKOA 3GQCA 4WFZA 1RA7A 3V6KA 2I1RA 3NKYA 4TY8B 3HKWA 2RF2A 2JEJA 1LW2B 4XO0A 3V81B 5KFDA 3GV5B 1S6PB 3V6DA 3KMQA 3QO9B 2OPRA 3CJ0A 3KHLA 5J2MA 5KFBA 1HMVA 1CSJA 3UQSA 3OSNA 1TQLA 5F8HA 5HROB 3Q8SB 2AX1A 3ISNC 4ECVA 4GC6A 2OPSA 5KFXA 2YKNB 4U6PA 4J9NA 4DL7A 1C0TB 1Z4UA 2XI2A 1RTHA 3IG1A 3DYAA 4NLRA 1HYSB 4RUAA 4K4SA 4WZMA 3N6MA 4LSNB 2JEIA 1RT7A 3ITHB 5KG6A 4IQXA 1S1UA 4TQSA 1DTQA 3H5YA 5F8GA 3M8PB 5KFKA 2OPQB 3KLIA 1TV6B 3SI8A 2C2EA 3QIDA 5KFZA 4WE1A 4KKOB 4QWDA 1SV5A 4LQ9A 3C6UB 4YMEA 4H4OA 2QE5A 4Q0BA 2IA6A 4F4XA 3DRSA 2BR0A 1FK9A 4PUOB 2J6UA 5DG8A 2VA2A 1RT1A 5KG4A 1VRTA 2YNGA 4XPEA 4H4MA 3MR5A 4KV8A 3LP0B 3V6HA 4ECUA 2ATLA 4ZVHA 2E9RX 5F8JA 2XC9A 4NLUA 3KLGA 2OPPB 1S9GA 1SH2A 4I7FA 5KT3A 2IAJA 1TVRA 3MEGA 3MF5A 2AQ4A 1S0MA 3CO9A 4ICLB 2D41A 5KFVA 3KK3B 4RNMA 4EEYA 5KFOA 3PW7A 4MFBA 1RTIA 1JLGB 2FVRA 3H40A 2BRLA 5C42B 3DMJA 4IG3A 3RB6A 1REVB 2WK4A 5J2NA 3RBEA 2IMWP 4I2PA 2CKWA 4DL4A 2JEFA 4GC7A 5KFYA 5KFJA 2IM0A 2XGPA 4NLDA 4TY9A 3PW5A 3FQKA 4RW7B 3QGGA 3CJ4A 3GIKA 1IKXA 1JLCB 2ILZA 5CYQA 3DRPB 5C24A 1C2PA 3PJXA 4TY8A 2BRKA 4Q8EA 1LW2A 2JLEA 3FFIA 5L9XA 3NBPB 5L1IA 4KSEB 5KT7A 1D0EA 1LWCA 4EO8A 3QO9A 1C0UB 5CYMB 2IJNA 3KLFA 5KG5A 3GIMA 3RAXA 1JLQB 3QGHA 5HROA 1RT6B 2BQ3A 1LWEA 1JLAA 4Y2AA 5HP1A 4M95A 4TXSA 1TL1B 1JLEB 2ZD1A 2AGQA 4RUCA 4DL5A 2YKNA 4NLQA 3LANA 2FLNA 1TP7A 3E51A 2ZE2A 1TL3A 1VRUA 1LWFB 4LSNA 1DLOB 4F4WA 4IRCA 3MEDB 4DL6A 4TLRA 3KK1B 3D28A 2R8HA 1BQNA 4J9OA 2FJVA 3G86A 3SFGA 4YR3A 4ZVGA 3BR9A 3T5HA 3CJ2A 3M8PA 2OPQA 1TV6A 5HBMB 5J1EB 1S48A 3QLHA 4KKOA 1N6QA 4ECQA 2HNDB 3I5CA 1SH3A 4IR9A 3FQLA 5F8NA 4IDKB 4KFBB 1QE1A 3DOKB 3TQ1A 3DLKB 3KOAA 3BGRB 3BQ1A 5DGAA 2V4QA 3TAMB 4O4GB 4HKQA 5KFWA 3M9NB 3KLEB 2RKIA 2HNZA 4LSLA 5KFEA 3RAQA 3H5UA 3LALA 1BQMB 1UWBB 3NAIA 3NGDA 3OHAA 3DLEA 1J5OA 3I5AA 1RYSA 3UDLA 4M94A 1C1CB 2VG5B 5T14A 1RTJA 1TKXB 2UVRA 3GV7B 4Q44A 3ISND 1S1TB 1IKYB 5C25B 3KK3A 4K4YA 1IM4A 1JLGA 2YKMA 1IKVA 2BQUA 5C42A 2BE2B 2VG6B 2XI3A 5L1LA 4NLSA 4TYBA 1REVA 2AGPA 4QWEA 5D3GB 2B5JA 4Y34A 1JLBB 1MU2B 5KFPA 4Q8FA 2C28A 4RW7A 1DTTB 1IKWA 2B6AB 4G1QB 3RB0A 5J2QA 1S1XA 3DM2A 3DRPA 1MMLA 3QYYA 4ED3A 1RT3A 4IFYB 4PWDB 2D7SA 4RW9B 3C6TB 2W8LA 4ECYA 4O3SA 4WZQA 3IS9B 4J9LA 4ZPDA 3H2LA 1C0UA 3MEEB 5CYMA 4KE5A 3I0SB 4X2BA 4DL3A 1JLQA 1EETB 1T05B 4URGA 1KLMA 1S0NA 5DQIA 5KFNA 4NLVA 3Q8RB 1TL1A 3H5SA 3OHBA 2R8JA 3EPGA 1JLFB 2WB4A 2HMIB 3H5XA 4MIAA 1T94A 3OL8A 3NMAA 4QWAA 5DLFA 1JXLA 1LWFA 1HQUB 1EP4B 1RT4B 1SH0A 4ZPBA 5KG0A 3KK2A 5KG7A 3GILA 3KJVB 4URSA 4OL8A 5JXSA 4RW6B 2YNFA 1U09A 2XWYA 2JEGA 1SUQB 4QW8A 1C1BB 3DDKA 4KHRA 1RT2B 1JKHA 3V6JA 3HVTB 2ALZA 3JYTB 5KFAA 4IDKA 3JSMB 2ILYA 4IFVB 2R2TA 5F9NA 2R8GA 4FBTA 2W7PA 4MKBA 3DOKA 4J9MA 2HWHA 2RDJA 1HQEB 4ZMMA 3BGRA 4U7CA 4RW8B 4YR2A 4NLGA 2HNYA 3V4IB 4O3QA 3LAMA 2R2UA 3TAMA 3E01B 4ZP8A 1FKPB 4O4GA 1RTDB 4B3OA 5L1KA 3KLEA 4K4ZA 3MFHA 4ECWA 1S97A 1KHWA 4R8UB 2WOMA 1LW0B 1YVFA 2UUTA 3KHRA 1UWBA 2WHOA 4JV0A 1TKTA 5F8LA 3RB4A 2WRMA 5HLFB 2VG5A 2VA3A 1JX4A 1IKYA 3T5JA 3T5LA 3OSPA 2FLLA 4NCGB 4IKAA 1D1UA 4ECTA 1T3NA 2FVSA 4DL2A 4DG1B 1HNVB 4WFYA 4PQUA 3KLHB 2BE2A 5DLGA 3DRRA 1T03A 3PHEA 2E9ZA 3I5BA 4NLXA 4NRUA 1NHUA 3DOLB 5D3GA 3FDSA 2YNIB 2AU0A 2VG7B 3I0RB 2V0NA 1JLBA 4DEZA 4O4RA 4RNNA 3PW0A 4KO0B 5J2PB 3BQ0A 4ZHRB 4G1QA 2B6AA 1RDRA 3T19A 4NYZA 3ICLA 5JUMA 2ASDA 3V81A 3CDEA 4I2QB 4MIBA 4NLWA 1S6PA 3C6TA
chains in the Genus database with same CATH superfamily
4KGVB 3EGWB 1S6QB 3HHEA 1C0TA 2L08A 4CH0S 3R1HA 4P75A 4A46A 3N9UC 4YR0A 2VASA 3OUYB 3KDNA 2XSFA 4LR9A 1C1BA 4NA2A 4WXWA 1VC6A 1N36J 1RT2A 2VONA 1NJZA 4PUOA 2H4WB 3JYTA 1VGYA 4OZNA 3EMTA 2MKKA 1HNZJ 3GFZA 3THPA 2Q79A 1DURA 4F36A 2YNGB 1F0XA 2DPJA 5E7OB 2HLTA 2FZKB 3MGJA 3KLGB 4F3QA 3WBZA 4B3MF 1U1NA 4RBVA 2W2QP 3CWJA 2XB2D 2DCLA 2DR5A 5G4DA 4CO1A 1HBUA 5I3UA 4K4TA 5HP1B 1T9TA 1JQGA 3D68A 4KFBA 3DLLQ 2BMBA 4KQZA 1EQ0A 4IG0B 2FPHX 2X1BA 2XZDB 3IBCB 2N3LA 4JYAJ 3OTCA 5MLCV 4DMZA 2HURA 4LBIA 2P8IA 3CMQA 4TN2A 1SL0A 1HNXJ 3TUPA 2M0GB 2KJWA 4KC5A 2F9DA 1WEYA 3DRXA 1J5OB 2J76E 2W4CA 5DDRC 1P1LA 1S9EA 2FVQA 4DR2J 2QA1A 1QUVA 2HRTA 4PRFA 5I3PA 1ZYQA 3O6QA 3P4UB 4MKVA 3I4PA 1NU4A 3NGTA 4B3RJ 4CLWA 1FE0A 3UPFA 4DUZF 1TUWA 2FGCA 2H54B 4A8QA 4ZLNA 1QAIA 1UJ4A 4ELTA 5KG1A 3CJ5A 3NG8A 3C15B 3GIJA 4OYBA 2ZH7A 2CJQA 3KNAA 1ACMB 1IWGA 1LW0A 3Q24A 1WHXA 3QBCA 3MFIA 5IC4B 3W1YC 3C3LA 2AF6A 2G2YA 2GIQA 1F3VA 1VQ8S 1TVRB 4ZLPA 4OV1A 4Z7YA 3U1NA 3DMJB 3OTOF 1X5TA 2R8KA 4CLZA 3V6KA 3L09A 1LW2B 1YITS 2HRYA 1H7XA 5J1PA 2OPSA 1AB8A 2GVZB 4DQIA 3NY0A 2Y1JA 1R8CA 2P5VA 4PWWA 2B9WA 2VQEJ 3EVMA 3GONA 4ENOA 3UD4P 5DG8A 1Q53A 5E3CA 1WF2A 2J9DE 1Q4RA 4X4VA 3CJ8A 5E0OA 3TA2A 1FJ7A 3ZTRA 3W65A 2J5AA 3SDEA 2HFSA 5B7WA 5THWA 1SJ3P 4MFBA 5C42B 2AD9A 3ILJA 5HQMA 1NJYA 2WK4A 2IMWP 2JEFA 2HAFA 1HLWA 4NLDA 2V5HG 3FQKA 1XEZA 5HSPA 2HQDA 1N5QA 4LFAF 2DNHA 2V94A 4EO8A 3TWZA 1WOOA 4M95A 1U2FA 1EARA 1FEHA 1XWLA 4DV1J 1Q86T 1UMJA 3KK1B 1TV6A 3T3FA 5JVHQ 5B0EA 4CZCA 2FZCB 1CEZA 4DUTA 1SIWB 4DPWA 3OTEA 1YI2S 2QLWA 2VDIA 3LOUA 1C1CB 1WTBA 3MPUB 4BS2A 2LU1A 3ISND 4OI3A 4KH0B 2J8SA 3ETMA 4PXBA 2VG6B 1DZ5A 1F5CA 3VGVA 3ELHA 3UCGA 1GQEA 1H72C 4MKYA 4L3KA 5DZ6A 4J90A 1QSYA 1S1XA 3Q89A 2GIFA 1W2IA 1WG1A 4RW9B 2DHHA 1KQFB 4DR5J 4DL3A 1JLQA 1WKLA 1AT1B 4NLVA 4LRBA 2YH0A 2QRRA 3LGMA 4OJHA 2WB4A 1F2HA 4EI2A 4EWTA 1BUXA 4Y2KA 5KG0A 1UKUA 2LA4A 4PG6A 7FD1A 5JXSA 4LFBJ 4M5DA 3V6JA 1YBTA 3MZIA 2EFPA 2R2TA 2MZTA 2HGMA 4U7CA 3LAMA 2NXNA 2CVEA 4LFCF 3HHLD 3Q86A 3MMCA 1JX4A 2DB1A 2UXCJ 3KG1A 1RU2A 1DQAA 1NHUA 3HULA 4I68A 3Q0AA 2HBZB 4DQSA 1I1GA 4DHVA 2MXYA 3T1YJ 2OAUA 1RCOB 1RAIB 3IGVA 4GKJF 1KVJA 1H38A 1YDLA 3D7SB 2CQBA 4DV5J 3OL7A 1IM6A 3ITHA 7FDRA 1VRQC 2CQGA 4ILRA 1BD6A 4U8YA 2AYBA 4HVZA 4MH8A 4JV2A 3JSMA 1X4BA 1ROFA 2VZ9A 2WVDA 4E2FB 2MKYA 4JOUA 2F8EX 2MZRA 1NK0A 4C3LA 1N33F 2BX6A 5E2QA 2ZJPQ 4YHHJ 1VRTB 4K2JA 2RJZA 1CLFA 3AY0A 4EFAC 1RABB 3HSZA 4DX8H 1K1QA 2JOQA 4LSZB 4PYAA 3QT8A 3UD5A 4NA1A 4M5LA 3TEHB 4YB6A 4CIOA 3FEZA 3KLFB 1HPZB 1O51A 2VFSA 4N8NA 2KVIA 4K4UA 3MPYA 3SXLA 4DS4A 2KXNB 5IT0A 1FJGF 4OYMA 4HYKA 2FY1A 4F4YA 5EN1A 3JQKA 4NWBA 5CQGA 2FUG9 3OFHA 4QR1A 4O3NA 2L3MA 2UUWA 4PPZA 4Y28C 3KLVA 3WQPA 4NI2A 3UVJB 4AL5A 4XIUA 5J2QB 3ZTOA 4DV2F 2OPRB 3VZIA 2B4VA 1N0UA 3V2UC 2HFUA 4RX6A 4DF4A 2ADCA 2I6WA 3W2VB 5DG9A 2IVYA 4RBTA 2IM1A 6AT1B 1FKPA 2DY9A 4LF8J 2KKHA 2OFHX 3PTWA 2R7UA 4KV8B 4FKYA 5ETSA 1OJ4A 2OELA 1TKZA 4ED4A 1YJ9S 4WFNQ 1AUSL 1FFSB 3UDCA 3GYNA 5KFLA 2LVWA 3RG6A 2M7SA 1KQKA 2CG8A 2L9NA 4FF3A 4DR3J 2XY7A 4FXVA 5A8KA 5AXMA 1HMVA 3T9NA 4U6PA 4PG5A 2UZAA 1HYSB 4K4SA 2DNPA 3IWLA 4LF9J 2UUBF 5KG6A 3BH7B 1S1UA 3W8PA 1S59A 1QDUB 1X9MA 4TKTA 3C2PA 3CSKA 4YMEA 3RR7A 1HBNA 2BR0A 3L7UA 1CJKB 1ZOTA 3LP0B 3EVWA 1VBZA 1P1TA 2KRRA 1PJ6A 1HI1A 3QSYB 4RNMA 4V19J 1NPRA 1U45A 2MHEA 2H65B 3PW5A 1QSLA 2AJ1A 1C2PA 2E7VA 1QLNA 2MLZA 1WG4A 5KG5A 4WBFA 3FBEA 2XNRA 5HROA 3R7SB 4KGZB 2KHCA 1DQ8A 3MEKA 2DO4A 2MYFA 3M8PA 1I5OB 2OPQA 1WSVA 2L9DA 1G1XA 3HO1A 4UF4A 2XMMA 3PXGa 1U1PA 4C0OC 4NZ7A 4OYXA 2ZH3A 3H5UA 2IVMA 3HFVA 2KT3A 2IA0A 3KK3A 1ZM9A 2KN4A 2B9XA 2RIJA 1YTYA 3R7NB 1HD0A 4NMXA 1CC8A 2B5JA 2DNKA 1IKWA 2QFJA 3A8KA 2HQCA 2RE1A 1MMLA 3HHDA 4L3NA 2LECA 4E98A 4J9LA 1UEKA 3ZTPA 2LEAA 2XG8A 1U7LA 2CZVC 4GMKA 3M6XA 4Q2MA 5GMDA 2F8MA 1F2GA 1U2RA 4Z7CA 2ZFHA 1FTRA 1S57A 1WDTA 3KJQB 2W7PA 2RDJA 4KHPJ 2CFXA 3AXKA 1KHWA 2WOMA 2CQ2A 5D77A 2IYIA 3MCSA 2VG5A 4OYPA 2VQFF 1AFIA 4NCGB 1B64A 2FVSA 3BN4A 4GRSA 1T03A 4DR7J 3QT6A 2ZJRQ 3CCJS 2U2FA 1HI0P 1SC3B 5JUMA 2DIUA 4MIBA 3DOMB 2GGPA 3RRHA 2DPIA 3M9MB 3TAQA 1LQ9A 1U02A 4ZPWR 1R0AB 3FNNA 4B3SF 4O44B 1XERA 2HWIA 4J9KA 4QZVB 3UI3A 2KM8B 4AXIA 4NCAA 3MM6B 3DNCA 3JXOA 4Y2MA 1XNRF 3CMES 2E9TA 1RTDA 2FHJD 4OLPA 2BJDA 3CEDA 1Y10A 4DSIA 2CDQA 4CYUA 1WNEA 3QQCD 3M6WA 4J37A 2VU5A 3P3DA 2GHWA 4ZP6A 2JC0A 3UDVA 5G0RB 3X1LB 2EFQA 1SKUB 2WZ1A 1N5YA 1VK8A 2J0QD 3GV8B 4CM2A 1JXVA 1HBOB 1JJHA 2KRBA 1I6JA 4B17A 3ZZUA 3HXMA 2V2QA 3G6ES 3RBXA 2ZE2B 1TL3B 4O3OA 1OSDA 1P8GA 4PEOA 2X7IA 3M8SA 4IO9Q 1WWHA 1S1VA 1R89A 2ZHOA 1N4LA 1GX6A 1OY6A 2LXFA 1FD8A 4LQ3A 2RH3A 3CC4S 2HNZB 2G0JA 2FYXA 3DLEB 5F3ZA 3C16A 1YSJA 2PDAA 4CO0A 4CO4A 2CJKA 4A8YA 3TVKA 2CA9A 4EO6A 3Q2SC 4UOFA 1NK9A 3WDOA 3VVTA 1QM9A 1FTCA 1SJFA 1FKOB 2DR8A 2KFYA 1YZ7A 3DU6A 3PW4A 2CADA 4A8KA 4ZVFA 1LNQA 3J80U 2RRNA 1GX5A 3CD5A 2IBOA 1WI8A 2V9WA 3CCUS 4WYWA 2GQCA 1NK7A 1CBKA 4ID5A 3SMZA 2POKA 2G2OA 3I0RA 2ZKUA 2QLJB 5EWFA 1ZETA 5D4LA 2L41A 2O5DA 5K5MA 3G71S 2ZC3A 1Y11A 2AX0A 4HHJA 3IGNA 5D8HB 2R7SA 3OVBA 4KH1B 3NKYA 3HKWA 2X3DA 4DV3J 2ROEA 2MZ1A 2GQ2A 1RHJB 3WHIA 2NXJA 3DDNA 4RUAA 4NXMF 2E5IA 2HHHJ 4H4OA 4F4XA 4LF2A 5A0YA 4L72B 1PBAA 2H1YA 1WOPA 2OPPB 1X5OA 1NZAA 4DR1F 2D41A 4X4PA 2VICA 3H40A 4HTJA 5J2NA 2CKWA 2B9EA 5IS2A 3R8YA 3R2DJ 3GIKA 4ZVRB 2MY8A 1WEXA 3FFIA 3TZYA 2FHOB 1JNRB 1D0EA 2BXJA 3VGUA 1TL1B 1P9QC 4RUCA 4F4WA 4TNOA 3MEDB 5ETQA 1NUEA 4PKDB 4KKOA 2VHGA 1N6QA 4IDKB 4FYXB 3TAMB 2AZ3A 2V4JB 3DGPA 1YJRA 1V5IB 1QTMA 2YWFA 4DN0A 2C3UA 2V6AA 2EI5A 2K7JA 1Q16B 1Q8IA 2DNQA 1NAQA 3CIMA 4GVLA 2JVRA 4PWDB 3M6VA 2ATCB 4DV4F 4ZVPB 3HD1A 2OLWA 2VC1A 3H5SA 5HMXA 2XLIA 4M63A 4ZPBA 3GILA 3R5AA 5HANA 4DFJA 4KTQA 3HVTB 2X1FA 2GHPA 3DOKA 3B78A 3R97A 2MQ8A 4FN5A 3IWNC 4OX9J 3GFHA 1SKRA 2RAQA 4L73A 4U7UD 3DRRA 1RUSA 5D3GA 4ATNA 2XMKA 2AU0A 4Y00A 4N76A 3PW0A 3G8SA 3ZNJ1 1U6BA 3ICLA 4AE5A 2B4UA 3QGPA 2MGZA 4IUFA 5LSOA 4K59A 3FC9A 5B0FA 4ZS6A 4YB7A 2ZC4A 1M5SA 3G8QA 4C8ZA 1WJ9A 2DGQA 1SC4B 3V6DB 3BM7A 1R8BA 3C6UA 3U27A 3GIIA 2XZWA 2HZAA 4DCOB 5FDLB 2H3EB 4G1IA 3GP9A 3KXDA 5D4PA 2DH8A 1RT7B 2QMUB 1DTQB 1R6YA 5L1JA 1CS4B 3M30A 4OX7A 5BJRA 4PAAA 1YJTA 4P10A 1RGVA 2B8QA 5HI7A 1T11A 3KUEA 2YNHB 1S1WB 1AA1B 4U7UK 3MURP 4CLKA 3TZXA 1RJJA 4RNOA 1S6QA 3UN5A 3R5CA 5HQLA 4K5SA 2FHMA 2CQ0A 5CH7B 3NS6A 2XSJB 1FVQA 4JV5F 2UUAF 2V8GA 3RW7A 2VPYB 4X4NA 1QTNB 2B0GA 4CT9A 2IYGA 3KJFB 2ROGA 1X4EA 2W2OP 1BQMA 1AZSA 1W25A 4F4ZA 4OFZA 2HZVA 1F1BB 2R7WA 2DNNA 4WJBA 3OL6A 4WFXA 3J80Y 2XEXA 3PW2A 1YBUA 5E3PA 3L7OA 3RRKA 4P2MA 2RUSA 4DFKA 3FMWA 3BBBA 3HHKA 3CCVS 3OJUA 1Q7YT 3NGUA 2FC9A 2RF2B 3HVAA 1Z1ZA 2CPJA 2R8IA 2DNZA 1Q79A 3THTA 1YJUA 3MM5A 1YLXA 3H4BA 4Y65A 2V34A 4MYTA 4QQBA 2JC1A 2EBEA 3CXCR 2ZZNA 4IG0A 2R9LA 1HBMB 4OI2A 2LQ8A 1BXNA 4USWA 3PRBA 4Q0BB 1KWMA 3ZZOA 2HRUA 2QA4S 3G6XA 2BW7A 2WBMA 4HHHA 3GMGA 2NLWA 3RW6A 1KNZA 3CDWA 1RHQB 2R2SA 2XCAA 3TQEA 5RUBA 1FRMA 2LQJA 3HHNB 2I1RA 3CJKB 1FNOA 1QVGR 5F8HA 2VV5A 4ECVA 2E5GA 2YWGA 1C0TB 1WC0A 1VHFA 2MQMA 3I6PA 1RKJA 1SXLA 2D74B 5EHHA 1S12A 1J5EF 4QWDA 2UUBJ 3SEOA 1MMDA 4PUOB 3FCVA 4WWSA 1XMQF 4H4MA 2LQ5A 2RQCA 2K8GA 2ZWOA 4ZVHA 1F60B 1Y0HA 1P9YA 1XN9A 3J7A1 4GKKJ 1TVRA 3MF5A 1Y3KA 4EEYA 1FF2A 1HWIA 3DMJA 4DPYA 5KFJA 1FDNA 3PO4A 2KFNA 4RW7B 4WIIA 1M1HA 3DRPB 5LT5A 2BRKA 1LW2A 1FXRA 3J7AN 2BW2A 1FWKA 2GVZA 4DL5A 5CD4H 1VI7A 1HBUB 2K2PA 3CJ2A 3X3UA 2I38A 4KFBB 1PYTA 5B0GA 3CW2C 2GW8A 1RYSA 2OI2A 3K7RA 3UDLA 5H9FK 1RTJA 1FESA 2UVRA 3PIOQ 1VIOA 2FJBB 1ZAWA 1IM4A 3EXYA 4PWUA 5C42A 2XULA 3Q83A 3KJNB 3D4JA 2VOOA 1OPIA 3NNAA 1F6TA 1FDBA 3Q8RB 4TVAB 5HMZA 2R8JA 1SQGA 3NMAA 4MIAA 2HQIA 3D6FB 1CQNA 2CNLB 2ROPA 2VBXA 1HQUB 2XTJP 3O8WA 5KG7A 3KK2A 2FB0A 2JEGA 4I4BA 3OFFA 4W90B 2QTWA 1B0VA 4USIA 4MKBA 4CDIA 1X4GA 2R2UA 2YXLA 4WP9A 2G9OA 5HL7Q 1LW0B 2UUTA 3KG4A 5CZVA 3RB4A 2IDEA 4DZDA 4DR4J 4IKAA 1D1UA 1HNVB 1T9WA 3DCAA 3DOLB 1AUDA 4OYIA 3HMJG 1H2TZ 2CNNB 2MKCA 3BEGB 2WSCC 5L46A 1H2VZ 4NLTA 2HIYA 1IXKA 1ZTWA 4NLYA 1WI6A 5HK4A 1YIJS 3M9OB 2NUHA 1VQNS 3AD8C 3ET6A 3TANA 4B3SJ 2VBZA 2OPSB 5F9LA 4BCAA 2FJXA 2UXBF 2AEMA 5HJXA 4ZJQA 4NOHA 1GTHA 3IFEA 1EX8A 3RBZA 1XNRJ 3NXZA 4ICLA 2M4MA 1UP1A 1BMQB 4IH6A 1Y5IB 4ZP7A 2F3JA 4P2XA 3M8QB 1DJ0A 3NBPA 3BKFA 3RUBL 1LFWA 4ZOSA 5IT4A 5D0HA 5HMYA 1U26A 1S7HA 3BSOA 4RJVA 2V4RA 2NPIA 1FRLA 4N5SA 2B9YA 3DRYA 2ZBRA 1URNA 1E6VA 1HNWF 2HNDA 5SUHA 2C2DA 3FMBA 5CCMA 3OD2A 1U1LA 2OHDA 2CZ4A 2Z2LA 4IO1A 2XS2A 4ZP9A 3JTNA 5C25A 2DXFA 3HZEA 3N6NA 3KUGA 4K4XA 3WC2A 1Q78A 3QWUA 2AGOA 3IR5B 4DX5A 1BGXT 2EBGA 2JWNA 3NGSA 3UNGC 2XLKA 1EETA 4K50A 2RS8A 5A8WB 2AEFA 4J9RA 1FERA 2ZITA 2ASYA 2QL7B 3MUMP 4RKUC 1S1XB 3HJFA 1NSPA 1VQPS 4NMLA 2MZJA 2XLJA 1FNXH 5KFSA 1FI4A 2DH9A 1SUQA 2LA6A 1HPZA 5LOQA 4FKXA 3T41A 1G4CA 1U1RA 2BVZA 2YWKA 4ZA1A 1WHYA 4RUBA 2CJXB 3E01A 2AJ0A 2B7CB 4FXDA 4QYZK 1RU1A 1VYAA 4R8UA 2C42A 1TU0B 3PJWA 1FX4A 2C3YA 2A18A 3C46A 4JB8B 5L9NA 5IQ6A 3PFOA 1RWVB 3BSAA 1KDNA 1G7CB 2BACA 3V4MA 2MLXA 5KT6A 3MMCB 3CIZA 4QIGA 2VKRA 4UZCA 4XO0A 4CLLA 3D1OA 2W25A 2OPRA 4UT4A 3NS5A 3PYFA 2AJFE 4UTGA 2JSXA 2MEWA 3ITHB 2VDHA 5KFKA 1N5VA 1TMMA 1FRXA 4ZIVA 2QE5A 4X65J 3M8ZA 2WSFC 4KRWA 5KG4A 5BXIA 4KV8A 3V6HA 4OLOA 3VAKA 2C2OB 4JI3J 1A6LA 2K1RA 5KFVA 1VC0A 1JLGB 2I8EA 2OKQA 4DR1J 4KGKA 5KFYA 3D9BA 4GO7X 2VODA 4I6AA 5C24A 3JB9k 3QGHA 4C2MA 1LWEA 5FJ4A 2OO4A 1SKWA 2G0IA 2U1AA 1HI8A 1N36F 3BB5A 3SFGA 2B51A 3BR9A 5D15A 2ABYA 1UVIA 1HNZF 4B9VA 4OHVA 3KOAA 1TK8A 3BQ1A 4OX8A 2V4QA 4W4MA 2RHSB 5CYJA 4OX6A 2F4FA 2AYGA 1IUJA 4LBHA 4PXDA 2BE2B 2VJUA 3CC2S 4OI0A 2OUGA 1JLBB 1GNKA 2DISA 4GO5X 2WVBA 2PD1A 3QSIA 3C6TB 3IS9B 1D9AA 2PMHA 2H9ZA 3W61A 1DAXA 2IPOB 3EGNA 4P2SA 3W5XA 4KYZA 4JI8J 3KJVB 4UY85 2ZBQA 3TJAA 1WKJA 2Q3PA 3MCNA 4B02A 4J9MA 4JYAF 2MMYA 2ZZTA 2AT1B 1FKPB 1S5ZA 3F44A 4JV0A 1HNXF 1A0OB 2BJ8A 3KLHB 2JLGA 1RWWB 1B0PA 3LWLA 1B7YB 2LEPA 3A8EA 4Q5VA 2XMJA 2GVDB 4NLWA 4CRJA 2OFGX 1SB6A 3TUIC 4Y2IA 3R7BB 4PXCA 2CQ4A 2W9BB 2ZM6F 2QLXA 3VHQA 2NPFA 3VQSA 2LCWA 5A8KB 1HMVB 2EPIA 4JI6J 2W9CB 4AFFA 4OV6A 2KT2A 2B8PA 4PYDA 4ZJOA 2XYPB 2FJWA 2I9SA 4USKA 1S1UB 2VFTA 5IZHA 5ETOA 3QAEA 3RB3A 2MY7A 4IH7A 2DVIA 5M2PA 4YN3B 3DOMA 2UVVA 1RWKB 4QR0A 4CCHA 3IRXB 2O66A 1JLEA 6FD1A 2MZSA 1R8HA 3ILIA 2KDOA 4UY8T 1R0AA 3OVAA 3QGIA 4O44A 9ATCB 1IVZA 2W2NP 4OZ5A 2IM3A 5LMUJ 4B08A 2BDPA 2AWZA 5A2QU 3MM6A 4YQWA 3HJVA 2VQEF 2ZDOA 3M05A 4N7TA 3IBFB 3HI9A 2HVEA 3TP2A 3VAJA 2P6SA 1HARA 1VQ4S 1LEOA 5AE2A 5G0RA 2E7WA 2FLPA 3CJRA 1URRA 3RR8A 3W9IA 1LV5A 1HHSA 4TU7A 4DQRA 3AT1B 3SCIE 2B5JB 5H9EJ 3MPDA 1IKWB 2PSZA 1HBOA 4OI6A 4F8RA 1H73A 1N48A 4OYOA 3W9HA 4DV1F 1NMEB 3V4IA 2B7BB 3H59A 2OSRA 5DDOC 2M3DA 2Y0BB 2FQQB 4HI1A 1NSKL 1HWLA 4X64J 1XK8A 3AODA 1KD1T 4ZPAA 3TYTA 2WOMB 4QJVA 3T9ZA 1PG5B 5FIIA 1RTIB 4DU8A 3DLJA 1GXTA 2PT0A 3MMJA 1T03B 2H48B 3ENQA 1RAAB 1D8YA 2W7AA 2LFVA 2NCKL 1TL7B 1FKOA 4WFZA 1TFYA 4DR5F 2GQQA 4LIWA 4OI1A 4ES2A 5DDPC 2GGPB 3UQSA 3VWSA 1TQLA 5L39A 2DYAA 3D6TB 3PRVA 5KFXA 2YKNB 1Z4UA 1UTAA 4LFBF 3N6MA 3W7BA 2ZNYA 4LSNB 5FLXY 4WTOB 3H5YA 5F8GA 4HL9A 4DSJA 1GT8A 2Q6CA 3CD0A 2AZ1A 2ZBIA 3M1VA 4PG4A 2V8VA 3DRSA 4XPEA 5JJBA 2VF3A 5F41A 4OZ1A 3G4SS 4I7FA 3KKFA 4CYUB 2UXCF 3CJSA 5IWAJ 1FJCA 2QN6B 3R27A 3HM9A 1FNMA 2BZ2A 4FP9A 2KG0A 3T1YF 1UVMA 1RCXB 2DGXA 2ILZA 4DV5F 1PJ5A 1LWCA 4USTA 1C0UB 5CYMB 4Z2XA 1E6YA 3I55S 4XTTA 2ZD1A 3SZ2A 4IOAQ 3E51A 1SKSA 2DGWA 4CLSA 2R8HA 4J9OA 1VQ5S 1KOHA 3NRBA 3BF4A 1VS3A 5GADI 4DSEA 4N47A 3TW0A 4USUA 3A3NB 4C8OA 4LSLA 4YHHF 2GV1A 1UWBB 1S7IA 5D4OA 3K2YA 3GV7B 4YUDA 2KB2A 2PIIA 4K4YA 2YKMA 2DCUB 4TYBA 1U0SA 2V2ZA 4ZCIA 5DDQC 1PBUA 1Q8BA 2B4PA 3J81Y 4WK3A 3A8JA 3C16B 3QYYA 2W8LA 2D69A 2RU9A 1T05B 1VCTA 1KLMA 1S0NA 3R5DA 1TL1A 3QNWB 2RQ4A 3TUJC 2RD5C 1NB7A 4URSA 4OL8A 1UCNA 1UVKA 4C11A 4QW8A 4WKYA 1GFWB 3PYDA 3N79A 4IDKA 2HNYA 2YX4A 1U0HA 3TAMA 3J7ZT 4ECWA 2V4JA 4I1TA 1DFDA 2YKOA 2VA3A 1WF0A 4PQUA 5LMNF 3C8YA 2H4YB 3HDSA 4CWBA 3OFGA 5E3AA 3I0RB 4LUBA 3WC0A 3IP0A 3CDEA 2YY3A 1NSQA 3D1HA 3MTJA 5LSRA 2Z58B 3TEGA 3T1HJ 5LXYA 1KP6A 4URQU 2EKYA 1TAQA 3DGVA 3UNYA 5ETTA 3CJQA 3F56A 3HVTA 3POTA 3PZPA 4PABA 4LF8F 2EWHA 2J7KA 3AQPA 3LF0A 2J7UA 2K7KA 1TMJA 4H4OB 5B0BA 3GJTB 5A0YB 2YKQA 1JIHA 3GPAA 3HT3A 4Q2LA 2DNLA 2J9EA 1RTZA 3SFUA 1EQMA 4ZJLA 1HHTP 3R3TA 2HHVA 2HKEA 1PIEA 4Z37A 1MMNA 1RT6A 4DR3F 4R0JA 3S8SA 1FD2A 2CJYB 3FFIB 2D9PA 3O3LA 2IC3B 2ASJA 4YS2A 1RLCL 1X4DA 3HSGA 2MJUA 4LF9F 4ECZA 2BM0A 4DXLA 5FDLA 2GMJA 2FY8A 1PC5A 1SC6A 3MM7A 3N5BA 3ENAA 2PFFB 1SJ1A 2BV3A 2AKWB 1KVKA 1N5TA 1N6QB 3IMQJ 3ZZRA 5M2UA 3T6JA 3QFHA 2AJQA 3DLGB 5IV4A 1SIZA 3OL9A 3Q23A 2YNHA 1L5UA 1S1WA 2RSQA 3UCZP 3UN3A 3Q8PB 1FXDA 1K73T 1VOMA 4AD6A 2HFZA 3PACA 4FPIA 2X1GA 4F67A 3I31A 2JZ5A 3RJMB 4J9PA 1T0TV 1IBLJ 3A8IA 4F26A 5J2MB 4OHWA 1L3UA 1N32F 4ZPTR 1CG2A 2RRBA 1T8EA 2UUCJ 2Z2ZA 1HFEL 3OQ2A 3KLIB 3LUYA 1QUPA 3FSXA 2XO7A 3SYZA 4QU6A 3MM8B 1HW9A 4F4KA 5GMKa 2VFRA 1NJIT 1NCLA 4DLGA 4ILLA 2SXLA 3PRDA 5DGBA 4DBQA 2DXEA 4I2QA 4Y3CA 3QWPA 2OIHA 3DRRB 1GXUA 1UEVA 2RF2A 4X84A 2CVIA 2KXHA 4USVA 5KFDA 2DT9A 3ULHA 2MGZB 3CJ0A 3KMQA 1YBAA 2DO0A 4PZVA 3ISNC 1JJ2R 2ZH4A 3EICA 1LXJA 3GYXB 4F4AA 4BHQA 3I87A 4LQ9A 6FDRA 3C6UB 2EVZA 4Q0BA 4KHPF 4NEZA 1R0BG 5C7PA 1VQOS 2R3VA 2ATLA 3VZHA 3MMBA 3TZZA 2V2KA 2Z30B 5ETKA 2ZOFA 1TTHB 3M30B 3U7JA 4DR7F 2CQPA 2HS4A 4BC9A 2QG9B 2UU9F 4TY9A 1YJVA 3FGVA 3EJMA 4M5MA 5KT7A 2F5GA 3HHLC 4HT7A 5B0DA 1O5JA 1GMWD 3DHXA 4ZVGA 4LREA 1S48A 3K5NA 3FQLA 1O8BA 2WW4A 1F9FA 3EM1A 2YKAA 2IMOA 2RKIA 2E44A 2E1CA 1BQMB 3QPIA 4J5OA 1AZSB 4OZ0A 3VGTA 2AV5A 3D6HB 3FUYA 2V68A 2CIMA 1IKVA 1NDLA 4A8XA 4NLSA 2FC8A 4X4RA 4C0HA 1Y4ZB 4RW7A 3DRPA 4ELUA 2EK6A 3HSDA 4O3SA 3H2LA 3OV7A 3MEEB 1AFJA 2HG4A 1IJFB 3PYGA 2O01C 3NGRA 1FO1A 2YNFA 3H2UB 3Q8UA 2NREA 1DARA 1UPMB 3FZBA 3MM5B 3UN2A 4KHRA 2A6OA 3CF5Q 2HWHA 2XMWA 4B3OA 1D9DA 4HDGA 4ANCA 2CPZA 3G82A 4YB5A 2IDLA 2DTJA 4ZDNA 3FDSA 1Q7LB 2V0NA 2NXUA 2H5IB 3Q2TC 4DPTA 4RW4B 3AOCA 1U1OA 2GCFA 4DSLA 3MOJB 1VLYA 3DKDA 1RWMB 2ZM6J 1HQUA 2WVCA 2E66A 1VQKS 1SVDA 1VHIA 4Y2CA 5A8RA 4EYIB 2R7XA 5HAOA 4KHMA 4CT8A 2DNMA 4ZCKA 4ZVEA 4MTPA 2Y1LB 2J0XA 1FE4A 1ZAXA 4H4MB 3BGLA 1HNVA 2AEJA 8ATCB 3DOLA 5F3TA 2B4OA 2Y8WA 3IR7B 1JLCA 2AJ2A 1XC9A 1K47A 2V8DA 1V3SA 3PV8A 3DC2A 4PR6A 4DV3F 5CHCB 3BS9A 2YH1A 1HA1A 3OLAA 2W01A 2FZGB 4ES3A 4RU2A 3CCQS 2D3ZA 5HBMA 1R43A 1YJWS 2GZOA 1WEZA 5DZ7A 1RAHB 3DLKA 1TL4A 2HHHF 3SIPB 2BANB 1BWEA 1HW8A 5GMEA 1NK4A 2Y1RI 3M8WA 2YKPA 1HWUA 2KT5A 2QLFB 1IR0A 3AB4B 1TFWA 7AT1B 2QV6A 3OLBA 4H4KC 4KY3A 1U1QA 3M8QA 3LH2S 4DV0J 1RTJB 4IFYA 3LGNA 2C22A 2DNGA 2CJAA 2Z4PA 3AQOA 4OI4A 3AHPA 1V5VA 4EBEA 3N28A 3S1TA 4QIVA 2FJEB 4X66F 1R6VA 1VDHA 4HLBA 1M90T 4MKAA 1YRUA 5T7LB 3MOZA 1HQEA 3R2CJ 2CQDA 3E3XA 2K3KA 3KK2B 4NASA 4NZ6A 1UW9A 5DG7A 1NH7A 1MW7A 2NS1B 2MB0B 3RZAA 2N4CA 2RUGA 4DR6F 3T6BA 1L3SA 3HKZD 4UW2A 2F40A 4FNIA 4JUZA 5D0EA 4CH7A 4RZRA 5HVFA 5A8WA 2CQCA 2VB6A 4P2FA 1AXQA 1BLUA 1CJVB 2CYYA 1KRPA 5GADU 5ETPA 2ZHBA 1ZM2A 2APOA 4LJMA 2IJRA 1YK9A 3ET6B 4UOCA 3MAAB 2BJ3A 2PEHA 4ELVA 4OX9F 4WKRA 5F8JA 2HVHA 1UZDA 5AXLA 1H7WA 2DH7A 2BA9A 3AA8A 2AQ4A 3CO9A 3CMAS 3HFKA 3HHLA 4ICLB 5ETVA 5KFOA 2DJWA 4U95A 2O3DA 2BRLA 3PHTA 4IG3A 4QOTA 4I2PA 2YQ0A 4F7VA 3D2WA 4I0WA 3IC1A 4M5JA 4NYPA 5HATA 4DFPA 1IKXA 1W26A 3NBPB 1V9OA 3G2XA 4OJ3A 4DJBA 3M6UA 1JLAA 3CGIA 1QVFR 1JB0C 1SJRA 1B99A 2WSEC 1E6VB 3EX7B 4QIFA 4A4JA 1WF1A 2HNDB 4IR9A 2XMVA 2N7YA 2UV8G 1NH8A 1OYEA 1CJTB 3IM9A 5IFMA 3NGDA 3CC7S 1IKYB 5C25B 1RZMA 1JLGA 1CC7A 2V8HA 1PAUB 1T9XA 4I6WA 1HIYA 1NHKL 2C28A 2Z2YB 3GSDA 4LVNP 1NB2A 4DF8A 2AP6A 1RT3A 5KOWA 1S4EA 3CCMS 4ZPDA 5DM6Q 4X2BA 1EETB 3TRGA 1WHVA 1JLFB 1IR2A 4DZ6A 2F63A 3BO2A 1ZS6A 3N0VA 4RW6B 1SUQB 3F73A 2QL9B 2ZBCA 3FEYB 4DQPA 2WVFA 4OJ1A 1RSCA 4FBTA 4O3QA 2JH3A 3E01B 1H0HB 4R8UB 4QYRA 1KS2A 1WTFA 4JI4F 2E29A 3OSPA 1SJQA 2JLFA 2BE2A 3DFEA 3MI7X 5HVHA 1JLBA 3MAHA 3BQ0A 4LRFA 5LMNJ 2OEJA 1PYOB 3A12A 4AL7A 3C6TA 3IS9A 1KR4A 3QT5A 4HI2A 1LOUA 4DCJB 3R5GA 2WTFA 3PO5A 2YPZA 4KIAA 3KJVA 3QIPB 1ZM3A 3LP1B 3MECB 2GAHC 5ETNA 3PG9A 3BR8A 1JWWA 3LAKA 3OT9A 3GLJA 3JQJA 4YP3A 4QW9A 3PEJA 4N41A 2FJAB 4DWIA 3NP5A 5KFRA 2HHSA 3KLHA 1F9HA 4M5IA 2LLZA 1WC4A 1LWXA 1DBDA 2K1RB 3CJ3A 2PMZD 3A3OB 2GVDA 2HBYB 1AW0A 4F3MA 3KHHA 3I82A 4F3OA 3LQVA 2W9BA 2ZHAA 5KFFA 2OTJS 1VIXA 4C48A 5I42B 5C24B 1VQ6S 1F3FA 2HWTA 5AJ3J 1YRXA 2W9CA 1LWEB 3OVSA 3PY8A 4PG7A 5E33A 2KYZA 4QR2A 2QX0A 1NNDA 4J7CA 2C2NA 4EBCA 4X62F 2VUGA 2DK2A 3MUVP 4ECRA 2CJBA 1OQ6A 5CD4A 2DRAA 3UDEA 4GKKF 2HQGA 1AROP 2A3JA 1DTTA 3CDUA 2QZ8A 1FHTA 3W3SA 2XMTA 4MYUA 2IBKA 3IRXA 3IAM9 2HAIA 4I69A 1PCAA 4ED1A 4K5RA 4H54A 1SPBP 1XR7A 4QWBA 1O0PA 1H3DA 3I32A 3OR1B 2PI4A 5BR8J 3TNVA 1N32J 3H42A 3CCSS 3M8RA 4M8LA 1K9MT 3LPYA 2E1MC 1R8PA 1RA6A 2YNIA 2OJ3A 4BBYA 3PCOB 2GIRA 5EWGA 4QIEA 4EUVA 2MKIA 3GQCA 5EX0A 2XYHB 4TY8B 1MN7A 2A6MA 3E2EA 3IG1A 3C19A 2JEIA 4DFMA 3FBFA 2EK1A 2WVEA 3R5JB 5T41A 2EFOA 2VA2A 3DLHA 3P8BB 3UWTA 2AYMA 1UW4A 1RHUB 4USMA 1S9GA 4DR4F 2IAJA 3JQMA 4X4SA 3SSSA 1UVLA 1RTIA 4J9VA 2PGCA 3FCWA 3UD3P 4DV6F 1TL7A 2C3MA 1UVJA 1NK8A 1FDAA 4Q8EA 4FYWB 2R7QA 2UU9J 5ETRA 4PG8A 3VAIA 4OYZA 2QYGA 2AGQA 3QRRA 1JLEB 3TOQA 2YKNA 1VRUA 4LSNA 4DL6A 3D28A 4QBUA 1EZZB 3QLHA 1TAUA 4DV7F 2L48A 4FYYB 5KFWA 3KLEB 4YB1P 3RAQA 2FHJA 2PO4A 3ZZTA 3UR3C 1PKUA 2P9CA 4X4QA 3J81j 2DR6A 1JNZB 2GA7A 1M0SA 3KTQA 2QA2A 2F4VF 5GAEI 1S6OA 2QL5B 1RHKB 5HJYA 2D7SA 4WZQA 3SV4A 2NXCA 1C0UA 5CYMA 2HFVA 2UXDF 1XMBA 4URGA 3NNHA 2KVQE 3EPGA 2CNKB 4QWAA 3GCXP 1B7FA 1FCAA 4O0IA 2HS0A 1RHMB 1KOOA 4RPFA 3I4HX 1TELA 4C8MA 3W2WA 1L3TA 4LF7F 3JAMY 5KTQA 2WAQD 5F9NA 4ZMMA 1NSAA 1O6XA 3V4IB 2YWEA 4JI7F 4K4ZA 1ZZFA 2JNJA 1UWBA 3CB4A 4LF4J 4Y0FA 4WU3A 2R42A 3DXSX 4JI2J 3B6BA 3CNQP 1OO0B 4FXWA 3CT9A 2VFVA 1X5SA 2KL8A 3V81A 3BDEA 3CCZA 4K0KJ 1S6PA 2HPUA 4D3GA 5KFGA 2W8KA 1T05A 1S0VA 4G3IA 4LMZA 1L3KA 2HS3A 1M5KC 4O3PA 4FDFA 4ES1A 2WONB 3ZNUA 3GJRB 4TYAA 3BPSP 3CCTA 1ZM4A 3D66A 1OS5A 5KFCA 3M1VB 4C8YA 3DRSB 1Y5NB 2KI2A 5KFUA 3HT0A 4UOGA 4I7FB 1UFKA 2DIVA 3VAFA 5EWEA 2XS5A 1ZH5A 1LK7A 2PA3A 4EZ9A 1IBMJ 2F1FA 5AE1A 2DRDA 2W7OA 2B43A 3R9LA 4OZLA 2AIRB 3KWMA 2J6SA 2DY1A 2JDJA 2M88A 3VVUA 5K8PA 5GAGI 1LWCB 1E6YB 4B9MA 2ZD1B 3TVZA 1S49A 2QGFB 2G13A 2F7VA 4JBCA 3M7VA 1Q8LA 4X65F 2ZUGA 1S4FA 4ED7A 3DI6B 1TKXA 1RE1B 3H25A 4ANEA 1XIQA 1SQEA 4JI3F 2MQQA 3DU5A 2OTLS 3ENWA 3LO3A 4LSLB 2RDIA 2RNEA 4DU7A 3OTBA 3HLUA 3U1LA 4J9SA 1TL5A 2YKMB 3IBWA 5KAKA 4WFBQ 3GZ7A 2WB1D 1HKAA 3E8OA 4DLEA 1KSPA 3M8YA 2XCPA 2NZ4A 4Y6IA 2BQRA 1N0VC 2IC3A 4JV1A 2K06A 1KLMB 3JSBA 4X66J 2YX1A 4CNZA 4RW8A 1HR0F 2RILA 3UFCX 5KFMA 3T1AA 4MIWA 4RLEA 4WE1B 4C11B 1N56A 2E7XA 2YTCA 3BZQA 1HQ2A 3DLGA 3O1LA 3FSIA 4IOBA 2W2MP 2HNYB 1U0HB 2HHUA 2E5LF 2XZTB 3MEGB 2PFDA 4DR6J 4C8NA 5GVQA 5L8RC 2MKSA 4WTYA 3WX4A 3A1YG 1KN6A 3BO4A 2V69A 5D0RA 4PQUB 2ACMA 4CH1A 1R7IA 3BGFA 3NWRA 4FYDA 1CPZA 3GV5B 3K59A 4F2RA 5J2MA 4LR7A 2ZNZA 3Q8SB 1FA0A 4JI8F 2ZH2A 4A8MP 1P6TA 3BBCA 4TQSA 2CPDA 4UUWA 3KLIA 1Q1KA 2D9OA 1BQXA 3MM8A 1U2CA 3POTB 2MKHA 4FVMA 3GIRA 3M2VA 1PO6A 3GG1A 2Y3YA 2WW8A 1ITPA 3SCLE 4ZCLA 5D78A 2EC2A 2ZJQQ 2V2VA 2HHWA 5KT3A 2GJFA 4P7VA 4YY3F 1F5BA 3PW7A 3RBEA 3VR1A 2HQ3A 2AYEA 1JMTA 5L1IA 2J9DA 2ZWPA 3TO8A 2IFXA 1RT6B 2V50A 1PJ7A 4P71A 1WELA 3NWGA 1DY3A 4JI6F 1BQNA 1VJQA 4BLGA 3K57A 3ZZYA 2F9JA 4ZITA 4TLQA 3BGRB 2DNYA 3MM7B 2F8HA 4G65A 2VJVA 3MCMA 2N7CA 4K8RA 4M5HA 2HK3A 1SBRA 5LM7E 3KDOA 1PGZA 4QWEA 1U49A 5E41A 1YWXA 2KXFA 2G1HA 3DM2A 4DUYJ 3M2UB 4ED3A 4RUHA 3G96A 1IQTA 3I0SB 5L38A 3MD3A 5DQIA 3AXMA 2OD4A 4EMDA 5A6WA 5LMUF 1SH0A 3UW1A 3HVRA 1B0TA 5KOXA 1VJWA 3WX8A 2ADBA 3FBCA 1MG7A 2C2ZB 2ALZA 1YGYA 3D6MB 3QFWA 4DSFA 4DPXA 4OZ2A 4F04B 2RQMA 2WHOA 1TKTA 3MUTP 2CPFA 1Y7PA 3T5JA 4A48A 4DN9A 4JI4J 4DG1B 4WP3A 2CPEA 1QSSA 1ZZNA 2ZOMA 3K0JA 1YHQS 4KO0B 4ZHRB 1Q95G 1RDRA 3T19A 1QJHA 3WZ0A 4I2QB 4C3KA 1Y5LB 3MEEA 3PJ9A 4NZ0A 1ZA1B 3ZTSA 2LXIA 4MMOA 4LF5F 3FKBA 4C9DA 4AQYJ 2XHCA 3KHGA 2R7TA 1FWPA 4AUKA 1WD6A 1C4CA 1RXOB 3I56S 1EHWA 1SC1B 4ERDA 1NPKA 3NOGA 4F25A 1TUVA 1S99A 5DQHA 2Q43A 1R31A 4X64F 2I5JB 2AHOB 1GEHA 3JSRA 3HVWA 4ED6A 3MMBB 3RYLA 1UPPA 1N34J 3BYRA 2CPXA 2HHTA 1IBCB 2HQFA 4RW4A 1RWPB 2X51A 3SV3A 3EZUA 2UVWA 5J1NA 4IRDA 1EB0A 5J1EA 1RT5B 1ZPWX 4FNHA 3H98A 2NYIA 3MR3A 1YZ6A 1RBOB 4ILMA 4IR1A 1U4BA 3H2VE 1UFWA 1OY8A 3R6LB 3P49B 1S1TA 4X62J 4J9QA 1MWYA 4XDCA 5IWAF 1WC3A 5BYSA 1MU2A 2RKIB 3GSIA 1KQGB 1CJUA 2M70A 1I94J 2DGSA 2BJEA 2YQ3A 1IKVB 4C8LA 5DM7Q 3QZ7A 4M5NA 5KT5A 3OXFA 1M1KT 2OH2A 3FVYA 2XS7A 3IN5A 3O2IA 2VPZB 1TZ0A 1D8ZA 1U1KA 3V5RA 4JI0J 5F0UA 4C97A 4C4WA 3D5MA 4IFVA 2BM1A 4V19X 1Q5YA 2XYGB 1ZA2B 2BANA 2YNFB 1SV5B 1XR6A 1RT1B 3W60A 5M2RA 2LQ9A 1VC5A 4B3OB 1ZAVA 1WACA 3B54A 3QZ8A 3EVOA 2COLA 3G82B 2Z56B 3BPDA 5HO4A 2R2RA 1J27A 1RISA 5HQ8A 3CO0P 3MPVA 5C2CA 3P45B 5IV3A 4P6QA 1KONA 3KHLA 2AX1A 4MJKA 1WHWA 1D3WA 2G0CA 1RTHA 4M5GA 5D4NA 5T7LA 2BBEA 3QJJA 1NO8A 1Z2ZA 3TA0A 2BABA 4KPCA 1B70B 3QIDA 2AJ4A 4BDPA 5A8RB 2GNKA 2ZZMA 2J6UA 1FK9A 5GAEU 3IWXA 4LT6A 4N56A 4FF4A 4ECUA 4XAKA 1VQ9S 3NCQA 1X0FA 4JI5J 4NLUA 2MSSA 2VH7A 1KC8T 3ZO7A 3QT7A 3TVYA 2DGTA 3BKUA 1M5HA 2HLUA 3GYGA 3MD1A 1JLCB 1CJVA 4F0KA 5CYQA 5LXRA 2JLEA 3OR2A 4XK8C 4DV6J 1JJCB 3N4WA 3GIMA 1NJWA 3RAXA 2ZOGA 3T1HF 4C0BA 2CNOB 4NLQA 4P7TA 4Q7AA 3ZZPA 3D67A 3HSJA 3TX0A 5HBMB 4OYWA 1FJEB 2IIHA 3MAAA 3I5CA 5B0CA 4IQMA 4PXEA 3DLKB 1U6ZA 3VAHA 3C66A 5H1SV 4WFAQ 4P74A 2XNQA 2DR7A 4DV7J 3ILLA 3O5TB 4M94A 5GAHU 4P52A 4WCEQ 3EYZA 4Y34A 4G1QB 4X4UA 2B6AB 2FD2A 3RB0A 4OHYA 3FJ2A 2F4VJ 4IFYB 5IC6B 4FF2A 3F0NA 3OJSA 3K8WA 5KFNA 3FZ2A 2UXDJ 3BH6B 1RI7A 1EP4B 2BE9B 4OZ3A 5AE3A 2OMOA 2Y0SD 3FRYA 1U09A 2XWYA 4DX7A 1JKHA 2H5JB 2QMWA 2A1BA 1HQEB 4LF7J 1T3NA 1CJTA 4ZP8A 1M5PC 4LRAA 1X8DA 1LFPA 1I3OB 2ZH1A 5HLFB 4OZJA 3KFWX 4JI7J 3AJ2A 1IKYA 4DL2A 2GFFA 3HZGA 4F2SA 2QSFA 3PHEA 1W2BR 3TA1A 5GAGU 4O4RA 2PE8A 3I9V9 4KGXB 3MAQA 1DQ9A 4N8OA 1IBLF 1JLFA 4FS2A 3BSCA 1YG0A 4RW6A 1S10A 3VGSA 2EEYA 2UUCF 4R5PB 2ERRA 2GMHA 3NCPA 1RAGB 4YDXA 1XMOJ 1NPPA 1G3OA 3US5A 2Q1LA 4ETZA 2F65A 5F8MA 1GMUA 3HHLB 3QJLA 3K89A 4RNFA 4CM0A 3Q22A 4AT1B 3PR5B 4NPOA 4IG3B 1OWXA 4I2PB 1VBXA 1QAYA 1T9UA 1IKXB 1VQLS 3B4DA 3PDNA 3CCWA 4LF6J 1V6HA 3QIPA 2FTRA 3LP1A 4M1KA 1JLAB 1U8WA 3MECA 1RAJA 2MPUA 2LXUA 4TQRA 2EG2A 3LA0A 2RS2A 3MM9A 1ICEB 4CLYA 2HEKA 3EE3A 3R1LA 3BSNA 4QCLA 3H7HB 3M32B 4A8FA 5ITHA 3ZTQA 1R3NA 2ZVIA 1VBYA 4KBIA 5EUHA 3N6LA 1HNIB 5C2GA 2YWWA 4ZVQB 3AD9C 3NMRA 5FLXU 2HFNA 1NBEB 4EYHB 4NXNJ 1KFDA 3ISZA 2HMIA 3SSQA 5DQGA 4HACA 4ECXA 5I42A 2HBQB 5KT2A 1RT3B 3OXLA 3R6GB 2CZ9A 3W63A 1FT8A 5DS7A 4KT0C 3H20A 4QPXA 4A8SA 3THVA 3VF0B 1FKAF 1HR0J 2KFZA 2HVZA 5F8IA 2QLBB 3LW5C 5J2PA 3QAUA 3O44A 1KTQA 3D0IE 2E5LJ 4IRKA 3W5ZA 2NUUG 4KGMA 3LP2A 2Z0GA 1RAFB 4B3MJ 2WCXA 2QYCA 2OMLA 3MMAA 5AXKA 3SQGB 3IRWP 1KQSR 1KTVA 4LRCA 1TUGB 3OPKA 4RO0A 5KFBA 2LDIA 4ER8A 3MHYA 2HZCA 3Q8VA 1FVSA 3OR1A 3OFEA 2FDNA 2GS8A 4OYAA 4J9UE 2ZDPA 3OW2R 3J81U 1FRIA 4UQTA 1XNQF 1GXLA 3C14A 5IM0A 3DDIA 3ADAC 3RB6A 1REVB 3AB2B 2KJVA 4W92B 4DL4A 4YY3J 5A76A 1OY9A 2MLYA 3QGGA 3CJ4A 3ZC4A 3PJXA 4TY8A 2IJNA 2YBVA 4DUZJ 1NJXA 1QY7A 2FLNA 4D3HA 4EU0A 4GVBB 3PX0A 1X4AA 2FJVA 2HHPA 4KR0B 2MDAA 2VL1A 1H2UX 1QE1A 1T02A 2VPWB 3EDQB 2HVIA 5DGAA 1UFLA 4O4GB 2JFKA 3OHAA 5LL6d 4JP8A 5L1LA 2CXEA 4Q8FA 3OTOJ 1VLOA 1DTTB 4WP8A 2IHR1 3CDBA 2DHSA 3IAS9 3ENVA 1VQ7S 2V67A 3CULA 1OQ3A 3CCES 3S6EA 5CXTA 4YFUA 1RT4B 3NOCA 4HEA9 1A7GE 4YEAA 2JVOA 2PA8D 3P96A 3RGIA 2P2CB 4NEYA 1WUUA 1MNEA 2KTQA 2BKOA 4G6VB 1V3RA 4W98A 3VAGA 2ASDA 1UVNA 3KLEA 3D3CJ 2JJ4D 2MKJA 3PYEA 4DQQA 5DLGA 3CDAA 2EKNA 4DV0F 5ETMA 2YNIB 3H8YA 2VG7B 4ITSA 4ETXA 2P9EA 4XDDA 4FPRA 5KT4A 2JL9A 4LFAJ 3SCKE 1SI9A 2OEMA 3NNCA 1U25A 3ZZ0A 3VQTA 2DHXA 2FIUA 2M9KA 4ZIWA 2E5JA 2YVSA 3TX8A 5ETLA 4CTAA 1KKHA 3EUNA 5HVGA 4LF5J 3BGOP 2BE7D 4QIWD 4FYVB 3IG1B 3NLCA 1GAOA 2RVJA 1NXIA 3AOAA 2EFVA 4I64A 1VISA 2LQBA 5KFTA 1WC6A 3KMSA 5KFIA 1S9GB 2AW0A 2R4FA 1N52B 2IAJB 4KB7A 2B3TB 3BJYA 4CO3A 4E8UA 1SCJB 4TU9A 2V63A 4I56A 4FS1A 5FD1A 5K14B 1VBKA 3HP6A 1DLOA 1Y9OA 4YDDB 2CRLA 4KAIA 5H9EK 1DRZA 2WONA 2QO3A 2HBRB 4DI6A 1ZBTA 1JK9B 2NQPA 4YOEA 1RKIA 2Y1IA 5B0AA 1NRKA 1VRUB 2Z2MA 5IOLA 3M2RB 2DHGA 4WXOA 3GU0A 2CAJA 2MSTA 3QLHB 1FXLA 3K58A 4X4TA 1T3OA 2BJ9A 2VOPA 3AFGA 4U67Q 4B9UA 4LFCJ 3H0PA 2KU7A 3OBIA 1XJWB 2KHDA 5DO2A 3J7Z5 2RHQB 1GMVA 3M4XA 2M8HA 1Y3JA 4GKJJ 4OHZA 2H5EA 2RRAA 4CI0B 2VD3A 4MAKA 3P5TL 1CULB 3DYAB 4F0HA 2YQ1A 2XMUA 3KG0A 2Y8YA 2JFDA 1FRKA 3W2WB 3DI6A 3JTOA 1N33J 3VCDA 2IM2A 4OHXA 3Q8QB 4RWWA 2D3UA 1BY9A 1UETA 4ZVOB 4ED2A 1WG5A 2XWXA 3RRGA 4LBPA 1HL6A 1K44A 2H51B 4QU7A 1WDDA 3R5BA 2JEJA 3V81B 2OSQA 4HH0A 1S6PB 3QO9B 3OUYA 1RB0A 5K8OA 1CSJA 1MROB 2CPYA 4WZMA 2J9CA 1R8AA 4WE1A 2NXEA 2KH9A 2YNGA 2MQLA 4DL0C 1FJGJ 4BWJA 2A0FB 4CO2A 1FDDA 3KLGA 2BUNA 1MLAA 3MEGA 3CPWR 2BOAA 1LXNA 2RMLA 3TJ9A 1BWVA 2IM0A 1XBWA 1Y00A 2DGOA 2KYXA 3PFEA 5L9XA 4CP5A 1F5AA 2BOPA 1YX2A 5HP1A 1OYDA 4G1PA 4Y2AA 4DV2J 3K8VA 2MJNA 2M52A 4ZCMA 3NEKA 1LWFB 2JHEA 4TLRA 2DITA 3CTRA 1BE4A 4CLFA 1U1MA 1UJ6A 2MHNA 4HHUA 3KUHA 2MQOA 4U8VA 3TQ1A 4X4OA 2FGOA 4ALZA 5K9FA 1OIAA 5CA5A 3EXCX 1FWLA 4USHA 3BYPA 1J5OA 4JI1F 2K3IA 1TKXB 4Q44A 3GFYA 3QJPA 2BQUA 1S77D 2XI3A 4ZLJA 2AGPA 1P27B 1IJEB 3G87A 2CDRB 4ZK7M 2C2KB 2E1PA 3GG0A 2CQIA 4KE5A 4CO5A 1APSA 3L4BC 1WSRA 4RWXA 3C15A 5AJ3F 3H5XA 2JX2A 2PI5A 5CCLA 3L7PA 4TU8A 3LGHA 1C1BB 1RT2B 2VBYA 3PKYA 3JYTB 1KEKA 4ZVUB 4L74A 5K8NA 3BGRA 3BKTA 4RW8B 2QJ3A 3HCXA 1K0VA 3MXHP 5H9FJ 5D6GA 1S97A 4DS5A 1NM2A 2VKZG 4FZVA 1YQHA 1NKEA 2FLLA 4M5KA 1NDCA 4NRUA 1VK3A 2A2DA 3CUNA 1D9FA 3M2UA 3PX6A 1RBAA 4U9RA 3TARA 1UZHA 4Q45A 3I0SA 1QAJA 4U96A 1X9SA 1BC6A 2J6TA 5KFHA 4O0NA 1RADB 3MDFA 5B08A 3D54A 4RNHA 1K8AT 4DSKA 2BJ7A 5I3UB 2HHXA 5BR8F 3U1MA 3CCLS 3FBBA 3BQ2A 3T5KA 1ZTTA 2IRXA 3NL0A 3GFXA 2KZZA 1JJ4A 1S9FA 4DG1A 3M2VB 2EW9A 4LVOP 4MK9A 4KO0A 4ZHRA 2FLOA 2D3OR 4EK2A 3BGUA 4ZPCA 5KG2A 1S9EB 2GMLA 2FVCA 3CVKA 1PSDA 2O1PA 3MPWA 4N77A 3ZZZA 2CWKA 4J91A 3KK1A 2EG1A 4IH5A 3TUZC 4EBDA 2EC0A 2PN6A 3Q8YA 5LJ5Y 5SZTA 2DXDA 1BQNB 3PX4A 4ZKAA 3NS7B 1C1CA 1IBKF 3EWGA 2I5JA 3CCRS 2VG6A 1J2VA 2VQFJ 3NAHA 5LJ3Y 4OMFG 5LSLA 1UL3A 2M2BA 1UAWA 3MR6A 2IRUA 2C3OA 2OP5A 1UA0A 3N01A 1XTZA 4RW9A 3JSYA 1UWAA 1B4SA 3HX9A 4MK7A 4PCQA 4ZN1A 4AXJA 4F50A 2EFGA 3OXGA 1NKBA 3W5YA 1YKWA 3W66A 5KG3A 3DM2B 2IJFA 3D1QA 3HPOA 1VFJA 2CJ9A 3HD2A 4B3TF 4K4WA 2DNOA 1RT5A 1V3ZA 2DGUA 2C3PA 2EFNA 2ASLA 2DRBA 4DCPB 1GMWA 1RACB 4HTIA 3VV2B 5AXNA 4WYLA 3BV8A 1X7VA 2OEKA 1H74A 5CABA 1C4AA 2ZH5A 2UP1A 5C5JA 2DGVA 3ILOA 1R0CB 1REGX 4ZLLA 2LP4A 3D3BJ 5K8MA 3LTOA 3P5BP 3SDEB 2R7VA 1TKTB 2BYCA 1VMBA 3PR4A 4MFBB 3FCHA 4F0MA 2ALYB 1K1SA 2CWXA 1YJNS 2Y9HA 2X3GA 2QT7A 3NGKA 4ED5A 1SL1A 1BHNA 3J7YI 2W4DA 3N5FA 2XM3A 4GC6A 3PKMA 4J9NA 4QYZJ 2DNRA 2DBBA 4P9SA 3OTDA 2ZH8A 3SI8A 1TV6B 5KFZA 3A4TA 4S0MA 4NCBA 1SV5A 1A9NB 2KM8C 3EZOA 1H6KX 3AJDA 1RT1A 1VRTA 3UE2A 3TAPA 1CVJA 4LF4F 2XC9A 1X0PA 3GTYX 1SH2A 4JI2F 2G1DA 4HH1A 2MQPA 1S0MA 3AJ1A 4UUXA 5AT1B 2FVRA 1RAOA 3JS9A 1XNQJ 4V1Ak 4DOZA 4KJIA 3VAMA 4K0KF 1Q0NA 2N4DA 1M1GA 4L75A 3KLFA 2W24A 1JLQB 4LIRA 1OMSA 2L9WA 2AMCB 2ZUAA 3GJQB 2QSWA 4IRCA 4YR3A 5J1EB 4M5DB 3QATA 1SH3A 5F8NA 2RT3A 2VFUA 3M9NB 1Q81T 2E5HA 1N8RT 3LALA 2GJ2A 3NAIA 3I5AA 4IYQA 5T14A 3FSYA 1S1TB 1G6BA 3IA0A 3UVJA 1MU2B 5KFPA 3QRQA 1IBMF 1CJUB 5J2QA 3LPEA 4PPDA 3TI0A 3QRPA 1SL2A 1NK6A 3OHBA 3W2VA 2O67A 2Q6BA 5IT9U 2OGUA 2LEBA 5JMNA 4NXMJ 3RTVA 4UQGA 3DDKA 1RP5A 2YWHA 2GX8A 2VIHA 1T9YA 3A3PB 2ILYA 3JSMB 4IFVB 2R8GA 3S01A 4RL1A 1I51B 1WC1A 1GK8A 1MN9A 5L1KA 3BDPA 3KHRA 4L76A 3TZWA 2UV8A 4USJC 5EGYA 2HK2A 1MWQA 3I5BA 4NLXA 4DEZA 4CQ1A 4G1QA 2B6AA 1UEUA 2KZMA 3HF5A 3B82A 2HSEB 1DHMA 3EZ5A 2YPYA 1U47A 2QC3A 1HYSA 1EP4A 3RBDA 2XGQA 1RTHB 1CJKA 1JXEA 8RUCA 3LP0A 3MR2A 3L3CA 3G6YA 2VC0A 3EGZA 1K0TA 2UVUA 3CD7A 1KFSA 5HLFA 5IQQA 1PAEX 1FK9B 3TJ8A 2BEFA 3K5PA 4NRTA 1WKKA 2MTLA 3W9JA 2J7WA 3AH6A 1RLDA 1Z2LA 4ZPVR 3EPIA 3L9ZA 4NI2B 2XY6A 5U47A 4F02A 4R0EA 1OPZA 3G6VA 2GC8A 1TR0A 3JTPA 2W9AA 1ZPVA 4DV4J 1RYRA 5CYQB 3BREA 1IN0A 4O3RA 3OR2B 4CLPA 1VQMS 3A13A 2P9GA 3KYLA 4C3MA 1NEEA 4R5PA 3I9ZA 3DHWC 2IRYA 4OIXA 4QPTA 4C7QA 1S79A 4WU2A 3WIUA 4K4VA 1EKSA 1EIYB 1FX2A 4LF1A 4I6YA 4DR2F 3RAMA 1TKZB 3D0GE 2Q66A 5E3RA 4UOHA 2DD8S 1FFGB 2KO1A 4B9SA 3L95X 4B3RF 1X5PA 1S0OA 3TR5A 4XPCA 2LMIA 4NLPA 5K20B 1X31C 1YJ7A 5HN0A 2D1CA 4B9NA 1KVIA 2G2ZA 4O23A 2OD6A 2ZBPA 4IOCQ 4MK8A 1XQIA 5DRKA 4Q43A 1MWZA 2XMAA 1HBNB 1JKHB 4NLOA 4NCGA 1UJ5A 1RWXB 3H4DA 2IVFB 1WC5A 1EJ7L 1NHVA 4PQAA 3M32A 2QIFA 2CQ1A 2CUYA 4C8KA 4EZ6A 2N82B 2WBRA 1HNIA 1N54B 2R7OA 2N3OA 2GAGC 2GO9A 3UR0A 4DUYF 3GB0A 2NR0A 4LRDA 3GJSB 3OSNA 5HROB 3AA9A 2XBPA 2LYVA 4JV5J 2UUAJ 3K5OA 3K5MA 4IQXA 3M8PB 2OPQB 2C2EA 3UCUP 2DHAA 3CJTA 3FEXB 1FRJA 2A10A 1OSCA 1G2EA 2IA6A 3IXQA 4HR2A 3MR5A 3ZFVA 2P6TA 4CLTA 5ADZA 2E9RX 4P72A 2GJIA 3KK3B 3LWMA 1NK5A 3G9CA 2HYIB 1S72S 2G4BA 1EAYC 3ETOA 1RHRB 4GC7A 2XGPA 1MSWD 1PYSB 2ZVSA 3SQGA 4ZVSB 4C98A 4P73A 3JAMU 4KSEB 2CPHA 1RK8A 3PNIA 1RWOB 3LANA 1TP7A 2HW3A 2ZE2A 1TL3A 4AQYF 5BYQA 4CLUA 3RU0A 1X4FA 3G86A 4C6AA 3T5HA 3P6YC 2XHWA 1IWAA 2A2CA 1QD1A 4ECQA 3D0HE 1HWKA 4RBUA 4CNYA 1U8SA 1UA1A 4HKQA 3F41A 2HNZA 2YX7A 3KNGA 2J8AA 3MM9B 3DLEA 2VG5B 1VQYA 5IT9Y 4BC7A 4I67A 4JI1J 1FRHA 2VBWA 1REVA 1N34F 4ID8A 2RDDA 3IR6B 3PEHA 2E1RA 1T9VA 3I96A 3K17A 4NE9C 2QEXS 4OJGA 2W4PA 5CAAA 3GR1A 2HMIB 2GHVC 1T94A 4HACB 4GVBA 3PM9A 1X4CA 1L3VA 2DEJA 1N5SA 1IQZA 3SSRA 2GO8A 5KFAA 1J5EJ 1RWNB 4AYBD 4YR2A 4NLGA 2XQCA 4H4KA 4O4GA 1RTDB 3H90A 2MQNA 1XMQJ 5D0GA 2WRMA 5DETA 1HWJA 3T5LA 2I0XA 4WFYA 1U6FA 2RU3A 2E9ZA 1PC4A 3CD6S 1I94F 3GWCA 5J2PB 1X4HA 4MT1A 1NKCA 1X9WA 3EGVA 2DEIA 3LP2B 1N5YB 4DDFA 2J0SD 1YRTA 4NYOA 2V8PA 4JI0F 3MMAB 4ZVTB 5KFQA 1RT4A 3BBFA 1M5VC 1NDPA 1HHQA 1RWUA 4A47A 2RB7A 1PILA 3SQOP 4RU9A 1SQFA 1U24A 4LR8A 2BJ1A 5MAOA 3AAWB 3BN7A 4AL6A 2OPPA 3VTIA 8AT1B 1S1VB 1AYEA 4A8WA 2V9KA 4WPAA 3GR0A 4FBUA 4ED8A 3WIVA 4ED0A 2VG7A 1RBLA 2ZH9A 1GTEA 4ECSA 3C14B 5IM0B 2FHKA 3PVXA 3NCRA 2ZKTA 1QAXA 3MWBA 1T7PA 2BKPA 3MEDA 1XR5A 1FEEA 5JVGQ 4BWMA 2QFIA 2CG4A 2LKZA 2BKNA 4NX9A 2ZEJA 2MZQA 3W62A 2QA4G 1ULRA 2J0WA 2XO6A 1LKZA 2LDYA 4OQJA 1M5OC 1TK0A 4ID5B 5EDWA 2HVDA 2Z8QA 1H98A 3MTKA 4JI5F 1KHVA 1S6UA 3G8TA 1QE1B 1Q5VA 1WORA 2DKOB 1IBKJ 4E0DA 1X60A 2R7RA 4QWCA 2B56A 3J7YU 2E1AA 4PWDA 2RQKA 2XY5A 4NL5A 1HD1A 3EDRB 1TKDA 4K7QA 5K14A 4L6V3 5E5NA 5F0WA 3FRZA 3MR7A 3IM8A 4RR5A 3ONQA 1SJ4P 2EXUA 2HFOA 4B3TJ 2IY5B 4K2XA 5EX3A 5HMWA 4ZN3A 1KLNA 2VPXB 3M2RA 2CPIA 3SBMA 2UXBJ 1RQ0A 3QMQA 3PIPQ 2HHQA 2FVPA 1R27B 3S7RA 4HDHA 4DPOA 1U48A 5A6PA 2W2PP 5A2QY 1S76D 1VQSA 2NSBA 5J2NB 2D3O1 1FFWB 1RA7A 2NZCA 1VR6A 3V6DA 2PMWA 2HIQA 1CQMA 2ACYA 2M5YA 4DL7A 2XI2A 1CULA 3GCWP 2Z57B 3DYAA 1ELOA 4NLRA 2X1AA 1HNWJ 1IR1A 1RT7A 1DTQA 1D09B 3FK4A 5CZXA 4CTAB 3DN9A 4KKOB 1CS4A 3UO0A 3DXBA 4DPUA 1F9EB 4HT5A 3DGPB 2CQHA 1W7WA 3IO1A 4FVCA 2NYHA 2PC6A 2XSJA 3QO9A 2HGLA 1MROA 2BQ3A 4TXSA 2W1BA 4ANDA 5GAHI 5IXUA 1DLOB 4WK1A 1LK5A 3VALA 5I3QA 2LU2A 5E3QA 1GH8A 3HFZB 1XMOF 1WOSA 3DOKB 3ZXWA 4FF1A 2CQ3A 2C2MB 4B9LA 1NLKL 4UZBA 5KFEA 3W64A 3DLBA 2ZH6A 3W8GA 4EGLA 4KPYA 3MCOA 2HGNA 5I4MA 4WIQA 5D3GB 1Q8KA 1N88A 4ECYA 2I2YA 1T95A 2M8DB 1Q82T 4R25A 1B3TA 4LF6F 3OL8A 2DR9A 5DLFA 5DJBA 1JXLA 1LWFA 2FJDB 3AD7C 3B8HA 3B4MA 1HBMA 2JRSA 4WF9Q 5BYRA 9RUBA 1RAEB 3AOBA 5B09A 3CE8A 2C1EB 2C2RA 3BO3A 1KBRA 2NSCA 3MFHA 1YVFA 1NDKA 3HK2A 4DX6A 5F8LA 4A8OA 2KG1A 2PEBA 4ECTA 1TK5A 1EKRA 1NZ8A 3U02A 2QMXA 4B9TA 3GE9A 4NA3A 3CJKA 4NYZA 3K5LA 4NXNF 4RNNA 3SCJE
chains in the Genus database with same CATH topology
5KT4A 3IS9A 2JL9A 1AUDA 1KR4A 3EGWB 4HI2A 1S6QB 1LOUA 3HMJG 1H2TZ 2MKCA 3BEGB 3SCKE 1SI9A 3NNCA 2WSCC 1H2VZ 1U25A 3HHEA 1C0TA 1IXKA 4NLTA 3ZZ0A 1ZTWA 4NLYA 2WTFA 3PO5A 3VQTA 1WI6A 2DHXA 2L08A 4CH0S 3R1HA 1YIJS 2FIUA 2M9KA 4A46A 3N9UC 2E5JA 2YVSA 3TX8A 4KIAA 3M9OB 3KJVA 3QIPB 4YR0A 2VASA 1ZM3A 2NUHA 3OUYB 4CTAA 1VQNS 2XSFA 3LP1B 3EUNA 3TANA 1C1BA 4NA2A 4WXWA 1VC6A 2VONA 1RT2A 1NJZA 2VBZA 2OPSB 4PUOA 4QIWD 3MECB 5F9LA 4BCAA 3JYTA 3BR8A 3IG1B 1JWWA 3LAKA 2FJXA 1VGYA 2UXBF 4OZNA 2MKKA 3NLCA 4YP3A 4NOHA 1GAOA 1GTHA 4QW9A 3IFEA 3GFZA 3THPA 2Q79A 2RVJA 3PEJA 1DURA 4N41A 4ICLA 2FJAB 2M4MA 2EFVA 3NP5A 4DWIA 1UP1A 5KFRA 4I64A 2YNGB 4IH6A 1F0XA 2HHSA 1Y5IB 4ZP7A 2DPJA 3KLHA 2F3JA 5E7OB 2HLTA 2LQBA 5KFTA 2LLZA 3KMSA 3MGJA 3KLGB 5KFIA 1S9GB 2AW0A 4F3QA 2R4FA 3WBZA 1N52B 1DBDA 2K1RB 2IAJB 4KB7A 3CJ3A 2PMZD 3M8QB 1DJ0A 3NBPA 4B3MF 1U1NA 4RBVA 2B3TB 1LFWA 4ZOSA 5IT4A 3BJYA 1AW0A 4CO3A 4F3MA 3KHHA 3I82A 3CWJA 4E8UA 4F3OA 3LQVA 4TU9A 2W9BA 2ZHAA 4I56A 5HMYA 5KFFA 5FD1A 2DCLA 4FS1A 1U26A 2XB2D 2OTJS 1VIXA 1S7HA 3BSOA 5K14B 5I42B 2DR5A 2V4RA 2NPIA 1FRLA 5G4DA 3HP6A 4N5SA 5C24B 1DLOA 2B9YA 3DRYA 4CO1A 1HBUA 1VQ6S 1Y9OA 4YDDB 2CRLA 2HWTA 4KAIA 1DRZA 1URNA 5I3UA 1YRXA 2W9CA 2WONA 2QO3A 1E6VA 4K4TA 1ZBTA 1LWEB 1JK9B 3OVSA 1HNWF 2NQPA 5HP1B 4YOEA 2HNDA 1RKIA 3PY8A 4PG7A 5SUHA 2C2DA 3FMBA 2Y1IA 5E33A 4KFBA 5CCMA 2KYZA 5B0AA 3DLLQ 1NRKA 4QR2A 1VRUB 2Z2MA 4KQZA 1U1LA 1NNDA 2CZ4A 4IG0B 3M2RB 2FPHX 4EBCA 2DHGA 4WXOA 4X62F 2Z2LA 4IO1A 2X1BA 2N3LA 2XS2A 2MSTA 3OTCA 3QLHB 1FXLA 3K58A 2VUGA 4X4TA 2DK2A 5MLCV 3MUVP 4DMZA 4ZP9A 1T3OA 3JTNA 2CJBA 4ECRA 5C25A 2VOPA 1OQ6A 4U67Q 2DRAA 3HZEA 3N6NA 4B9UA 4TN2A 4GKKF 1SL0A 4K4XA 3WC2A 1Q78A 2M0GB 1AROP 2KU7A 2KJWA 4KC5A 2F9DA 3QWUA 3OBIA 2A3JA 1WEYA 2AGOA 3IR5B 1DTTA 3CDUA 2QZ8A 1BGXT 1FHTA 2EBGA 3DRXA 3W3SA 1J5OB 2J76E 2XMTA 2KHDA