2YL8A

Inhibition of the pneumococcal virulence factor strh and molecular insights into n-glycan recognition and hydrolysis
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
434
structure length
434
Chain Sequence
NEKLAKKKIVSIDAGRKYFSPEQLKEIIDKAKHYGYTDLHLLVGNDGLRFMLDDMSITANGKTYASDDVKRAIEKGTNDYYNDPNGNHLTESQMTDLINYAKDKGIGLIPTVNSPGHMDAILNAMKELGIQNPNFSYFGKKSARTVDLDNEQAVAFTKALIDKYAAYFAKKTEIFNIGLDQYANDATDAKGWSVLQADKYYPNEGYPVKGYEKFIAYANDLARIVKSHGLKPMAFNDGIYYNSDTSFGSFDKDIIVSMWTGGWGGYDVASSKLLAEKGHQILNTNDAWYYVLGRNADGQGWYNLDQGLNGIKNTPITSVPKTEGADIPIIGGMVAAWADTPSARYSPSRLFKLMRHFANANAEYFAADYESAEQALNEVPKDLNRYTAESVTAVKEAEKAIRSLDSNLSRAQQDTIDQAIAKLQETVNNLTLTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of the Pneumococcal Virulence Factor Strh and Molecular Insights Into N-Glycan Recognition and Hydrolysis.
pubmed doi rcsb
molecule keywords BETA-N-ACETYLHEXOSAMINIDASE
source organism Streptococcus pneumoniae
molecule tags Hydrolase
total genus 172
structure length 434
sequence length 434
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2011-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.90 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AF1782-like 2yl8A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2yl8A01
1E40A 2CYGA 3PZVA 5CG0A 4DUVA 2D24A 4HU0A 1I1WA 1E5NA 4JAWA 5D9PA 5D9OA 2JEQA 2VZUA 2QMKA 4RE2A 1UWSA 5DO8A 3WEOA 1GVYA 1BF2A 2X09A 1RPKA 2FGZA 1QBBA 2DT1A 1QNSA 4S3KA 5GNYA 5I6SA 1OIFA 2ZUSA 1FP9A 3WELA 1E4LA 1H09A 1KR0A 4JFWA 4AIOA 4IPNB 2OYMA 4J27A 4PMQA 1V6WA 1GOIA 4W8AA 1PZ3A 1KXVA 2D23A 5AC5A 4UR9A 2WZHA 1AQHA 5IDIA 4E8CA 5EB8A 4BQ5A 2XWDA 2VQUA 1PJ9A 1TVNA 3CZKA 3F5KA 1Q6GA 1MQPA 4GI9A 4GZIA 3VOCA 1FH7A 4F8XA 2VX7A 3N11A 1VFFA 3T09A 4JHOA 2PWHA 4WKAA 2J7DA 5GNXA 1CLXA 1QPKA 2OWXA 4HA1A 1RD6A 1BAGA 4W7WA 1W32A 3GXMA 3E1F1 1G5AA 4IM4A 4PSPA 2WMGA 1WCGA 4JKKA 2D0FA 3WFLA 3WNLA 2NT0A 1P6WA 1W1TA 2JFEX 2E9MA 2UWFA 1JF6A 3SUVA 3GXDA 1UWUA 3A47A 1NQ6A 4GXPA 4DM1A 5IHSA 2J47A 3OBAA 1EGZA 4UNIA 1UOKA 2BY1A 1E55A 4ZFMA 1FH9A 2BXZA 5CXPA 5D8ZA 4UQBA 4EANA 4AXNA 2YBTA 3AYSA 2XM1A 2W66A 3QHNA 2WXDM 3VGFA 1U30A 3U57A 1VENA 4U5KA 1KQZA 4H8VA 3PZ9A 1GQJA 3M6DA 4AZ5A 2D1ZA 4ACZA 4QFUA 2VVSA 1HJUA 2E40A 1YHTA 3FXYA 3WUEA 2CITA 2WHKA 2Y2WA 5CZKA 3AMKA 1KXHA 4GQRA 2JIWA 2X8RA 1UD4A 3A4XA 4MNMA 1UWIA 1E6PA 4KMQA 3MMDA 1EDQA 3F4VA 3GNRA 4HZ8A 5LA2A 4M80A 3U5UA 4JKMA 4WIWA 1QI0A 1ZBWA 3VDCA 4QLKA 3K8KA 1CGWA 1OIMA 4XV0A 2ZX9A 1BGAA 3CHDA 4P7RA 1XGZA 2VURA 1PX3A 2VI0A 2ZOXA 1KR1A 4U3CA 5A6MA 4FF5A 1QI5A 2D0GA 2PWEA 1C7TA 3WNPA 3WH6A 1ESWA 3VDHA 1CGVA 1TG7A 2VCBA 4LXFA 4U33A 5I0DA 2J8GA 2FHBA 2J8FA 5IFPA 3VM7A 1TA3B 2G3JA 1YQ2A 5FD0A 1E6RA 4U2YA 3KEHA 4CVUA 1E6SM 1K9FA 1Q6EA 8A3HA 4CU6A 1JIBA 4S3JA 3ARUA 1HJWA 2ZWYA 2ZX5A 1EO5A 2Z1KA 3ARTA 1JFHA 3UG5A 1W1YA 1G01A 1UD2A 1DWHM 1CECA 3VGHA 1PIFA 1UA3A 4PUDA 2GSJA 1E6XM 1OGGA 2JIEA 2ZUNA 2YIHA 4W89A 2XFFA 1JI1A 1QHZA 4E4PA 4WLCA 2OSXA 4A4AA 4UCFA 6CGTA 4OZOA 3WH7A 4NF7A 1V0MA 3RM9A 4M81A 1E3XA 1V08A 3B9AA 3AFBA 3N17A 1UH3A 4XX6A 1PPIA 4HZ7A 2YL5A 4AWEA 2ZE0A 5ABFA 1E1FA 3SCNA 3WQ5A 2YDSA 4JZ5A 3RJXA 1HT6A 5ABHA 1CYGA 3ZJ7A 4KRUA 4AD2A 1UH4A 3RILA 3OA5A 4BF7A 3BMVA 2WK2A 4MB4A 4MJ2A 3VUPA 1HJSA 6TAAA 4GI6A 5JIPA 1US3A 3DC0A 4LGXA 1TR1A 2XHYA 2TAAA 1KWKA 2VRQA 2A3HA 1M7XA 3S6TA 3CZ8A 1CTNA 1IZKA 4J3TA 1H1NA 2PMRA 2YL6A 1E0WA 1ZBKA 1ZBCA 1CXFA 3AI0A 3VNZA 4E8DA 4D71A 1BGGA 3WF2A 1VFOA 1E4MM 1CGTA 1HX0A 4EKJA 1LG1A 2NSXA 1VEPA 5E70A 4XZWA 1W9VA 5BXPA 4LX4A 1ISVA 3MUAA 1NP0A 1ITCA 4NRRA 3GNPA 4TUFA 1E5JA 1DTUA 2D2OA 5CLWA 4TVDA 4V27A 5D8WA 3ZJ8A 2VX4A 5E6YA 1H49A 1UKQA 5A95A 3AXXA 1QNPA 4A3HA 5IFTA 3RDKA 4UFJA 3WH5A 1UD3A 3VGGA 4BS0A 1EO7A 2JF6A 3OLGA 5CLTA 3MANA 4L4PA 3FHAA 5A69A 2GDUA 3BCFA 4BA0A 5GPRA 1W1PA 1HJXA 3G6LA 1MXDA 3W6MA 1VEOA 5E0CA 3I3EA 4WKFA 1EDGA 3SCQA 3ZT7A 4HOXA 4GI8A 4ZENA 1VRXA 2ZXAA 1QNRA 5A2CA 1CIUA 4YHGA 1H11A 4PMUA 3VGDA 3CUGA 1W3LA 4B3KA 2GK1B 1EOKA 1UH2A 3AHVA 1NP2A 1RP9A 1M53A 5EFDA 1CWYA 2E8YA 5HNNA 2Q8XA 4B3LA 1WDQA 4AD4A 5C8BB 3ARQA 2F8QA 3QHMA 1GJWA 2W91A 3L4WA 2JF7A 4B15A 3L4TA 2J25A 1FP8A 3VM5A 4CUCA 2QPSA 3WDHA 1XSIA 3KWXA 2OYLA 3VX0A 1C8QA 3WN6A 1XH1A 4HZ6A 4RL3A 3VD5A 1EXPA 4D6HA 1QNOA 1ODZA 4J3XA 3SCPA 4EAMA 1EA9C 3QHOA 4QLLA 3VTRA 2BS9A 1WKYA 1GHRA 5EFFA 1UG6A 5KEZA 2PC8A 3VGBA 4IISA 2ZX7A 2BY3A 2EPNA 3RJYA 5DFAA 1V3IA 3B9EA 3AHYA 4P7QA 1V0NA 1XV8A 1JL8A 4D72A 1MFUA 2DSZA 1VFUA 3AIUA 5AYBA 3UG4A 3WF4A 1FH8A 3FN9A 4EK7A 4P7LA 3AXHA 3W82A 3PTKA 1BSIA 1QW8A 1WZKA 1CNVA 3WDIA 2NT1A 4ZE5A 4P7NA 2E8ZA 1JXKA 1ZJBA 2GK1A 3TTSA 2BHYA 3IAQA 1AQ0A 3GBEA 5A94A 2FH8A 3KL3A 3TOPA 3HMCA 1OINA 5JBEA 3ZJKA 2CESA 5FCZA 1IT0A 1BPLB 1CGYA 4PYSA 2G8ZA 1HKJA 3BC9A 3TTYA 1KFWA 1J12A 2WBKA 3QGVA 4P8XA 1JZ6A 3QOMA 1E0VA 3WSUA 1OGSA 4MDOA 1KBKA 1O6IA 2WC4A 3OIHA 4AEEA 1XC6A 4TOQA 2YDRA 3N9KA 4PMDA 3WKZA 1DWGM 1LWHA 1H0IA 2HISA 3EDFA 1IZJA 4PUEA 3AHZA 3ZO9A 4MB1A 2DGAA 3AMLA 5BXTA 9CGTA 3BAJA 3ARZA 1VJZA 2OWWA 1UR9A 2VZTA 3KL5A 2WB5A 1I75A 4ZXOA 5IXEA 4AC1X 1Q4NX 1HF6A 5F7UA 1ZL1A 2VR4A 1G94A 2Z1SA 5BROA 1XD1A 3DHUA 1HXJA 2C7FA 1HP5A 1TCMA 1E3ZA 3IAPA 1Q6DA 2PWFA 1OM0A 2FHCA 3AMGA 1GW1A 3W81A 2JEPA 4Y7EA 2WKGA 1XH2A 1B0IA 5BCAA 2CXGA 4MJ4A 3SCTA 3L4UA 4DM2A 2W62A 2YBUA 3BAYA 3W53A 1JG9A 1JF5A 2XVKA 3AOFA 3MUZ1 4F66A 2VVNA 2QV4A 3ARSA 3WNMA 3POCA 1QI4A 2XG9A 2WMHA 4AW7A 2VX6A 1N82A 1SYTA 2WVUA 3PZGA 3CH9A 1J0HA 3VKKA 2VTFA 3RIKA 2WKLA 3APGA 1R86A 2GVYA 1JYNA 1B3ZA 4FLOA 3UR8A 1G9HA 4JFUA 4NSBA 1L8NA 2Y24A 4MADA 4W8LA 4LPCA 3OB8A 3PZIA 4AZBA 4AMCA 2VL4A 3TA9A 1B3YA 1GCYA 2WCAA 1KQYA 2J74A 3PTMA 4FLQA 3WEMA 2XWEA 4FK9A 4ACZB 1NWSA 3GH4A 1MVYA 2F2HA 1ZU8A 4GO8A 4M24A 2ZXBA 5D4YA 1EHNA 3CGTA 3K8MA 1J0IA 3CZLA 1FHLA 1VBRA 3AZRA 1FFQA 3T0DA 3WF3A 4CU8A 4TVUA 3W29A 4H2CA 2MANA 1EHAA 3ZSSA 2D0HA 1G1YA 1AQMA 1VFMA 4ZE4A 2VZVA 3LMYA 3AXIA 2O9PA 4TXEA 2QMJA 5FKYA 3AMCA 3FAXA 1NARA 4D6FA 2F61A 2XVNA 2J7GA 1V6XA 3ARYA 3WUGA 4ATDA 1KXTA 4KH2A 3UERA 4UQEA 4QCFA 1QNQA 1BG9A 4URIA 3WQ8A 2BV9A 4PMYA 5BXRA 2WW5A 4OUEA 3W24A 3W0KA 3ZOAA 2JE8A 4LQ1A 2WCSA 3D3AA 1QI3A 2J7EA 2WWCA 2DIEA 4P7OA 5HPCA 1S46A 3WH8A 1NOWA 3K8LA 3G6MA 3BGAA 4PMVA 3NSXA 2YOCA 1E56A 3NDYA 2BY0A 3OG2A 1H4PA 1V6UA 3K4AA 1JZ3A 3SCRA 1OB0A 3TTOA 3AISA 3SCUA 1WAWA 1HVQA 3RM8A 4Z2IA 1QHOA 3BLPX 4AZHA 1Q6CA 5ABGA 2EXOA 3FY1A 2UY3A 2W4XA 1DWAM 3TP4A 4OBRA 4UZSA 3W6LA 1UWTA 1MXGA 2BVYA 1RH9A 4AZGA 3SCOA 3AQUA 4UZUA 3WNKA 4MNJA 3MMUA 4QAWA 1J01A 4W5ZA 3CUJA 1UWRA 4B9ZA 4AYSA 4ZEPA 3SUTA 4JHZA 5E09A 2VOTA 5ABFB 1BYBA 1UA7A 1W9DM 3DYMA 1HKIA 2CKSA 5A3HA 4W87A 2WMKA 2EJ1A 3L2MA 2EQDA 1H2JA 3WUFA 1R87A 3VO0A 1BTCA 1JZ2A 1KBBA 3AHXA 4Z2LA 2BNJA 2OYKA 4AD5A 4J3SA 2E0PA 3BAWA 4B16A 5I77A 3NUKA 3BLKA 2WYSA 3ZT6A 3OZOA 2XVGA 4XUYA 3VIIA 2BVTA 1J10A 1NM9A 3ARPA 3VIPA 4MPKA 1E43A 4JFSA 4PMNA 4OKDA 1ECEA 2WVVB 3AJ7A 4UOZA 1UZ1A 1XHGA 3CZEA 1FA2A 1W9XA 3PZMA 2PI6A 3L4ZA 2J77A 3CHEA 2RGLA 1UR0A 4U3AA 1MW1A 2VNCA 1JZ4A 2CIPA 1SR0A 1CEOA 4U31A 3VIJA 4PMOA 4GQQA 4PCTA 2J62A 5HXMA 2EPKX 2VCCA 4OOZA 4TTUA 3WNNA 3W37A 1OSEA 1GQLA 3WBEA 4JCMA 5I2UA 4HMEA 1WNOA 5JBFA 2XIBA 2AOSA 2J7BA 4V28A 1C90A 1LQ0A 1LWJA 3W26A 2CERA 2GJRA 4M29A 2CNCA 5A6KA 1D7FA 5CPSA 3UR7A 3L2LA 3N04A 1UR4A 1KGXA 3GZAA 1CLVA 4PBGA 1HJQA 5JBDA 2EO7A 2VRKA 1UYQA 4W5UA 4MDPA 3SCSA 1PIGA 2YL9A 3F5LA 3T0BA 4E2OA 1OGBA 4TX6A 4WK9A 1KXQA 1JAEA 3LPFA 1OD8A 1R85A 1OT1A 3U5YA 4JL1A 1E6QM 4XZBA 2WMIB 1B1YA 2VQTA 1K9DA 3NSNA 4W8BA 1CXLA 3DHPA 4NI3A 1V03A 1KGWA 4W88A 4OOUA 2DSKA 1W2PA 2WVVA 4W86A 4ML4A 4MAVA 3WY1A 2Y8VA 1PZ2A 1H3GA 2VUYA 1OT2A 2UY2A 2WC7A 2BHZA 1HL8A 2G41A 3RO8A 5CPTA 4HOWA 5M03A 3BAXA 4CD8A 8CGTA 3WQ4A 3MMWA 3WD3A 2XIIA 2WZIA 2ZUWA 1J0KA 4UFLA 4WSKA 2VMFA 4UFIA 3AS2A 1M04A 3AZTA 3HU7A 1F4HA 4KRTA 1TFVA 4KGJA 2UY5A 2J7CA 5CGMA 2DSWA 1B90A 2EBNA 2CBJA 2DEPA 1NOFA 2DPEA 4YHEA 3O6AA 3T08A 1BLIA 2J78A 3WENA 3ZR6A 4AY1A 2DH2A 2ZUVA 3U7BA 1MQQA 4Z2KA 4D1JA 1UZ4A 1JFXA 3VVGA 1TZ7A 5M17A 2J7FA 3VU2A 4KWUA 1JZ5A 2DSUA 1NWUA 3VX1A 4CD4A 4GO9A 3CPUA 2BFGA 2WMIA 5I79A 2W63A 3CMJA 3VIHA 5DMYA 1UUQA 4CD6A 4D6JA 3THDA 2IUZA 3WBAA 5ABEA 4Z2HA 1Y7VA 4C7GA 4PMZA 3B9DA 3RMEA 1GPFA 5A8MA 4ACYA 1CENA 2UY4A 5A8OA 1KGUA 4L4OA 3KZSA 1E6NA 1HL9A 3IJ8A 2WWDA 1XSJA 2VO5A 1XH0A 7TAAA 2V3DA 1US2A 3SEPA 2OSYA 2GFTA 1OD0A 1BYDA 1L0PA 3ALFA 1XRVA 4UQ9A 1LLOA 4X0NA 4MAZA 2W61A 2YLAA 4DWSA 5FOOA 1U2YA 1UKOA 5A8QA 4FLSA 1GJUA 1X6NA 2OZNB 4HTYA 3VIFA 3GBDA 3WF0A 3ZJ6A 3AROA 3ZT5A 3DECA 3BMWA 1H0GA 3AS0A 4UTFA 1GONA 1WPCA 1D2KA 5CQ1A 1ISWA 1PX4A 2VCAA 2XJ7A 4HMDA 1V0LA 2E3ZA 4H04A 5TD4A 3VGEA 1XCXA 3VMOA 2X2YA 1Z32X 5A2AA 2PF0A 4CCEA 3WDJA 3WQVA 5A6SA 1GORA 5CSUA 1EQCA 1QVBA 1GQIA 3WD0A 2XSBA 4QDMA 3VIGA 1WE5A 4NRSA 1VB9A 4H7VA 3ZM8A 4J3WA 4D6DA 3OLIA 1W9PA 4MB5A 1H5VA 4Q22A 1W3HA 3SIMA 1OCQA 3WL0A 2X1IA 4Q7NA 2WSKA 3POHA 2B31A 5A6BA 2WHLA 1UQYA 5HOSA 2FH6A 2CETA 4HMCA 5A8NA 3CZJA 1ZS2A 2WMFA 4GPNA 1HIZA 4U2ZA 4CU7A 3N18A 4H8UA 3VILA 1CGUA 2QPUA 4M1RA 3CIVA 4DUXA 3VMNA 1XCWA 3THCA 4P8UA 4CD5A 1UWQA 3NDZA 4PEEA 5C70A 1EDTA 1W3JA 1WO2A 4DUWA 1PX8A 1E72M 1W2VA 3WEZA 2BY2A 2GUYA 3HJEA 1FHDA 2WMJA 3VMPA 3VD9A 2G3NA 1JXJA 1HKKA 4QP0A 4R5EA 4PRWA 5AY7A 3EMQA 2YLLA 1C93A 2ZIDA 2G4FA 2XYLA 1DHKA 3AIVA 5JIWA 2BHUA 2WM0A 3WQWA 2DDXA 2PB1A 4PTVA 4AEFA 1EIBA 3OGRA 3EBVA 2O9RA 1UR2A 2CHOA 4XB3A 3VDBA 3UESA 3VPLA 3M07A 1U33A 3GYCA 2E9LA 2CCRA 1XD0A 1EOMA 4BQ4A 3A3HA 4LYPA 3AZSA 3AIRA 4WSJA 2J4GA 3WD2A 2IXVA 2WSPA 4J3UA 2OSWA 5E9AA 3OGVA 3MSDA 1WB0A 3FAWA 4HPHA 1ISZA 1F4AA 1WDPA 1JD7A 4GZEA 2G3MA 7A3HA 5HBFA 1E71M 3HN3A 2JALA 1GZJA 4X0VA 3CTTA 3I3BA 3BSHA 4J7RA 5AYIA 4CKQA 5JUVA 1AMYA 1DEDA 4N42A 4AD1A 3W38A 4AZCB 3K1DA 4A3YA 2V5DA 5DT7A 4HPGA 2W67A 3KE0A 2NW0A 1B2YA 1UR8A 1QI2A 2WPGA 2VX5A 4DWSC 4JL2A 3EMZA 1C92A 3J7HA 3GXIA 3A6OA 1UHVA 4HU8A 3SUSA 2OO2A 2FGLA 3OZPA 4UFKA 4F9DA 1OBAA 2DIJA 5ECUA 1NWRA 1VIWA 1W9BM 1PAMA 5FL0A 4D6CA 3WH9A 4K68A 1C8XA 5I23A 3EMCA 1SMAA 2D20A 4OBSA 1B3VA 4UQDA 4N0RA 1V02A 2VC9A 1JZ7A 4W85A 4CN1A 1MW2A 1JI2A 2YJQA 1J0ZA 4AIEA 2ZUMA 4BZYA 3TONA 3OLDA 5M3WA 2DT3A 1DWIM 2WVSA 4WJXA 3DYOA 4JFVA 3ARVA 5AC4A 1W91A 4DWSD 4W93A 5C71A 3BCDA 1GOQA 5HDRA 2VZOA 4H8HA 1JDAA 1EH9A 4AD0A 1HNYA 1ISXA 5DT5A 5LA0A 4PMRA 1R7AA 2YA1A 2AMGA 3N13A 4QLJA 1J0JA 2VR5A 2DH3A 3GM8A 2FHFA 1B31A 2WZEA 1C91A 4AZCA 3MUY1 1XYZA 4CN4A 4UFHA 3SUUA 4ATWA 3W4RA 3A4AA 1UQZA 4GIAA 2AAAA 2ZWZA 4F79A 3AYRA 1PBGA 4PTWA 2ZXDA 2BXYA 1VJSA 2DT2A 5LYRA 3CUIA 3PZUA 1GVIA 3CHFA 1V3HA 1JAKA 3FW6A 3FHQA 1JDCA 1GNXA 1G0CA 3IJ9A 1UD8A 3RPMA 4JCLA 3WD1A 1RP8A 2A3EA 3CHCA 3D5HA 3N12A 5FL1A 4CGTA 1MYRA 5A6BD 2ZXQA 4JKLA 1MW0A 4RE3A 1MFVA 4EE9A 1O7AA 4FZPA 5DEZA 3ZR5A 2PWDA 2CPUA 2C0HA 3LPPA 1LL4A 4FLRA 3VD7A 5HPOA 3FNDA 1B3WA 2IXUA 4BCEA 1BHGA 1R8LA 3MKKA 3SURA 3OGSA 2O9OA 2WANA 4GINA 1J18A 3WFZA 4AIUA 2V3FA 4M8UA 2CEQA 3GDBA 2XFRA 1EQPA 1UD6A 4B9YA 1W9UA 1HP4A 1KCLA 1GUVA 1JD9A 3T2QA 4J28A 1NH6A 3WL1A 2XPKA 1CDGA 1CXKA 5BWFA 1OWQA 3MU7A 3ARWA 3GH5A 4KGLA 4PTMA 1K9EA 4HA4A 4FMVA 3L4YA 5CSYA 2VZSA 1TVPA 4J3VA 3ECQA 4UQCA 1H41A 3ZSTA 1V3MA 1HJVA 2DSVA 4Z2JA 3AS1A 5CGTA 3N1AA 4GKLA 2XGBA 4QCEA 3WDRA 1W1VA 4AD3A 2W5FA 2V38A 4HP5A 2PBGA 3BAIA 1CZ1A 3F5JA 5EMYA 3SCWA 3AICA 3CO4A 4FZOA 4LYQA 3BH4A 2XVPA 2QHAA 3CLWA 2A3BA 3M7SA 5A6LA 3T2OA 2E4TA 1ISYA 4BQ2A 1DP0A 3MS8A 1NOUA 1JGIA 3U7VA 1WZLA 6A3HA 1A3HA 1WZAA 4P8WA 5EBAA 1E73M 1GOKA 2VT0A 2WLYA 3CBWA 3L4VA 3UEQA 2DQXA 5I78A 2ZX8A 3CMGA 2ZUTA 5BXSA 3CUFA 2X0YA 3AS3A 2WVTA 3K46A 3L4XA 1JZ8A 1CXHA 4JFTA 2WC3A 2WNWA 1BFNA 2DT0A 4M82A 5GNZA 1DWJM 1KWGA 2D22A 3DYPA 3AIEA 4U5IA 3VINA 1C8YA 3NSMA 2YDQA 3W25A 1V3JA 4TVCA 4CCCA 1QOXA 1I1XA 1QW9A 1ITXA 2QLYA 1GOWA 1XYFA 3MSGA 2XSAA 3EDKA 4W84A 4PSRA 3AMDA 4C7DA 5M5DA 3VNYA 3VD3A 1TA3A 2PWGA 3MO4A 3WF1A 1E4NA 1LF1A 1MWOA 4OIFA 1C7SA 1V3LA 2V3GA 3PZTA 2ZX6A 3IANA 3K4DA 1B30A 1E15A 2XGIA 1K9TA 4DWSB 2WHJA 2QF8A 1QHPA 2A3CA 5A1AA 3UETA 1K6AA 3NIYA 3QR3A 1WP6A 2GDVA 2EPMX 4V2XA 4PMXA 4UOJA 1KCKA 3PZOA 1ZBVA 3LPGA 3N15A 4MNKA 1JDDA 1ZB5A 3B8SA 1HVXA 1V0KA 1V02E 1HKMA 4MTVA 1MQRA 1JNDA 5CJ5A 4F9JA 1C3FA 1TE1A 3AIWA 2A3AA 3WIJA 4UFMA 2FDMA 3AIQA 4HOZA 4GZJA 5A6AA 3ZIZA 4AZ6A 3O9NA 3BAKA 1ODUA 1WDSA 2YA2A 1E0XA 4CCDA 3TTQA 1UD5A 3WMBA 2WHMA 2XUCA 3VIKA 5I24A 4WF7A 2J79A 1FFRA 1IV8A 2J75A 1WZMA 1GOOA 2WBGA 1LJYA 1BYCA 3UG3A 2RGMA 5KZ6A 5BRQA 1LG2A 1E70M 4OJYA 3VIMA 2CBUA 1B3XA 5BRPA 2VJXA 4Z2GA 1CGXA 3VIOA 1UKSA 1D3CA 3JUGA 2BVDA 5E0FA 3PZNA 3PN8A 1FOBA 4IUGA 3GNOA 5GQBA 7CGTA 1BQCA 4RE4A 3W28A 3QOKA 4ATLA 4PTXA 1JYXA 3PBGA 4AISA 5DF0A 1JNEA 1R7OA 4D6EA 3WNOA 1LL7A 3SUWA 1UKPA 1VBUA 4X9YA 5D9MA 3AIBA 3OLEA 3I3DA 3NJ3A 2WLZA 2CKRA 1VEMA 1VF8A 2V5CA 2Y8KA 1E4IA 4PCSA 3ARXA 3LPOA 4D1IA 1J9YA 2OWCA 1E9LA 5A2BA 1PEZA 3BSGA 4MB3A 2WAGA 4R27A 1A47A 1JYWA 1XSKA 3EDEA 2CBVA 3MUIA 3W27A 4IPLA 2XM2A 3CZGA 4TX8A 2D3LA 4D6IA 4JIEA 2Y4SA 1J0YA 5LA1A 2D3NA 3BXWA 1M03A 4HA3A 3T0AA 5I3DA 4AZIA 2GJXB 2CHNA 1BVZA 3II1A 5D9NA 4CD7A 4NZCA 3S2CA 2JNKA 4UQAA 2E9BA 3ZMRA 5FIPA 1Q6FA 3A4WA 1SFSA 1CXEA 1KB3A 2YKKA 5IHRA 3GXFA 4C7FA 1V6YA 1QBAA 1GQKA 5BYWA 1NWTA 4BQ3A 2YA0A 1W3KA 1BVNP 4CVWA 1SMDA 4WKHA 4M56A 2WCGA 2G3IA 3WQ6A 3WMSA 4AZ7A 2XFYA 5I5RA 3WMCA 1AVAA 1GOMA 1BYAA 3O2LA 3M46A 1JYVA 4W7VA 2EPOA 4PN2A 1BG4A 1GHSA 3MV11 2XVLA 2V3EA 1UR1A 2PBOA 4D6GA 2O92A 2ZUUA 3VDAA 2J7HA 2X05A 5A6JA 3WDPP 4P8VA 2ESCA 4H41A 1X1NA 3NYDA 3KL0A 1CBGA 5CPQA 3ZQ9A 5A8PA 3NCOA 1TMQA 3T2PA 2X0HA 1J11A 3GH7A 4MNLA 4ZXLA 4UOQA 3PTQA 3CUHA 3RM4A 3ARRA 2EEXA 4CN6A 4W7UA 3AHTA 1E6ZA 1LL6A 2GJXA 3WDQA 1MW3A 4YPJA 4LYRA 1V6VA 2ZICA 1UKTA 1WDRA 3PHAA 3WD4A 3RCNA 3VD4A 4TTGA 1TUXA 3EDJA 3EYPA 3PZQA 1M01A 2W92A 1HN1A 3EDDA 1ZJAA 3SCVA 1DWFM 2O9TA 1X6LA 1VAHA 3IJ7A 2VRJA 1CPUA 2C8NA 2HVMA 2OLHA 2CBIA 4YN5A 3WUBA 1E1EA 3GTNA 1CXIA 2XTKA 3UCQA 3ALGA 2EPLX 3IK2A 2YL8A 2Y5EA 1B9ZA 5E6ZA 2GJPA 1V3KA 3MV01
chains in the Genus database with same CATH superfamily
3PZVA 1S1PA 2DORA 2ZZ4A 3UA4A 4PBEA 3URAA 5HNUA 4ZL1A 3C7NA 2JEQA 4G8TA 3PFMA 1F5ZA 5D05A 1OFBA 3TH6A 1GVYA 3V5CA 4GLEA 2X09A 4AWUA 1TQTA 2FGZA 1QBBA 2DT1A 1LM1A 2QJJA 3DEQA 4S3KA 4AY7A 1OIFA 2ZUSA 3W23A 5F1UA 1E4LA 1K1DA 2OKTA 1IWPA 2FYVA 1ONWA 2YYTA 3V5OA 4J27A 1G4EA 1V6WA 4OU1A 3CK5A 2E09A 1AQHA 4BQ5A 2ZBTA 2OVLA 2XWDA 3LM7A 3CV1A 1V7AA 1TWZA 3F5KA 1Q6GA 2BG5A 1UCWA 3M0VA 1V4YA 3IK4A 3OEXA 2VX7A 3N11A 1VFFA 3VOIA 3FSTA 4WKAA 3QJAA 2J7DA 1CLXA 1QPKA 3IVSA 1DBTA 3STPA 4V33A 1BAGA 3GVRA 3SW6A 3QPZA 5G1TA 3LBMA 3UBPC 2EAWA 3FA5A 4FNUA 1W1TA 2JFEX 1WOAA 4OUIA 2VGBA 2E9MA 1DQXA 1JF6A 1NQ6A 3Q67A 4DM1A 2J47A 4O15A 1EGZA 2QS8A 4ZFMA 4CQAA 1FH9A 3LK6A 4HHHA 4O1DA 5F4XA 5CZ0A 2WXDM 3VGFA 4H6RA 1PL9A 1FWBC 1VPQA 1NSJA 2V6AA 1T6MA 2TPSA 2D1ZA 2FGBA 5G5IA 1DJIA 1P1MA 4RKAA 1A3XA 3AXMA 1ME7A 3FXYA 3VC6A 2OMAA 2Y2WA 2CZDA 3AWOA 4MKSA 1KKOA 4L80A 1KXHA 2JIWA 2X8RA 3A4XA 4MNMA 4CNPA 4KMQA 1Z69A 2HRWA 2E5CA 3DDMA 5FJTA 4M80A 3BUDA 2V30A 4IGSA 3HPAA 1CGWA 1OIMA 3D50A 3MVIA 1WDWA 4RNIA 5HA7A 5F1VA 3BZJA 3RO6A 2OFJA 1PX3A 2ZOXA 3SBFA 5HJXA 2F1BA 3JU2A 1SU6A 2PTDA 3PLTA 2D0GA 1A5BA 1C7TA 2VCBA 3M0MA 4K7VA 5HWNA 3ENLA 5GJPA 1NJJA 4YNGA 1X1OA 5IFPA 1TELA 4YTQA 2ZRUA 3SQSA 3VUSA 1E6RA 3KEHA 4CVUA 1E6SM 2FVMA 2ZWYA 2P8CA 1PKYA 3MSYA 3H2FA 1G01A 3BDKA 1CECA 1NDZA 3MPGA 4OVXA 5T8GA 4RNFA 5K9DA 2JIEA 3CT7A 2XFFA 3TJIA 3FA3A 1X03A 2DIKA 4A4AA 3N2XA 2PZ0A 1V0MA 3RM9A 3B8WA 3PUEA 4AU0A 1RUSA 1V08A 1I60A 3G24A 4HZ7A 3CQHA 5D38A 2G37A 1YIXA 1SZNA 4JZ5A 4DBWA 1HT6A 1UROA 1KFEA 3ZJ7A 3KVKA 5C5YA 4H9YA 5MF5A 1G67A 3W7RA 3RILA 1TPB1 4LYKA 4PFHA 4Y8FA 2LXYA 3MWAA 4XTDA 4GI6A 4MJZA 4WR3A 3FDKA 1US3A 5JIPA 1G4PA 1MSSA 4LGXA 1XIMA 5J8LA 5FJPA 1KWKA 3T55A 3O07A 3RAOA 3EJUA 3DC8A 1H1NA 3WLNA 3TYCA 1ZBKA 1E0WA 3D46A 3VCNA 1CXFA 4ZO9A 1XLBA 2Q02A 2JK2A 4H3DA 1VFOA 1FTXA 4MY9A 3DGBA 1HX0A 1U5JA 4O50A 1QTWA 2AQVA 2KX9A 1F8MA 5BXPA 4LX4A 3MUAA 5D2XA 3QV6A 3GNPA 3C52A 4TUFA 4GX9A 2D2OA 5AHFA 1F3WA 4ZSTA 4YWIA 3WQCA 2A7RA 4YLWA 3B0YA 3SZ8A 5E6YA 1H49A 1UKQA 5FSEC 4X2PA 3ZWTA 5A95A 4OBTA 1QNPA 3H22A 1EKOA 2KAUC 1XIFA 4NX0A 4IX0A 3WH5A 5CGQA 4CQDA 3VGGA 4BS0A 4IGNA 3CB8A 1KBIA 2DU2A 3FHAA 4BA0A 3TW9A 5GPRA 1NAL1 1F73A 3G1RA 3DOPA 1UB3A 4OWGA 2O7SA 1EPXA 3TR9A 4E4FA 2GVEA 2PU0A 2YXOA 4PMUA 4Y8EA 3CUGA 1P48A 2ZVIA 3UJEA 1W3LA 3CM4A 4GC4A 5H8UA 1UW9A 4JTIA 2E8YA 5HNNA 1TE6A 4AD4A 3ARQA 1TJPA 3A21A 2ZA1A 4OGZA 2W91A 3L4WA 3L4TA 2CLMA 3W2LA 4CUCA 4MHBA 3MMTA 3LCIA 4L9XA 3WDHA 3KWXA 3G2GA 3EWWA 3MYOA 3TLLA 3D3FA 4HZ6A 3PTDA 3VD5A 1D8CA 3SN1A 4JX5A 2Z1WA 2PSNA 4GA8A 1I6NA 3T78A 4UC5A 3WO8A 3S5OA 1WKYA 3RR4A 5KEZA 3VGBA 2BY3A 2ZTKA 3STEA 1N8WA 1DVJA 3LB0A 4KQNA 1JL8A 4D72A 5C55A 1KCZA 1VFUA 3AIUA 3UG4A 3BLOA 3W1PA 2NQ9A 1LP6A 1FH8A 3EOEA 3FN9A 1GEHA 4DJDA 4YU1A 2PDQA 4JDBA 1ZHAA 1PCKA 3O0KA 3WQEA 4E4UA 3WDIA 2NT1A 3FDGA 4ZE5A 3M0KA 4P7NA 4RW5A 1JXKA 3TC6A 4B9QA 3TTSA 3RG6A 2BHYA 5A94A 4UMAA 1KD0A 4NUWA 4A2RA 4FPSA 3BJTA 3H4WA 4DAFA 4PYSA 1CGYA 5XINA 4NKCA 5BW6A 3BC9A 4LT9A 3M0JA 1KFWA 1X6UA 2R8WA 5CAKA 4Q8TA 4S23A 3IPWA 1QT1A 1O6IA 4FM3A 4CEXC 3OIHA 4K8HA 1XC6A 4PCNA 2Z25A 4L64A 2YDRA 3VFCA 1UBPC 5DX7A 3GZ3A 3AO0A 1T96A 2BLEA 1EX5A 3ZO9A 4X9SA 3OW1A 2DGAA 9CGTA 1UR9A 2VZTA 3KL5A 4QXIA 1U00A 4M19A 1XKYA 5IXEA 4A3UA 4AC1X 3A12A 3P84A 1KFBA 1XQKA 2Z1SA 5BROA 1M68A 5HQLA 3DHUA 4WXYA 1VR6A 3COTA 4KCUA 4LVDA 3AAMA 2FHCA 3AMGA 4ES4A 3B0XA 2JEPA 4O54A 2Q13A 4IICA 4JWDA 5F4SA 3WQOA 4XO6A 7ENLA 3SCTA 3WFAA 1VIZA 5I03A 2E67A 1E0UA 4QDPA 2QKFA 5FF0A 1SM9A 4R88A 1JCJA 3CQJA 1S2WA 2ZDRA 2DZBA 3SRKA 4Z08A 2BODX 4Z1CA 1TIMA 3AC0A 5A8GA 3ARSA 4HHMA 2CW6A 4F4RA 3F2DA 1VBGA 3BGGA 1SUFA 4EF8A 4PCFA 1ZSXA 2VUNA 1YNYA 3MHFA 2WMHA 4AW7A 2VX6A 1VBJA 2WVUA 3GG7A 1XDJA 3H7VA 4UXDA 1DJNA 3ZFHA 1S2CA 3GQYA 1H7XA 1RVKA 3APGA 2PD5A 3VKAA 1JYNA 1B3ZA 4FLOA 4AQLA 3OYXA 3UR8A 4NSBA 3IRDA 5LIUX 5CEWA 4LPCA 1J93A 3NM3A 1GCYA 1NEYA 1KQYA 1YRRA 3WEMA 3GU9A 2XWEA 1JPKA 4ACZB 2PCEA 1EHNA 4GXWA 3ZYZA 4L6HA 1FHLA 2DZWA 3AZRA 1OX4B 4JEQA 1FWSA 2R1NA 4CU8A 4ZOAA 3U8GA 4G9PA 2MANA 4HQVA 1AQMA 1OJXA 3T7VA 3IIVA 2RAIA 3W7GA 3GFZA 1SJCA 1JRCA 4D6FA 4KCVA 1V6XA 1M3UA 4ATDA 2PD9A 3UERA 3KRUA 4QCFA 5C7VA 4QEHA 1QNQA 1OEPA 4XAZA 1BG9A 3WQ8A 4OUEA 1ONEA 1FQ0A 3W24A 2C16A 1PKMA 2HK0A 3KXQA 4IUOA 1RAKA 2J7EA 3NQGA 1S46A 1K4GA 3K8LA 4QHRA 3WH8A 2EJAA 3BGAA 3NSXA 3KRZA 3TMLA 3TROA 1J2BA 1XLCA 1Q13A 4A3RA 1OFQA 4JQ1A 3SSJA 3GVGA 3GR7A 3BLPX 1NF0A 4AZHA 2ZADA 3PBVA 4HCDA 5ABGA 3FY1A 5IBXA 2Q3RA 3R79A 2PY6A 1OX4A 5CZTA 1R5EA 3W6LA 1MXGA 4WDWA 1B4EA 1IYXA 3SCOA 3AQUA 1I2OA 3V0SA 3W7OA 3Q58A 1RK5A 1BWKA 4B9ZA 3D2FA 3SUTA 4JHZA 5ABFB 1IGWA 3DYMA 1T8QA 1VD6A 4NZ5A 3CO8A 4GH3A 4FS9A 4J1OA 3E38A 2PE4A 4JQ3A 1R87A 4XZHA 1BTCA 3FD9A 1B4KA 3A3XA 3AHXA 4Z2LA 1LYXA 3BVVA 4EZYA 1AMKA 2F7OA 2E0PA 3QYSA 3GVQA 2GAFD 2QIIA 5F2MA 5E0KA 3LHTA 2WYSA 1T99A 3ZT6A 2XVGA 4XUYA 4C6PA 1NM9A 5CBBA 4JTEA 4KS0A 5DBTA 3MTWA 4GQGA 2NX1A 3VIPA 4YVXA 4MPKA 4GH1A 4OKDA 3AJ7A 2P10A 1TV8A 3PZMA 4JWIA 3KHJA 2Q12A 1MW1A 1ME9A 2QVNA 1JZ4A 2CIPA 4MPQA 3VIJA 2Z1XA 1N7KA 3TC7A 5G4EA 3B03A 1GK8A 3W2KA 2VCCA 3WNNA 3UNDA 4ZSUA 5E84A 4HJWA 2XIBA 3C86A 5JXQA 3C2YA 4QE1A 1C90A 3PG9A 3W26A 2CERA 2GJRA 3O16A 3L2LA 4E3VA 1IIHA 3HM7A 3MCMA 1CLVA 1HJQA 3R8RA 3ABHA 1UYQA 4W5UA 3JW7A 4MZ1A 4BHYA 3L65A 5DXXA 3SCSA 4OV9A 3QPEA 2NQHA 2XDFA 1E1CA 3O0FA 4E2OA 4WK9A 4HU3A 1R85A 3FIGA 1OT1A 4JL1A 4K6AA 1Z42A 2VQTA 1K9DA 1CXLA 3MJMA 4LU0A 4EZXA 1V03A 2TMDA 1R34A 3R11A 3WK3A 1PXGA 2V5BA 2Y8VA 2VUYA 2WSYA 1OT2A 2WC7A 3RO8A 4HOWA 2DJXA 5M03A 4NAFB 3T40A 3WQ4A 3MMWA 1IQ8A 3SJ3A 5D09A 5FAJA 2XIQA 1SO6A 2MUCA 3AZTA 1TFVA 3MBDA 4KGJA 2J7CA 3MJYA 1S2UA 1B90A 2EBNA 3TUUA 2R6OA 1YWMA 2CBJA 3LNMA 1MEIA 3VNMA 1NOFA 1VCGA 3ZR6A 4AY1A 2DH2A 2ZUVA 3O3OB 2YCEA 1MQQA 4Q32A 4WSHA 3T4WA 4F0HA 4AF0B 2OLSA 3H2AA 1CT5A 3NPXA 3VVGA 1TZ7A 1JQXA 2J7FA 3VU2A 3F4WA 1UWAA 1ICQA 4LVAA 4KWUA 3R13A 2DSUA 3H8AA 3H54A 4CD4A 4GO9A 3CPUA 4JTFA 3IIOA 1U1JA 5CC3A 2P8BA 2BFGA 1EUAA 3UXAA 4H9ZA 5I79A 3QZAA 1UUMA 4Z2HA 4TV6A 4ZQNA 1ZQ5A 2CU0A 4RDWA 2A5HA 1CENA 2LM0A 1TV7A 5A8OA 3TN3A 1MEWA 1E6NA 3N34A 5FJJA 5D2YA 1XX1A 1R3VA 3P0XA 3L12A 1BYDA 4UQ9A 3I4KA 2W61A 1U2YA 1ALDA 4FLSA 1X6NA 1EWDA 2Y62A 2Y0FA 3WF0A 4RXFA 1WDZA 1UR3M 1KFLA 3S1XA 2X3XA 3DFOA 3KW3A 1N8FA 4K1GA 2Y5SA 1LTDA 1ISWA 4HMDA 1OK6A 5TD4A 3UPMA 3GI7A 3VMOA 5A2AA 4CCEA 1I2RA 3TYBA 5I09A 5CSUA 1BSLA 1QVBA 4B4HA 4KIKB 1JEZA 1DKYA 4MLRA 2XSBA 2P76A 1WE5A 1EYEA 4NRSA 1O5QA 3BG5A 3K5XA 1VJIA 3LZ5A 2VOMA 4M6PA 4NIRA 1W9PA 1TTIA 4MB5A 3W73A 1L2QA 3NYZA 1P0DA 3CT2A 1K8YA 4DHGA 1V7YA 2OQYA 4E2VA 1RJRA 6REQB 2B31A 4A2SA 1XLEA 3BLIA 1I4LA 3PY2A 2P5NA 1RD5A 2PLMA 4Q4RA 4FOJA 3E2QA 4HR1B 3W22A 5A8NA 5LNUA 4M1BA 4RZBA 3VOGA 3N18A 2JQXA 1CGUA 2QPUA 1MNSA 3CIVA 4IJCA 4NJIA 2ABBA 3HAHA 1RQHA 1TPUA 3M0HA 4PEEA 3ITXA 2ZE3A 4Q4OA 5HMSA 3M64A 2BY2A 3LM3A 3GG0A 4AHPA 3BVTA 3VK5A 3BLEA 4QP0A 3MDWA 1HO1A 5AY7A 4Y9NA 1QWUA 4FOKA 4M6QA 1K70A 2ZIDA 2O0I1 4X22A 4LJ3A 3AIVA 4XBSA 1JPIA 4IP5A 2WM0A 4PTVA 2Y61A 1EIBA 3OGRA 2O9RA 4KIKA 3W84A 3MYPA 1IXPA 3EEGA 2IQTA 4O12A 4QRNA 1BXNA 4BQ4A 4ZO6A 1O60A 1XLJA 3LV6A 3MBFA 4HSOA 3THQA 2ZRYA 1YPFA 1FWTA 1MUMA 3S9YA 1TV5A 3WD2A 5C6MA 5H1WA 1DTNA 1G7VA 2WSPA 3MSDA 1WB0A 1D7KA 4E81A 2Y7FA 4WX2A 2WQPA 3CWNA 2OLAA 1DQWA 1TWDA 1WDPA 3B04A 4HR1A 3H2MA 2FIQA 5HBFA 1E71M 1DKXA 3IJLA 3KOFA 4Q8VA 2ZZ1A 1AH3A 1HUVA 4HYRA 3UWZA 1MI3A 3HQPA 4Y90A 4IMGA 2HS6A 3NQCA 4DPQA 4F2TA 4QNEA 5DT7A 3KE0A 5DLCA 1Y2OA 2YI8A 1XLMA 1HKVA 2QDDA 5DXYA 1ML1A 1QI2A 1L6WA 3HBLA 1POJA 2EGZA 4DWSC 1XIHA 3FYPA 5JH2A 2FGLA 3DX2A 2QR6A 3TLQA 1VIWA 1W9BM 4WOQA 3KTCA 1C8XA 2PUZA 2DUZA 3EMCA 2D20A 1B3VA 3VZXA 2VC9A 2VEFA 3RV0A 2QW5A 3BOXA 2FZMA 4B5VA 4D2JA 3TONA 3OLDA 3TCEA 3PJUA 4WJXA 4MLJA 3QFEA 1VKFA 4NJGA 4ZODA 1PDZA 5C71A 1GOQA 3G1HA 1HNYA 1KKRA 1R7AA 1ONRA 4MWAA 2AMGA 2YGYA 2Y5JA 1D3HA 1J0JA 4TIMA 2VR5A 3SGUA 3GM8A 4GYKA 4BEUA 3B3DA 1C91A 4CN4A 1IE7C 4UFHA 3KBJA 5H91A 4AHOA 2PDCA 3EJQA 3QM3A 4DELA 1NDYA 1EPVA 1M41A 1RXOB 2QUUA 3TXVA 1VJSA 2DT2A 4A6GA 3CHFA 3IGUA 1JDCA 4UIOA 3IJ9A 4EZZA 2YXGA 3LLDA 2J6XA 4XD6A 1RP8A 3N12A 3R8GA 5FL1A 1MYRA 2ZXQA 4C65A 4YIWA 2IPGA 3W07A 1QR7A 4JTLA 3OODA 3S1UA 3UJSA 1Q6RA 2CPUA 2ZVRA 4ZTXA 1LL4A 3EA1A 2OEKA 1I2PA 3AU6A 3SY5A 2ALWA 2RAGA 3FNDA 4IWWA 1BHGA 2XH7A 2FJKA 3IEBA 2NXGA 1WUFA 3BG3A 3WFZA 4M8UA 2CEQA 3HO8A 4B9YA 1GUVA 1JD9A 3NAVA 4BFAA 5LSMA 1CXKA 2REQB 1P0EA 4JN7A 1OWQA 4IT1A 3W2UA 2NV9A 3PWGA 1GEQA 2UZ9A 3MWCA 1VS1A 3GSMA 5CSYA 1ADSA 4LUYA 3ZSTA 4G2DA 1DJQA 4LF2A 1DV7A 1W1VA 2OTDA 3NQDA 2PBGA 2PFHA 1CZ1A 1AD1A 2YYUA 1ME8A 4ICMA 3W7LA 5EMYA 3H26A 3BMXA 1R3SA 1I4DA 1H7PA 1UMYA 2FMNA 4LYQA 3DFYA 4B5XA 3VKJA 2XVPA 2A3BA 5EMLA 3F2BA 3ISIX 3T2OA 1ISYA 3CQKA 3MS8A 4BQ2A 2QCCA 1ZYLA 1WZLA 3WQFA 1Q4WA 4O8RA 2GVGA 1GOKA 3C0SA 2PRHA 3W7CA 3L4VA 3UEQA 5I78A 1RJQA 3O06A 1RY0A 3N3MA 3CXOA 3CMGA 2ZUTA 3K46A 3L4XA 4DAIA 3R10A 1BFNA 3V0TA 1ZLPA 5HATA 3AIEA 5HMDA 3VINA 4TVCA 3BVJA 3SRHA 1QOXA 3P80A 3SY1A 1ITXA 4D8JA 4JTRA 1EUNA 3EDKA 4JICA 4W84A 3ZXWA 4PSRA 1QFEA 3DKLA 1W5OA 3TC3A 1IEVA 4K1WA 5KITA 1TA3A 4BWLC 2WZTA 1E4NA 4R5JA 2E7FA 2PDYA 2Z0OA 3IANA 4E2BA 3STCA 1K9TA 4GGHA 2ZDSA 2QF8A 4JEJA 4MSSA 3MI3A 1LROA 5D02A 4JTUA 1NFGA 1S5NA 1K6AA 3NIYA 3RMJA 2F7FA 2GDVA 4AX7A 4NYUA 3PZOA 3W7EA 3N4AA 2Z1VA 4MWAD 3T07A 1KO0A 4MTVA 1JNDA 5CJ5A 4D8LA 3OHXM 3W01A 2W0UA 3TCSA 4GNVA 3TDFA 2Z6IA 2RKXA 3AIWA 4QISA 2QFFA 2VD9A 3TJLA 3DYTA 3GTXA 3AIQA 3KRBA 5LIXX 4F0MA 3E0VA 1RBAA 5T9CE 1XLLA 2X7VA 2VFDA 1LRQA 3O9NA 1WDSA 2HMCA 2E77A 2V2HA 3WMBA 5I24A 2J79A 3FLUA 1FFRA 1IV8A 4US6A 5K9CA 3S2MA 3EOSA 2WSRA 3UG3A 1EZ2A 4Y9MA 2RGMA 2JKEA 3P0WA 2BSLA 4IIEA 4PR4A 4GY0A 4RE0A 3VIMA 4DJFC 2J88A 2IQDA 4IP7A 5BRPA 2VJXA 4Z2GA 1CGXA 1AH0A 1JGMA 1DIDA 5E0FA 3PZNA 3UGVA 3PN8A 1SJDA 5DMMA 3I7SA 5GQBA 1BQCA 3W28A 2OQHA 3NURA 3W3OA 4ATLA 1QRQA 2TODA 3N3TA 5AVHA 4X60A 4DX3A 3QSRA 1GVOA 2PS2A 3ZLGA 2WZMA 4EZRA 1RCOB 1NELA 3GVVA 5D9MA 3AIBA 4XBKA 3B0PA 2WLZA 1P0BA 3S8HA 4POCA 2DP3A 1TMLA 3UXKA 1VF8A 3FA4A 2DUXA 4PCSA 4Z0SA 8XIMA 1QPQA 2GOUA 3LPOA 3B8UA 1EP3A 3CNYA 4D1IA 1QK0A 4LSBA 3CAVA 4TR9A 3TN6A 3GC2A 1RJPA 3EDEA 3MUIA 4IPLA 3WBWA 3FJ4A 3BJFA 2HZGA 5LA1A 1GKQA 3LERA 4AZIA 1BEUA 2GJXB 1PE1A 3TIMA 3II1A 5D9NA 2QUVA 1DXEA 4CD7A 3HGOA 4DO7A 4UQAA 3NZQA 4UB9A 5FIPA 3A4WA 1V77A 3DZ1A 3FVMA 1KB3A 4GABA 2WJZA 4AKVA 1V6YA 1QBAA 1WUEA 2YCLB 5KSWA 4HBKA 5D30A 4H8SA 1DOSA 1R3YA 3NDOA 4M56A 2G3IA 3WMSA 3EWYA 3PPGA 4DRSA 1ITQA 2Y6ZA 5EKYA 3O2LA 3B97A 1SU8A 2BGSA 2HCVA 1T0OA 4XIAA 1EC8A 1GHSA 1KTNA 2XVLA 2V3EA 2W6RA 2X16A 5A6JA 3WDPP 4ENLA 1EP1A 2JGQA 3THUA 3KM8A 4XZMX 4KCWA 4LY4A 5A8PA 4XKMA 3PPFA 1TMQA 3S2JA 3GH7A 1J11A 1GPWA 3GR4A 4UOQA 3PTQA 4GQBA 4FZSA 3A9IA 3ARRA 3PNUA 3CEUA 2A2IA 2DVTA 1J5TA 4EXBA 4QJ4B 3G0XA 1VFSA 3GIYA 3ANYA 1GW9A 4ALDA 2GJXA 1QWKA 2NSOA 1JCTA 1SPQA 4JR5A 4N6EA 1WDRA 4QBXA 3VD4A 4TTGA 1TUXA 3EYPA 4R9OA 1HN1A 2F84A 2D69A 2O9TA 4BY3A 1X6LA 2ND1A 5DMLA 3WK2A 3R0UA 3HB9A 1E1EA 2V5LA 3TA6A 1CXIA 1P4CA 1FY6A 2YCLA 1OC7A 3WLQA 1B9ZA 4IMDA 2C19A 3IVUA 3P81A 1E40A 2CYGA 4DUVA 1LQ2A 2D24A 1D9EA 3QF0A 3MI6A 5TBOA 4H9UA 4JAWA 1IR1A 2VZUA 1Q66A 1UWSA 1NTHA 2OZTA 5LNWA 1R6WA 2PP0A 1BF2A 1RPKA 3RLUA 3W2MA 3WELA 5AC7A 4M5PA 3W02A 1X1ZA 4HK5A 3LGGA 4NNBA 3MUCA 4AIOA 2OYMA 1G7UA 1LUCB 3VKBA 3PM6A 1PZ3A 1KXVA 5AC5A 2CLEA 5SWUA 5H8PA 2OCZA 5IDIA 3ZLFA 4WXZA 3QTGA 4QSHA 2RDXA 1WXZA 4GI9A 4KIEA 4HNLA 5FLEX 4L65A 4GZIA 3VOCA 1DJHA 4JNYA 1TPC1 2B7OA 1FVPA 2C15A 4AX6A 5G4WA 3O05A 4HA1A 2AAMA 3GXMA 1W9MA 3LLLA 4XWUA 3E1F1 3NO5A 4IM4A 2ZZ7A 4PSPA 3SGZA 1W3NA 5ECVA 3EA3A 4JNMA 4TQTA 5I3JA 1P6WA 3OVQA 1FHVA 5KBPA 4F2UA 3KBNA 3GXDA 1DIEA 3A47A 4HKPA 3E2SA 5IHSA 2NVDA 4UNIA 3LCFA 1E55A 3UXLA 1TQVA 5FJRA 5IDZA 1XYCA 4REQA 4LW7A 1FWWA 4UQBA 4LRTA 2BX7A 2X1TA 4LCQA 3NZRA 3AYSA 2W66A 4K8GA 4EXQA 4U5KA 3PZ9A 3M6DA 1GVSA 4C91A 1LUCA 5FACA 4LUSA 1R2TA 3QNJA 3MW7A 2E40A 3OZMA 4JY9A 5C9RA 4K36A 5CZKA 1TPH1 3AMKA 4GNKB 3NTYA 1UPXA 3HGJA 1EX1A 1UD4A 1UWIA 3B4YA 1E6PA 3MMDA 1QNVA 3OVRA 3QYQA 4GBDA 1TPDA 1WAUA 4QDWA 3OPSA 4QX4A 2PC4A 4EZTA 4WY0B 1JCXA 1KNWA 3U5UA 4JKMA 4DZHA 5HWMA 5U7SA 3M0LA 1ZBWA 2BWGA 1ECQA 2XISA 2OXNA 2PPGA 4JX6A 1BGAA 4EP8C 3A3WA 2WNQA 4LUJA 5CZSA 3C8FA 4U3CA 1WOBA 1Q6OA 2EG7A 4FF5A 2HNEA 4A05A 3WNPA 2QDGA 1ESWA 1Q6LA 3AU2A 1CGVA 3VDHA 3OBKA 3PAOA 4ERGA 4LXFA 3W72A 2J8GA 2FHBA 3EX4A 2J8FA 3M3WA 3NL2A 2GJNA 4KPLA 3UWYA 3UZYA 1D8WA 3RNDA 4MG4A 1YQ2A 5FD0A 1M6JA 1TVLA 3ARUA 3TAKA 4EPDC 1R9ZA 2ZX5A 2ZZ2A 4LALA 3ARTA 4QE5A 4JNFA 1UD2A 3PSWA 4LNYA 3VGHA 4LEQA 4XD3A 4F40A 4X61A 4DPPA 2GSJA 1OGGA 2PWUA 2ZUNA 3RX3A 4W89A 1JI1A 4E4PA 1YDVA 1N8IA 3GTFA 3P60A 3OTRA 2FB2A 4OZOA 3W85A 3WH7A 4LBUA 5EMKA 4ZQPA 1X8FA 4PL2A 1UH3A 4XX6A 2YL5A 4KWWA 1E1FA 2ZRWA 3SCNA 2NX9A 2F1AA 3RJXA 1DJWA 4GWEA 5ABHA 4PTDA 4AD2A 1UH4A 3OA5A 4BF7A 3M5YA 4MB4A 3DX5A 3GU1A 1HJSA 5IM51 2OT1A 4G6QA 3HZ3A 3S9IA 1XG3A 2PTZA 4DNMA 3N25A 1HXKA 1U5VA 3TW7A 2XHYA 2TAAA 5BOFA 3FK4A 1W5PA 3GY1A 5LHFA 2EX3B 1YXDA 2A3HA 1M7XA 3C4UA 1W5MA 3B8TA 1AJZA 1CTNA 4O1FA 1IZKA 5AB3A 3TWAA 3QV8A 3APTA 1TTJA 5AHIA 3WLSA 1MRAA 4XAGA 3LRMA 5E1QA 3QGAC 1KRBC 1BGGA 3W9ZA 3WF2A 3CAWA 2DW6A 1E4MM 1A5AA 1LG1A 3KOWA 3CASA 1VEPA 2C3ZA 3LQLA 1ZJHA 2HQAA 1DTUA 2NQLA 5CLWA 3VC5A 5HMFA 1PTGA 3TJXA 3CQ0A 4KEMA 1SO3A 4NZ4A 5D8WA 1YTDA 3O3NB 3PWIA 4K2SA 5IFTA 2DJLA 2V5KA 3P8IA 1PTAA 4C5ZA 3RLHA 2JF6A 3OLGA 2A79A 3MANA 2GDUA 1GOXA 2AL2A 1W1PA 5KETA 1HJXA 3DN5A 3G6LA 4EZUA 1VEOA 4YL2A 4WQ6A 4F0RA 4JIRA 3ZT7A 4ZENA 1VRXA 3A64A 2GJLA 3SM0A 1QNRA 4YHGA 1FWEC 1PS3A 2Y7EA 1K3UA 1RP9A 4J3ZA 3UJFA 4ZOCA 4B91A 4B3LA 3C2OA 2I56A 4IH3A 3BV4A 3E9AA 4JTJA 1GJWA 1E51A 2B7PA 2EPHA 2OB3A 5DCDA 4Q7BA 1XSIA 2BGQA 3I68A 3VX0A 1C8QA 3VNKA 1QWGA 2V63A 4RL3A 2KZHA 1EXPA 1QPNA 1MDRA 3AJXA 4G6CA 1OY0A 4ADUA 1O68A 2BS9A 1XYMA 1H50A 3UWQA 1XW8A 4QJ5B 4IFKB 2VFEA 3LLFA 4N9CA 3PUGA 3EJSA 5EFFA 2PC8A 3GYEA 4IISA 3E0FA 2EPNA 3KCLA 1XLKA 4AIBA 4G1NA 3WQGA 1V0NA 1V6TA 2PDMA 1XV8A 4MYAA 4IPPA 4FAMA 5HJLA 1IEWA 1N2VA 3F4CA 3ZS4A 3PTKA 5C2GA 3FXGA 5I07A 5DANA 1RZMA 3EGJA 3M1ZA 2E8ZA 2QCFA 3AYTA 2PA6A 3RFAA 2X1SA 3GBEA 3W1XA 2FH8A 4HZMA 3TOPA 4X2RA 3P14A 3HMCA 1G69A 1M1BA 5JBEA 3ZJKA 3I10A 5FF3A 4H6KA 5FCZA 2HWGA 1IT0A 3IUDA 4G7FA 2G8ZA 1S39A 2OT0A 4OFCA 4WDTA 3CUXA 4WDXA 1J12A 1TPEA 3CPGA 3GS6A 4KESA 3QOMA 3CV2A 1OGSA 3TQPA 4GKTA 3HAIA 2Q8ZA 1KBKA 5FA5A 4ZB2A 2Q01A 3N9KA 3B05A 1KFJA 1H0IA 1P6CA 2GDQA 4GX8A 3FYYA 2QCNA 3DG3A 4YVVA 1UASA 3AMLA 3E5BA 3W1UA 5HR7A 3GD6A 3BAJA 1OCBA 2OWWA 1VJZA 4AWTA 4JY8A 2WB5A 1I75A 1OVDA 3W7QA 5HQEA 3GG1A 1ZL1A 3F03K 3N9SA 3AUJA 4DO4A 4B4FA 3E74A 4QIUA 1C9WA 1SFJA 1MMFA 1TCMA 2IMRA 4MYXA 5DCBA 2PDHA 2PWFA 1FWIC 4PBFA 3CQIA 1YDOA 3W81A 3C8NA 3SO7A 2HS8A 4LAKA 4IW0A 1ADDA 3ZEDA 2CXGA 1QU4A 2FLIA 2J27A 3TU9A 1OABA 4DXVA 2YW3A 1X97A 4DM2A 2W62A 3LXBA 2C1GA 1LBLA 1R0MA 4O8AA 5FEZA 1RLDA 3MUZ1 3DHDA 4F66A 2QV4A 3POCA 4H7CA 4S38A 4A8LA 3G9GA 1EF2A 2GGJA 4E5TA 2XG9A 3TSDA 3XIMA 2ISSA 4Q4QA 6ENLA 4ZZ9A 1EZWA 2PGFA 3PZGA 3CH9A 1W8GA 3ITOA 3RIKA 3QMRA 1R86A 3CZSA 2HROA 1G9HA 3TR2A 2Y24A 2DZVA 4MADA 3G77A 2VL4A 3ZR4A 1B3YA 3DKJA 3NPVA 5K7JA 4FLQA 3JR2A 3PTMA 1X8CA 4EPEC 3G18A 2WJDA 4B5NA 4GIYA 3JS3A 1MVYA 4PL1A 1ZU8A 4M24A 2ZXBA 5D4YA 3TYEA 3K8MA 3CZLA 1KM3A 1KLYA 3WJSA 2E68A 3T0DA 4MIMA 3WF3A 3WLRA 3LY0A 4TVUA 3W29A 4LOCA 4WY0F 2QKWA 3D47A 5G2IA 1G1YA 1GYNA 4ZE4A 2WQDA 4ZQOA 1ELSA 3LMYA 4UTWA 3D52A 5FKYA 3S5NA 1QPRA 3FAXA 1O5XA 1NARA 2AQOA 2J7GA 4DJDC 2IKIA 2C13A 1T7LA 1WV2A 1NVMA 1PWMA 3LGEA 5XIAA 4HSNA 4WD0A 4PMYA 4QQ3A 5BXRA 3U0HA 2O4QA 4DLFA 3SOGA 4GFIA 1CB2A 3TV8A 3N4FA 3ERCC 3PNZA 2WCSA 1PSCA 1A5UA 4LH8A 2WWCA 4KFNA 2WV8A 3NDYA 4EZQA 2BY0A 3P7YA 3OG2A 4RNJA 4UTKA 2ZZ5A 3K4AA 1IEXA 1OB0A 3TTOA 3RM8A 1OZQA 2INFA 3DPQA 1TJ2A 4NVTA 1LBMA 1A4MA 1EGMA 2PDGA 3BCJA 1EEXA 4WZHA 1SU7A 1G6CA 1UWTA 3B4UA 2IS7A 1JCYA 3ONBA 4DI9A 3UR2A 5CPOA 1Y5WA 4QAWA 1RVGA 5DY2A 3BW4A 2B81A 3UPWA 3LUTA 1GZGA 4IM2A 4C6BA 3IJQA 4K3ZA 2VC6A 2EJ1A 2EQDA 4Q6XA 2Z0IA 1BXBA 2BNJA 4AD5A 1XXXA 5I77A 1QDSA 3UCDA 3VIIA 3TNBA 3QTPA 1J10A 4M3PA 5JQ9A 2WO5A 3M0IA 2EG8A 3DFHA 4GOAA 5DN1A 4PMNA 3IIPA 1XI3A 3CZEA 4CLMA 4JTQA 3I6TA 2PI6A 3L4ZA 1E0TA 2J77A 3CHEA 1P0NA 1F2JA 2VNCA 1CEOA 4U31A 4XIMA 4G1KA 4PMOA 4GQQA 2J62A 4WEVX 1I49A 4QE4A 3HPZA 2RJHA 2EPKX 3GW0A 3VKHA 4TTUA 4IMAA 2D2JA 5EPDA 1GQLA 1YX1A 5I2UA 5JBFA 2AOSA 3CC1A 3OWGA 1XF0A 2W9MA 4V28A 4IFRA 4EXAA 4M29A 2CNCA 4HNCA 5CPSA 4WRHA 3PPCA 3WJYA 3N04A 3NPWA 2ZFAA 2VHLA 1FBAA 3NEHA 3H23A 2EO7A 1RR2A 1RQBA 2J6VA 3E49A 4PFMA 4IJBA 4IMEA 3DIPA 4P2VA 4AVNA 3T0BA 1H61A 1OGBA 3BWWA 1JAEA 3LPFA 1OD8A 1DIOA 3A5FA 2EKCA 4NSWA 1EJSC 3EAUA 3A22A 2F9RA 3NSNA 2WYHA 4CNSA 4F00A 3WG6A 3GNDA 4OOUA 1W2PA 4S39A 4W86A 3IGHX 2DQWA 3EX2A 3WY1A 4O0ZA 1H3GA 2BHZA 4GG9A 1HL8A 2X1RA 3L23A 4CD8A 2DZXA 4BK9A 1IR2A 2WZIA 3DXIA 5REQB 3KAVA 1CLKA 1OX5A 3KWSA 4UFIA 3AS2A 2Z2BA 1M04A 3PP7A 1F4HA 4KRTA 2C71A 1GVQA 1Z7AA 1HGYA 3BE7A 2DSWA 3MP3A 4L1WA 1K02A 2FVKA 2C0AA 3CL7A 3O6AA 4XKYB 2OOGA 1Y0EA 5IBXC 1S5TA 4LC8A 1X39A 5HWJA 2QCDB 3OP2A 4C6MA 1GWJA 5FI8A 3V36A 4D1JA 2OGYA 1JFXA 3QZ6A 4MMWA 1IXNA 1WXJA 4B5WA 1NWUA 1H62A 4JTHA 4DBDA 3IV8A 4LEFA 1OG6A 4Q8NA 1EYWA 3EWCA 2CZEA 3VIHA 5DMYA 4D6JA 4YCOA 5ABEA 1BWLA 4HNUA 3FKRA 1A0EA 1GPFA 1NQKA 2YZ5A 2UY4A 5FF2A 4L4OA 2VEIA 3C3UA 3KZSA 2Q6ZA 5REQA 1REQB 3HF3A 4FALA 3VOHA 1SUXA 1XH0A 3UZWA 4R85A 3T1GA 2GFTA 2I57A 3ALFA 1XRVA 3VNIA 2HPMA 4MAZA 2Y88A 1LWIA 1ZUAX 4XKYA 1GJUA 1U1HA 1PHQA 1TREA 3W00A 3GBDA 3VOJA 3ZT5A 4IP4A 5HUPA 1H0GA 3AS0A 1PHWA 3S2NA 1WPCA 1DE6A 1U22A 2HSAA 1D2KA 2AMXA 5CQ1A 5CH9A 1XLHA 3QQ0A 3R6IA 1XCXA 2X2YA 2BZNA 3N9RA 3VEBA 2PF0A 4UR8A 2HVNA 1GORA 1EQCA 2D2GA 3DU0A 3SN0A 3DX3A 4QDMA 4H1ZA 1ZY9A 1VB9A 4IFOA 4D8AA 1TPVA 3QY8A 2F6XA 4D6DA 3OLIA 3IARA 4Q22A 1W3HA 1OCQA 4G56A 1VBHA 3QKEA 1BKHA 2X1IA 3BOFA 1S2VA 4OE7A 2H6RA 1X96A 3S5YA 3DENA 2WHLA 1REQA 4GIRA 1H7OA 2INZA 5FJOA 3GG8A 3W2JA 5HOSA 2CETA 3REQB 1Y65A 3ABSA 3T05A 1MUCA 1YXCA 3CZJA 4IX2A 1BXCA 1ZS2A 4AVFA 1HIZA 4FF7A 4CU7A 2XN1A 4H8UA 4Y2WA 3HGSA 4GVIA 2NX3A 4P8UA 2CFFA 4CD5A 1UWQA 5C70A 1BQGA 3D6NA 1WO2A 4DUWA 1PX8A 3W1MA 1SO4A 3UXIA 2G3NA 1NDVA 1HKKA 2FPYA 2Z24A 3KRSA 3GE7A 3DFQA 3LVTA 3NQMA 1H60A 3ERPA 3R12A 5K3VA 4GJIA 3RU6A 3MCOA 2PODA 3UCCA 2BHUA 3WQWA 2BOGX 4ROPA 1UR2A 4FIRA 3W83A 5A5WA 4XB3A 3HV9A 2IPWA 2IPJA 3V18A 4L1XA 2E28A 2PDIA 3K1GA 4ORIA 4C6FA 2J4GA 2E1DA 3KVMA 4D8ZA 3OGVA 3VCCA 3FAWA 4C6QA 3BLBA 4MKVA 3VDGA 1E1DA 1ISZA 3UZXA 3OHIA 4GZEA 3LD5A 1YKWA 2JALA 3IS4A 1GZJA 3I3BA 3QW4B 4UCGA 3BSHA 5AYIA 4CKQA 4LS1A 4C6EA 4N42A 3FSUA 5LNRA 3LNPA 1WXYA 3ME3A 4HPGA 2XGZA 2W67A 4IOTA 4J35A 4N7QA 4AXKA 4TO8A 1M65A 2VX5A 5EY5A 4DZAA 3HPSA 3J7HA 4XAYA 3GXIA 1UHVA 4JWCA 1YYAA 3VEAA 3E96A 3UW6A 4AYGA 1MXSA 4MZYA 4F9DA 1XGDA 2DIJA 3ACOA 1AODA 4D6CA 1FCBA 4B92A 3O1NA 2Z4GA 4OBSA 2VYOA 2GVJA 1JZ7A 4W85A 1MW2A 4AIEA 3NFUA 4BZYA 3IIZA 4S2BA 2E25A 2DT3A 1DWIM 2WVSA 4X3ZA 3DYOA 4EAYA 3HG3A 4M7TA 1OFAA 2FYMA 5I02A 3BCDA 1FWFC 1EJ7L 2CWXA 4H8HA 3HFYA 4AD0A 3HFTA 4PMRA 3N13A 3OK8A 3B06A 2DH3A 2V2DA 3TMQA 1C29A 3MUY1 4O10A 4QG9A 4P5UA 4ATWA 4BF5A 1LZOA 1U1UA 1TPWA 3DUGA 3A4AA 1UQZA 2GQ9A 2E6YA 3RU8X 2ZWZA 4RPQA 4F79A 2DVXA 4YMZA 5LYRA 3CUIA 3IJIA 2GWGA 3PR2A 3IV3A 2FQIA 1V5XA 1KA9F 1JAKA 1K8CA 2OW6A 2ONEA 1GNXA 2QJGA 4FR1A 1MNZA 3DDFA 1G4TA 3IGXA 2B7NA 1JCMP 4I9MA 5AFDA 1TQWA 1ZRQA 2HBXA 1MFVA 4H7ZA 5DEZA 3P82A 3CS2A 3MDUA 1RQEA 4B2DA 4JWEA 1TJ0A 3NVDA 1TZZA 4CQ9A 1UP0A 2X41A 4NXSA 1K03A 2Y70A 3KOZA 1RK6A 1VRDA 2IXUA 4BCEA 4DCNC 4AY8A 2ISWA 1R8LA 3MKKA 1JPDX 5BOOA 3RV1A 4J2MA 1F76A 3T9PA 4M0XA 5I3HA 3HA1A 3I6EA 1O94A 2NV1A 2YIVX 2V3FA 1EQPA 3SAZA 4N2YA 4HJFA 1T40A 3T2QA 3OJGA 2XPKA 2VENA 1TWIA 3O63A 2OEJA 2NUXA 1ZAHA 3FFSA 5HANA 5BWFA 4HA4A 1LT7A 3G1YA 4FMVA 2VZSA 2BP1A 4J3VA 3ECQA 4UQCA 1AH4A 1V3MA 1HJVA 3AS1A 4JL9A 3EJTA 2XGBA 4QCEA 3WDRA 4AD3A 1KRMA 2W5FA 4B3ZA 1F6KA 4H00A 3SFKA 3PG8A 3SCWA 3NR0A 2V68A 1DHPA 3BQ6A 4GI4A 3LHVA 2PTYA 5C54A 1Q2RA 2VP8A 1SSGA 1YPXA 5AKQA 4DEFA 2A21A 2QHAA 4UDYX 5A6LA 4YTTA 3RUBL 2E4TA 1NFBA 3U7VA 4FHAA 8XIAA 2QAFA 3GHSA 1OA0A 3HAJA 3UR5A 1WZAA 5EBAA 2OZ3A 5G1YA 4PEKA 1E73M 5CSRA 2GQ3A 3B9OA 2VFFA 2X0YA 3AS3A 2WVTA 4HU4A 4JQ2A 2PLKA 4F48A 2CLPA 2ATSA 2WC3A 2R14A 4M82A 1OHLA 1YLVA 2OQLA 3TQVA 5FEXA 4AMAA 3L3OM 1NF7A 5AYZA 3R58A 4R5IA 2FICA 1I1XA 1QW7A 5HULA 4GNJA 3MSGA 4LRSA 2Q71A 2XH2A 5M5DA 3VNYA 2DZSA 4MWAC 2PWGA 3ITGA 3V3WA 3WF1A 2IKGA 1LF1A 2VGGA 1C7SA 4GUFA 2CZVA 1V3LA 2V3GA 3NQ8A 3W7MA 5CC5A 2PURA 2ZX6A 3F4DA 3H2OA 3ITTA 3A9BA 5C2XA 4UTUA 4DWSB 1QHPA 3QQ1A 1TIWA 1SO5A 1ZAJA 3QR3A 1J2WA 3EWZA 4V2XA 4PMXA 3NEVA 1L6GA 3LPGA 3N15A 3QFWA 1HVXA 3G1DA 3TEVA 1P0KA 2JKPA 5C9UA 2QUNA 3PBYA 3SY8A 4AB4A 4YTSA 2GUBA 2I16A 1C3FA 1PZ1A 3WIJA 3LHZA 2DZTA 1IXOA 2RDWA 2IKJA 5EGRA 4NHVA 3HIJA 2F6KA 3BAKA 1ODUA 2YA2A 4ZGYA 2BTMA 3BLLA 2WHMA 2XUCA 1XYLA 3L0KA 5AOUA 4MWAE 1WZMA 4KCTA 2JGYA 5H8MA 4JTTA 1R47A 3B52X 2FZBA 5BRQA 3E6EA 1JPMA 4EVZA 4L6OA 3GIQA 1LG2A 4OJYA 1H7NA 1NFPA 1L2UA 3GHRA 3M47A 3A13A 4PUJA 4Y9OA 1O7DB 4EWND 2ZRVA 1FOBA 3DESA 3LXAA 4B2DD 4H01A 3S47A 3RCYA 3GIPA 4PTXA 1TKKA 3RRAA 1OF8A 2DFAA 2CLFA 1W1A1 4AISA 1ZJIA 1JNEA 1LL7A 2ALRA 1ZP4A 3B8VA 1KCXA 4CCZA 1H1ZA 3N73A 2J9XA 3QY7A 2FTPA 4NPHA 4S3BA 2V5CA 3GAYA 4HGXA 2P3EA 2C79A 4UTTA 3ARXA 4NZ3A 4H9VA 2VEKA 1J9YA 1RCQA 2OWCA 1A0DA 5A2BA 1PEZA 3QNIA 3EWDA 4DJEA 4MB3A 4LTSA 3TN5A 4R27A 3N2BA 3LTPA 1A47A 1BWVA 1EJVC 3DFTA 3W27A 3CZGA 4ZR8A 3L5AA 2Y4SA 2X3VA 5DRIA 5C7HA 2W3ZA 1J0YA 4HA3A 4RZ5A 3T0AA 3TQ0A 4FXJA 3WLHA 4Q6JA 1A5CA 2E9BA 1F8IA 1B54A 4WJ8A 1FWDC 1SFSA 3ITVA 4YTUA 3VA8A 1K7XA 1CXEA 1J4EA 1J6OA 3NL3A 5IOBA 4XVEA 1XISA 3FCPA 3IRSA 2WKJA 4RNHA 3E0IA 1F07A 3RCMA 1GQKA 4BQ3A 4E3TA 4WKHA 2WCGA 3VCRA 1HG3A 2XFYA 3E0LA 5I5RA 1GOMA 1BYAA 2O4MA 4MFEA 7TIMA 1P1XA 1FKWA 4LCRA 4OECA 1BG4A 2FJUB 3G8EA 1QJWA 3OQ8A 1QPOA 3C2FA 2O92A 3JVAA 2X05A 4H41A 1X1NA 3NYDA 1IWAA 3TYAA 5AYXA 2J13A 1FDYA 1OG0A 3T2PA 2X0HA 4ZXLA 3KTSA 4W7UA 3URBA 3ZLHA 1GNTA 1T41A 3BUIA 4YPJA 4OHQA 1JPHA 4LYRA 3LCWA 1V6VA 2ZICA 3TSBA 3PHAA 3VNDA 3WD4A 3UD6A 2Z00A 2HDJA 1NIUA 2J8TA 4IL0A 4I7WA 3EDDA 4N02A 4GYPA 1DWFM 4E38A 2P0OA 1CPUA 2R94A 2HVMA 1H63A 2NWRA 4R9XA 3WJZA 1Z9AA 3TE9A 3TSMA 3FEQA 3FS2A 3GTNA 3ALGA 5AN7A 2EPLX 3IK2A 2PMQA 5F2IA 2P88A 5CG0A 1FCQA 3U6WA 4O4WA 1E5NA 1FWJC 5D9PA 1R3RA 2QMKA 4RE2A 3D4YA 3R0KA 2A6LA 3ZVHB 3WEOA 2A1YA 1EBHA 1XDMA 1ZGDA 3TZFA 3LBCA 1QNSA 5I6SA 1IZCA 7REQB 3PFRA 2H9AB 1FP9A 1S5MA 1XGEA 3SFWA 1XIDA 1FDZA 4ASTA 1GOIA 4W8AA 1SU5A 4Q8OA 2WZHA 3PANA 1FWRA 1DE5A 2VQUA 1PJ9A 1MQPA 3S46A 2YKTA 2PWHA 1R38A 5GNXA 4KFPA 1GYLA 2V82A 1RD6A 4UNKA 1O66A 1W32A 3BTNA 3CWHA 3KHDA 3NGFA 5JMUA 3U4AA 3ITYA 4O0KA 4PUUA 2NXHA 5F2LA 1WCGA 3WNLA 5CPLA 1BKSA 4GUHA 1XCFA 1JDFA 2OBLA 5GVJA 1W17A 3SUVA 1UWUA 1KFCA 3CAKA 4B5TA 2HE5A 4HNVA 3MB9A 5CXPA 3W7PA 2ACUA 2FKPA 4DJED 3S1VA 4AXNA 1I0DA 2Z0NA 7REQA 4DJDD 1U30A 2CHRA 3P67A 4H8VA 1GQJA 4JIPA 3F7WA 4ACZA 4IHCA 4GUGA 2DW7A 2PGWA 1GVFA 2PEVA 3KCJA 3TW6A 4O1AA 3M5XA 3RPTA 2VVSA 1HJUA 1YHTA 1XUZA 3QSTA 4IWOA 3GX9A 3LCHA 4I90A 4ZBCA 2QPXA 4Z0JA 3F4VA 3GNRA 2PF8A 3BUPA 4E6MA 3GUWA 2ISFA 4HZ8A 3EOOA 3EXSA 5LA2A 2QGHA 4JTSA 5T26A 1QI0A 4DNHA 3VDCA 4FNPA 1RA0A 3K8KA 4AUBA 2QJNA 2ZX9A 2I1OA 3E5PA 1XGZA 4LY8A 1H7RA 5J5DA 2VURA 1EXBA 4ROQA 5A6MA 1BVWA 5RUBA 4XZLX 2XZ7A 2PWEA 3WH6A 1TG7A 2QUTA 5I0DA 3CIXA 3NVTA 4FR6A 4J9JA 1TJ1A 2GVLA 1LLWA 3WLLA 4OTKA 2G3JA 4XD5A 4QG8A 1KC7A 1RBLA 3LDVA 1FKXA 1K9FA 2JBMA 5FESA 8A3HA 3LEPA 4LBSA 3KP0A 2Z1KA 1XC4A 1JFHA 2Z6JA 2TRSA 1W1YA 3SYVA 1UC5A 4PCPA 5TIMA 1E6XM 5I06A 4LUTB 1TV4A 4MF4A 3OA3A 3G0UA 4FX6M 4J40A 3GFXA 4WLCA 4UCFA 6CGTA 3EB2A 4R33A 4ZQCA 3RF9A 5E9XA 1KTBA 3AFBA 3N17A 4GACA 1MEHA 1PPIA 1I45A 4PUKA 3NZ1A 2ZE0A 5ABFA 3PULA 2GF4A 1MJGA 3W7HA 3FJLA 1FCUA 2J9ZA 2YDSA 1Q7MA 2ACQA 4ZCWA 3B9NA 1CYGA 1X98A 4KWSA 1WKFA 7ODCA 5MKGB 2EFLA 2WK2A 2GGHA 4MJ2A 2IKHA 5B7YA 3VUPA 6TAAA 1SR9A 1BD0A 2FTWA 5I3IA 3DC0A 2QCLA 1S3HA 3EJPA 1XIJA 4GJ1A 4FNTA 3UFYA 1XINA 2I5GA 1TQXA 3IACA 3S6TA 1S5WA 4IIFA 4I5RA 3I6RA 2Y7DA 2PMRA 3LYEA 5BWAA 3AI0A 3TQKA 3HPFA 4F0SA 2F18A 4HCLA 2BBFA 4Q8QA 4XZIA 4EKJA 5E70A 2WOQA 5DMNA 3CIWA 1W9VA 1ISVA 4LUTA 4R34A 1NP0A 4NRRA 4L6DA 1OZMA 3G1FA 3S4TA 4IM0A 4KWVA 4TVDA 4NASA 3W86A 5DRCA 5KZMA 2YCIX 3ES8A 4WPCA 1OADA 3RR1A 4D9PA 3G1AA 3W74A 3ZJ8A 2VX4A 3OQEA 1KV5A 3AXXA 4A3HA 4UFJA 1ZCOA 4PA8A 1UD3A 3URNA 3PUDA 4DVOA 1M9HA 5CLTA 1R30A 4L4PA 2BASA 1Q45A 3MQTA 1W56A 3EA2A 2NUYA 3W6MA 4K7YA 1W31A 5E0CA 4O52A 2I5QA 3I3EA 3BARA 3G1XA 4HOXA 4GI8A 4O11A 2ZXAA 1OFOA 1QAPA 1CIUA 4JN6A 1R9YA 1F61A 3DAQA 1MZRA 3VGDA 4L1GA 3HGRA 2RUSA 4B3KA 4LB4A 1UH2A 3AHVA 1NP2A 2XH0A 2PGRA 9RUBA 1PKLA 1WDQA 1XBXA 3V1HA 1VP5A 2F8QA 3CYJA 3WBYA 4S3CA 4B15A 2J25A 2YB4A 1FP8A 4NAFA 4N9DA 1AJ2A 2HK1A 4UTMA 1EC9A 3F1QA 3M9YA 3E2VA 3NWRA 3EWBX 1XH1A 2PTWA 2AGKA 6XIMA 2V0OA 1QNOA 1ODZA 4JIQA 2NLYA 3LCXA 1EA9C 1Z48A 4QLLA 4Q8PA 4PUWA 3KS6A 4A21A 1GHRA 1XLAA 3NXLA 3MUXA 1SQ7A 4ML9A 2V8ZA 3GDTA 1V3IA 3B9EA 3UYIA 5BU6A 1PO9A 4O16A 1US0A 4P7QA 4YWSA 4AF0A 5F2GA 1MFUA 3MO7A 1BF6A 4UMBA 3GKFA 4R3UA 5AYBA 3WF4A 1ZWWA 4CQBA 3UVAA 4EK7A 1FCVA 4P7LA 3AXHA 4A8RA 2AL1A 1OQFA 3SRDA 2ODOA 5LNSA 3URQA 3W7IA 4JTKA 3G0SA 5CPMA 1IEIA 4I9TA 4JOMA 1AQ0A 1A50A 1UIPA 4JIIX 4DQWA 3B53X 4GBUA 4R7OA 3ABOA 3RLGA 3DX4A 4OV4A 1XRFA 1OINA 1ICPA 4N6FA 1BPLB 2HEJA 4WJEA 1HKJA 1GYMA 3TTYA 4JD4A 4DYLA 4US5A 2WBKA 1J96A 1QX1A 2ZTJA 3QGVA 4P8XA 3SR7A 3I7QA 3WSUA 4MDOA 1TCDA 3V7PA 2WC4A 4L4LA 4NXKA 4TOQA 1DWGM 4QEEA 1LWHA 5T91A 2HISA 1LORA 2EWFA 1IZJA 1JJKA 2NXIA 3AHZA 3AYVA 1XBVA 5BXTA 1C9DA 1KTCA 2WINM 1KM2A 4QITA 3OU8A 4YCPA 2NVCA 3IIXA 2VKZG 4HA0A 3O6YX 4FXFA 2VR4A 1G94A 1XD1A 1Z8AA 2PDPA 4A29A 1XS2A 1Q6DA 3RITA 1OM0A 2VFHA 3MZNA 3LTYA 3OG3A 2WKGA 1E9YB 4TMBA 5FEPA 4MVAA 1XH2A 1S5VA 1B0IA 1OFPA 5BCAA 3S9ZA 3EKLA 1TQUA 5FAGA 3N19B 4IWPA 3L4UA 2EHHA 2QYGA 5A6TC 2YBUA 4B90A 3W53A 1TWWA 2XVKA 1VHNA 1OFRA 4J4KA 2VVNA 6REQA 4C6LA 1K77A 3WNMA 4PE8A 3G22A 3QLDA 1QI4A 2E6FA 3R25A 4F2BA 2DV0A 5LHEA 5AECA 4I5XA 2R82A 2P53A 4JYFA 4MJMA 2HE8A 2YIAA 1EBGA 1XIIA 1J0HA 3VKKA 2WKLA 2A7PA 2DUAA 2YIBA 5D2TA 2BDQA 3NL6A 1L8NA 4W8LA 3OB8A 3PZIA 2GGIA 1L6SA 1TX2A 3NQEA 2ZQ0A 3TA9A 2WCAA 3CB3A 4INFA 1YXYA 1PUDA 1NDWA 4FK9A 5I00A 1RHCA 1NWSA 2NCZA 3T48A 1XLGA 1J0IA 3D0CA 2FZDA 4JN8A 5BMXA 3KP1A 1IEQA 1EHAA 1GGOA 4QSFA 1XBYA 2D0HA 2PLCA 3B40A 1Q7QA 4IIGA 5D03A 2O9PA 4TXEA 1GG1A 2QMJA 4DIAA 2BOFX 4GUJA 1S2AA 5TAOA 2ND0A 4GXMA 3VYLA 3QV9A 1R33A 3WUGA 3KBWA 3E2RA 4KH2A 1VCFA 2E6AA 1VCVA 4UQEA 3G5EA 3STGA 3E02A 3QEZA 2WW5A 3UWUA 1W5QA 1Q63A 1W3IA 3W0KA 3ZOAA 1O1ZA 3N2TA 4LQ1A 3D3AA 3UP8A 2DIEA 5HPCA 1QOPA 4NQ1A 3G6MA 3W87A 3PK7A 4PMVA 2YOCA 3QE6A 1E56A 1FWGC 1TMHA 4HMNA 1H4PA 1JZ3A 3SCRA 3SCUA 2R1LA 3FKKA 1WAWA 4U4MA 4Y96A 1WA3A 4R53A 2OW7A 1X04A 4XBJA 1Q6CA 3CLMA 4JDYA 2EXOA 3LCGA 1DWAM 3HG5A 4OBRA 4BI5A 4KERA 1GVRA 1UMLA 3TYUA 4I9AA 1SJAA 4UZUA 1XLIA 3WNKA 4MNJA 4W5ZA 1I0BA 1CI1A 3PBUA 3EPNA 1AW5A 4ZEPA 1IGSA 1MZHA 5KZEA 4US5D 3H4XA 1W9DM 1HKIA 5A3HA 2PP1A 5CC7A 3A4JA 1UC4A 3L2MA 3WQPA 1UIOA 2V67A 3V0UA 3WUFA 3VO0A 3DFSA 1JZ2A 3NNTA 1KBBA 2F2KA 1VYSX 2HXTA 2OYKA 1WKDA 2FZ9A 3N14A 1JVNA 4IIHA 3PJXA 4J3SA 2QGYA 4JYDA 3S6OA 3NUKA 3BLKA 2ZYFA 3OZOA 4FNQA 1K8XA 4AHQA 2BVTA 5JU6A 3BUQA 3APYA 2Z8YA 2VGIA 3ARPA 4K37A 1E2UA 1E43A 4JFSA 4C90A 3M0YA 1MDLA 1XHGA 4X63A 5G4HC 4IJRA 1V93A 4C1KA 5B80A 1SR0A 3CV6A 2YFOA 3D4ZA 2V9DA 4ZA0A 3IJ6A 5TNVA 1XICA 4UUIA 4LBRA 1X38A