2YL8A

Inhibition of the pneumococcal virulence factor strh and molecular insights into n-glycan recognition and hydrolysis
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
434
structure length
434
Chain Sequence
NEKLAKKKIVSIDAGRKYFSPEQLKEIIDKAKHYGYTDLHLLVGNDGLRFMLDDMSITANGKTYASDDVKRAIEKGTNDYYNDPNGNHLTESQMTDLINYAKDKGIGLIPTVNSPGHMDAILNAMKELGIQNPNFSYFGKKSARTVDLDNEQAVAFTKALIDKYAAYFAKKTEIFNIGLDQYANDATDAKGWSVLQADKYYPNEGYPVKGYEKFIAYANDLARIVKSHGLKPMAFNDGIYYNSDTSFGSFDKDIIVSMWTGGWGGYDVASSKLLAEKGHQILNTNDAWYYVLGRNADGQGWYNLDQGLNGIKNTPITSVPKTEGADIPIIGGMVAAWADTPSARYSPSRLFKLMRHFANANAEYFAADYESAEQALNEVPKDLNRYTAESVTAVKEAEKAIRSLDSNLSRAQQDTIDQAIAKLQETVNNLTLTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-N-ACETYLHEXOSAMINIDASE
publication title Inhibition of the Pneumococcal Virulence Factor Strh and Molecular Insights Into N-Glycan Recognition and Hydrolysis.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
total genus 172
structure length 434
sequence length 434
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2011-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.90 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AF1782-like 2yl8A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2yl8A01
4MDOA 4GO9A 2VL4A 4UR9A 5I24A 3ZM8A 3SCOA 1V03A 1JNEA 3BC9A 2GVYA 3MANA 1B3WA 1E5NA 2WVTA 4JFUA 6CGTA 5BXRA 1W9PA 4JFVA 2BVYA 5A8OA 4CD4A 3J7HA 4W89A 1B3YA 5E0FA 2Y5EA 2NT1A 5A8PA 1VBUA 3LPFA 1CBGA 4U31A 4M29A 1GUVA 3AS1A 3GNPA 4NI3A 1KBBA 2E3ZA 4OKDA 2J7GA 4D72A 1E9LA 5A94A 1I1WA 1QI0A 4LQ1A 3VD4A 5E6YA 3VKKA 4WKFA 4A4AA 1XGZA 3AJ7A 1BVNP 3VIHA 4L4PA 3CLWA 1SMAA 2JFEX 3N1AA 3ZJ8A 1UWQA 2ZXQA 4RE2A 1J9YA 1W3JA 1WE5A 2WMIB 1V6UA 4AZCA 2J74A 4DWSB 1G9HA 3AMGA 4JAWA 1QBBA 3VU2A 2CHNA 2GJRA 3L2LA 5I0DA 1J18A 3AXXA 3VO0A 5C71A 1TFVA 4M56A 2CBUA 2ZUSA 4AC1X 1QOXA 5D9NA 2J75A 5F7UA 2EPNA 3T2OA 3CZEA 1ZU8A 3SCSA 3RDKA 1C7SA 4JL2A 3WF3A 4D1IA 3U5UA 2ZUTA 4QAWA 3WNOA 2EPMX 2XHYA 4JFSA 2F2HA 3U7BA 1TE1A 1J12A 3ARSA 4IPLA 1EH9A 1W9DM 1BPLB 1VFOA 2DQXA 1VB9A 3THCA 4CD6A 1KFWA 1DWHM 3B9AA 2EQDA 3WH9A 3RJYA 4J28A 1UR1A 7TAAA 3VIJA 3A6OA 2XYLA 4S3JA 3WD1A 2V3EA 3GZAA 3CHDA 3WEZA 3BAIA 4HA3A 5A6JA 3AS0A 1XYZA 1NOUA 4W7VA 4PUDA 4PUEA 5CQ1A 1JZ5A 1JD9A 3ZR6A 5HDRA 4B15A 1L0PA 1BYBA 3BAJA 2WWCA 3MMWA 3RO8A 4ZE4A 1VJSA 2A3CA 3F5LA 4ATLA 1CXEA 4UCFA 1BYDA 2ZUNA 2GDVA 1G94A 3VD9A 4KGJA 4QDMA 2YBUA 3W4RA 2BVDA 4UFIA 1ZJBA 1LL6A 3RM4A 1O7AA 1LG2A 1V3IA 3VIPA 3E1F1 3MMDA 1WZMA 4AD1A 5EMYA 4BQ5A 1E6XM 4B16A 2BS9A 3AHZA 1DEDA 3WQVA 2ZWZA 5A8MA 2WHLA 2RGMA 3AIEA 2WSKA 1FP9A 2J79A 1S46A 1UH3A 3KEHA 4PMUA 4KMQA 1QNQA 3PZIA 3K1DA 2B31A 2GSJA 3K8KA 3PZQA 1E71M 2JEPA 2VR5A 2VX7A 4UQEA 2Y4SA 3ZT5A 4PN2A 4GI8A 1NWUA 4EKJA 3WL1A 3B9EA 1GOWA 2JF7A 2QMKA 4MJ2A 1MW2A 3AIQA 1PPIA 1GCYA 5BXPA 1CLXA 4X0NA 1GQJA 3CZLA 4FLOA 4KGLA 3AOFA 2ZE0A 3FNDA 1E6QM 3TP4A 3IAQA 3ARRA 2GJXB 4PMVA 1DWAM 2V5DA 4UOJA 4F9JA 1OM0A 3DYOA 1E0XA 1Q6CA 1VRXA 4MB3A 3K8MA 1Q6EA 3AMLA 2XFFA 4UTFA 2YA2A 2VMFA 2WVVB 2Y8KA 1UKQA 1GORA 1PX8A 3F5JA 3NJ3A 2BY0A 3KL5A 2VC9A 2ZWYA 4P7NA 3GNOA 5I78A 1E0VA 3WMSA 1CLVA 1QPKA 3F4VA 4JL1A 1B3XA 3IK2A 4AD3A 3BCFA 3VDCA 4MNMA 3QR3A 3VX0A 2DT0A 4BA0A 4ZEPA 1FHDA 7A3HA 3AXHA 3CPUA 5FD0A 4AEEA 1TVPA 3VIKA 1JXJA 4PBGA 4CKQA 3T0DA 4PMNA 1CTNA 4HA1A 2PMRA 2VQTA 3BMVA 1QW9A 1ZBVA 2CKSA 3VGBA 2VO5A 1W2VA 2V38A 1UA7A 3RILA 4UZUA 4J3VA 4NZCA 4AD5A 1V0KA 4Z2KA 5GNXA 2W4XA 2GFTA 4AD4A 4KRTA 1ISWA 1GVIA 1RP8A 3PZTA 1HX0A 1KXQA 1LWJA 3FHQA 3CMGA 2WHMA 5M17A 2GK1B 4MDPA 2QPUA 1UD8A 3MUZ1 2CESA 4AW7A 1QVBA 2X05A 2OYLA 3UG4A 3WH5A 1AQMA 2OZNB 3W24A 5E0CA 5M5DA 5DMYA 2CXGA 3WSUA 2CPUA 3DYPA 5DEZA 2G8ZA 4CVWA 3ZJ7A 5CGMA 1DWJM 2W91A 1XV8A 1BYCA 5BCAA 3AIVA 2BHYA 2FH6A 2CNCA 4HOWA 3W82A 3RMEA 3UG3A 1XH0A 3RM8A 1W1YA 3WD0A 1NOFA 2WPGA 1DWIM 1W9XA 1JG9A 3AHXA 2CKRA 1OGBA 5A6LA 2X0HA 1W1VA 3GH7A 1ISXA 2WAGA 1P6WA 2DPEA 3WH6A 1BLIA 5CSUA 1UD3A 2J47A 4OZOA 3U7VA 4BCEA 4Q7NA 3SUVA 1V08A 1W32A 2WHJA 1F4AA 4EK7A 3GXIA 4CN1A 1ISVA 3TOPA 5TD4A 2OWCA 2PWGA 3QHNA 3FXYA 2VX5A 1CZ1A 1EIBA 1NH6A 1PIGA 2CIPA 3CHFA 3ZJ6A 1MFUA 3IAPA 2OSYA 3NDZA 1WDRA 1XCXA 1IZJA 2DH3A 2VOTA 4JHOA 4TVDA 2O9PA 2GDUA 1R7OA 4U5KA 6TAAA 1E5JA 1RP9A 4MNJA 5JIWA 4JFWA 4J3XA 3VGDA 2X8RA 1SYTA 3I3EA 5A6AA 2W5FA 4LYRA 4AZ6A 3CUFA 3SUTA 5A8QA 2W92A 1WDSA 2WB5A 4PCSA 2Y2WA 4JIEA 3ARXA 2ZX5A 1DWFM 3BLPX 2XVLA 3WQ8A 1V0MA 3I3BA 2CCRA 3VGGA 4F79A 2VJXA 2EO7A 5LA1A 4UQCA 3SIMA 3BXWA 1UWUA 3M7SA 4PTXA 4M80A 3UCQA 4OOUA 4GQQA 1PZ2A 5JBEA 2BHZA 1BG4A 1UUQA 3ZOAA 3ARTA 2WVUA 5ABGA 1GOIA 5DT7A 4LX4A 4H8HA 3VM7A 3AHVA 3T09A 1JNDA 1WZLA 1UWSA 2VQUA 1HJUA 2ZICA 3WMBA 5CZKA 1NARA 2JE8A 1GJWA 3WEOA 3PTMA 4B9ZA 2OO2A 4AZGA 1Y7VA 2MANA 4UNIA 1UD5A 3WENA 3VNZA 1L8NA 2E9BA 4ZENA 3AROA 4ZE5A 1OD0A 1QHZA 1E72M 1NWTA 4Z2LA 5C70A 4TX6A 1FH7A 1UQYA 3QHMA 4CU7A 4GINA 3FN9A 1JYXA 3TA9A 4Q22A 1RD6A 1XH1A 1UH2A 4ML4A 3EDKA 1VEMA 1HL8A 4HA4A 4UOZA 3PZNA 3NDYA 2YL9A 4HMDA 2G3NA 1I75A 3WUBA 1MFVA 2YIHA 4F66A 1H1NA 1PIFA 4UQ9A 4YHGA 1QW8A 4W8AA 3N18A 3UR8A 2UY2A 4PMQA 5I79A 3L2MA 4BQ3A 4ZXLA 1CXFA 2V3DA 4X9YA 1EDGA 1ISZA 2WANA 2D3LA 1WDPA 2VRQA 4N42A 1KCLA 2D3NA 1OWQA 3VIOA 3EYPA 4MNLA 4RL3A 1JZ2A 2ZUMA 5HPOA 4QCFA 1V0LA 3U57A 3WD3A 3PZGA 2XM2A 3AQUA 2BY1A 4MADA 4DUVA 5AYBA 2J4GA 5HOSA 1JZ6A 2Y24A 1ECEA 2JALA 5JUVA 1JDAA 5A6SA 1GHRA 3WBAA 2YKKA 3BAWA 1JZ4A 5CGTA 2DT1A 3I3DA 3VILA 5I77A 1KB3A 1QHPA 3WNMA 3WNLA 1EO7A 2WCSA 4D1JA 4P7RA 4E8CA 1V3KA 2Y8VA 3W27A 5LA0A 1QI3A 2WVSA 3VVGA 5A1AA 1UZ4A 1H0GA 4UOQA 4HZ6A 3UESA 1V3MA 4D6EA 2VZSA 3WD4A 1BF2A 3VUPA 2Z1SA 3BMWA 1E4NA 1NP0A 3PZOA 5HNNA 2YLLA 3SCPA 1GOOA 2VCCA 1JAKA 1Q4NX 1MQQA 2YOCA 2EPLX 4ACZB 2WMIA 2E9LA 4W85A 3VNYA 1JDCA 2AOSA 1KR0A 1DHKA 4DWSA 1HKIA 1EOMA 2A3EA 4D6CA 3MO4A 2D0GA 1E6ZA 1UR9A 1CPUA 1V6VA 2BY3A 5A6BA 3NYDA 3W0KA 4A3HA 1WO2A 1O6IA 4Z2JA 3L4YA 3ALFA 1EDQA 2X2YA 1C92A 4Z2GA 2C0HA 4CD7A 5ABEA 1XYFA 3VMOA 1HT6A 1IT0A 5I5RA 3FAWA 4GKLA 3VDAA 3SCNA 1BAGA 2JF6A 2WW5A 2JEQA 1V6YA 3IJ9A 1JF5A 1OGGA 4FZOA 3K46A 4WSJA 2PBOA 2HISA 3WY1A 4W84A 2CHOA 4HU8A 1KQZA 3CUJA 2XPKA 1CDGA 4CCCA 1XRVA 2OSWA 4XB3A 1HJSA 2V3FA 3M6DA 6A3HA 1US2A 3EMZA 4H2CA 2WC4A 1EGZA 5IHSA 4GZEA 4RE4A 2BXZA 4AZ7A 4LYPA 1Q6FA 1ZB5A 3OBAA 2V5CA 1X6LA 3OLIA 2DSKA 2VNCA 3L4VA 3N04A 1ZL1A 3ZQ9A 3VGHA 3ZO9A 2Q8XA 3BSHA 1JZ8A 3GYCA 1VEOA 1R8LA 2PI6A 4AEFA 1H11A 1TMQA 5E9AA 5KEZA 5C8BB 4U2ZA 3FHAA 1GONA 1KGXA 3VMNA 1PJ9A 2O9RA 4J7RA 5LYRA 1R85A 1EOKA 4MJ4A 1OIMA 1HP4A 3S6TA 3SUSA 1E40A 3A3HA 4PMXA 1HNYA 3KZSA 1E55A 3WDRA 1GQKA 4V27A 3EMCA 3WUFA 5D9OA 4W7UA 1ZBWA 3KL3A 4WIWA 3ARVA 3VD3A 3PZMA 1HN1A 4P8VA 4AZ5A 4J3UA 5A95A 1V02E 1CGXA 2PWDA 4AIOA 4GI6A 2RGLA 1DWGM 3AMCA 1QHOA 3EDDA 1GPFA 4YN5A 3N9KA 3HN3A 3OB8A 1UKPA 3VIMA 4DWSC 3SCRA 4IM4A 2J8GA 4PSPA 2G4FA 1OCQA 4C7FA 1HJVA 4TVCA 1QNOA 3WFLA 1V0NA 1H0IA 2GJXA 4AISA 3T2PA 4W7WA 5CXPA 4TTGA 1JFHA 1E70M 2XFRA 2D0HA 4WSKA 4S3KA 4BQ4A 1A3HA 1Z32X 1HJWA 2PWFA 4MTVA 4FLSA 2WVVA 1J0YA 2XWEA 1UR8A 4AXNA 1JD7A 4P7LA 4UFMA 1UOKA 2O92A 3GTNA 4AD2A 3ZIZA 3RPMA 1PEZA 4OOZA 3PN8A 4HU0A 3GM8A 4IUGA 3IANA 1MW1A 2DGAA 4HP5A 1R7AA 3AHTA 4HMEA 1J0ZA 1ESWA 1KQYA 1PZ3A 1JXKA 2OWWA 1NM9A 2CERA 2DIJA 3W6LA 1C3FA 5FCZA 4HZ7A 2BFGA 3MS8A 1JI1A 3OZOA 1J0IA 2VCBA 3RJXA 4D6FA 3AS3A 1CGVA 2FGZA 1J0KA 5A3HA 2XUCA 3LPOA 4U5IA 5GQBA 1BHGA 4W5UA 3HU7A 1WDQA 3APGA 5A2CA 2GK1A 4K68A 2WZEA 2WNWA 1HXJA 3SURA 2J7BA 3KE0A 3N15A 1CXIA 4W86A 2EPKX 1J10A 2WKLA 1AMYA 3AZTA 3W37A 2VRJA 1BVZA 5DO8A 2VX6A 1KGUA 2ZUWA 4AYSA 1N82A 1UKOA 2E8YA 1WP6A 9CGTA 1VIWA 3QOMA 3WDQA 2E0PA 4UFLA 2WM0A 2BHUA 4IISA 5I6SA 5ABHA 2YL6A 3TTYA 4QCEA 4PTWA 2J8FA 1US3A 1E6NA 4P8XA 1W91A 1UR4A 4XZBA 3TTSA 4CD8A 2FH8A 3SCTA 3UR7A 4J3SA 2FHCA 1V3HA 3VM5A 1SFSA 2ZX9A 2PC8A 1FHLA 3WDHA 3CGTA 1XSIA 1XSKA 1C90A 4H8UA 1WPCA 5CG0A 3WUGA 1CXHA 3M07A 4FK9A 2YDRA 1W2PA 5A6KA 1B90A 2XSAA 1BFNA 3KL0A 2AMGA 2UY4A 3U5YA 3W81A 3AI0A 3N17A 3BH4A 4M8UA 1E43A 5BROA 5D4YA 2VURA 2XFYA 5IHRA 2WC7A 2G41A 2ZIDA 3QGVA 3WDJA 3OGVA 1E0WA 1ITCA 1ZBCA 1K6AA 4HMCA 1I1XA 4XX6A 2YL5A 1BGGA 3DECA 4DM2A 1UD6A 1LF1A 1W9UA 2YA1A 1KWGA 2FGLA 1EQPA 1MQRA 1WKYA 2E40A 4N0RA 3OZPA 4DWSD 1TR1A 3ZSSA 1U33A 3K4AA 2UY5A 4MAZA 1UWTA 3TONA 5BYWA 2YJQA 1ODZA 1EHAA 2CITA 4LXFA 1EQCA 3GXFA 2D24A 7CGTA 4OBRA 2VUYA 5A2AA 4CN6A 4L4OA 5FOOA 4PCTA 3FAXA 2AAAA 5A6BD 4UQBA 3AZRA 5BRPA 2QV4A 3VGFA 1E1EA 3L4TA 4OJYA 1FP8A 1JGIA 3WQ5A 3WF1A 3SEPA 3WNKA 1EDTA 1VFUA 1CNVA 1IZKA 2DSUA 3SCWA 1G0CA 5JBDA 2WKGA 2DIEA 1IV8A 1X6NA 2J7EA 2PWEA 3D3AA 1HKKA 3JUGA 1VF8A 2DSZA 1K9TA 3T0AA 4X0VA 3OGRA 1UR2A 3LPPA 4P8UA 3PZVA 4JFTA 5EBAA 4DM1A 2C8NA 5IXEA 1BTCA 3OIHA 4TOQA 2DEPA 1OSEA 2PF0A 3BSGA 3NSNA 2WXDM 2YDSA 1YQ2A 4JHZA 1E3ZA 3NSXA 2CETA 4BF7A 2VI0A 2ZX7A 3QHOA 2WLYA 3CZKA 1LL4A 5AC5A 3SCQA 3WNPA 1W3LA 1C91A 3ZT7A 3W29A 5GPRA 5IDIA 4GI9A 5ABFB 2ZXBA 3MUAA 5A8NA 4U2YA 3CIVA 2XJ7A 3T0BA 3WQ6A 1HIZA 1WB0A 5D8ZA 1B31A 1CGYA 2WMJA 2ZXAA 1KR1A 2QLYA 1E6SM 3WQ4A 1XSJA 3FY1A 3VIFA 5I3DA 3CTTA 1GW1A 3B9DA 1BSIA 1H49A 3WD2A 2ZX8A 3ZSTA 4YPJA 4JZ5A 3WF2A 1MWOA 4W93A 3WFZA 1E6RA 5AY7A 4Z2IA 3AIRA 1A47A 2HVMA 4KRUA 3VPLA 1XC6A 5IFTA 3AMKA 1OD8A 2WMGA 4M1RA 4HPHA 1CXKA 4GQRA 1TVNA 3LMYA 3II1A 3DHPA 3VD5A 3N12A 4B9YA 2D1ZA 1WNOA 3ZJKA 1E73M 2WLZA 1NP2A 1BQCA 2VVNA 1CWYA 5CPSA 4AZHA 2D2OA 3OG2A 1SR0A 4CCDA 1PAMA 1D2KA 1GJUA 5D9MA 1H4PA 4JCLA 2FDMA 4M24A 4QLKA 4W87A 3VX1A 1UH4A 2XGBA 5EB8A 1CXLA 2VVSA 3UEQA 4PSRA 2DDXA 2O9OA 1MXGA 4NF7A 1AVAA 1CGUA 3AISA 4WJXA 4WKHA 1RPKA 2VRKA 3CZGA 4NSBA 4WLCA 3BAXA 1TZ7A 3MV01 2NT0A 4TUFA 2VZTA 1GOMA 1QBAA 2QMJA 4RE3A 3MV11 4UFKA 4HPGA 4E2OA 2W66A 2YLAA 2GUYA 2E4TA 2BY2A 1GNXA 4D6DA 2E8ZA 4D71A 2WHKA 1XCWA 1V6XA 2JNKA 1PX3A 3WEMA 3RM9A 3CZJA 1V02A 5FKYA 3PHAA 3IJ7A 1AQ0A 1WZKA 4PMRA 4P7OA 4WF7A 3RIKA 3VIIA 4ACZA 2ESCA 3GXDA 5A69A 2ZOXA 1M03A 4HTYA 1DTUA 1M04A 3UERA 1JI2A 4PMZA 3DC0A 3MSGA 1M01A 3CO4A 1HVXA 4AZCB 3CZ8A 2W63A 4J27A 3AIUA 3BAKA 1NWSA 2XIIA 3GXMA 1WZAA 4KH2A 3ARUA 2QHAA 1B0IA 3M46A 4NRRA 1W3HA 2XIBA 3PBGA 1K9DA 1H2JA 2FHFA 3MUIA 3ECQA 2F8QA 2NW0A 3W26A 2XSBA 3CUHA 1E4LA 3EBVA 1AQHA 2CBVA 3PTKA 1XHGA 4W5ZA 1B30A 1KGWA 4B3LA 3A4XA 8A3HA 3O6AA 4FLRA 3B8SA 3MUY1 4QLLA 3DHUA 4MPKA 3AICA 4OUEA 2XVNA 1MW3A 3L4XA 3ARZA 2WCGA 2D20A 4R27A 5HPCA 3CMJA 3VINA 5DFAA 4W8BA 2X1IA 2J62A 1VFFA 3MKKA 2D22A 4AWEA 1FA2A 2A3HA 4W8LA 5ECUA 5CLWA 1JF6A 3ALGA 3AIWA 4OIFA 4U3AA 1VAHA 1C8XA 1VENA 2XGIA 2ZUVA 2J7FA 4D6HA 4D6JA 3SCUA 4U33A 2CEQA 3N11A 3RCNA 3WNNA 3EDJA 2QF8A 5HBFA 1H3GA 1CENA 1BG9A 4GO8A 5A2BA 1V3LA 4UFHA 3EDEA 4CUCA 1B2YA 1HVQA 3POHA 3WL0A 1RH9A 4FZPA 3VIGA 2IXUA 3AS2A 5CJ5A 4KWUA 3G6MA 2WBKA 4WKAA 3UG5A 1GOKA 4ATWA 2WMKA 4UQAA 3POCA 4CN4A 1HJXA 4MB4A 2JIWA 4URIA 1R86A 3A4AA 1OIFA 4CD5A 1JYVA 1ZJAA 2D23A 5M3WA 3D5HA 1D3CA 4FLQA 1TG7A 3PZ9A 1FOBA 3O2LA 4FF5A 2O9TA 1MXDA 3O9NA 4AIUA 1BYAA 2XWDA 1W1TA 3WF0A 4Z2HA 2EEXA 2ZXDA 1E3XA 2WWDA 1ITXA 2A3AA 4BZYA 2DT3A 1FFQA 1ODUA 4DUWA 3GH4A 5BWFA 1HL9A 3AMDA 3VTRA 2EPOA 1C93A 2G3IA 1EHNA 1KXVA 3BAYA 3F5KA 3AHYA 1C8YA 1DP0A 1E15A 2UY3A 2WSPA 1QI4A 5IFPA 1GVYA 3ZT6A 4PTMA 3T2QA 3NUKA 2BNJA 1GHSA 5DT5A 1GQLA 1QNPA 2C7FA 3BLKA 5BXTA 5KZ6A 1B3ZA 3TTOA 2PWHA 1J0JA 1JAEA 2CYGA 1JL8A 1XD1A 1HP5A 1Q6DA 3IJ8A 3WMCA 2OSXA 3EMQA 3N13A 5M03A 1G1YA 3CBWA 2OWXA 3NSMA 1B1YA 1E6PA 2XVPA 1OT1A 1X1NA 4AZBA 1E4MM 2WMFA 3WELA 4CCEA 3VD7A 1OGSA 1JIBA 3WUEA 4CVUA 3UETA 1B9ZA 3HJEA 1UYQA 2DH2A 2YBTA 4H04A 1JFXA 5I23A 1FH9A 4JKLA 3GBDA 1XH2A 1H41A 2F61A 2J7DA 1UQZA 4ZFMA 2NSXA 3EDFA 3VMPA 4F8XA 3THDA 4P7QA 1OINA 1QNSA 3AIBA 4OBSA 3ZR5A 5FL0A 1UR0A 4MB5A 5BXSA 1G5AA 3AZSA 3WN6A 1LQ0A 3G6LA 4V2XA 1MW0A 1JYNA 3GDBA 3VDHA 2YDQA 3GBEA 4PTVA 3W25A 1PX4A 1ZBKA 2VT0A 1TUXA 1VBRA 2G3MA 3OLEA 4D6GA 4MB1A 1Q6GA 2YL8A 4IPNB 4HOZA 2EBNA 4AD0A 5AC4A 1VFMA 4UQDA 3ARPA 5E09A 2X09A 4AMCA 1WCGA 4FMVA 3WBEA 2XVGA 4GZIA 1JZ3A 1NOWA 4TTUA 4GXPA 4PMOA 1OBAA 4J3WA 4PEEA 1MQPA 2DSVA 5CPTA 3VOCA 1TCMA 2D0FA 2W67A 2BV9A 1EO5A 2VZVA 2G3JA 2WC3A 1HJQA 2IXVA 5A6MA 5FIPA 2BXYA 2W61A 1GQIA 3K8LA 5DF0A 4F9DA 4ATDA 2XVKA 1UD2A 1PBGA 2EXOA 2VR4A 1LJYA 1MVYA 3OLDA 1J01A 1V3JA 3K4DA 4M82A 3CUIA 2XTKA 4C7GA 1JYWA 1UHVA 5D9PA 3SCVA 3PTQA 1R87A 4YHEA 4QLJA 1KBKA 1E4IA 1KXTA 1LWHA 2JIEA 3AYRA 3MSDA 5E70A 1QI2A 3VGEA 4E8DA 3OGSA 4H7VA 4AIEA 3A47A 4U3CA 3BGAA 3ZMRA 1G01A 5GNZA 4AY1A 2TAAA 2WYSA 3WQWA 3MU7A 1UWRA 4NRSA 1D7FA 1HF6A 1CIUA 1VEPA 4A3YA 4LYQA 1GOQA 4EANA 2WZIA 5CLTA 2J78A 5EFFA 4GIAA 4LPCA 4CGTA 5CPQA 3WKZA 2XG9A 3AYSA 4MAVA 1ISYA 1M53A 1MYRA 4H41A 4P8WA 1B3VA 2ZUUA 2V3GA 3AXIA 4LGXA 4W88A 2WK2A 3T08A 2QPSA 3WH7A 2VTFA 2J7HA 4TX8A 2A3BA 4Y7EA 3WIJA 1J0HA 5HXMA 4JCMA 3HMCA 5E6ZA 3S2CA 4HOXA 1YHTA 1U30A 1UKTA 4DUXA 4MNKA 1ZS2A 2CBIA 1E1FA 2X0YA 4R5EA 4JKMA 3DYMA 3WDPP 3WDIA 5BRQA 1KCKA 2Z1KA 3SUUA 3NCOA 2OLHA 2DT2A 5LA2A 4V28A 2OYKA 4XV0A 1UZ1A 2WMHA 3NIYA 4TXEA 3MMUA 1CGTA 1LG1A 4H8VA 1UWIA 1UA3A 4BS0A 1SMDA 1M7XA 3WF4A 3A4WA 4B3KA 3W38A 2YA0A 3CH9A 3CUGA 1H09A 2J25A 5JBFA 1W3KA 4UFJA 1CECA 2WZHA 4AZIA 4J3TA 4TVUA 1QI5A 1E56A 4M81A 2J77A 3W53A 4CU6A 3AFBA 1W9BM 1HKJA 3OA5A 4EAMA 4UZSA 3L4ZA 1TA3B 5ABFA 1EXPA 2VZOA 1TA3A 8CGTA 4PYSA 1KXHA 3QOKA 1FFRA 3GNRA 3OLGA 1U2YA 3ARYA 1HKMA 1K9EA 1OB0A 4PMDA 4BQ2A 3W6MA 5AYIA 4QFUA 2OYMA 1CYGA 2GJPA 4GZJA 1OT2A 1UG6A 4WK9A 1WAWA 3ARWA 2VX4A 1FH8A 4HZ8A 5EFDA 4E4PA 1NWRA 2EJ1A 1CEOA 2W62A 2XM1A 1V6WA 1VJZA 2VZUA 2CBJA 5JIPA 2E9MA 4GPNA 1CGWA 1W1PA 4ZXOA 1F4HA 3WH8A 3GH5A 3W28A 4D6IA 1K9FA 4PRWA 4XUYA 4C7DA 4XZWA 1C7TA 2J7CA 2UWFA 1QNRA 1JDDA 1KWKA 4EE9A 4PMYA 1LL7A 2WBGA 2PB1A 2WCAA 3BCDA 3FW6A 5GNYA 2PBGA 3TTQA 4QP0A 1UKSA 1GZJA 3PZUA 4JKKA 1LLOA 1JZ7A 1W9VA 4ACYA 3ARQA 2ZX6A 3L4WA 5CSYA 3KWXA 3VDBA 4CU8A 1NQ6A 3CHEA 1UD4A 2IUZA 3LPGA 1XD0A 3SUWA 3CHCA 5D8WA 5FL1A 2VCAA 1EA9C 2DSWA 5I2UA 2FHBA 3L4UA 1H5VA 1BGAA 1J11A 1C8QA 2BVTA
chains in the Genus database with same CATH superfamily
4GO9A 5IOBA 5CBIA 1JDFA 1JNEA 2GVYA 1E5NA 5EMKA 1H7WA 3MC5A 2BVYA 4YTQA 1U00A 4CD4A 3J7HA 4W89A 3UZXA 1JQKA 2GYIA 5HULA 2YIVX 4U31A 3F2CA 3AS1A 4NI3A 3W7CA 1GEQA 2NQHA 3OQ8A 4FXFA 4QQUA 3TXZA 1QWGA 1E9LA 3KRUA 1ZENA 1QI0A 4WKFA 3B9NA 4A4AA 4QNWA 5MHBA 3G0UA 1U22A 4EXAA 4AWUA 1WE5A 1KTBA 1OCJA 2W79A 4KT2A 3TYBA 2O0I1 4JNFA 4JAWA 1N2VA 3H4GA 1QBBA 1WUEA 3QC0A 3VU2A 5FEWA 2VEFA 3L2LA 5I0DA 4O17A 2CBUA 2ZUSA 1GZGA 5D9NA 3NZGA 3QY7A 1M7PA 3UGVA 2F6KA 3KXQA 3HPAA 3SCSA 3RDKA 4XISA 4JL2A 3WF3A 3O05A 5FA5A 3LERA 2XHYA 2F2HA 1UASA 1AL7A 3N6QA 1TE1A 5C6MA 1VFOA 5C2XA 1VB9A 2UBPC 4MKNA 1JCMP 2EQDA 1RD5A 3RJYA 3XINA 2POTA 1F61A 3Q65A 4H7CA 1UR1A 5EU9A 3YPIA 5CSSA 4S3JA 4F0KA 3G1HA 5HNUA 3BAIA 3KCJA 3V18A 1A5OC 3OBKA 3SO7A 4O4VA 5FJTA 4A05A 3DDMA 3E2SA 1YWMA 4ZB2A 4MFEA 5CQ1A 4YU1A 3GAKA 4CQDA 5JQ9A 5HDRA 2CLMA 3RG6A 1R33A 1BYBA 3M5YA 4IMFA 4BEQA 3A64A 2NVCA 3ABOA 3BW3A 3RO8A 3UNDA 2A3CA 3F5LA 4ATLA 4XAFA 1EL3A 4UCFA 2ISDA 3GE7A 1XIHA 1V6TA 2J9ZA 4L64A 3VD9A 4KGJA 4QDMA 4UFIA 2Y61A 1OQFA 3GTFA 1V3IA 3VIPA 3MMDA 3G1RA 4AD1A 3CIXA 1SO4A 5EMYA 4HBKA 3AHZA 3M41A 3WQVA 3SN4A 1KLYA 1S2AA 5LNVA 1ML1A 2WHLA 3BCJA 1S46A 1UH3A 4QDPA 1I2OA 4KMQA 1XICA 5C2GA 4WDUA 3K8KA 1SJAA 1JDEA 3PZQA 3W7PA 2JEPA 3R79A 4UQEA 4PN2A 3UWYA 3WL1A 1DHPA 1EC8A 1QASA 4DB7A 3Q45A 3U48A 2V2DA 4KIKA 1XYMA 1MW2A 2NXGA 2ZA2A 4GC4A 1GCYA 5GJMA 4A3UA 5BXPA 3UG8A 1QPRA 4KGLA 2BBFA 2QGYA 3OK8A 4KF1A 3RR1A 1E6QM 5TBOA 1JR1A 4JIRA 4YS1A 3ARRA 4JDYA 3I01A 1DWAM 3W1PA 4UOJA 1VRXA 3B9OA 3AMLA 3TLQA 3EWUA 1DJQA 3A24A 3G77A 1R30A 3VYLA 4W4QA 1PX8A 3F5JA 2GQ3A 3BUPA 4P7NA 3GNOA 3N9SA 2Z24A 4KW2A 2GQ8A 4XSLA 1UROA 3TW6A 4XWUA 3GZ3A 2BASA 3VX0A 1XRFA 3F1QA 2CLPA 3EPNA 4M0MA 1OFQA 1R5YA 1ZPTA 2C15A 1JXJA 4CKQA 1AK5A 4CNSA 2JKEA 3ITYA 2PMRA 4JTFA 2QCFA 3CT2A 3H4XA 1YW1A 3BMVA 3MYPA 1YPXA 3LDVA 3LHYA 3TCSA 3RLHA 3BQ6A 1W2VA 1S5TA 3UNTA 4L4MA 2RKXA 4FOKA 2ACQA 5SWUA 4C6QA 1FCQA 2I57A 4AD5A 4AWSA 4HVXA 2PD5A 1KM4A 3QFWA 4AD4A 3PZTA 1DJWA 3CB3A 5M17A 1L6YA 2YCEA 2PP0A 3WLRA 3ZFHA 1UD8A 1GOXA 4ZB5A 4AW7A 1QVBA 2X05A 3M0MA 2F9RA 2OYLA 3WH5A 4ZSUA 2PTDA 1OFEA 5M5DA 3R0DA 1VHNA 4HNOA 3DYPA 4CVWA 5BRBA 3ABHA 5CGMA 1XV8A 3A3WA 1BYCA 4HQVA 4WR3A 1KRMA 2VC6A 3LNMA 3AIVA 3RLGA 2FH6A 4AVFA 3MQTA 5DN1A 2YBVA 4POCA 2WPGA 3BLDA 1W9XA 4YCOA 4K37A 2VC7A 3O0FA 1SW0A 1OGBA 3W3OA 1M41A 2VDHA 4ZTXA 3G18A 5CSUA 3Q58A 1UD3A 6REQA 5JXQA 4DBSA 1V08A 2PEVA 2WHJA 1ME9A 4CN1A 2B7QA 4IW0A 3W1XA 1DJXA 2VX5A 4L80A 1NH6A 1PIGA 1GJPA 2CIPA 4LCSA 3IAPA 4O1BA 3S42A 1WDRA 2Y0FA 1F7BA 1QPNA 3VA8A 3T44A 1POJA 2ATSA 2R9RA 4JHOA 4DYKA 4DZHA 2DFAA 1BKHA 4FNTA 1E5JA 4AY7A 1MEWA 3NOEA 3LCIA 4JIHA 1HUVA 1AODA 5DBUA 2QR6A 3BUIA 3P81A 1BSLA 3S2JA 3ARXA 2WOQA 3M47A 3BLPX 1IEVA 4EZRA 2PDYA 3LN3A 4PTDA 1WA3A 4R33A 3EX2A 3UD6A 2EO7A 4HNLA 5LA1A 1D3GA 3SIMA 3RUBL 3M7SA 4PTXA 4RNJA 3UCQA 4AY8A 4GQQA 1BG4A 5DLCA 2FVKA 3ZOAA 2QVHA 4HNCA 3OP2A 4RV3A 3GVGA 1WZLA 4L1GA 5DX7A 2VQUA 2AGKA 4NG3A 1OG6A 4AUBA 1QWKA 3EKLA 1X04A 2JE8A 1J96A 2YI9A 4B9ZA 4WZHA 3TWBA 4AZGA 4I5XA 1UPPA 1UD5A 2YXOA 4DI9A 4GOAA 1FWIC 4ZENA 2OELA 1M65A 5PTDA 4ZE5A 3HIJA 1DQUA 1OD0A 3M43A 2OLSA 1ONXA 3IACA 4Z2LA 5C70A 1UQYA 3QHMA 1JYXA 1T0OA 3TA9A 1XH1A 1UH2A 1D7KA 4D9PA 3S5YA 1FCBA 5KBPA 2WYHA 3T4WA 1PKMA 3NZ1A 4UOZA 1EWDA 4A2SA 4C6EA 2AL2B 2Z0OA 1W9MA 3W87A 2IMRA 1O68A 2G3NA 3TE9A 3FKKA 1MFVA 2HCVA 3V1PA 2PRLA 4PO2A 1LQ7A 2QDEA 4UQ9A 3T05A 4W8AA 3N18A 2BODX 1CI1A 5EGRA 4BQ3A 4ZXLA 1SW7A 8XIMA 3I4KA 1ISZA 4ROQA 2VRQA 3F4WA 1KM1A 4GYFA 4A22A 3BLBA 4MNLA 2ZUMA 5HPOA 1V7YA 1V0LA 3U57A 3PZGA 2XM2A 5CSRA 4GD0A 2YXXA 2IPWA 4O11A 5HOSA 3U0HA 3AXMA 4Q4OA 1YXYA 3BOFA 4O0KA 3SRDA 4KWVA 1JCLA 1JDAA 5A6SA 4PUJA 4BF5A 3WBAA 4H6HA 2YKKA 2IPJA 1XP3A 3AXKA 3HA1A 1HGWA 1M6JA 1TJRA 3WNMA 3WNLA 1EO7A 1X96A 1BRLB 4P7RA 2W6RA 1T7LA 2Y8VA 1M68A 2WVSA 3VVGA 4QITA 5RUBA 4WUIA 4HZ6A 4ORIA 3PS7A 4EIVA 1Y5WA 3KVMA 1A50A 5I3GA 4BHYA 2EX3B 4H9TA 1BF2A 1NDVA 4ZOAA 1NP0A 5G1YA 3SCPA 1TTQA 3CWHA 3ID7A 4Q4SA 4E2VA 3LNPA 2VCCA 1EBHA 5LGXA 3B0PA 4ACZB 1A5CA 1OG0A 2PDBA 1JVNA 1I60A 3ITGA 4Y90A 2AOSA 1EZ2A 3LS9A 1B3OA 4DEFA 2CC0A 1Q6OA 4D6CA 1TYGA 1W5MA 3R0KA 1UR9A 2BY3A 3RRXA 3W0KA 3DKJA 3L4YA 3ALFA 5D2TA 2C19A 4Z2GA 3FX4A 4B5SA 3H23A 4CD7A 1XYFA 1B57A 1HT6A 3IVUA 5I5RA 3MB9A 3QV6A 3M5ZA 1A5UA 3VDAA 2ABAA 4DZIA 1V6YA 3IJ9A 3K46A 4W84A 4HU8A 5C9UA 2O56A 1F3TA 1CDGA 1IQ8A 1OFAA 3BPWA 1XRVA 3JRKA 2V3FA 5KITA 5AHEA 4H2CA 1EGZA 1Y5VA 4E81A 1OK4A 2J13A 2BXZA 3NOYA 1Q6FA 3FEMA 4HGXA 4JNMA 2V5CA 3L4VA 1RUSA 2GVJA 2V0TA 1XLBA 3N4EA 2PI6A 4NJJA 3DEQA 1M1BA 3DI1A 3UJRA 1QR7A 1ZP3A 4ZOCA 5C8BB 5MF5A 3HGOA 1JPDX 2ACRA 3VMNA 4FX8A 2YXGA 4U10A 3P0XA 1SVDA 2AQVA 3QGAC 2F7QA 1W3IA 2V2CA 3SUSA 3A3HA 1KFEA 1E55A 2ZCGA 1XQLA 1MDRA 1ZBWA 1K77A 3CEUA 4HZMA 3PZMA 1VPQA 4H2HA 4J3UA 5A95A 1V02E 4AIOA 3P8JA 2TYSA 3N2TA 3H7VA 1TE6A 4I5RA 4GI6A 1GG1A 2TPSA 1XDJA 4B4HA 3AMCA 1GG0A 1YPFA 1GPFA 4DYLA 4NZ1A 1O1HA 3AWOA 2QUNA 3EJRA 4B5TA 4LH8A 1UPXA 3HN3A 3OIXA 1OX5A 4US5D 4O1DA 3H26A 1NDZA 3SQSA 1EFZA 3QH2A 1YDNA 2G4FA 2ZKMX 2X7VA 4GHRA 3GU9A 3GC4A 1QNOA 2PGEA 2GWGA 1QX1A 2F7FA 2NZLA 1OFRA 4ECLA 2XN2A 3F7WA 4O10A 4BQ4A 1Z32X 3KDNA 2PWFA 1BWVA 3TIMA 4MTVA 3WO8A 1A3XA 5DCEA 4FLSA 3P5YA 3PJXA 1OF6A 3N2CA 2DVUA 2A7NA 3REQB 1UOKA 2O92A 4MJZA 2V8ZA 2DZUA 5HMSA 3U2CA 2ZZ2A 4OQVA 5CC5A 3PN8A 3SRFA 4J3ZA 3LCGA 3QV7A 1AFSA 1NELA 1KFCA 2HJPA 3B04A 4ALDA 1D3HA 1GVRA 4KIEA 2ZYFA 3NTYA 2DZPA 3W6LA 1C3FA 4GY7A 3THAA 1HW6A 4L9XA 4Q3MA 1REQA 1BXBA 1P5BA 1J0IA 4JPGA 1VFLA 1MUWA 5A3HA 2ASHA 5GQBA 1O7DC 3HU7A 3RCMA 2ZA3A 1WDQA 4GNKB 3BG9A 1KO0A 2GK1A 4OVXA 5HJLA 1EUAA 3P5ZA 4A6GA 2F7RA 4DY1A 3C0JA 1P1MA 1K7FA 3AAMA 3QSTA 1AMYA 3AZTA 5MKGB 3W7GA 1EGVA 1KGUA 1UKOA 4HJWA 4IJBA 1TREA 3SOGA 4RW5A 3WDQA 5ENLA 3R94A 5I3FA 3UYCA 5AYZA 3UVIA 3O07A 5ABHA 3LHZA 1J6PA 2J8FA 1PZ0A 1US3A 5D37A 3TTSA 3G1VA 3E0WA 4LNYA 4DO4A 2FHCA 5HINA 7PTDA 1GTHA 2PC8A 1FHLA 3WDHA 2FGBA 3KWSA 3CGTA 3QZ6A 1FY6A 3GR8A 4CNUA 3QQ0A 5DXYA 1WPCA 1EA0A 4IM0A 3WQPA 4DWDA 4FK9A 2OKOA 5LXEA 2YDRA 2GOUA 5F2GA 3KL0A 2LLEA 5IM51 3AI0A 3N17A 4YNGA 3UR5A 4GQ0A 2R1LA 1NSJA 1UPMB 3B4UA 2OMAA 4E3CA 3F4DA 2WC7A 4Q8TA 2YCIX 2I7GA 1FDYA 3BW2A 2P5NA 4EXQA 1ELSA 1QO2A 4XX6A 1ECQA 3DECA 1W9UA 3JZUA 4IUOA 2FGLA 4EXBA 4N0RA 5JVLA 4DWSD 1U33A 2UY5A 1K8YA 4DELA 1SU6A 4H9XA 3SB0A 1EQCA 3GKFA 4B2DA 4NJKA 4OBRA 2VUYA 3QPEA 3V5CA 3DERA 3S46A 5FOOA 2OEKA 3GB6A 2AAAA 3NQAA 2IPGA 2EPHA 2H9AB 2A3LA 3WQ5A 1PB0A 5LIKX 1EDTA 3PF3A 4FALA 4BFAA 1K8ZA 5HR6A 2DSUA 3SCWA 1G0CA 1RZMA 1IV8A 2XZ7A 4OT7A 1TV8A 4WDXA 3D3AA 3S47A 1VF8A 2DSZA 4ZZ9A 3T0AA 4X0VA 3OGRA 5FAGA 2P3EA 2P50A 3PZVA 5EBAA 1FXPA 2E09A 1HKWA 2HK1A 4MWAA 3QMTA 1OF8A 3U2ZA 3KVKA 2VD8A 4J35A 2WXDM 2YDSA 1YQ2A 4GGBA 3UWVA 4O18A 2VI0A 4NAEB 2AKMA 3CZKA 3O1NA 4LYKA 4N6FA 1LL4A 1TWWA 3WNPA 1W3LA 1C91A 5D33A 3TYZA 2OEJA 5GPRA 5IDIA 4GI9A 2DW6A 1XIGA 2ZXBA 1Z89A 2WSQA 4U2YA 3CIVA 3VNMA 1OFOA 3UGRA 1CGYA 1Z3NA 1XSJA 5T9BG 4ZGYA 4B3ZA 2XN1A 1MSSA 3W22A 2Q13A 3ZSTA 1I8JA 1JULA 4DJED 1H7PA 3FGCA 4W93A 4PULA 1ZJHA 3IGSA 1A5LC 3R6IA 1GNLA 4LOCA 1TVNA 2X0SA 2B81A 3IPWA 3ITVA 1AJ0A 2CHRA 5TIMA 1I0DA 2DZTA 4ES4A 2Y7EA 2PU1A 1CWYA 5CPSA 4MY9A 2D2OA 1XIEA 4IIHA 3ANVA 4ZO8A 1PAMA 4NXSA 4CCDA 1D2KA 2XISA 1LORA 4TX9A 1Q63A 2PRMA 3N34A 3MVIA 4PUUA 5FF3A 4FO4A 3DN5A 1UH4A 4F0LA 5EB8A 2Y7GA 4LVFA 1RCQA 2ZTKA 3E74A 1VCGA 1MXGA 4M5PA 4E2DA 1YADA 2YKTA 2BG5A 2PWVA 4MKSA 1TMHA 4MY1A 1VKFA 1ZGDA 4PCNA 4XVEA 3CAZA 4GUIA 3GNXA 4MGGA 3MV01 5G2WA 2QQ6A 5T26A 3C0SA 3GXNA 3K2GA 1E9YB 4G56A 1DKXA 4RE3A 1SO6A 1JCXA 4M51A 2VFGA 1Y65A 2E8ZA 2G97A 2JNKA 2R1MA 3WEMA 5D2WA 5FKYA 3PHAA 3IJ7A 1AQ0A 2Z00A 2ALDA 1SFLA 4P7OA 4PMRA 4WF7A 1XRSA 3FVMA 3RIKA 1QOPA 1XF0A 5I02A 3GXDA 2ZOXA 1M03A 4HTYA 2DY3A 1DTUA 3M0JA 1JI2A 4ZQRA 2Z28A 3CAVA 3C4UA 3CO4A 4JTHA 3TH6A 4J27A 3BAKA 2R14A 2XIIA 3G3DA 4QQ3A 1PS9A 1R46A 1A0EA 2HNEA 4UR7A 1DJIA 4MSSA 1XM3A 1XHGA 3PTKA 1HGYA 2WJZA 3HM7A 3P61A 4W5ZA 5KZEA 1K02A 3PPCA 3P60A 3IIXA 3IK4A 3CV2A 4IWOA 3O6AA 1HTIA 3T48A 3MUY1 4IXXA 3PB0A 4QLLA 3DHUA 3C61A 3DDGA 4WVXA 5J04A 1MW3A 2HVNA 3EGJA 4FNSA 1O5QA 1U1JA 4LEQA 4Y2WA 4R27A 2GJNA 5DFAA 1EUNA 4W8BA 2X1IA 1LUCA 1AMKA 4AWEA 4GYPC 1ADSA 5ECUA 3W1TA 3F2DA 3QLDA 3ALGA 3VOIA 1E51A 4D6HA 2E5BA 2PP1A 1WV2A 2JKPA 3FKRA 4LWWA 2CEQA 3EWDA 3WNNA 4NT0A 1UR3M 4XZ9A 3DGRA 3M9YA 1CENA 4GO8A 4UFHA 3EDEA 5HUPA 1LRQA 1UBPC 1B2YA 3QXBA 3POHA 2VGFA 3BV4A 2IXUA 4MG4A 1O5KA 2R6OA 3G6MA 2WBKA 2XH7A 3K1GA 3UG5A 1DXFA 3H2NA 1Q7QA 4MB4A 1OIFA 4OECA 1ZJAA 1Q6LA 2H90A 3CEPA 2O55A 4FLQA 1TTIA 1DJHA 3G1AA 3VUSA 2CWNA 3H12A 4YIWA 3W02A 1LBMA 5EBUA 3BURA 3O9NA 3OBEA 3TW9A 3LCFA 4DYJA 4IIEA 5AZ1A 3E2QA 2OO0A 2PLJA 3R13A 2ZXDA 2WWDA 5I00A 1ITXA 4KIKB 3E0VA 2IQ0A 1FFQA 1ODUA 3DENA 4DO6A 3TYDA 1U5JA 4F01A 4M6QA 2G3IA 3KS6A 3EX4A 2A6LA 1KXVA 1RXOB 4Q8PA 5K2ZA 3W7OA 3AHYA 1C8YA 4C1KA 4HHPA 2FB2A 2OR2A 3M0ZA 2OO6A 2WSPA 3B53X 1PDZA 2JKAA 1W0MA 1LT7A 5H91A 4K39A 4CNPA 3E2RA 3OHIA 3SM0A 1UUOA 3ZT6A 2Y7DA 3T2QA 3NUKA 3GIYA 4S38A 3BUQA 3BLKA 4Q4MA 2Z0VA 2ISVA 2EF9A 4JX6A 3DFPA 1JAEA 4G7EA 4QRNA 1LRTA 1LRNA 1XD1A 2P53A 4JXCA 3WMCA 3UA4A 2INFA 1G1YA 1L6WA 2BVWA 1B1YA 1E6PA 1RA5A 3SADA 4DBUA 3MHFA 1K70A 3PUEA 3IIVA 2XSXA 5LHFA 3HJEA 5FAJA 1LDCA 1U5VA 4H04A 3KZPA 3GBDA 3TJXA 1UB3A 4ZFMA 1S2TA 1LBFA 4LFYA 1R6WA 4F8XA 3ZR5A 4G8TA 1UR0A 4QDWA 5BXSA 1G5AA 3AZSA 3G6LA 4V2XA 3GDBA 4TU1A 3M16A 4PTVA 2G3MA 2CZ5A 3OLEA 4I6VA 4GQBA 1YMYA 4ZQNA 4LTSA 2EBNA 5ECVA 4AD0A 2FTYA 5AC4A 1VFMA 4AMCA 3OJGA 2X09A 1ZQ5A 3DYTA 1WCGA 1JUEA 1TJ0A 4FXJA 4GZIA 3V0TA 3H6OA 4P2VA 4GXPA 4XVDA 2QUUA 4ONVA 3WQCA 1EJSC 1TMLA 5E9XA 2D0FA 2A0NA 3DGBA 2W67A 2BV9A 5AHFA 2G3JA 2ISFA 2WC3A 1HJQA 3M1ZA 2IXVA 5A6MA 1LBLA 4RPPA 2BXYA 3K8LA 1GWJA 4BNEA 3QYQA 4NZ5A 4FA3A 1UD2A 4R34A 4PFHA 1IEWA 4I1QA 1J01A 2QYGA 3GHTA 3K4DA 4M82A 3GFYA 4C7GA 1JYWA 2RFGA 4YVXA 3BO9A 3ITOA 2FFCA 1WXYA 3BG5A 3MSDA 5E70A 4XZMX 2NV2A 4AIEA 4K38A 4U3CA 4GFSA 1IIGA 3ZMRA 1G01A 5GNZA 3TOYA 2Q01A 4AY1A 1FDJA 1XUZA 5AYXA 3WFAA 1EEXA 1MMFA 2P10A 2FPVA 3GIPA 4EZQA 1H62A 5CPQA 2HQAA 1S39A 2OPJA 4MAVA 1XIDA 2Z1WA 1ISYA 4Z1CA 2JQXA 4P8WA 4KFPA 4DO5A 2V3GA 5AHIA 3AXIA 3W2UA 4ZQCA 2QIWA 4QS5A 3MVTA 1YDYA 2J7HA 1U1UA 2V5KA 4JCMA 4YJ5A 4HCLA 4UMCA 3S2CA 1UKTA 2HS8A 2CBIA 1Q65A 2VFDA 1FWTA 1E1FA 2X0YA 5AB3A 4G9PA 3KFTA 1EJRC 3WDPP 1MRQA 2D4CA 3DC8A 3KBMA 2QIIA 2DT2A 3TN4A 4V28A 2WKJA 2AGTA 4TXEA 1UWAA 4HTBA 3O06A 1LG1A 4H8VA 1IHIA 5HMFA 1FWBC 1SMDA 4GCAA 1SZEA 4UDXX 1H09A 4H19A 4JWEA 1FKWA 3VCCA 2FVMA 1CECA 2WZHA 3HZ3A 4AZIA 1OEPA 4J3TA 3EWCA 4RDVA 3OA5A 4UZSA 3L4ZA 2OEMA 2VZOA 2J24A 1TA3A 8CGTA 3GG1A 2YW4A 1T41A 3L66A 4MZ8A 3MZNA 3NM3A 5CCZA 3TU9A 3QOKA 3MWCA 1HKMA 4PMDA 2QJNA 4KEMA 4Y9PA 4WK9A 4XZLX 4IOTA 3EKGA 1YLVA 3E2VA 3N6JA 4N7QA 4HZ8A 1OZMA 3PK7A 4E4PA 1Q6RA 2XM1A 3M7WA 2VP8A 3PP7A 1VPYA 1VJZA 1YNQA 3O3OB 1SFJA 1OX6A 3B03A 3WH8A 3GH5A 3S5ZA 2QZRA 1AQFA 4HYVA 3R89A 1SZFA 4PRWA 4PUKA 3M0VA 4LAUA 4XZWA 2J7CA 2OZ0A 3LV5A 1KWKA 4NNBA 4C6JA 3PBUA 3FW6A 4G7FA 2UZ9A 3RX3A 1UKSA 4GE8A 3T8QA 3CQKA 2PCQA 5CH9A 1W9VA 3L4WA 1P6BA 1NQ6A 3HPFA 4REQB 3SUWA 3CHCA 5D8WA 4JR5A 1X8CA 3QEZA 1DJYA 4I3GA 2FHBA 1H5VA 1BGAA 4DLMA 2GWNA 2Y7FA 4M19A 3BOXA 2AKZA 1NQKA 4TV5A 3VNLA 3ZM8A 1ZCOA 2E77A 5BXRA 3KBVA 4U28A 4IM3A 2HXUA 1AW5A 5FEPA 1B3YA 1MUMA 4S1FA 1EKOA 1XLLA 2ONEA 5C5YA 4ERGA 4HB7A 1RBAA 2E3ZA 4OKDA 3TEVA 2J7GA 3LLLA 1XIMA 3KOXA 2C1GA 5A94A 1I1WA 5CPMA 3W7IA 5E6YA 3VKKA 1A53A 3N2MA 1I2NA 3BK0A 3R10A 3VIHA 3MCOA 1GGOA 5A5WA 3N1AA 3ZJ8A 2QPXA 4RE2A 1W3JA 3UZYA 4AZCA 3W75A 1DKYA 4NQIA 1Q7ZA 4NZ4A 4XG1A 2REQA 1G9HA 1DKZA 2CHNA 3ICJA 4KEUA 3UPBA 1QOQA 3AXXA 3VO0A 5C71A 1UIOA 4ZOEA 1QOXA 1G7VA 2EPNA 4L9YA 1PTGA 1DORA 1O5XA 1XX1A 2IW0A 3BVJA 3CZEA 5TAOA 4X3ZA 5EKYA 4XIMA 3LCLA 4IXHA 3UPWA 4D1IA 2ZUTA 4LUJA 4JYEA 2Z1BA 2EPMX 3GD6A 1R2SA 1J12A 3F4NA 2YW3A 1KCXA 4IPLA 3T42A 1XIJA 3KAWA 5HWMA 3CV5A 5HMDA 1Q3NA 2GGHA 4AC7C 3QPZA 7TAAA 2OT0A 3STGA 3L3OM 1T5AA 5CJMA 2V3EA 2DU2A 4IF2A 4C60A 3BLEA 3NFUA 3CHDA 1TPDA 5A6JA 1BEUA 2QKWA 4W7VA 4PUDA 4PUEA 4JTDA 2GGEA 1VCFA 1XQKA 4IWWA 1SPQA 4LAZA 4FI4A 5G4WA 3W2JA 3ZR6A 4ZOBA 1W5PA 5AECA 2F1AA 3FV9A 3BAJA 1ADOA 4XKYA 1E1DA 1VJSA 3GG8A 1CXEA 2D73A 3URNA 1IZCA 1ZTVA 2ZUNA 1G94A 3KHJA 3PG9A 2YBUA 2BVDA 4KWWA 3E1F1 1AD1A 1IGWA 4LUIA 3DKLA 3E5BA 3EOLA 5G1MA 1E6XM 2BS9A 4DZ5A 3AIEA 3G9GA 2WSKA 4K7VA 4DAIA 1FP9A 2J79A 1T99A 3K1DA 2B31A 2GSJA 3DCPA 2VR5A 3ZT5A 2VOMA 4GI8A 4EKJA 2BZNA 1GOWA 2Z8YA 3MI2A 5C7VA 3KVJA 4X0NA 3V36A 3L0GA 1XI3A 3PBMA 5K3VA 2ZE0A 3FNDA 4PMJA 4LU0A 4O8RA 3W9ZA 5TQLA 1YPIA 2OZ8A 3QV9A 3IAQA 1SU5A 4PRTA 3D4YA 4ROPA 6ENLA 2OU4A 1IEXA 2DZXA 3V5FA 1QWNA 3LMFA 2Y63A 2V5DA 3SRHA 3DYOA 4B9QA 1Q6CA 3GVVA 3O8AA 4DN1A 5T91A 3K8MA 2XFFA 3CIWA 1R0MA 2YA2A 1QWUA 1EJVC 1RBLA 3W7RA 4OTKA 2VMFA 4QJ5B 5JH1A 2Y8KA 2AMXA 2ZWYA 3LTSA 1Q45A 1A0CA 3GDLA 4H9MA 3WMSA 1CLVA 1QPKA 3F4VA 1CX9A 4IIFA 1B54A 3NQVA 5CPNA 5KTLA 3GS6A 3OQEA 3STPA 4DXXA 4QROA 2J6VA 4ZEPA 1QFEA 2PDXA 3AXHA 2C16A 3CPUA 5FD0A 3NURA 2E5DA 1XBZA 3B4YA 4MLRA 5DMLA 3T0DA 4PMNA 1PL9A 1CTNA 4GMEA 4CQ8A 2VQTA 1ZBVA 2YCKX 2CKSA 3N14A 1REQB 1TV4A 4CNTA 1UA7A 3Q4DA 4EF8A 1EB3A 4UZUA 4J3VA 1IXPA 3RGTA 3PFRA 2HE8A 4Z2KA 3UA3A 3P14A 5E5CA 3KBNA 3FIGA 2GFTA 2O4QA 1XBYA 1GVIA 4AFYA 1HX0A 2GF4A 1LWJA 3FHQA 1KM0A 4BWLC 2WHMA 3PC0A 2C91A 2GK1B 2D2JA 1L2QA 4IGHA 3KUMA 3G1DA 5LNRA 3LCHA 3ACOA 4LC6A 2CPUA 2VEMA 3B8WA 5DEZA 1GQNA 3R8HA 3LY0A 1GK8A 4MJMA 1IR1A 1DWJM 3WQGA 4CQCA 3DHDA 3LRMA 2VEGA 5C7HA 4NL1A 4Z08A 4FOJA 3DFSA 4Q7IA 1EIXA 2WSYA 1FWCC 3UG3A 4CEXC 4QJ3B 1W1YA 3WD0A 1OFBA 1DWIM 1TPEA 4RCXA 5E84A 2BOEX 1JG9A 3P80A 3WK0A 4LCRA 3OO2A 4C6MA 1OA0A 2ZVRA 3GH7A 2D69A 3EXTA 2Y5SA 3M6YA 3TN5A 5EMLA 3TJIA 1PCKA 4K6AA 2DPEA 3WH6A 4Q8OA 1BLIA 1HXKA 1US0A 4Q7NA 1H5YA 3KBJA 5FSDC 1F4AA 4LRSA 3GXIA 3PAJA 1UJQA 2OWCA 4NXKA 4Z17A 3FXYA 1CZ1A 4IQLA 3L67A 4S3CA 3ABSA 2O9PA 3A13A 1QATA 4DHGA 3F2BA 3NWRA 2OG9A 1Q7MA 3CK5A 2QJHA 1RP9A 3L21A 2PDMA 2WZMA 4KKXA 2YIBA 1YDOA 2CLKA 3I3EA 3BLIA 2NXHA 4AZ6A 5A8QA 2W92A 3LV6A 4US5A 5EMJA 4PCSA 1Z9AA 4NNCA 2ZX5A 1DWFM 4GUJA 4CCZA 1EJWC 2XVLA 3TUUA 3I3BA 2CCRA 3VGGA 3KTXA 3OA3A 2VJXA 1VR6A 3ABXA 3BXWA 3GFZA 1LT8A 2ATMA 1S5NA 4B91A 2BHZA 1UUQA 3HJZA 4ZCWA 3ARTA 5ABGA 3GR7A 1GOIA 1PWMA 5DT7A 5K4ZA 3AHVA 5T8GA 1TWSA 4JTJA 4H9UA 3TSBA 1X6UA 1UWSA 3VC5A 2X3VA 2PDIA 3SAZA 4JTLA 3WMBA 4YCPA 1VBGA 3TVAA 1NARA 3TC7A 4F0RA 3W72A 2GJLA 4DNHA 1X97A 1Y7VA 2MANA 3UCDA 3WENA 4UWMA 1DJZA 3B8IA 4N02A 2E9BA 2BGSA 5CC3A 4AMAA 3EZ4A 3NZRA 2YSWA 3DOPA 1NWTA 2ZZ3A 4CU7A 3G8RA 3M0LA 1DV7A 4YTUA 4GINA 1KV8A 1RD6A 4ML4A 2PTXA 3SW6A 4A3RA 2VFIA 4HA4A 1F9CA 1LZOA 1TQJA 3TNOA 3WUBA 4LANA 1JQXA 3TC3A 1JQVA 2YIHA 1H1NA 3IVTA 3CASA 3PSWA 2I16A 2UY2A 3WJWA 5EMMA 2D2HA 2GQAA 2PODA 4HSHA 2BDQA 4O54A 2V3DA 4L65A 2HE5A 1EDGA 5J5DA 3WJZA 1KW1A 3WX7A 3EYPA 1KRCC 3VNJA 1EP3A 4QCFA 1K4HA 2A85A 4Z1BA 1Z42A 2VGGA 2TMDA 3AU6A 4GNVA 5HNRA 3QRHA 3DX1A 8TIMA 1TX0A 1IT7A 2J4GA 3OU8A 5AVNA 3QKZA 1C29A 2QCCA 3R5EA 4HMNA 2PMQA 4JWDA 1JZ4A 2EG6A 3I3DA 3VILA 1M7OA 4D1JA 2C13A 4IWPA 4LNCA 3IJ6A 3W27A 5LA0A 4WOZA 3MDWA 4Y9NA 4L4LA 4C6IA 4IPPA 2VEKA 4MZ1A 1UC5A 3GVQA 4S3DA 1V3MA 5HQEA 1J5SA 3PUOA 5AC7A 2Z1SA 3PZOA 5HNNA 3O3NB 6XIAA 4K36A 4UCGA 1JAKA 2WMIA 2E9LA 2QCGA 4UTTA 1OK6A 2F1BA 1UJPA 1XKJA 3HF3A 1KR0A 1DHKA 4DWSA 4PE8A 4IP5A 1Z48A 2A3EA 2UV8G 2DW7A 3HG3A 3WLPA 3UXKA 1HWWA 2D0GA 3IJDA 4NJIA 1CPUA 3MSYA 2VWTA 3DDFA 4FR6A 4KCWA 3SR7A 3GVWA 3ITTA 3EA3A 1R34A 3NYDA 5D32A 1F74A 1KTCA 3QE6A 1VYRA 4A3HA 1WO2A 1B4KA 4Z2JA 4GKTA 5DANA 3R11A 1KA9F 2C0HA 5ABEA 3VMOA 5EYWA 4OHQA 3VEAA 1T6MA 1RVGA 1BAGA 2Z1VA 3IRSA 5I09A 2JF6A 2JEQA 3DX4A 4WSJA 2PBOA 1KQZA 3CUJA 4PODA 2ZDRA 4Z0SA 4JWIA 1PVNA 2OCZA 4JNEA 4CCCA 2DORA 2GSEA 1E9ZB 4XB3A 4GXWA 4B5XA 4JICA 6A3HA 1LUCB 5HANA 3GHSA 2WC4A 4PH6A 3H7RA 1LCOA 1KCZA 4AZ7A 4EZPA 4LYPA 4RXFA 5HK4A 5FI8A 3OLIA 2QXWA 4GVGA 4XD4A 3SRKA 1ZL1A 1OYAA 3D6NA 4JN4A 2I9UA 1VEOA 4QM1A 1TVLA 1K3UA 2VFHA 4ADTA 3LTYA 3PBVA 1TMQA 3W00A 1ZJIA 3QMSA 4EOUA 1MDLA 3AALA 5KEZA 1GONA 2JGYA 3FEQA 3ZZ1A 1KGXA 2X41A 4ZQOA 4WDWA 1CCWB 4MPQA 2A21A 2PDPA 4J7RA 1WUFA 3SSZA 4XTDA 3D46A 1A5BA 1EX1A 1R85A 1TZZA 3ANYA 4MJ4A 1OIMA 4ADSA 3WQOA 1E40A 3ITLA 5AYYA 1HNYA 2ZZ6A 8RUCA 3FXGA 1DKWA 4AEOA 3KTCA 3WUFA 4IMCA 5D9OA 4WIWA 3NQCA 1F3WA 2IS7A 3PB2A 1HN1A 4KFOA 2OVLA 3LZ3A 4P8VA 3H2AA 2QCDB 4AWTA 3AJXA 2HEJA 3RAOA 4IFOA 3CHVA 4FZSA 4F0MA 4UTTC 4YN5A 4LF1A 3OB8A 1UZDA 1G4EA 3VIMA 4DWSC 3SCRA 1OCQA 2GPTA 4Y8FA 2Y70A 1HJVA 1BD0A 1KV5A 3BLLA 3WJSA 3WFLA 4JTRA 1H0IA 1I6NA 4JTKA 4AISA 3R12A 1NEYA 4UTJA 1JFHA 1U83A 2QCEA 3SBFA 3TZFA 3GHUA 3VFCA 1GVSA 2D0HA 4WSKA 2XDFA 1A3HA 3P3BA 2TODA 1FBAA 3W74A 1HJWA 4XAPA 3EEZA 4L1WA 3VKCA 4IZGA 3A22A 1R47A 1XCFA 3O6CA 3O15A 3W85A 2WVVA 4UTWA 1XIBA 4D8LA 3U4FA 2XWEA 2A79A 4Z1AA 3GTNA 3S3GA 3PY2A 4AD2A 4R5IA 1DE5A 3P84A 2QUMA 3RPMA 3C0LA 5HNTA 1PEZA 2CLOA 3M5XA 4OOZA 2GVGA 4G7EB 4RDYA 4S3FA 1MW1A 2NSOA 3P62A 4JTTA 3NO1A 1J0ZA 4DF0A 1KRAC 4QR6A 1ESWA 1PZ3A 2O0TA 3UJEA 1NM9A 5DRCA 2F84A 4PR4A 1DIDA 3QM3A 5FCZA 1TPH1 4HZ7A 1QNVA 4CLMA 2Y89A 2HMCA 6PTDA 1QK0A 2VCBA 2BWGA 1OJXA 1CGVA 5C9ZA 2FGZA 2XUCA 3LPOA 4M6VA 1SGJA 1A5MC 3DFNA 5U4NA 2Z6IA 1N55A 3HFTA 2WZEA 4D8ZA 1Q85A 3PLTA 4QHRA 1CXIA 1W1B1 4FSAA 4W86A 3BUDA 2O4MA 2EPKX 3EB3A 2FJKA 1LM1A 3W84A 2CLHA 3UZJA 3PULA 2ZUWA 4GIYA 2E8YA 4RX0A 1D8WA 2H3BA 2DUAA 4RXGA 1VIWA 3QOMA 2E0PA 4UFLA 2WM0A 4IISA 3LCWA 5I6SA 5KSWA 4XAGA 4L7ZA 1LOSA 1PZ1A 4L6OA 3LMZA 5AN7A 2FH8A 3SCTA 4GWEA 2Y1HA 3SZ8A 3UR7A 4J3SA 1SFSA 4ILSA 1LOQA 1NAL1 4J2PA 4FS9A 4NASA 1C90A 2EHHA 4JD4A 1FTXA 2Q3OA 5CG0A 4I7VA 3WUGA 2CLEA 2DZWA 3UY8A 1CXHA 3C2VA 1MNSA 4NIRA 1W2PA 3H2MA 2FIQA 3U5YA 3W23A 2ZRVA 4M8UA 1E43A 2HTMA 5BROA 1XLEA 5D4YA 4UTWC 4AVMA 3U2OA 4GACA 1QPOA 1E0WA 1ITCA 3SGGA 4PL1A 1K6AA 4HMCA 2PUZA 1SUXA 2Z2BA 4JS3A 4DM2A 1O5RA 4FB7A 4KEZA 1KWGA 1OCBA 4KESA 1EQPA 1MQRA 2E40A 3RFAA 1TR1A 4XTIA 1XGEA 2PAJA 1UWTA 3TONA 3GDTA 4IIBA 1Z69A 4IFKA 2CITA 4LXFA 5CBBA 2D24A 4I9MA 1EPVA 3UCCA 1YTEA 1TQWA 3P67A 1UP0A 3PJTA 1V8EA 1DL3A 4Q32A 4F0SA 5BRPA 2TSYA 1FP8A 1JGIA 3VOGA 3VNKA 3ZXWA 3SEPA 3WNKA 4AB4A 1OX4A 2QFFA 2DIEA 1X6NA 2WKGA 2PWEA 3JUGA 1K9TA 1QRQA 3UWEA 4UTMA 2Z29A 3ZS4A 3NM1A 5AFDA 4H9VA 2C8NA 4LW7A 4LVDA 5IXEA 2PF0A 1POKA 4NZJA 1LQ2A 3NSNA 2OFJA 2H8ZA 4UTUA 2CETA 2NQ9A 2WPBA 4UTLA 2ZX7A 3O6DA 4WQ6A 3SCQA 3DUGA 3ZT7A 3W29A 2ZC8A 3SQLA 2O7SA 1RSCA 1DVJA 3ONCA 2RJGA 1WAUA 3WQ6A 3W88A 4MHBA 5D8ZA 4K8HA 1ZAIA 3HGSA 1KR1A 2QLYA 3CJPA 3WQ4A 2X42A 3FY1A 3VIFA 3ELFA 2GUBA 1OAOA 2YCLA 4YPJA 1SR9A 4LAKA 3KRBA 3MHGA 2YYTA 5AY7A 3GXTA 4Z2IA 5TKYA 3AIRA 1NDYA 4KRUA 2HVMA 3VPLA 3S9ZA 1OD8A 4JTEA 5K4XA 4GQRA 4H6QA 1KD0A 3II1A 1BVWA 2WLZA 3DXIA 1NP2A 3T8LA 4QE5A 1FWSA 3MMTA 1AZ1A 2X2GA 1FHUA 1SZNA 1CB2A 3D2FA 1IEQA 4LAOA 3HV9A 3VKBA 2FDMA 3CH0A 4BI5A 2BGQA 1QK2A 4C6NA 1SSGA 3VX1A 2QULA 2C08A 3UEQA 2O9OA 3I7QA 4BEUA 4DCNC 2FZ9A 4QE4A 1OYCA 4UIOA 4S3AA 3B8TA 3T46A 3FA5A 2F18A 4NSBA 3LXAA 3BAXA 4KIRA 3W6YA 1GOMA 1R3QA 3GHRA 1I4LA 4V33A 3RPDA 5BOEA 3GKAA 5FJJA 4N2YA 4HPGA 2W66A 2YLAA 2GUYA 2E4TA 3EWXA 2BY2A 4D6DA 2WHKA 1V6XA 2J27A 4YL2A 3CZJA 4PA8A 3MDUA 5C9XA 3D50A 1YE6A 5FF4A 1WZKA 5EL1A 3V3WA 5C9RA 1M04A 1RQEA 3H2FA 3N4FA 1OY0A 4PMZA 3MSGA 3IIOA 1M01A 4DI8A 4EAYA 4AZCB 3CZ8A 5BZAA 3MI3A 1XINA 3STCA 1NWSA 5LXXA 1EJXC 2REQB 4KH2A 3G8EA 4EACA 3GUGA 1FQ0A 3ARUA 4NRRA 2XIBA 1Q2SA 1H2JA 2FHFA 5LNWA 3MUIA 2FZDA 3W73A 3W26A 3TYUA 1AQHA 5HWJA 2CBVA 3F03K 3H70A 1B30A 2V2HA 4B3LA 3EAUA 3A4XA 8A3HA 3B8SA 1VLIA 5C5BB 3QVQA 1B9BA 1BKSA 3NXLA 2CZEA 2PDUA 2QJGA 3AICA 4R85A 5AHMA 3L4XA 2WCGA 1G69A 2R94A 5HPCA 3T0TA 1AJZA 3BOLA 2WM1A 2J62A 3OYZA 1HG3A 3C2FA 1O95A 2D22A 1FA2A 4L6DA 1XL9A 1VAHA 1C8XA 3TAOA 3IWPA 2J7FA 2ZUVA 4D6JA 5FJUA 3GTIA 3SCUA 3M5VA 1F6YA 3AWNA 4AF0A 1P7TB 3BJTA 1VRDA 4XBJA 2QF8A 1H3GA 4C5ZA 1V3LA 2PLCA 4RE0A 3GVRA 1AW2A 2QS8A 1ZYLA 3LBOA 2VEIA 4WX2A 4JIQA 4XKYB 3W7LA 5LIUX 3LM7A 5CJ5A 2FZMA 1LWIA 3B52X 1PDYA 4EF9A 4FPSA 1GOKA 1PIIA 1P4CA 2C79A 2WMKA 4UQAA 1HJXA 1UW9A 1XWYA 3CVRA 1D3CA 1W54A 4E4UA 1TG7A 3MP3A 4Y9AA 4ZFCA 2Q12A 1SFTA 5HA7A 1XBXA 4GRSA 4R7JA 3F4CA 2V6AA 1JPKA 2WNZA 1BQGA 3BVWA 3N6HA 3WF0A 1DXEA 3KTSA 1TQTA 2WQDA 4NX0A 4I7WA 1E3XA 1UC4A 4BZYA 1K03A 4YTSA 3GH4A 5BWFA 2HS6A 3RLUA 3AMDA 3UF9A 4GY0A 1E9VA 2PGWA 3VZZA 1KM6A 3BUVA 4G1NA 4LUSA 4PTMA 5T9CE 1PSCA 3EX1A 2B4GA 2VYOA 1XLAA 3WLLA 1GQLA 4O16A 3GY1A 1SO5A 3TTOA 4O53A 1K7EA 1Q6DA 2B7OA 3BG3A 1NIUA 2X3XA 3N13A 1TQUA 4XD3A 5M03A 3BVVA 3CS2A 3ZVHB 2OOGA 2JGQA 2XVPA 1MRAA 3W7DA 1X1NA 4AZBA 3LBCA 3WELA 4CCEA 3VD7A 1OGSA 3ERPA 4QX4A 4RNHA 1VFHA 2DH2A 3TR9A 1JFXA 3VKAA 4JKLA 1RALA 1XH2A 2F61A 2J7DA 1UQZA 2FTPA 3DIPA 3EDFA 3LYEA 1OINA 3AIBA 3SY1A 3A4JA 4MB5A 1TIWA 1LQ0A 5KZMA 3GBEA 3W25A 3XISA 3G1YA 2GGIA 1X1OA 2VT0A 4KCUA 5F1VA 2Y6ZA 4R5GA 4IPNB 4HOZA 4IH3A 2KHOA 3T1GA 4IGSA 1A80A 1FWRA 1NOWA 1GKQA 3G2GA 3DFTA 4R7WA 1OBAA 3L2IA 1LQAA 1QT1A 1WXJA 4GA8A 4GYKA 2V81A 1XFCA 3ABRA 4KWSA 2R8WA 5FIPA 1I45A 2W61A 1G6CA 1GQIA 5DF0A 4F9DA 1PBGA 1EYEA 3WK1A 2EXOA 2VR4A 4I9JA 1CLKA 1LJYA 4S2BA 1GNTA 1MVYA 4RV8A 4YVVA 1V3JA 3CUIA 3JR2A 5HQLA 1NTHA 5D9PA 5F4SA 4FNUA 4HNTA 1IR2A 1F6KA 3RX2A 1E4IA 1TJ1A 4NHVA 4BY3A 1KXTA 1LWHA 3H22A 1ICQA 2Q6ZA 2ZQ0A 4IIGA 4DO7A 1OCNA 4JIIX 3QY8A 3OGSA 4H7VA 5F4XA 3G3MA 4DXKA 2XFWA 5FJOA 4DXVA 2TAAA 1R3RA 1HF6A 3EPMA 1CIUA 4V1XA 4XIAA 1XLDA 1L6GA 2JNSA 2WZIA 2EWFA 4O12A 3AYVA 4GIAA 4CGTA 4M6PA 2XG9A 4I9AA 1B3VA 3QR0A 4LVGA 2Q02A 4LGXA 4W88A 2WK2A 2CFFA 2QPSA 4Q8NA 3KS5A 3WH7A 3KCLA 3OODA 2VTFA 1WOAA 2I5IA 4Y7EA 3DPPA 3OZYA 2IKJA 3S1XA 1N7KA 1R9YA 5E6ZA 2HPMA 1XG3A 3B51X 1YHTA 3CO8A 4O13A 2F2KA 2N3KA 3DYMA 1GVOA 4B5VA 3OW1A 3NGJA 2WNQA 2Z1KA 2XZ9A 1O66A 1K6WA 2OLHA 4DPQA 3NVDA 5G4HC 2IKIA 4C1LA 3ABZA 4Q8UA 2I17A 2FZNA 4HU4A 3IUHA 3NNTA 4XV0A 3R7MA 3W07A 3MMUA 5J5RA 1TWIA 3UWQA 3NPWA 4D8JA 2BMBA 1UA3A 1M7XA 3KLKA 4B3KA 2YA0A 3CUGA 2J25A 4TMCA 1W3KA 1R2RA 2PA6A 2O7QA 3TYCA 4B90A 1QI5A 3TQVA 3W7KA 3AFBA 1WX0A 2ICSA 4EAMA 5ABFA 3QNIA 1QO5A 5KZDA 3I7SA 3VZYA 4H6IA 3QKEA 1I2QA 3IJLA 1K9EA 1OB0A 4BQ2A 1ZZMA 3W6MA 1P6CA 2GJPA 1UG6A 1WAWA 3EX6A 2Y88A 2Y8UA 4RLIA 2Q8ZA 2A5HA 1NWRA 1CEOA 2W62A 3QTGA 3BVUA 1RPXA 1S2VA 1ZNNA 4FF7A 1F4HA 1SO3A 3IUIA 3DESA 2J66A 4L56A 5CZJA 2ALWA 4Q6XA 4XUYA 3KX6A 1C7TA 4WSHA 3CMFA 1OVDA 3G0XA 2WBGA 3Q67A 2PB1A 2WCAA 3BCDA 5AC6A 4GH1A 3TTQA 4DVOA 1GZJA 3LLFA 2WINM 2V63A 1LLOA 2G0WA 3LRLA 3WLTA 5HUOA 4ACYA 5CC6A 3ARQA 4H9YA 3GXPA 3KWXA 2RT6A 4Q7BA 1XD0A 4YXGA 2A2IA 4REQA 1KFKA 3LOTA 1OA1A 4RZBA 1GYLA 1EA9C 2DSWA 2OZ3A 3L4UA 5KETA 4EZVA 2V67A 4MDOA 3HG4A 3OHXM 4IWQA 5I24A 3SCOA 4DZAA 1V03A 3BC9A 5K9XA 1YTDA 3CWOX 1TQSA 2WVTA 2OQLA 3IEBA 1IEIA 4JFUA 5D2VA 2FDSA 6CGTA 9RUBA 1W9PA 3L65A 3SY8A 4R53A 5A8OA 4ASTA 4LBSA 2Q71A 1PHWA 2ZC1A 5E0FA 1TWZA 5A8PA 1CBGA 3E0IA 4M29A 3GNPA 2INZA 5I3HA 4JEQA 3NPVA 1SSDA 3CV7A 1VIZA 2P1FA 1VFSA 3EJPA 3LB0A 4RZ6A 4O4WA 4DF2A 3T0CA 3CLWA 3DG7A 1UWQA 4IL2A 2ZXQA 1GVEA 2WMIB 1V6UA 3T4AG 2J74A 2PDNA 4DWSB 4XK2A 5REQA 3V7PA 3UFYA 2GJRA 3I6TA 3W1LA 1J18A 3H2OA 3CLMA 2E7FA 4JX4A 4LV9A 3S1GA 4TQTA 1EP1A 2J75A 2TRSA 3T2OA 4LS1A 1YBQB 3DZ1A 3U5UA 3QY6A 2H3DA 3EWYA 2DP3A 4NZ3A 4JFSA 3CV1A 3STFA 3DAQA 3ES7A 1EWEA 3TXVA 2ZTJA 1AA1B 2DQXA 1E2UA 3THCA 3B97A 1DWHM 2QCNA 2QJMA 1NU5A 4I90A 5CZ0A 4C6BA 4J28A 3DG6A 2XYLA 3WD1A 3ZR4A 3E02A 3WEZA 1SU7A 1XYZA 2HWGA 4G1KA 1NOUA 4PB4A 4O1AA 1QUMA 5AOUA 1TIMA 3ERCC 4NYYA 1ONEA 4H8NA 3OYXA 2RDXA 4RDZA 4B15A 2YPIA 5L6UA 3W2NA 2NX9A 1I9CB 3NQEA 4ZE4A 2E6FA 4W9TA 3GLCA 1BYDA 2XH0A 4AU0A 4DJFD 4ICNA 5GJNA 3W4RA 1HO4A 2QKFA 3RM4A 4IJCA 1O7AA 4DBEA 3GFXA 4AQLA 1W1ZA 4B16A 5C2CA 1DEDA 1OADA 4PEKA 2ZWZA 5A8MA 5HJXA 1QW7A 3O3RA 4GC3A 3WQDA 2YGYA 5J8LA 1WBHA 4PMUA 3P2VA 3G1FA 4HKPA 2VX7A 3HG2A 3WLSA 4B2DD 1JPIA 1NWUA 3B9EA 2BXVA 3ZWSA 5DY3A 3L5MA 1DYSA 2V69A 1TZ9A 4MJ2A 3VKJA 4AYGA 3AIQA 1PPIA 4XUGA 3H21A 2Z0NA 4TIMA 1GQJA 4FLOA 4O14A 4H8SA 3AOFA 3E9AA 1VS1A 2HROA 3HPXA 4PL2A 3NEHA 4ZR8A 3VE7A 3DHFA 3B8UA 4GX8A 2DVXA 3SJ3A 4IMEA 3TDFA 4PB3A 1UUMA 1IWAA 4D2JA 2Z4GA 1TQVA 4NQ1A 4ORMA 4MB3A 1P0BA 1Q6EA 3MI6A 4UTFA 1DPMA 1W8SA 1K8XA 4WY0B 4MWAD 1J2WA 2ACSA 1N8WA 2WVVB 2VKZG 4Q4QA 4TO8A 1UKQA 1GORA 3NJ3A 3KL5A 2E1WA 1A5NC 3UPMA 5I78A 2VDIA 1YRRA 1E0VA 1PYMA 3T40A 3ZLHA 1B3XA 4AD3A 4HPXA 3VDCA 4MNMA 3QR3A 3MKCA 3NVTA 2DT0A 4BA0A 2Z1XA 1TVPA 1RJQA 3S5SA 1TR9A 4GQGA 1QAPA 1IF2A 1J8VA 4GLEA 3CB8A 3RMJA 3TX9A 1XUUA 1QW9A 4PCPA 3CAKA 3VGBA 3RV0A 2VO5A 5AHLA 2NUWA 3RF9A 3VI2A 1NFBA 3SDOA 3RILA 3W7JA 2ABBA 3STEA 5GNXA 1MXSA 3QQ1A 1RP8A 4JGDA 3A98A 3A9IA 3CMGA 1SJBA 4KFNA 3M0XA 2ZRXA 3T4CA 1VYSX 2QPUA 3MUZ1 2CESA 1H60A 3UG4A 3EA2A 2V68A 3HPZA 3NQBA 1SM9A 1X7IA 2G8ZA 2NVDA 4WCJA 2HNHA 1PCWA 3QW4B 4XBKA 3VCNA 1JRCA 3NEVA 5A8GA 1OABA 3ZJ7A 3PUDA 5BCAA 4PUWA 3PSVA 5D2XA 1YXDA 3NQMA 2PDHA 2CNCA 1S2CA 5FF2A 2XIJA 3T78A 2WO5A 4EX4A 3WQFA 1EC7A 2CKRA 3HFYA 5A6LA 2OX1A 2V30A 2X0HA 2WAGA 4YYCA 3IRDA 1P6WA 4GIEA 4QTGA 4O0QA 1SUFA 3G22A 1W17A 2PGRA 2J47A 3U7VA 4BCEA 3V0SA 3QNJA 2PZNA 3SUVA 2ND0A 1Y0EA 3I68A 4EK7A 4NP7A 3NQ6A 3VNIA 1ZCCA 2PWGA 1K7XA 2WNNA 2J9YA 2ODOA 3QHNA 1EIBA 3PFMA 3CHFA 4JY8A 3UBPC 3ZJ6A 3A3XA 3LVTA 4L61A 2ADAA 3NZPA 1XCXA 1JCJA 2DH3A 2VOTA 4TVDA 2GDUA 3VEBA 3PPFA 4U5KA 3NAVA 3VOFA 4MNJA 5CBJA 3VGDA 4Q4RA 2E67A 2X8RA 1SYTA 3CAQA 3Q0KA 4CNNA 3HTWA 4HPNA 1Z6KA 4IFKB 2W5FA 3CUFA 1ZFJA 1THFD 3LD5A 3SUTA 3URBA 3GU2A 3QW3A 3MO7A 2WB5A 1M9HA 3B0YA 3CQHA 4JIEA 2RAKA 4N9EA 3WQ8A 3UR2A 1V0MA 3U9IA 2HXTA 5DMNA 2BGNE 4K3ZA 3BJSA 1UWUA 3D51A 4M80A 1QJWA 4OOUA 4GI4A 3WLQA 4HSOA 1TCDA 4OFCA 1UZHA 1OX4B 2PURA 2QCMA 1EC9A 2PU0A 2NLYA 4LX4A 4IGMA 3T09A 4AX6A 3L12A 1XLKA 4QISA 1HJUA 4AVNA 2ZICA 3TA6A 4P61A 5CZKA 1G4TA 3WEOA 1ME8A 5H1WA 1YIXA 4I8YA 2ZRUA 5K9CA 2OO2A 4UNIA 3PR2A 3A23A 3UITA 2BOFX 3VNZA 1XYLA 3D3FA 3JU2A 3A5FA 6XIMA 1IE7C 3K13A 1ONRA 3UWWA 3TKFA 2NWRA 3H2EA 4OU1A 3FN9A 3URAA 4Q22A 3EB2A 3OVGA 3EDKA 4HSNA 5B80A 1VEMA 4LY8A 3LLXA 1HL8A 4QG6A 3PZNA 3NDYA 4ZVJA 4HMDA 3WLKX 1R38A 2YCLB 4K1WA 1S5WA 1PIFA 4KS0A 4M1BA 1TTPA 4YHGA 3SN1A 4A3QA 1QW8A 1XRTA 4YTTA 3R8GA 4GABA 1QU4A 4PMQA 5I79A 3SYVA 1LTDA 2G37A 1RV8A 4X9YA 2WANA 4YTRA 2D3LA 2PRHA 4N42A 2R1PA 1KCLA 2D3NA 3FK4A 1OWQA 3VIOA 2Z2UA 1JZ2A 4IGNA 1GVFA 4Q4PA 3WJYA 3WD3A 4PBEA 3AQUA 4E2BA 4GYPA 5AKQA 2OW6A 4DUVA 2DIKA 2EFLA 1UP2A 3TMLA 1TV7A 2Y24A 2GAFD 1JJKA 2F6UA 1ECEA 2OQYA 2JALA 1JPMA 3HB9A 3USZA 5DBTA 3TLLA 1OC7A 1TV3A 1XPGA 1EZWA 3BAWA 3LSBA 2DT1A 3LGGA 5CGTA 2PFHA 4EZUA 1P48A 2GVEA 5I77A 1QHPA 2WCSA 5CAHA 1L6SA 4EPEC 3W1RA 3RHGA 4GG9A 4N9CA 1QI3A 1MEIA 1A5KC 1TPUA 4HY9A 2VC5A 1H0GA 5C54A 3G0SA 3D4ZA 4UOQA 3UESA 5G4EA 4B5WA 4H01A 2VZSA 3PVFA 1PE1A 3WD4A 4JQ3A 3WBXA 2V5LA 3FVDA 1VLWA 2YLLA 1RR2A 4GBDA 1GOOA 1XGDA 1HQTA 2YOCA 2EPLX 2EFKA 1IT8A 1R3TA 1I0BA 4FR1A 1AG1O 3MO4A 1E6ZA 4GJJA 2E6YA 2RDUA 3EEGA 4WPEA 4E4FA 3RYSA 1R3YA 2I56A 5B7YA 3N3TA 4LT9A 3RO6A 3A21A 2LM0A 4YYFA 3SCNA 3BUBA 3E96A 3UJ2A 2WW5A 2ANUA 1JF5A 1OGGA 5LNUA 3SN0A 4KETA 2QCLA 4LBRA 1DBTA 4MVAA 4NU7A 3WY1A 2CHOA 4IM2A 4ZQMA 5BNKA 5IDZA 1OFDA 2XPKA 3MUXA 2RDTA 3PBYA 2VUNA 3IGXA 1HJSA 4X2PA 1US2A 3C2EA 4QBXA 4GZEA 5E0KA 3MTWA 4Q33A 1X38A 4RE4A 1PTAA 3CAWA 3RR4A 3NQ8A 1ZB5A 2XGZA 1GW9A 1X6LA 2DSKA 2KAUC 4FNRA 3VOHA 3THQA 3HQOA 1YEYA 3ZQ9A 4UTIA 4AF0B 2Q8XA 3BSHA 1AH4A 1R8LA 2FMOA 4AEFA 2PC4A 1H11A 5E9AA 1H50A 4U2ZA 2BX7A 2PE4A 3FYYA 3W01A 1PYFA 4ZO6A 1PJ9A 3NYZA 2O9RA 2C14A 3OZMA 5AC8A 1EOKA 1HP4A 3S6TA 4NSWA 4PMXA 4QG9A 3WDRA 2G4JA 3EMCA 3EJTA 4LALA 5HWNA 3CL8