2YL8A

Inhibition of the pneumococcal virulence factor strh and molecular insights into n-glycan recognition and hydrolysis
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
434
structure length
434
Chain Sequence
NEKLAKKKIVSIDAGRKYFSPEQLKEIIDKAKHYGYTDLHLLVGNDGLRFMLDDMSITANGKTYASDDVKRAIEKGTNDYYNDPNGNHLTESQMTDLINYAKDKGIGLIPTVNSPGHMDAILNAMKELGIQNPNFSYFGKKSARTVDLDNEQAVAFTKALIDKYAAYFAKKTEIFNIGLDQYANDATDAKGWSVLQADKYYPNEGYPVKGYEKFIAYANDLARIVKSHGLKPMAFNDGIYYNSDTSFGSFDKDIIVSMWTGGWGGYDVASSKLLAEKGHQILNTNDAWYYVLGRNADGQGWYNLDQGLNGIKNTPITSVPKTEGADIPIIGGMVAAWADTPSARYSPSRLFKLMRHFANANAEYFAADYESAEQALNEVPKDLNRYTAESVTAVKEAEKAIRSLDSNLSRAQQDTIDQAIAKLQETVNNLTLTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of the Pneumococcal Virulence Factor Strh and Molecular Insights Into N-Glycan Recognition and Hydrolysis.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
molecule keywords BETA-N-ACETYLHEXOSAMINIDASE
total genus 172
structure length 434
sequence length 434
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2011-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.90 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AF1782-like 2yl8A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2yl8A01
5C8BB 4BZYA 4DUWA 1I1XA 4AD1A 1HXJA 1GJWA 3FN9A 4N42A 3T09A 3ARPA 4W86A 4AD3A 4OZOA 2BY1A 2CBUA 2J74A 4MB3A 4AXNA 3UETA 5EFDA 3CHEA 7CGTA 2E8YA 1BGAA 2O92A 4PTMA 4EKJA 5JIWA 2J8FA 2XFYA 4M82A 3UESA 3VU2A 1D3CA 2RGMA 1A47A 4IPLA 2ZUNA 2DSKA 3TOPA 4EK7A 4JCMA 3ZJ8A 1U2YA 2VCAA 3AHZA 1W1YA 4DWSD 2DQXA 3BSGA 1ZBKA 3AMDA 2DGAA 1IV8A 1E40A 1HVQA 4HA3A 3FY1A 1OSEA 1WZKA 3F5LA 2W91A 2WK2A 8A3HA 3RJYA 2J7BA 4B16A 4GO9A 2ZWZA 1X1NA 4BQ5A 1V3IA 3CO4A 1MXDA 4UQBA 3EDDA 2CKSA 3PZQA 1Q6DA 3CIVA 2FGLA 5BXTA 4E2OA 1JXJA 2XYLA 3QHMA 1UWSA 4MADA 1TVNA 5JUVA 2J78A 4QLKA 5A6BA 3A4XA 4AC1X 3VGEA 3KL0A 4GINA 4WKAA 2VR5A 2FHBA 3DECA 4B3LA 2J7GA 4Q22A 1XSKA 1XYZA 2E40A 3POHA 3CUHA 2ZUWA 4BQ2A 3LMYA 1CDGA 2OSWA 4AD4A 1GOMA 3MUY1 5AYIA 3GNPA 1NOUA 1QI5A 1GUVA 4UFIA 3GH7A 1CECA 3W27A 3WNMA 1UKOA 1Q6EA 3BGAA 4JFWA 1OT2A 4K68A 1VIWA 4JHOA 1C3FA 5HBFA 3MMWA 4FLSA 2VVSA 1J11A 5CSUA 1GQIA 1GHSA 4P8UA 2YL8A 1CTNA 1U33A 3L4TA 4UFLA 3NCOA 1DWHM 3VDCA 4Z2LA 3HMCA 5FD0A 1C8QA 5A6SA 3II1A 4L4OA 3CZ8A 3BSHA 1XH0A 1FFRA 3T2PA 1AQHA 4BCEA 5BYWA 1UD3A 3SCVA 1O7AA 3AIRA 4YHEA 4D6IA 2W5FA 3WQ6A 5AYBA 2WVVB 1ZBCA 3VIGA 1JF6A 1MW0A 2UY4A 3PZTA 1A3HA 5M03A 2OWXA 3W81A 4LYQA 1PZ3A 1JYVA 4WSKA 2ESCA 4B9ZA 1KQZA 2CITA 2D0FA 3O2LA 2BY3A 2D24A 3CBWA 4FZOA 4U3CA 1ZU8A 4UZSA 2JE8A 4PCTA 3ARVA 3EDFA 1BLIA 3BLKA 4JFSA 2WZIA 1RPKA 4D6FA 4HZ6A 5BXSA 3QOMA 3MMDA 2WBGA 3VDBA 4UFMA 1J01A 3VIPA 4PMZA 2XVKA 4NI3A 1Q4NX 3GM8A 1EIBA 4MNMA 5A95A 3BH4A 1BYBA 4TX8A 5BRPA 4HZ8A 1B31A 2WB5A 5CSYA 3D3AA 3ZT6A 4NRSA 3ZM8A 3AMCA 1J0IA 2V38A 4D1IA 3K8LA 1J0JA 3WD0A 1ZBVA 5DEZA 1HKMA 5BRQA 3VGFA 1JYNA 1WDRA 2CXGA 4B9YA 1V3MA 2BHUA 2WMKA 5M5DA 3BCDA 4HOZA 4WF7A 2ZX9A 4J3XA 1VRXA 4RE4A 1JF5A 2XFRA 1KGXA 3W4RA 3D5HA 2D3NA 3PTKA 2CIPA 4AISA 1P6WA 1H0GA 2ZX5A 1H4PA 1J10A 1TE1A 3VMPA 4EAMA 4X0NA 1NM9A 3BAJA 3O9NA 3OZPA 1JIBA 4M29A 3UG4A 4M80A 1UZ1A 2C7FA 4PTWA 3EYPA 3MO4A 4CU8A 5IHRA 1FH7A 4D6CA 4TOQA 1GQKA 2F2HA 4PMVA 1MQQA 1WDQA 2VRJA 3U7VA 4AZGA 3VD4A 3AHTA 4FZPA 5D9NA 1E70M 2XSBA 3W28A 2J47A 1QNSA 5HNNA 3TTQA 3ZT5A 2D20A 2BXYA 4AEFA 4HZ7A 1OM0A 4M81A 1JZ4A 1WKYA 1HN1A 2GJRA 5DT5A 4HTYA 3L2MA 1DWFM 3VNZA 4QFUA 1B3WA 2HVMA 4XX6A 4BQ4A 1F4AA 4MNLA 4H04A 3QHNA 1B0IA 1B9ZA 1G5AA 2XVGA 3MSDA 5I79A 1GHRA 3K8MA 1EOKA 1VB9A 2Y8KA 1R7OA 3WY1A 2PMRA 4J3UA 4JKKA 2CPUA 2WZEA 2W62A 3BXWA 5A6JA 1JAEA 4AD5A 3AROA 3ALGA 3A6OA 1Z32X 4IUGA 2XTKA 2YBTA 1GVIA 3T0BA 1E3XA 4Z2HA 3ARYA 4X9YA 3NDZA 3NSXA 1Q6FA 3VIIA 3G6MA 1VFMA 4W84A 2UY5A 1Q6GA 2E3ZA 4J3SA 4XZBA 2ZUUA 5ABFB 1H41A 1K6AA 3WF0A 1BYCA 4GKLA 1M7XA 3FHAA 3QGVA 2DEPA 1ODUA 3CUIA 2NT1A 1FHLA 2YBUA 4PMYA 2XJ7A 2J75A 2EPLX 1CGUA 3VUPA 2WC3A 3DHUA 1ISVA 1QI4A 1H49A 2WBKA 2J7DA 2VZSA 5E0FA 1C8XA 3BAWA 1VEOA 1MVYA 5GQBA 2VT0A 1AVAA 4ZXOA 1WE5A 2PI6A 4PMNA 3SCUA 1HKIA 1OWQA 1EOMA 3PN8A 3AIWA 2VRQA 1KCKA 1EO7A 1HJSA 4A3YA 2WLZA 4DUXA 1RP8A 2EPMX 2DSUA 1VJSA 2JIEA 3ZOAA 1BSIA 4ZXLA 3WF4A 3AICA 4QLJA 2W61A 2VX6A 3OGSA 5D4YA 3WD1A 2GUYA 1NWTA 4D6JA 4KGJA 3EDJA 3NUKA 1E6NA 1HJXA 5CGTA 1V03A 2PF0A 2XG9A 1TMQA 2WW5A 1X6NA 1CWYA 5FCZA 3CGTA 4NRRA 1NOWA 1GZJA 1GQJA 4V2XA 5EB8A 3SUWA 3DHPA 2FH8A 3N04A 3AXIA 1B3VA 3RILA 1VEMA 3AIBA 1RP9A 3VINA 1R87A 1V0MA 5IHSA 1UKPA 4U3AA 1UD2A 2CCRA 4B15A 3VX0A 3SCWA 1CYGA 2F8QA 2WSKA 2PC8A 2IXVA 1IZKA 4JAWA 2GDVA 4AWEA 4CU6A 4CKQA 1IZJA 1EHAA 5FL1A 1QI0A 1XH2A 1JYWA 1W1VA 2D3LA 4CN4A 1TG7A 2J7FA 4LYRA 1UWIA 3VILA 1HL8A 3WNOA 2VCCA 4GZIA 1UR8A 5D8WA 4AZCA 1BGGA 1WDPA 4DUVA 4TVUA 4CGTA 5BROA 5F7UA 1SMAA 1DWIM 2IUZA 2ZXQA 3ARUA 4NF7A 4D6EA 4HOXA 1M01A 2ZXDA 2VI0A 4QP0A 2O9OA 4MNKA 4P7OA 4F66A 2W4XA 3ZJ7A 2D0GA 3WF3A 1PZ2A 2EPOA 2XVPA 3BAKA 3CLWA 5EBAA 4UOJA 1HX0A 1GCYA 3MSGA 5ABFA 5BCAA 4KRTA 4HPHA 5A3HA 3RM9A 1D7FA 3PZNA 1VFOA 3OGRA 2MANA 1FOBA 2E0PA 1BYDA 2PWDA 4FLOA 4MB5A 2VQUA 1XSIA 1LL6A 3PZUA 1ZBWA 1O6IA 4U2YA 4H7VA 4TVDA 3HU7A 2VZVA 3AS0A 3THDA 1XHGA 4UFHA 3SUVA 3A4WA 1M53A 1R7AA 1H1NA 2WZHA 1DWAM 2G3JA 2X1IA 3OGVA 2BVDA 1JFXA 3E1F1 4CD4A 3EBVA 3BAIA 2AMGA 1V6UA 1UKSA 1VENA 1HL9A 1HJUA 5A6BD 2DPEA 4P8VA 3UR7A 2UY2A 4R5EA 3ARRA 3OIHA 4URIA 3WH5A 3N15A 1E56A 4TTUA 3WEMA 1JZ7A 4GPNA 3JUGA 1PX4A 1MW2A 4JFTA 1PJ9A 4HMCA 3W24A 2E9LA 4BS0A 1SYTA 2CHOA 1FP8A 1W9VA 3WQ8A 3FHQA 3RIKA 2UY3A 3VIFA 3W38A 4DWSA 5A69A 2CKRA 1B3XA 1EA9C 2D1ZA 2WVSA 5TD4A 3AIVA 2WMJA 4QLLA 1GOQA 1V6WA 5BXPA 3VGBA 1TCMA 1CXLA 1R85A 2GJPA 2Y4SA 5FKYA 3PHAA 1E4MM 4V27A 2GVYA 3OA5A 2PBOA 3L4VA 3K46A 1VF8A 3AIQA 2XUCA 3N1AA 2J7HA 1ITXA 2X05A 5DO8A 4FF5A 1MQRA 3WN6A 5HPOA 1NWUA 3WKZA 2DDXA 1QNPA 1KFWA 4UQCA 1OD0A 3M07A 1NP0A 1XSJA 2G3IA 4UQEA 1KGUA 1XRVA 1WZMA 4AZ6A 1HP4A 1V6YA 2E9BA 4MAVA 3VKKA 4P8XA 3GXDA 4LYPA 5FOOA 5CQ1A 3WL0A 4PMDA 2XM1A 2A3CA 3SCNA 3HN3A 3W37A 3ZT7A 5BWFA 2XIIA 4AD2A 4ZENA 2D22A 4TTGA 1EHNA 2WXDM 1LLOA 3WUGA 2G3MA 3ZSSA 3B9DA 3WENA 2EEXA 5CGMA 2PB1A 4IM4A 2VO5A 1ZJBA 3GXFA 3PZGA 1ISXA 2JFEX 1EGZA 4M24A 3QHOA 1E1FA 2BY2A 4C7FA 2HISA 4AD0A 2XIBA 1FH8A 4H8HA 1CXKA 3T2OA 4H8VA 4DWSB 5CG0A 1E4IA 5JBDA 5CJ5A 2D0HA 4M8UA 1UR9A 4D1JA 1E6XM 3GNOA 1G9HA 2BS9A 1B3YA 4EANA 2WWCA 5IXEA 5D9OA 3SEPA 3DYPA 5HOSA 3APGA 3CZEA 5KZ6A 3CUJA 1GOIA 4CVUA 1XCXA 4CVWA 2X8RA 4HMEA 5CPSA 1EQCA 3BMVA 4LX4A 4ACZA 1SMDA 2WCGA 3GXMA 3WF2A 1EDGA 1WZAA 1JZ3A 4P7QA 1JGIA 3VD5A 3KL3A 1HJVA 1OIFA 3WDHA 4J7RA 1K9DA 2VZTA 1GPFA 1UH2A 3M46A 1UD6A 1ECEA 3HJEA 2J7CA 3AMGA 3N9KA 4NZCA 1VFUA 3CHCA 4J3VA 4N0RA 2XVNA 2DH3A 2EPNA 1WZLA 2C0HA 3L4UA 1E0XA 2XPKA 4W5UA 3OLDA 5A2AA 2FH6A 3AIEA 5E6ZA 2DSWA 3AYRA 1EDQA 5A94A 2G8ZA 4ML4A 2XHYA 3IK2A 3WF1A 3WEZA 1S46A 2QF8A 2OLHA 1UR1A 3IJ7A 4UFJA 4WIWA 1R86A 1GVYA 1QNOA 1JYXA 2ZX6A 1E73M 1H0IA 1YQ2A 1UOKA 4D6DA 3WEOA 3BCFA 1JI1A 3CZGA 1TZ7A 4S3JA 2CBJA 3ZQ9A 3NDYA 3GXIA 1B1YA 1FH9A 4CD6A 1HVXA 4QDMA 5E0CA 3NJ3A 1NQ6A 2V3DA 1JDAA 2XVLA 3FNDA 2WC4A 4PSPA 3TTSA 1WO2A 4JZ5A 1C7SA 2WLYA 4FLQA 1HKJA 1OBAA 2BNJA 5AC5A 2DH2A 3SIMA 1E15A 5A6AA 2YDRA 4JCLA 2GDUA 4J3WA 1MYRA 1KBBA 3ARXA 2XM2A 2VX7A 2CHNA 5GNYA 3WDQA 2VNCA 3NSMA 5FIPA 1OT1A 1C92A 3LPPA 2YA0A 5I23A 1PAMA 1W9XA 4W93A 3WD4A 2DSZA 1OGBA 2WYSA 3U5UA 1CGVA 1KCLA 3WD3A 5D8ZA 1E43A 2WVUA 4JFVA 4Z2JA 1OCQA 1W3HA 3WNPA 4F9DA 3O6AA 1B3ZA 2DT1A 5ABGA 2WHKA 1D2KA 3W25A 1K9TA 1W9BM 1DTUA 1L8NA 5I6SA 4D71A 4X0VA 4OOZA 1W3JA 1X6LA 1BQCA 2B31A 4JL2A 4YPJA 4BF7A 2WMGA 1AQ0A 2QLYA 1MW3A 2WCAA 2EXOA 2X2YA 1KBKA 3U7BA 1E0WA 5D9PA 1WB0A 2W63A 1UQYA 1KXTA 1US2A 5IDIA 1CGWA 2BVYA 1V08A 4H41A 9CGTA 1UA7A 1UQZA 1E3ZA 1ISZA 1KR1A 3L4ZA 5DF0A 1KB3A 4PRWA 3N17A 3RM4A 3W53A 5A8NA 3GDBA 1VJZA 2XSAA 3GYCA 1JXKA 4RE2A 3L4WA 3ZSTA 4U5IA 3WMSA 1UWQA 1V0KA 3VX1A 3W6MA 2JF6A 4AZ5A 3ZJKA 4WLCA 4AYSA 1XH1A 2JIWA 2VZUA 3OG2A 5ECUA 3MV11 3A3HA 4GZJA 2E8ZA 1E5JA 2X0YA 3AYSA 1GQLA 3AS1A 4A3HA 1RH9A 1C90A 4E4PA 2JF7A 4P8WA 2ZUMA 3KE0A 3AQUA 4GI6A 3UG5A 8CGTA 2GJXA 1GNXA 5I5RA 3M6DA 3RMEA 4MDOA 2W67A 4HU0A 4B3KA 5FL0A 4PMRA 4JIEA 3IANA 1I75A 1UHVA 3SCSA 5HPCA 5I2UA 4CU7A 3W0KA 3VIHA 1JNEA 1W2VA 1BYAA 3GBDA 1E6ZA 2FGZA 3VO0A 1HP5A 1UUQA 3W26A 4DM2A 2QMJA 3OBAA 4KMQA 6A3HA 4HA4A 1BG9A 1CPUA 1VBUA 1PIFA 4WKHA 4TUFA 4AZBA 1DWGM 2CBVA 3VD3A 2V3EA 3QOKA 3F4VA 5A8PA 3WFLA 4YHGA 1IT0A 4LQ1A 4NSBA 1UWUA 5E09A 4DWSC 1JD9A 4GO8A 3GH5A 5A8OA 5A8MA 4HP5A 1HT6A 1UH3A 5CLTA 5JIPA 4R27A 2YLLA 2VQTA 3VTRA 1EO5A 1KXQA 3SCPA 1JAKA 4ATWA 3GNRA 1OIMA 4HU8A 1CGTA 3CMGA 5E9AA 4ZE4A 4AZCB 1W1TA 3BMWA 1GOWA 1NOFA 2ZUSA 3WFZA 1E9LA 5IFTA 4GIAA 1UG6A 3THCA 3WDPP 2PWFA 3T08A 3BAYA 2E9MA 3CZLA 1BVZA 1UKTA 1FP9A 1H09A 1YHTA 2WHMA 2A3HA 3BC9A 1CXFA 3EMQA 4U2ZA 1OINA 4D72A 2OZNB 3VM7A 3AZTA 1OGGA 3PZOA 4W87A 1V0LA 3VOCA 2YDSA 5JBEA 1VAHA 3RO8A 2VCBA 2QMKA 1DWJM 1EH9A 1V0NA 4KGLA 3S6TA 2X09A 4J27A 3M7SA 5I77A 2WANA 3VIOA 2E4TA 3W82A 1TVPA 1XC6A 2WC7A 3B8SA 4KWUA 4XV0A 5A2CA 3OLGA 1SFSA 2J79A 2QHAA 5E6YA 1BG4A 4PTXA 2CEQA 2J62A 2VRKA 2A3AA 2GJXB 2XGBA 2CBIA 1JG9A 2A3BA 4OIFA 3N12A 1DEDA 1E71M 1CBGA 2IXUA 1EXPA 4JHZA 2QPUA 3VMOA 3G6LA 1EDTA 5A1AA 5EMYA 4MB4A 2J77A 4MAZA 3GTNA 3WNKA 5M17A 3WUFA 4UQAA 4MJ4A 4AW7A 4IPNB 4HA1A 2WM0A 4W89A 1QPKA 3B9EA 4JKLA 2BV9A 3ZO9A 2YDQA 2AOSA 2CERA 4CD8A 1E4LA 3KEHA 4MNJA 4PN2A 1KWGA 4LPCA 1G1YA 4WKFA 2YIHA 4FK9A 4PUEA 1ITCA 4HOWA 1QNRA 1WCGA 1BF2A 3AHVA 2J7EA 1LL4A 3ZJ6A 2TAAA 3N13A 2GSJA 3ARTA 1CXIA 3WD2A 3SUTA 4CCEA 1E5NA 1GJUA 2CNCA 3K1DA 1FFQA 1UR0A 1MWOA 3TA9A 2AAAA 2O9TA 1XCWA 3TP4A 4W8AA 1VEPA 2NW0A 4BQ3A 3AI0A 4D6GA 3AHYA 4J28A 2Z1KA 1BTCA 1W32A 3CTTA 4OKDA 2VURA 2CETA 3WH7A 2VX5A 3ZR5A 1B90A 4LGXA 2WCSA 3AISA 1MFUA 2X0HA 1LL7A 4ZFMA 4D6HA 3WNLA 4F8XA 1K9EA 1B2YA 1DHKA 3CUGA 3OLIA 2FHFA 1LF1A 4AIEA 1UA3A 1E6QM 1JFHA 3RCNA 1QI2A 1L0PA 5I24A 4MJ2A 2JNKA 4CD5A 3AZSA 4C7GA 3MKKA 4UZUA 3A47A 2DT2A 3MU7A 2EJ1A 3WELA 1V3KA 3CZJA 1GW1A 1HF6A 5JBFA 5A2BA 4Z2KA 2WSPA 2ZE0A 1XD1A 2G41A 1WPCA 3WH6A 3PTMA 1JZ8A 2VZOA 4HPGA 1V6VA 2PWEA 1JZ5A 4BA0A 3W29A 2VTFA 4UOZA 1ZS2A 2PBGA 4UR9A 1C91A 4W5ZA 4UNIA 1GOOA 6TAAA 4PTVA 1V3JA 4QCEA 5LYRA 3K4AA 4C7DA 2YL5A 3SCRA 4WSJA 5M3WA 3VIJA 2WVVA 3OZOA 1CIUA 1QHOA 4TX6A 2JALA 1UYQA 4OJYA 5HDRA 1CLVA 1KXVA 4GQRA 3I3BA 3AXHA 1ZB5A 4AZHA 2WHLA 1JI2A 4AIUA 2Y24A 3EDEA 3VNYA 1NH6A 2YA2A 3WDIA 1W2PA 2GK1B 2OYKA 1XYFA 4AY1A 2NSXA 3N11A 2YL9A 1GOKA 2PWGA 2VOTA 1CNVA 3I3EA 4ZE5A 1V02A 2PWHA 2WNWA 4E8CA 2A3EA 3WUBA 4H2CA 5DT7A 2YKKA 2VVNA 1CGXA 1OGSA 3NSNA 3BAXA 3RJXA 3WIJA 2WKLA 4PMXA 2XGIA 1V02E 1J0YA 4PSRA 3MMUA 4TVCA 4M1RA 4Z2IA 4CCCA 5I3DA 1HNYA 3F5KA 3AHXA 4U31A 2VL4A 2OO2A 3TTOA 3WMBA 5CPTA 2VJXA 1ESWA 5GPRA 1QOXA 1M03A 1NWRA 1K9FA 5E70A 2BFGA 5LA0A 2XWDA 3WH9A 1QHPA 1Q6CA 1LG1A 3F5JA 5LA2A 2ZOXA 3MUZ1 1QI3A 5ABHA 5CXPA 4P7NA 3J7HA 4PMQA 6CGTA 3SCQA 1R8LA 1BVNP 1V3HA 1ODZA 1TUXA 3OB8A 2C8NA 3L4XA 4MDPA 4A4AA 2WMIA 1PBGA 3LPGA 3VMNA 2G3NA 2WWDA 7A3HA 1KR0A 3WDRA 4W8LA 2ZICA 3N18A 3CUFA 4ZEPA 1C93A 4OBRA 3K4DA 3VD7A 1MQPA 1VBRA 3KZSA 2CYGA 1UD8A 4E8DA 1C8YA 2BVTA 3MUAA 4OUEA 3UR8A 2GK1A 2UWFA 1LJYA 5ABEA 1J0HA 2YJQA 4H8UA 4F9JA 1RD6A 3FAXA 1J9YA 3SUUA 1OB0A 2YOCA 1HJWA 1W1PA 3ZR6A 4CCDA 1FHDA 1LQ0A 3FAWA 2OYMA 4OBSA 2NT0A 2J4GA 1LG2A 1AMYA 1UR4A 2D23A 3T2QA 2O9PA 5CZKA 1SR0A 1QW9A 2BY0A 3AIUA 1ZL1A 3SCOA 5C70A 2ZXAA 3WL1A 1UKQA 2OWCA 2FDMA 3TONA 3T0AA 4PCSA 5A8QA 1E4NA 1W9DM 2WMHA 3PZ9A 4L4PA 4WK9A 3ARWA 4GXPA 1JZ2A 4UOQA 4KH2A 1UZ4A 3WBAA 2DIJA 4TXEA 1E0VA 1NWSA 2EBNA 2WAGA 1EQPA 1J12A 4V28A 4PUDA 1CGYA 3ALFA 1TA3A 2XFFA 1QBAA 3AXXA 4GZEA 5EFFA 1E6PA 1E6RA 4W88A 2ZX8A 4P7RA 1CXHA 2V3FA 2V5CA 3KWXA 4YN5A 4PMUA 3MV01 4RL3A 3VVGA 1QBBA 1ISWA 1M04A 3AS3A 4JL1A 3AMLA 4HMDA 3EMZA 1CEOA 1JD7A 1GORA 1XV8A 3A4AA 2YL6A 4DM1A 3CHFA 3UEQA 1FA2A 3PZVA 1HJQA 3POCA 1W9UA 2WPGA 3WH8A 3T0DA 2Q8XA 3OLEA 3SURA 1H3GA 3RDKA 1VFFA 3ARZA 3SCTA 4S3KA 1V3LA 5KEZA 3WDJA 2W66A 3WQWA 3CZKA 1CXEA 2BHYA 1MXGA 1J18A 1W3LA 4W7VA 1CZ1A 3ECQA 1MFVA 3GH4A 5LA1A 1ZJAA 2OSXA 1AQMA 3IAQA 3RPMA 3NIYA 3TTYA 5HXMA 4CN1A 2ZUTA 3MANA 3RM8A 1HKKA 2YA1A 3CHDA 1OD8A 1KQYA 1BFNA 2QV4A 5A6KA 1BHGA 1PX3A 3AMKA 3PZIA 2Z1SA 1E1EA 2O9RA 3VGDA 3MUIA 2VR4A 3SUSA 1BPLB 3AJ7A 3VM5A 2RGLA 3KL5A 4FMVA 1G0CA 1CLXA 1QNQA 4QAWA 2XWEA 1E6SM 1JL8A 4LXFA 3IAPA 3WUEA 5AC4A 2OWWA 2G4FA 4GI8A 1PEZA 3CH9A 1UWRA 1N82A 2VUYA 3VDHA 2Y5EA 5AY7A 4M56A 1W9PA 3VDAA 1UD4A 3VGHA 1G01A 4JFUA 4UCFA 2Y8VA 2JEPA 1WAWA 3WNNA 2DT3A 2DT0A 3IJ9A 1C7TA 2J25A 2VMFA 3U5YA 5CLWA 4W8BA 4PMOA 3L4YA 4MTVA 4QCFA 1QVBA 3GBEA 5DFAA 2BXZA 3AOFA 3I3DA 1TR1A 4MPKA 2GFTA 1KWKA 1I1WA 4RE3A 4W7UA 2WHJA 1MW1A 4ATLA 1UWTA 4ACZB 3U57A 3CPUA 5I78A 7TAAA 3AS2A 3LPOA 2F61A 4XB3A 3GZAA 1KXHA 3ARSA 3VGGA 3CMJA 3IJ8A 3QR3A 4UTFA 3WBEA 1G94A 4CD7A 3MS8A 1UH4A 2OYLA 3AZRA 3BLPX 1H2JA 2ZX7A 2VC9A 4CN6A 1DP0A 1JDDA 3WQVA 5GNXA 1KGWA 2D2OA 4JKMA 1XD0A 4PBGA 4F79A 1WP6A 2OSYA 4AMCA 1W3KA 2W92A 1V6XA 1JZ6A 5BXRA 1E72M 5IFPA 1F4HA 3ARQA 2WMIB 4EE9A 1LWHA 4GQQA 2EO7A 1U30A 1Y7VA 4IISA 2EPKX 4Q7NA 2J8GA 2V5DA 3FXYA 4WJXA 4AZIA 2BHZA 4MB1A 4Y7EA 4UFKA 2ZUVA 2EQDA 1QW8A 1UR2A 1J0KA 2CESA 1WNOA 1HIZA 4CUCA 1PPIA 3L2LA 2YLAA 3NYDA 2ZIDA 1ISYA 1JDCA 3VIKA 5A6LA 3UCQA 4AEEA 1W91A 4ATDA 1US3A 1XGZA 3UERA 3DYMA 3PBGA 1QHZA 3EDKA 3LPFA 3S2CA 3EMCA 2JEQA 1WDSA 4W7WA 2ZXBA 4AIOA 2Y2WA 4U33A 4W85A 1LWJA 2QPSA 3AFBA 1UD5A 2WMFA 3PTQA 1H11A 4XZWA 4ACYA 4J3TA 1JNDA 4P7LA 3UG3A 2DSVA 2VX4A 2ZWYA 3ZMRA 1E55A 3DC0A 3VD9A 3WMCA 4U5KA 2FHCA 1NARA 1TFVA 1TA3B 1PX8A 1H5VA 5CPQA 4Z2GA 3B9AA 4GI9A 3VIMA 5DMYA 1NP2A 4OOUA 4AZ7A 4PEEA 3PZMA 5D9MA 3VPLA 4UQDA 3K8KA 4UQ9A 3W6LA 1BAGA 5I0DA 3WSUA 3ZIZA 3DYOA 5A6MA 1CENA 1J0ZA 2WVTA 1PIGA 4FLRA 2V3GA 3WQ5A 5C71A 3FW6A 1B30A 4XUYA 2WKGA 1GONA 4KRUA 2DIEA 4PYSA 3WQ4A 5GNZA
chains in the Genus database with same CATH superfamily
1MMFA 1XLJA 4BZYA 2V0OA 2DZXA 3MJYA 3A24A 1SZFA 3TMLA 3F2DA 5CZ0A 4L1XA 3HF3A 3M0HA 3ARPA 4NT0A 3VKJA 4AD3A 3S9ZA 3ZVHB 3B97A 2BY1A 4MB3A 5CKSA 4AXNA 4Q4MA 1NSJA 3EA1A 3CHEA 1PS3A 3D6NA 5DCEA 4L9YA 4PTMA 1IWPA 3P62A 4MZ1A 2ZUNA 4MPQA 3TOPA 2FTWA 4M3PA 4AXKA 4JCMA 3ZJ8A 2VCAA 5EMKA 4Z1BA 1ZBKA 3AMDA 4QE1A 4OE7A 1JRBA 4DB7A 3LI1A 4JNEA 2PDPA 2W91A 2WK2A 1NU5A 1O66A 1UZHA 1Q5MA 3WQDA 4BQ5A 3GDTA 2Z7GA 3MYOA 3EEGA 3EDDA 3PZQA 4HNTA 2RAJA 1FDYA 4O54A 3W01A 5C9XA 2FGLA 3RRXA 4E2OA 4ZR8A 4AKVA 2Y63A 4QDPA 2EFKA 2Q12A 5HMDA 2F7QA 2J78A 3VFLA 3A4XA 3MBFA 2A7PA 5LIYX 5LXEA 2VR5A 4O10A 1KTBA 4EVZA 1XSKA 3MZ2A 4YCPA 7TIMA 5LSMA 1PKLA 3CUHA 2ZUWA 4BQ2A 1OADA 1CDGA 3RLHA 2EGZA 3GIYA 1XIEA 1NOUA 3Q84A 3H2EA 1CECA 3VE7A 1R2RA 4QG9A 3T40A 5FF3A 3LCHA 4ILSA 4JFWA 2Y6ZA 3EWZA 4AF0A 1OT2A 4KW2A 1YE4A 1XLCA 5CJNA 2VVSA 1GQIA 3D2FA 1O7DC 3I7RA 1U33A 4XZNX 3KRSA 1DPMA 2OPJA 3R25A 1TE6A 3HMCA 2O4QA 3CZ8A 4HCDA 3A4JA 3DX2A 1FFRA 3G5EA 4BCEA 5BYWA 1UD3A 2OZ8A 2IS7A 3MY9A 1O7AA 4YHEA 1CLKA 1P1XA 3LLLA 1A53A 3C0QA 3VIGA 1VYPX 1ZPTA 1R9XA 4QJ1A 1M5WA 1PZ3A 1Y65A 3CQKA 3GG7A 1BQGA 2BY3A 5AYYA 3M0XA 2G95A 2VWSA 1AD1A 4IF2A 5DCBA 2PDIA 3OU8A 1EP3A 2RKXA 4PCTA 2LLEA 1WXJA 1YKWA 4D6FA 3ERPA 3MMDA 3KW3A 4UFMA 1ZLPA 4YWIA 5EY5A 2QXWA 2ZRYA 3W86A 4NI3A 3APTA 3TQPA 1Q4NX 2PLCA 3CT7A 5F2GA 1FWDC 4MNMA 3DFSA 5A95A 4GXWA 3QRHA 1BYBA 3MHUA 3QFEA 3JVAA 3CU2A 2R82A 2WB5A 4C6QA 3ZT6A 5F1UA 4NRSA 1YTKA 3AMCA 1DL3A 2V38A 4B9QA 3FK4A 2E67A 1ZBVA 3EWBX 3KLLA 2NXIA 5BRQA 2CXGA 4HOZA 3DBPA 4JNYA 2ZX9A 3BWWA 2XFRA 1Q13A 5AOUA 2CIPA 3NYZA 4AISA 3V1HA 3GAYA 4X0NA 3BAJA 3CYVA 4M29A 5FJRA 3V5FA 1X96A 3SO7A 3EYPA 3MO4A 2QF7A 4CU8A 4DJFC 2RHGA 3KOYA 4EACA 1FH7A 2VRJA 4AZGA 3VD4A 2R9RA 2XSBA 1D7KA 3O3MB 3W84A 2ON3A 5K9CA 3D52A 3T55A 1QNSA 2ZRZA 2IKGA 4H7ZA 4ML9A 4WJEA 4A8LA 4AEFA 1OM0A 4M81A 1JZ4A 1WKYA 2GJRA 4HA0A 4HTYA 1DWFM 1TRDA 4IM0A 4L9XA 2PDLA 2VGBA 4XX6A 4BQ4A 2N3KA 2NXGA 4I5UA 1B9ZA 3W00A 2AGKA 4AUBA 2NUXA 3LBOA 3MSDA 1GHRA 1VB9A 2WZEA 3HPAA 5A6JA 4AD5A 4O8RA 1Z32X 4LF1A 4IUGA 2VC5A 2PD5A 3IUDA 2YBTA 3HQ1A 2OJPA 3N4FA 3ARYA 5H6HA 5C7VA 3G6MA 2OX4A 2WJEA 3DGRA 4KERA 3M0JA 1QCWA 3EA3A 4W84A 4DXVA 1Q6GA 2E3ZA 1WOAA 2PUZA 1EJ7L 4L4MA 2I9UA 2ZDRA 2HROA 5C0QA 3W7PA 1KRAC 3WF0A 1BYCA 1AFSA 3EX3A 3D4YA 4GGBA 1FHLA 1U1HA 2YBUA 2OZ3A 4LV9A 1CGUA 1J5SA 1QI4A 3FXGA 3RO6A 4MZYA 4MWAD 3VZYA 2KHOA 5E0FA 1C8XA 3BAWA 2UBPC 3QLLA 4IIBA 3VKHA 1XIGA 2J9YA 3PJWA 1HKIA 1E2UA 3CAZA 4LRSA 5KZEA 1M41A 1FWJC 1RP8A 3E3HA 3GVWA 2DSUA 3WF4A 1J6PA 2TMDA 3S1WA 1SFJA 4MGGA 2QDDA 3EJSA 2GUYA 1NWTA 4KGJA 1HL2A 3EDJA 3PFRA 3NUKA 3PSWA 5DXYA 1HJXA 4DRSA 4E2BA 3S47A 3QZ6A 2WW5A 3KUMA 4H2HA 5EU9A 3BUDA 2NCZA 1NOWA 1GQJA 3SUWA 3N04A 3L0NA 2P76A 3UR5A 2JKPA 1H1YA 4AX6A 5IHSA 2VFEA 1WBHA 1FHUA 4A35A 4N9CA 3VX0A 4KETA 2WSKA 4PODA 3TK7A 2ZKMX 2PC8A 5HQEA 2H8XA 4AWEA 1XWYA 2ISDA 1QI0A 1JYWA 1V8EA 3VOJA 4WR3A 4CN4A 4U10A 4LT9A 4GZIA 1MEHA 2Z27A 4TV6A 4B5WA 1GEQA 1UR8A 4B5TA 1HGWA 3IIPA 4AZCA 1WDPA 7REQB 4JN7A 1QMLA 1DQUA 3QPEA 3QLDA 3UJEA 2B7OA 4XISA 2CLLA 4US5A 3HB9A 5I3FA 1Q4WA 2Z1BA 2YI8A 2O9OA 2XH7A 3IVTA 2ZRVA 3TMQA 3QSTA 5KZDA 1GCYA 2FTYA 5A3HA 1KBJA 3M0MA 1VFOA 4QS6A 2VR2A 1BYDA 2PWDA 4FLOA 3NQ7A 4MB5A 2VQUA 1ZBWA 4LW7A 5C9WA 2VZVA 4NJHA 3L9CA 4UFHA 4HNOA 1S2AA 2WZHA 4IP7A 4JX5A 1O5KA 1OYAA 3C2YA 3D46A 3E1F1 3BAIA 3P67A 3V18A 1UKSA 1VENA 1HL9A 1ZWWA 5A6BD 4P8VA 1SZEA 2QULA 3UR7A 2UY2A 1XG3A 3UBPC 3R4IA 1QPOA 3LNPA 1E56A 3D4ZA 4TTUA 1JZ7A 1XI3A 3A9IA 3NZ1A 2G37A 3H4WA 4HMCA 4BS0A 4U28A 1SYTA 1W9VA 4MLRA 3RR4A 3VIFA 3IWPA 1B3XA 4MFEA 2D1ZA 3I04A 4MWAB 4RXGA 1XIFA 2QJMA 2YCIX 1QAPA 3SI9A 4JQ1A 1V6WA 2A79A 1CXLA 3DDMA 2Q09A 4WSHA 4HSHA 3W1RA 1R47A 2PBOA 4HJWA 1GVOA 3AIQA 1DKYA 3N1AA 4MY9A 3UWQA 5AHNA 2RDXA 4FF5A 1M68A 3LLFA 4ZOAA 4PFMA 1NP0A 3WLSA 4AZ6A 1ZAHA 1HP4A 3A22A 3IIXA 4GUJA 2C0AA 3VKKA 3R1ZA 2Q02A 5FOOA 3IV8A 3BVVA 3HN3A 2V2HA 2QEZA 2EHHA 2OCZA 3ZT7A 2XIIA 1XLGA 4NXSA 3M1ZA 3S6DA 1LLOA 1U5JA 1V51A 1L6WA 1UB3A 3NL6A 3DERA 4GWEA 5CGMA 4N4PA 4DJEC 4IM4A 3GXFA 2OT0A 4ZBCA 4M24A 1R2SA 1E9YB 2BY2A 4DQWA 4C7FA 2HISA 4UCGA 2GUUA 2YZRA 4A8IA 1PDZA 4U4MA 1RJPA 4A8RA 4H8VA 2D0HA 4JX4A 4G2DA 1R2TA 1CT5A 3NQVA 4AU0A 4D1JA 3KCJA 4GYPC 2ZA3A 5LNRA 2WWCA 5LHEA 3APGA 1GOIA 2QKFA 1DVJA 3QGKC 4CVWA 3CT2A 1U5HA 1EQCA 2OVLA 2V5BA 4ACZA 3WF2A 3TSDA 1HO4A 3ITYA 1JPDX 3HGOA 3N4EA 4H9ZA 3IV3A 2PLMA 1EEPA 3P0WA 2EFLA 1R5EA 4KPLA 4DPPA 3Q94A 4XAZA 3HJEA 2J7CA 3PUOA 1VFUA 1XISA 4C6OA 5BWAA 2XVNA 3UVAA 1TR9A 2DH3A 2EPNA 3ABZA 4MWAA 1R33A 2C0HA 5D2WA 1E0XA 2XPKA 2DSWA 4C6DA 4Z42C 2QS8A 4ML4A 3VNIA 3KP1A 3WEZA 5CC7A 4QR6A 4WIWA 3BVUA 2A1YA 1R30A 2GWGA 2BGSA 1UOKA 3OYZA 5FEZA 2R6OA 1P6BA 1TZ7A 3GD6A 3ZQ9A 4XD6A 1AJ2A 4EF9A 4G7EA 4QDMA 5E0CA 3W1PA 2AGTA 1KRBC 2DVUA 4JEQA 3TTSA 3UCDA 1O60A 2RAIA 3S5OA 1VBJA 4O0ZA 2POTA 2QQ6A 3PBMA 1PHWA 2V68A 2XH4A 3Q2DA 4ZB5A 2FQIA 4FOUA 1MYRA 4P5UA 3DH7A 3DPQA 1KBBA 3E0VA 2IPWA 2PC4A 4IQJA 3ZFHA 5D03A 3S42A 1C92A 3LPPA 2F9RA 5I23A 3C3UA 1HKVA 1EUNA 2A5HA 4L4LA 3R0KA 1HFBA 3UZYA 3U5UA 1SJDA 2OLAA 3E0IA 4JFVA 1OCQA 4HNVA 1IR2A 3WMLA 3O6AA 4GQGA 1B3ZA 4Q8WA 4N9DA 1K9TA 2VEMA 1L8NA 2YW4A 4EXBA 1SW7A 1J8VA 1EZWA 1F9CA 2WMGA 4UNKA 2EXOA 1YTEA 2NX9A 2E68A 3RF9A 3U7BA 2C16A 1TQJA 1WX0A 3TQKA 5AC8A 4C6NA 3A21A 1I2QA 4XVDA 3REQA 1CGWA 2BVYA 4Z1DA 9CGTA 1UA7A 4ICCX 3VABA 2QDGA 3BG9A 1KR1A 4XZ9A 1A80A 3QY6A 5DF0A 5FSDC 1JXKA 4Z1CA 5J04A 3QFWA 4U5IA 3WMSA 1UWQA 3RN6A 2HXTA 4IT1A 3ZJKA 5DRIA 3C0JA 4AYSA 3O3OB 3I7SA 4DJDD 3OG2A 1AH3A 4PFHA 5PTDA 4GZJA 1H1ZA 3M0ZA 3AYSA 3CQ0A 3AS1A 1C90A 4E4PA 4B4FA 4D8AA 5CZSA 3RMEA 5FL0A 3SCSA 1JNEA 3ERCC 1BYAA 4GJ1A 1ONRA 3VO0A 2Y70A 1PTDA 1FWHC 4BJHA 3IGXA 5K3VA 3OBAA 1GTEA 2FZNA 1IIGA 2YGYA 2X7VA 1CPUA 1O1HA 4REQA 4WKHA 2HBXA 2PP0A 5LXXA 3TAKA 4G6CA 7REQA 3ABXA 2CBVA 3QOKA 3F4VA 2DZPA 2PTYA 1IT0A 5FEWA 5E09A 2BZNA 3GIQA 3CMFA 5A8OA 5XINA 1HT6A 4XVEA 4UTWA 3KM8A 1EO5A 3TLQA 4M7SA 4PUWA 4LF2A 3GFXA 3LRMA 3BE7A 1A0CA 4A3RA 1OIMA 4BHYA 4DO7A 4HSNA 1TQWA 4AZCB 3FX4A 1W1TA 1GK8A 5F2LA 3GVVA 4CEUC 1L6SA 3TJ4A 2Y7EA 4GIAA 3BAYA 4EWND 4HNNA 4S1FA 1BVZA 4L80A 1FP9A 1TV5A 1VPQA 5FESA 1L6GA 1HTYA 4K8HA 2WHMA 3T7VA 5K4XA 1CXFA 3EMQA 4U2ZA 3LENA 1OINA 4D72A 3F2BA 3VM7A 2QPXA 2ZTKA 3RG6A 4CQCA 1V0LA 3EEZA 4PE8A 3QV8A 2DV0A 2VCBA 1DWJM 1EH9A 5BOOA 4YL2A 4J27A 1OA1A 1J2BA 4GX8A 1GJPA 3T47A 1OX6A 2INZA 3LHYA 3VIOA 4V1XA 3HMJG 1E1DA 1KD0A 2MI7A 1RQEA 5CC3A 3SGGA 3SFKA 3OLGA 4Q33A 1SFSA 4HK5A 4NL1A 1BXBA 3GVRA 3SR7A 1KBLA 4KESA 3DC8A 1TV4A 5D30A 2VRKA 3SGUA 5AHMA 2A3AA 4QJ3B 3ICJA 2CBIA 3G0SA 3N12A 1DEDA 2HDJA 1EXPA 5LZLA 3HV9A 2QPUA 2GLKA 1OX5A 3G6LA 2BTMA 2E09A 5FF2A 4ENLA 3HAIA 4MB4A 1JUKA 3CZNA 3WNKA 4LU0A 4MJ4A 3HFTA 4HA1A 3W88A 4KIKA 2OOGA 1OC7A 2H3DA 4IGMA 4IQEA 1OCNA 5DMMA 2C3ZA 1NFPA 2HBVA 3F4WA 2DUXA 1AODA 1MDLA 4MNJA 3ZR4A 4PN2A 2WSQA 4IX0A 4EZNA 1G1YA 3V36A 3G3MA 1PTAA 2TRSA 4H9UA 2X5CA 1ITCA 1XBXA 1A5NC 1QNRA 5DY3A 3EWYA 3GI7A 2DVTA 1WCGA 1LL4A 4ASTA 3TN4A 4FM3A 3WD2A 3MVTA 1G4SA 4K6AA 3NL3A 5AVNA 2WJDA 1LRTA 4ERIA 1UR0A 3BVTA 7ODCA 4FXFA 3DG6A 5C2GA 4JTEA 4W8AA 3WZ0E 1EBGA 1RUSA 1PKMA 2IQ0A 3KBSA 3UF9A 3OBEA 3BSMA 2HCVA 3O7UA 4OV9A 3CTTA 5T26A 4OKDA 3GK0A 5D33A 2CETA 2R94A 1LOSA 3ZR5A 3MKCA 2WCSA 2X0HA 3FDKA 4GA8A 3U2CA 4BFAA 4ZFMA 3S1VA 3OA3A 1K9EA 2OO6A 4Q4PA 3MYPA 1DXIA 3CUGA 3OLIA 5C9RA 1G7UA 1HG3A 1TJ1A 5DXXA 1L0PA 2OTDA 4MJ2A 3AZSA 3TYDA 1TWIA 3ENLA 3KCOA 3MKKA 3SBFA 3W7IA 1TSIA 2DT2A 1S2UA 1YDYA 1S2WA 3MU7A 1WDZA 3JR2A 1GW1A 4WPEA 1A0EA 3NQBA 4QIUA 2PP1A 4RZ5A 4Z2KA 3ES8A 2WSPA 2ZE0A 1XD1A 1W1ZA 2G41A 4JTUA 3WH6A 3PTMA 3NZRA 1RJRA 2XIQA 4C1LA 1JZ8A 1EGVA 4Q4QA 4HPGA 3NA8A 3U0HA 1O1ZA 3INPA 1OYBA 3DX4A 3BOXA 3PSVA 5BU6A 3UGRA 1ZS2A 3EGJA 5AHIA 2PBGA 4UR9A 3GG1A 3HGJA 4MLJA 6TAAA 1VFHA 3LXAA 2OZTA 1V3JA 2XISA 4C7DA 3SCRA 4M6UA 3OZOA 1CIUA 1XW8A 3GR7A 4TX6A 4ZGYA 4OJYA 5HDRA 3LLXA 1KXVA 4R9XA 3GSMA 3HQPA 1ME8A 4AZHA 1X98A 3WQFA 3QH2A 3PVFA 4V1YA 4TR9A 1NH6A 2ATSA 1W2PA 3DFPA 4OVXA 1WYIA 2EG7A 3G0UA 3FFSA 3N11A 3OZMA 1XFBA 5AN7A 2BB0A 3TZNA 4O18A 2HNHA 1TPUA 3UNDA 2WNWA 2PU0A 2YKKA 2VVNA 4DJDA 4N9BA 3KBNA 1Y0EA 3K1GA 4B5NA 4FZSA 2DVXA 1UOZA 3R6IA 4PSRA 2NQZA 4JIRA 3UD6A 1YNYA 4RK8A 3LHUA 3NQ2A 4Z2IA 3LERA 1EX1A 1HNYA 3L3OM 1SGJA 4Q8OA 4C5YA 2VJXA 2ZBTA 1M03A 3B8UA 4G7EB 2YBVA 4NZ5A 5E70A 4MJMA 2XWDA 4HBKA 3NFUA 3LG3A 1A5KC 1QHPA 1FWCC 1RXOB 1QI3A 5C55A 3E02A 1T41A 3LMZA 1V5XA 5CXPA 3UVIA 3V4BA 6ENLA 3IJQA 3FSUA 3KVKA 1GG0A 2QDHA 5EMJA 5HMSA 1V3HA 3KRUA 3N73A 4MDPA 2WMIA 3GXPA 2HQAA 4IOTA 1PBGA 3VMNA 2G3NA 2WWDA 3MCOA 3ITCA 1J2WA 2F18A 4W8LA 3USBA 2XU2A 1EIXA 3CUFA 3BPWA 1BTMA 1ELSA 1I2PA 2FICA 1UD8A 4E8DA 1C8YA 4QE5A 3T44A 3MUAA 1FDZA 1NVMA 2YJQA 3LI0A 3NXLA 5HULA 2HPIA 3QYSA 1OB0A 3HO8A 3ZR6A 4AEOA 2Q8LA 3LSBA 2ZFAA 3FAWA 2A0NA 1ZCOA 4GACA 3L0KA 1UR4A 5FJPA 4PRTA 3U4AA 2Q3RA 4LVGA 2R1PA 1QW9A 2BY0A 5CBBA 1XLEA 2AKZA 3GRIA 4HR1B 2PDGA 4PCSA 1E4NA 1W9DM 1IEIA 2PDNA 3ARWA 4JIIX 4KH2A 1XDLA 1K02A 3FA3A 4LUYA 2EBNA 3NGJA 4ZSTA 4DZAA 4ZO8A 3OPSA 1TA3A 2CWNA 4GZEA 1UASA 4LC6A 1E6RA 2ZX8A 1CW2A 1CXHA 3T1GA 1K8CA 4MY8A 3KWXA 2VYOA 2JNSA 1QBBA 3OYXA 4CQDA 2ELBA 1QPNA 1M9HA 3AS3A 3T07A 1DV7A 4HR1A 2DW7A 3HG2A 3A4AA 4DM1A 1NF0A 1XIMA 3TQVA 3TNBA 2OKOA 3M0KA 4ERGA 5HINA 4DX3A 3RDKA 1VFFA 3BGJA 3ARZA 3FD9A 1OFPA 3SM0A 1KM6A 4QTGA 4Q3MA 4A2SA 1P6CA 3M6YA 3SAZA 4DIAA 4W7VA 1ME9A 1CZ1A 3ECQA 5G4HC 2WNZA 3GC5A 3RPMA 4UTJA 1W9MA 1RPXA 3TC6A 5KBPA 4O52A 2CZEA 3EJUA 2XINA 1OD8A 4KWVA 4KWOA 4LUTB 3LVTA 1WA3A 3LY0A 1E1EA 1ZJHA 2O9RA 3VGDA 4S3FA 2YR1A 3NO5A 2J8TA 3A5FA 3VKBA 3VM5A 4FMVA 3TNOA 1G0CA 1EC8A 1E6SM 3SB0A 1JL8A 1KW1A 3MW7A 4HHMA 4QG8A 1GNLA 3S3GA 4ZO9A 1LDCA 2HS6A 3VGHA 3M7WA 1YPXA 5LKYA 4YU1A 1WUEA 2DT3A 3IRDA 3S5NA 3EWUA 3BLIA 3A64A 2VMFA 3P2VA 4QRNA 3GBEA 3IUHA 3N2CA 1EFZA 4MPKA 5CBIA 2GFTA 1MXSA 2YPIA 4Y9MA 1KWKA 2F6UA 1OQFA 4W7UA 3BG5A 3BLEA 1UWTA 4ACZB 1PZ1A 7TAAA 4O15A 4Q7IA 2Y0FA 4UR8A 3OQEA 2FYVA 4Z08A 4F40A 4UTFA 4IWWA 4JIQA 1G94A 2D69A 4CD7A 3MS8A 2V2CA 4EWJA 2OYLA 3L23A 2I16A 1H2JA 1ME7A 1W1B1 4I1QA 1KGWA 3E0WA 1XD0A 3UWWA 4PBGA 2NX3A 5CZJA 4J2MA 1KFLA 2W92A 5BXRA 5IFPA 3U2OA 3R2GA 3ARQA 4Z1AA 1XLHA 2EO7A 3I10A 1RCXB 2EPKX 3H23A 3FXYA 2BHZA 3G0XA 4NAFB 4R53A 4EP8C 4UIOA 1QW8A 4LVAA 5FACA 4WQ6A 3H8AA 5G4EA 1HIZA 3ZLFA 1GYLA 5HK4A 3B52X 1ISYA 4AEEA 3O6YX 4ATDA 3D47A 4H3DA 1O4UA 4GUGA 4JX6A 2Z0NA 3LPFA 1H7XA 5EL1A 3ITGA 3TXZA 4LBUA 3UG8A 4W85A 2Y7FA 1Q2RA 3PTQA 4ACYA 2DSVA 4O4WA 3PR2A 3STCA 1O95A 3DC0A 4DO4A 4U5KA 4O57A 1FCUA 4Z2GA 3B9AA 4EZYA 1OZQA 5DMYA 3LD5A 3B03A 1NP2A 4XQ6A 3T78A 4HCHA 4OOUA 2DZUA 3PZMA 4UQDA 2NQ5A 2QUMA 1F61A 4PGLA 1BAGA 5I0DA 4FALA 1MRQA 1PIGA 4F0RA 4WXYA 2OU4A 2VGFA 3P14A 2PCEA 5K2ZA 5GNZA 1OC6A 4DUWA 2R14A 1I1XA 1OEPA 3GNDA 2ATMA 1OFAA 1HXJA 3M4HA 1J96A 1GJWA 3BL3A 4O8AA 3QC0A 4IMCA 4OZOA 1H50A 3UETA 5CPOA 4E3TA 4EZWA 4LAZA 3UESA 2RGMA 3T48A 3S5YA 4IJCA 1I49A 4EK7A 1JVNA 3GLCA 3QMRA 3RFAA 3TC3A 4DWSD 2DQXA 4GH3A 4HA3A 3FY1A 3BLDA 3RJYA 1WXZA 3HV8A 4FR6A 3N6HA 4JICA 2J7BA 4XO6A 4GO9A 4H6EA 3W1QA 2ZWZA 3QKZA 1V3IA 4UQBA 1XP3A 3H22A 3C2VA 1Q6DA 1S39A 2BBFA 3GFZA 5I09A 2I5GA 1Z44A 3GHTA 3QHMA 5I3HA 3DHDA 4H01A 4NZ4A 2HRWA 3TOYA 5JUVA 4PMJA 4AC1X 4AX7A 3P7YA 3MO7A 3VGEA 1ADDA 2ZRUA 2FHBA 3DECA 4HYWA 3ZWTA 4F2UA 4XD5A 4B3LA 2J7GA 4Q22A 1XYZA 4O16A 4C6FA 3SSZA 3CAWA 3QYQA 4BWLA 2DW6A 3WLMA 1ZYLA 4AD4A 1AH4A 3GNPA 4UFIA 3RU6A 4OECA 1XFCA 3GH7A 3HJZA 6XIMA 2NQJA 3HZ3A 4XBKA 4TU1A 3B0VC 1UKOA 3DYTA 3O8AA 4JTHA 4JTRA 3BGAA 4B5UA 1TJ0A 3MC5A 4HT3A 3MUCA 3R43A 2V81A 3EXSA 4IQLA 1C3FA 5HBFA 4FLSA 3M0VA 4B91A 5CSUA 2D1LA 2YL8A 1P4CA 3N34A 1FXQA 1BWKA 5DCDA 4UFLA 3NCOA 5KZMA 1A5MC 3RU8X 1C8QA 1F07A 1REQA 3II1A 5A6SA 4L4OA 2XN2A 1DKZA 4GD0A 3S0CA 3TR9A 3SCVA 3TAOA 3PAJA 2W5FA 2WVVB 3N2BA 3CHVA 3EB3A 1JGMA 1JF6A 1JUEA 1UIOA 3NXFA 4J2PA 4C6KA 3O6CA 2DZSA 4KEMA 5M03A 1OYCA 4B5XA 1BD0A 1RJQA 4LYQA 4UTLA 2C6QA 1ZHAA 3G8RA 1TELA 1Q66A 4F2TA 4YTRA 7XIMA 3CIXA 3CBWA 3P5YA 4FZOA 4U3CA 2PDWA 2GYIA 4UZSA 1LP6A 2JE8A 3KDOA 3BV4A 3O0KA 4A22A 3CWNA 5ENLA 3U2EA 1BLIA 8XIAA 3SQMA 4GBDA 4QS5A 3QOMA 3D2EA 1J01A 1I2RA 4BEUA 4PMZA 3S9IA 5HANA 5HUOA 4PC8A 5XIMA 1TV2A 2C1HA 1EIBA 3CL7A 3GNXA 1RLCL 2DFAA 4PA8A 3Q67A 4TX8A 3T49A 3KXQA 3QQ1A 5BRPA 4E8GA 3B0XA 4HZ8A 4DO5A 5I3KA 2A21A 1XF0A 3H21A 5CSYA 5F4WA 3D3AA 1A5AA 3WX7A 3ZM8A 5LIXX 1J0JA 2NWSA 2VEFA 3KHDA 4H19A 5DEZA 2Y61A 1WDRA 1TTJA 4R7OA 3ABSA 2DUAA 1EXBA 4DBUA 1IXOA 4XKMA 2RJHA 3PTKA 1XRFA 1S5TA 1QTWA 3HBLA 4DNMA 1H4PA 1OF6A 1TE1A 1LBFA 4ALDA 4QDWA 3OZPA 3IVUA 2O56A 3UG4A 4GG9A 1TQVA 2C7FA 4EX4A 2J27A 4B5VA 4CQBA 5LGZA 1GQKA 2F2HA 1WDQA 4B4HA 3AHTA 5D9NA 2OXNA 1E70M 2PTWA 3W28A 4UTKA 3WLPA 4GYJA 1ADOA 3TTQA 1JQXA 2I5QA 1HN1A 3T8QA 5DT5A 3L2MA 4MSSA 4QFUA 1ICSA 3OHIA 3UZJA 4PZVA 4MNLA 3QHNA 5G2WA 2CLFA 2PAJA 4S3DA 3P61A 3K8MA 1PUDA 2Y8KA 1V7AA 5HJXA 3BXWA 4QHRA 1XRTA 3TN3A 3G1HA 1XGDA 2V5LA 1GVIA 1GNTA 3T0BA 3BMXA 4X9YA 5B80A 3NSXA 1JR1A 1Q6FA 3VIIA 3TN6A 4WZHA 1RD5A 3NQ6A 3S2LA 4AIBA 9RUBA 1QWUA 2ZUUA 5H8MA 3BLOA 1KM0A 2RAGA 3PPGA 3FHAA 4PMYA 3DX1A 4IJRA 2XJ7A 4H9MA 3DHUA 2QDEA 1H49A 3UWVA 3LZ3A 1EGMA 2J7DA 2VZSA 1FWAC 2H6RA 1VEOA 3GC4A 2ZZ2A 2VDIA 3LGDA 3CB3A 4AF0B 2PI6A 1R3YA 3NG3A 4ZL1A 4DXKA 2GJLA 1EOMA 3LCFA 3T6CA 3PN8A 3AIWA 1R9YA 2WZMA 2VRQA 4B92A 5DN1A 4JY8A 1AUSL 1HJSA 4S3AA 2PRMA 4Y96A 3M9YA 3TYUA 2EPMX 3R5EA 3I6RA 3U9IA 2GQ8A 2JIEA 1BSIA 3SY1A 3AICA 3EXTA 4ICMA 2XN1A 3OGSA 5D4YA 3WD1A 4D6JA 4GOAA 4LTSA 4Y9AA 5CGTA 2PF0A 4PEKA 3UU0A 1DIOA 1OHLA 1QNVA 3Q65A 1TMQA 3G2GA 1X6NA 5FCZA 3AYTA 4NRRA 3L67A 1U00A 4JXCA 1GZJA 3MA8A 2NX1A 1RBLA 4V2XA 5EB8A 3DHPA 2E6YA 4S3EA 3HPSA 3BW2A 3RILA 1RP9A 2H9AB 1ICPA 3C0LA 1V0MA 5CC5A 3C2RA 3CZSA 1UKPA 1H61A 1P43A 4C1KA 1XRSA 4Y8EA 3QKEA 4JAWA 1DTNA 3ITXA 4CU6A 1IZJA 5E93A 3SSJA 1TG7A 2PA6A 4LYRA 2HPMA 3GVQA 1XIBA 1B4EA 3W7LA 3W6YA 4DUVA 1ENUA 4H00A 5C9ZA 4MMWA 5F7UA 1L6FA 3EJQA 4DWDA 3QM3A 4Q8UA 1YDNA 3ARUA 3P81A 1PIIA 4HZMA 4HOXA 2ZXDA 4QP0A 4DBEA 4TQTA 3W07A 1P0KA 2QIWA 3VK5A 2W4XA 1NDZA 3ZJ7A 3WF3A 2NQHA 2XVPA 3WBYA 3M3WA 4UOJA 4ZMGA 3MSGA 5ABFA 1RLDA 1YPFA 1EBHA 2QCCA 1D7FA 1Y8BA 2ZCGA 3PZNA 1R5YA 3LHZA 3OGRA 1W37A 2E0PA 4C6PA 1LL6A 1O6IA 4JN8A 3NO3A 4U2YA 4TVDA 2QR6A 3AS0A 1XHGA 1MNSA 1JCJA 1T7LA 3W1NA 3B0UX 3SUVA 2WKJA 1ITQA 3MUXA 2G3JA 4GNKB 3BK0A 3NPVA 3PG8A 2I7GA 1FWNA 2VFFA 1HJUA 1AL7A 4IFOA 3M47A 4URIA 3CV5A 3N15A 3WEMA 3TYAA 2OKTA 1RY8A 3KS6A 4GPNA 3FEMA 3JUGA 4RNHA 1MW2A 3R10A 3QZEA 3CV6A 5CAHA 2CHOA 3TYCA 3PWGA 4IMEA 4XD4A 2A3LA 1F3WA 1TX2A 1KM2A 2XH2A 1EA9C 4KEUA 2XFWA 4QLLA 4E3VA 2OW6A 3VGBA 3IGHX 1ZZMA 1RHCA 1BRLB 2Y4SA 4TIMA 3PHAA 1E4MM 3VNDA 2CLEA 1N7KA 3OA5A 2ZVIA 2B81A 3V75A 1IGSA 5FF7A 4DXXA 2J7HA 4AY8A 1KV8A 4OUIA 5G4WA 3DFOA 1W5MA 3E0FA 2JBMA 1MQRA 3TSMA 1NWUA 5DELA 3WKZA 1F6KA 1QNPA 1KFWA 4UQCA 2Z1WA 3QSRA 3M07A 4W9TA 3SRHA 2G3IA 4UQEA 4GIRA 4M6QA 2AKMA 1WQ5A 3WBWA 2O0I1 4DLMA 4GFIA 4UC5A 5T9BG 4P8XA 1OZMA 3GXDA 1DE6A 2XM1A 3F4DA 4E0CA 4I8DA 1LQ7A 2OFJA 3ES7A 2F7OA 5BWFA 3CASA 4ZENA 4YS1A 5GJNA 3VOHA 4TTGA 3EJRA 1EHNA 2QCHA 3BANA 2WXDM 2ISFA 3KLKA 2G3MA 3VOIA 1A50A 2PB1A 1D3GA 4IIGA 3MWAA 1Z89A 4Q6JA 4HMNA 4AD0A 2WINM 2I57A 2XIBA 1AW2A 5I07A 1TWDA 4HVXA 1L8PA 5CG0A 4GFSA 1E4IA 3C4UA 5JBDA 3B9OA 5CJ5A 4WVXA 5EPDA 1QK0A 1KM1A 1TPFA 1E6XM 1DXEA 1VPXA 2BS9A 1B3YA 1EP2A 3PUGA 5CPNA 4GYFA 5HOSA 5DANA 3CZEA 5KZ6A 4CVUA 1UCWA 4RE0A 1QUMA 2D2JA 1FWSA 2X8RA 4RV8A 3BMVA 4LX4A 3ZEDA 2WCGA 1WDWA 3GXMA 3V3WA 5K9XA 5IOBA 1JGIA 3C3NA 4JNMA 1FX6A 3KL3A 1HJVA 1LWIA 4G1KA 3WDHA 1YXDA 4ZTYA 1K9DA 3I01A 1UW9A 3ZXWA 4GE8A 4NI8A 1GPFA 3OEXA 1UH2A 1OFRA 4FNSA 3UZWA 3A3XA 1T0OA 3CM4A 4J3VA 3CV7A 1DJNA 2YXOA 1BEUA 3M5YA 3PUDA 1RK5A 2ABAA 3L4UA 3VI2A 4W5UA 4IIFA 3L3PA 2FZDA 2FH6A 2NQLA 5E6ZA 3W85A 3AYRA 1MZRA 3IK2A 3V16A 4LANA 3TXVA 1B9BA 3KOFA 1S46A 1GOXA 3W76A 3IPWA 3GU1A 3MSRA 4B2DA 5DLCA 3REQB 3TH6A 3TSBA 4IP4A 2ZX6A 4Y2WA 3GR8A 4H9VA 4ROPA 3RITA 3BCFA 1JI1A 4RX0A 3W9ZA 1FH9A 4CD6A 4C1NB 2V3DA 4Q8NA 4QSFA 1JDAA 3VNJA 3QJAA 2PDUA 2CFFA 4MG4A 2YCJA 3PWAA 2WLYA 2FFIA 2KX9A 4JBRA 3VC6A 4FLQA 1OBAA 2W9MA 2BNJA 5AC5A 4GH1A 1O5QA 3TX9A 1EB3A 5D2VA 3EOOA 1GT8A 1ZFJA 4H6IA 5A6AA 4JCLA 2GDUA 1EPXA 4KT2A 4J3WA 4AVFA 4CQ9A 3B51X 3DGBA 3MHGA 3AU2A 4IMFA 4R3UA 2QKWA 5FIPA 2GJNA 1OT1A 3HGRA 3GU9A 3BJTA 1PAMA 4KF1A 4XAFA 2DSZA 2WYSA 3F4NA 2CZVA 1B3OA 1E43A 3KTXA 1W3HA 3KVLA 1D9EA 1PSCA 1VR6A 2DT1A 5ABGA 4A8NA 3GTXA 1PB0A 1T99A 4INFA 1B54A 1O5XA 2G4JA 5I6SA 4D71A 2QNEA 2E77A 2B31A 4JL2A 1M7OA 1KFBA 4EXAA 2V69A 4XAYA 3PJUA 4Z17A 1FCBA 3TROA 3ATYA 1E0WA 5D9PA 1WB0A 4UTWC 2J13A 3P80A 3UYCA 2ZQ0A 3SQLA 4RJEA 1KXTA 1V77A 1US2A 1PE1A 5IDIA 1KCXA 3W7DA 5D38A 5CBJA 1SJAA 3BLLA 4O53A 1KKRA 3KRBA 1UQZA 1CB2A 3NQ8A 3W1UA 3Q45A 1KB3A 4PRWA 3W53A 5A8NA 4NYUA 1VJZA 3GYCA 3WJYA 4Y90A 4WJ8A 3JU2A 3ABHA 1V0KA 1DJGA 4AZ5A 4KWSA 4WLCA 3BLFA 4IFRA 4JIHA 4JTCA 2E6AA 1HO1A 2JIWA 2VZUA 2CLOA 3W71A 3MV11 2C14A 2H9AA 1E5JA 2P8BA 2X0YA 3E2RA 5IM51 4Q8MA 4NZ3A 4A3HA 4O17A 1O5RA 2E5CA 3GHRA 4GI6A 3UG5A 1T6MA 5I5RA 2A6LA 3P6LA 2W67A 1QJWA 2C19A 4ZCWA 1I75A 1UHVA 4MUZA 1CB7B 3W0KA 3BUQA 3CYJA 3GBDA 2FGZA 3OVPA 5FI8A 4YLWA 2QMJA 2QCGA 4L65A 1BWLA 4HA4A 3HQNA 1VBUA 3HAJA 1PIFA 3B8IA 2BGNE 3R8RA 2ACSA 2V3EA 4AHOA 4HQVA 4YHGA 4NSBA 4RZBA 1CI1A 3NZQA 1JD9A 3S1UA 4K8GA 3EWXA 2X16A 5JIPA 1I0DA 3L12A 5FIGA 4M7TA 1VFLA 1GN9A 4S38A 1KXQA 3GQYA 1ALDA 4ATWA 3DHFA 5AHLA 1TJRA 2QCEA 4FPSA 2R1NA 3UJ2A 3I65A 1UR3M 1A49A 3NZGA 2O4MA 3BMWA 2NSOA 1A5LC 4DYKA 3GDMA 1GYNA 3UT0A 3THCA 3WDPP 3T08A 4BR1A 3SJ3A 3DFHA 1KNWA 4O4VA 1H09A 3URNA 2OEKA 4NNAA 3IEBA 3UFYA 5B7ZA 2Z26A 4KFOA 4FIRA 1H7RA 4DJFD 2OZNB 1OGGA 3PZOA 2XIMA 3QR0A 1ZGDA 3VOCA 4JQ2A 1I2OA 1VBGA 3SN4A 3RO8A 3KWSA 4UWMA 1R3WA 4KGLA 3NM3A 3S6TA 1FTXA 1GZ1A 4C91A 4QROA 1WDDA 4UDYX 3T8LA 2WANA 1S5VA 4FB7A 2WC7A 4J40A 3MP3A 1TIMA 3B8SA 5G1TA 3W2LA 3JZEA 2QHAA 5D09A 2PMQA 4KIKB 4RLIA 4M5PA 1Y2OA 3HGSA 3C0SA 6XIAA 4NAEA 3S5ZA 5DBUA 2YB4A 4PO2A 3TA6A 5FF0A 2FYMA 2YKTA 1EDTA 1NELA 3KRZA 3R8HA 4MAZA 1K70A 4D9PA 1W8GA 2I5IA 4IXHA 3MDUA 4FX6M 5F1VA 2J24A 3BVXA 1QPKA 9XIMA 1WBJA 1HGYA 3UPMA 2YDQA 1XBVA 1YMYA 2CERA 2WQDA 2OBMA 1E4LA 4Y9PA 3KEHA 3TU9A 3HIJA 3QEZA 2HXUA 2ZA1A 3DBNA 4PB5A 4WKFA 2W3ZA 2YIHA 4X2PA 4FK9A 4PUEA 4HOWA 5KINA 2ALDA 4MWAC 4RPPA 2HE5A 4ZOEA 1DXFA 4C90A 2GSJA 3ARTA 1IZCA 1CXIA 3SUTA 2INEA 1UBSA 4HHLA 1GJUA 4DYEA 1P0DA 1FFQA 1MWOA 3TA9A 1YNPA 4ZTXA 1AMKA 2O9TA 3DG3A 3GG0A 1KM5A 3H53A 2NW0A 4IMDA 2G96A 3IIOA 1TPH1 1BTCA 3GW3A 2VC6A 2VURA 4AWTA 1QXLA 2MUCA 3MSYA 1LQAA 3RAOA 4LVDA 3SRKA 5REQB 4F8XA 1B2YA 2D4CA 1EYWA 2UV8G 2PDHA 1I4DA 4N6EA 1UA3A 4IG2A 1E6QM 3RCNA 5FJUA 3BGGA 1LLWA 1IF2A 3E5PA 4UZUA 4LCQA 3RLGA 1W3IA 3W7GA 3NM1A 3OK8A 3SGZA 2YDAA 3G77A 5JBFA 1WPCA 2OO0A 1Q8JA 3WK2A 4YYCA 3AALA 3TQ0A 1EF3A 4GIEA 2X3WA 2Y88A 4HU4A 3VA8A 1V6VA 4BA0A 1A5CA 3W29A 3IK4A 2F38A 2GGJA 4UNIA 3WQPA 1GOOA 1VQTA 1GGOA 4FP1A 1FCVA 5LYRA 3K4AA 6ALDA 2ZRXA 2BSLA 3VIJA 2WVVA 4PTNA 4ZQPA 4YVXA 3ITVA 3XINA 2JALA 1F76A 1UYQA 2ANUA 3UXKA 3SJNA 4C65A 1VYSX 4AIUA 2Y24A 5MKGA 3VNYA 4DCNC 4FNRA 4AY1A 2NSXA 3SY8A 1FBAA 4FZIA 4JEJA 1Q63A 2C71A 3D51A 3C56A 3I3EA 2PWHA 3UZ5A 1Q3NA 4IPPA 2OQHA 3MB9A 3WUBA 1I0BA 4LB4A 4LFYA 1ONWA 2QAFA 2VEIA 3BAXA 3RJXA 3UJSA 4GMEA 1V02E 3MMUA 3CS2A 4KRZA 3E38A 4M1RA 4DJED 1OY0A 3F5KA 1OJXA 4FR1A 1H62A 3WMBA 1ESWA 5GPRA 1QOXA 1NWRA 1K9FA 5LA0A 3N29A 3SRFA 1QFEA 3I2WA 5LA2A 3WQOA 2ZOXA 3H7RA 1LOLA 3KOXA 1VKFA 1ZTVA 5HNUA 2A2IA 3L2IA 3EX1A 3J7HA 5EGRA 6REQB 6CGTA 4R5KA 1SPQA 1R8LA 4XSLA 5HATA 3QZAA 5G2HA 3OB8A 4HPJA 4O1BA 2C8NA 4LUTA 2F7PA 3FCPA 1R0MA 5BMWA 1K1DA 4DYJA 3V5OA 4V15A 2NVAA 1KR0A 1EWDA 1YDVA 3I4KA 3N18A 3K4DA 1UJQA 3H55A 1VBRA 3TTEA 2D2GA 2RAKA 3VOGA 4EPBC 2PY6A 1J5TA 2BVTA 5L9FA 1QWNA 2UZ9A 2GK1A 5D05A 4PCNA 2P3EA 5ABEA 4H8SA 5AECA 4F9JA 4JR5A 4Y6GA 1X6UA 3FAXA 4UTUA 1J9YA 3SUUA 3QTPA 5AZ1A 1HJWA 1W1PA 4GVIA 3ITTA 3FJLA 4CCDA 1FHDA 3WLQA 2OYMA 2TPSA 1DORA 2FVKA 3LV6A 1CX9A 2PGFA 1QPQA 1VJIA 4GGHA 1GKQA 3CTLA 4EAYA 2Z24A 3BUVA 1SR0A 3PC0A 3SQSA 5LNWA 3SCOA 1NIUA 4I90A 2PDCA 4NX5A 3TONA 1HTIA 3T0AA 1PCKA 4CLMA 4WK9A 2V9DA 5HWNA 1JZ2A 2PLJA 3W7OA 3DFNA 3COTA 1RBOB 3WBAA 5JQ9A 1E0VA 4Q4KA 1EQPA 3ALFA 2Y7DA 3KOWA 4LAKA 3CXOA 2XFFA 4RNJA 4X60A 3MI2A 5EFFA 3B05A 4UMBA 3SN0A 2V3FA 4YN5A 2RT6A 1JUBA 5G2IA 1PS9A 1ISWA 1A3WA 3P5ZA 1SW0A 4JL1A 3AMLA 4HMDA 1S5NA 3S8HA 1CEOA 2REQA 2WO5A 3FVMA 2DORA 3QTGA 1RCQA 3TC7A 1T96A 3PZVA 5AVHA 5K4ZA 1HJQA 1MJGA 1R46A 3F1QA 3POCA 4NJGA 1YADA 1XINA 3A13A 2WPGA 3WH8A 3BV7A 2Z2AA 1EZ2A 3QW4B 3BURA 4X2RA 4NY2A 3HG4A 1YLVA 3DIPA 2IQDA 1Q8AA 1NEYA 3MT1A 5FJIA 3TVAA 3CZKA 1I2NA 3MPGA 4PUJA 1XLMA 1MXGA 3HG3A 1W3LA 3UA3A 2AL1A 2H3BA 4M6VA 4JTJA 1UIPA 4XO7A 3DENA 2AL2B 1AQMA 3IAQA 3PPCA 3T05A 4RPQA 5HXMA 1HZYA 4NAEB 2ZUTA 4O12A 2YA1A 4XZHA 1W5NA 1KQYA 3DPPA 5A6KA 3EX4A 1LUCB 1BHGA 2Z1SA 4K8EA 1I6NA 3DXIA 2VR4A 2PP3A 2BVWA 4GUHA 3E9AA 4L7ZA 3FKRA 3EOLA 3E5BA 1GG1A 1VCGA 1CLXA 1QNQA 1TTIA 1UWAA 5FAJA 2NZLA 3NR0A 1U1JA 2OWWA 1OFEA 3WK3A 3VDHA 2ISSA 2DIKA 2X2GA 2QCLA 1UD4A 2PE4A 3W1MA 3H2OA 2TODA 2OELA 2Y8VA 3XISA 1SJBA 3EWDA 3QWEA 4E3CA 1JRCA 2QVHA 4I6KA 4ZB0A 3I6EA 1MUMA 2Z8YA 3W75A 2DT0A 3W70A 3G1XA 1K7XA 1VYRA 5CLWA 5DQPA 1H60A 2ZADA 1QVBA 2BXZA 3GE7A 3AOFA 3I3DA 4DPQA 3LXCA 5FJJA 1I1WA 4RE3A 3N9RA 4ZOCA 2ISWA 1KA9F 3N9SA 2E6FA 3CAVA 3G1RA 3GZAA 3VGGA 4LH8A 1QASA 3QR3A 3QR1A 1XUZA 4RW3A 2PGEA 3FDGA 4L6HA 3WBEA 2WOQA 3GUWA 3W1AA 1UH4A 3AZRA 4M0XA 3GC2A 3DFYA 2PRHA 1UMLA 1XLFA 1H5YA 1DP0A 1QK2A 3WQVA 5GNXA 3UY7A 3M43A 3MDWA 3B0PA 4AMCA 1JZ6A 3N3MA 1E72M 4KQNA 4E4FA 4LY4A 3ZZ1A 4DZIA 4J4KA 3LNMA 5LGXA 2DJLA 2OZ0A 4I5XA 4GC3A 1JPHA 4EE9A 1PKNA 4GQQA 2J6XA 1U30A 2ICSA 2X3XA 1Y7VA 4QBXA 1SU6A 1X38A 4Q7NA 3R89A 3V1PA 1ZAIA 1M6JA 4MB1A 4Y7EA 3B06A 2VP8A 1XYCA 1Q6LA 1RV8A 1J0KA 2CESA 1PHQA 2PTDA 3W1TA 1WNOA 4K2SA 1CCWB 4CUCA 4AMAA 2YLAA 2V6AA 2ZIDA 3FJNA 1SSGA 5BOFA 1W91A 4US6A 4WDWA 4ADSA 3DYMA 3PBGA 2RFGA 3EDKA 4K36A 5C2XA 8RUCA 3LK6A 3EMCA 1V7YA 3BUPA 2JEQA 4W7WA 3LEPA 2ZXBA 3WLHA 4AIOA 4JWIA 2Y2WA 1LWJA 4JWDA 2QPSA 3EOSA 4PUMA 2PTZA 3AFBA 3MMTA 1S1RA 3UPBA 3SOGA 4XZWA 1OAOA 4OHQA 2QCDB 3KAVA 4P7LA 1IEVA 2A85A 1E55A 2PCQA 3VD9A 2FB2A 1FWIC 4IP5A 3UR2A 3WMCA 3GTHA 1TFVA 5CPQA 3CUZA 3QW3A 4QJ4B 1OK6A 1S1PA 3VIMA 1MZHA 3L7RA 3OVQA 4KCVA 2DY3A 3K8KA 3N6QA 2QUTA 3OVGA 1XLIA 2O0TA 1UPPA 1CENA 1J0ZA 3OBKA 4REQB 4O1CA 1TWSA 3WQ5A 3FW6A 3RRAA 2CC0A 1GONA 2V82A 3VNKA 5T9CE 1H7PA 4IZGA 4PYSA 5I3IA 3WQ4A 1R34A 1NDVA 4EZTA 1RVGA 1XPYA 2J9ZA 2ZVRA 4W86A 1B57A 3V0TA 2J74A 3AO0A 3GX9A 4LV4A 5EFDA 2GA9D 7CGTA 2E8YA 1BGAA 1VZWA 2J8FA 2XFYA 3VU2A 2PD9A 1U2YA 1KM3A 1U83A 3BSGA 1IV8A 1E40A 4XK2A 1HVQA 4EZXA 3F5LA 1DJQA 4KEVA 2CLPA 1X1NA 5C54A 1UC4A 4GQ0A 3STPA 3CIVA 3S1XA 3TIMA 3S5SA 3UCCA 5BXTA 4IXXA 1NAL1 1JXJA 2XYLA 4MY1A 4MADA 2P8CA 4L56A 1EL3A 4QNWA 2QVNA 4QLKA 5A6BA 1Z9AA 3KL0A 3VXGA 4S3BA 1TQTA 1L2UA 1JCXA 2E40A 4YVVA 1EJRC 3PNUA 4AB4A 4MHBA 2OSWA 2J66A 1GOMA 3MUY1 5AYIA 1GUVA 2QUVA 4NJIA 3W27A 3WNMA 1EPVA 3PBUA 4NHVA 4AYGA 3LCLA 1ECQA 3FVDA 4K68A 1VIWA 4GCAA 4JHOA 3T9PA 1ZP4A 1TCDA 3MMWA 1J11A 4WCJA 2GGHA 4P8UA 2ABBA 1CTNA 1F5ZA 1PVNA 2ASHA 2QJIA 1DWHM 3VDCA 1A3XA 3BSHA 1AQHA 4JYDA 4R85A 3AIRA 3CO8A 1WV2A 3WQ6A 1ZBCA 4P61A 4GQBA 4QM1A 2UY4A 3PZTA 1A3HA 4ZQNA 3DI1A 4C60A 3W81A 3IJDA 1JYVA 3QNJA 4WSKA 3W2KA 1D3HA 1US0A 1A4LA 4IH3A 3ZYZA 1VS1A 2D24A 4R7WA 1ZU8A 1RQBA 3UWYA 3MVIA 3ARVA 1FRBA 4HIBA 4JFSA 1VPYA 2WZIA 2VGIA 5A6TC 1OX4A 4HZ6A 1KFEA 2WBGA 2VDGA 3CKDA 4HNUA 3TW7A 1TIWA 1AA1B 8TIMA 3TJIA 1DJZA 1QO5A 3OODA 4DELA 3S2MA 4CNUA 1RA5A 4LUSB 1B31A 4ZOBA 3AWNA 3KBMA 4ADUA 1J0IA 3NPWA 2TYSA 1EP1A 1GVQA 2V30A 3UWZA 2INFA 1HKMA 2WM1A 4S39A 1TZZA 2WMKA 5M5DA 3H12A 4WF7A 4J3XA 1JF5A 1KGXA 4GHRA 3NQEA 2D3NA 4N9EA 3GB6A 1P6WA 1H0GA 2ZX5A 3WO8A 3NPXA 1J10A 3VMPA 4EAMA 1NM9A 1ZJIA 3O9NA 2HVOA 1D8WA 1UZ1A 1J93A 4PTWA 3WFAA 3OHMB 5IHRA 2I14A 3A5VA 4LOCA 3SADA 4ZQMA 4TOQA 4D6CA 2DZBA 4PMVA 3P82A 3U7VA 3PJTA 3W1LA 3DX5A 4UMCA 2QT3A 4EZOA 1FHVA 4NSWA 2J47A 1OABA 3ZT5A 2BXYA 3CJPA 2AL2A 4WGHA 3VNZA 2E6DA 2CW6A 1XLKA 1F4AA 4H04A 1B0IA 3GTIA 2WNNA 1M7JA 1G5AA 5I79A 3BG3A 2VFHA 3TCEA 1R7OA 3H7UA 3W02A 2E5BA 7ENLA 3AROA 3ALGA 3A6OA 3M64A 3BQ5A 5I3JA 4EPEC 4ZSUA 2XTKA 3G9GA 2FKPA 2GSHA 2EAWA 2L5HA 4EZUA 2X42A 3GS6A 2CWXA 5EMMA 1QT1A 2ALRA 3R0UA 2UY5A 4A3UA 4CNOA 1R3RA 1SUFA 1LORA 3O06A 1YXYA 4FXSA 1M7XA 4RV3A 3B8DA 2DEPA 1ODUA 3CUIA 2B0MA 4QGCA 2CZDA 1AZ1A 2WC3A 3MP5A 1LUCA 1ISVA 1SM9A 2VGGA 1PYMA 2HMCA 4MFDA 1RVKA 1MVYA 1RSCA 5GQBA 4AWSA 2FPTA 5F4SA 1AVAA 3EWCA 4ZXOA 2O55A 1EC7A 2O7QA 1QPRA 2RJGA 1IYXA 4JD4A 4EOUA 3AWOA 1N2VA 3M0LA 4UTMA 3O05A 3NAVA 1KCKA 2E1DA 1R9ZA 3MQTA 4FXJA 1I4NA 3W87A 3AUJA 1XR2A 1UPMB 4C6MA 4EZQA 2BLEA 2W61A 4KCWA 3LQLA 4QSHA 1YRRA 1Q7QA 2YCEA 1E6NA 1V03A 1BF6A 2XG9A 3C8FA 2DZWA 2VD9A 3RX4A 1BXNA 1SO6A 3IRSA 1CWYA 2OR2A 4LYKA 3PUEA 1UP0A 1GYMA 2FH8A 3ANUA 4JGDA 1R87A 4K1WA 4A2RA 5K7JA 1KBIA 3GZ3A 3BUIA 4H6KA 1SZGA 4U3AA 1LT7A 1UD2A 4M51A 3PBYA 1X1OA 3UZZA 2F7RA 2XSXA 3IGUA 6TIMA 1IZKA 3W3OA 4IPIA 4CKQA 1I60A 4Z1YA 4EIVA 3DFTA 2VEGA 1W1VA 1P0NA 2CZFA 1UWIA 1ZUAX 4AWUA 1GTHA 4OBTA 3WLRA 3UYIA 5D8WA 1BGGA 4LUIA 3HPXA 2RDWA 4CGTA 5BROA 1DIDA 4RZ6A 4YCOA 1SMAA 2F2KA 3AUOA 3JW7A 1S2CA 3O3NB 2IUZA 2ZXQA 3G8EA 4WY0A 2Z00A 2Z6IA 1YEYA 4D6EA 2OMAA 4P7OA 1JCMP 4F66A 1ZQ5A 3C5QA 4AAJA 1PZ2A 2EPOA 3CLWA 5CH9A 1HX0A 4S2CA 2DZTA 3BO9A 4KRTA 4HPHA 2QCDA 3RM9A 3ZLHA 2IW0A 3DI0A 5D04C 4JTGA 3UGVA 4EZRA 2MANA 3HA1A 2VEPA 4I7UA 5MHBA 3N19B 4UDXX 2FIQA 3ISIX 3UWEA 1XSIA 4O19A 1K8XA 1OFOA 1FKXA 3N4AA 4H7VA 2OLSA 4JQ3A 5BZAA 4PRRA 1LT8A 2QCMA 1TJPA 4GBUA 4RCXA 3ER8C 5ECVA 1X03A 3A4WA 4I9TA 1R7AA 4KWWA 4ZQOA 3EPNA 3EOUA 5HR7A 2X1IA 3LCWA 2GAFD 4CD4A 4XKYB 2AMGA 2DU2A 1V6UA 2DPEA 1W1IE 1DJYA 5T8GA 3ARRA 3OIHA 1QWKA 5CC6A 1GPWA 5CEWA 1PX4A 4JFTA 1K8YA 2NVCA 2E9LA 4F4RA 1FP8A 1YPIA 2UY3A 3P60A 3DUGA 1F74A 4PTDA 2ZA2A 4KCTA 1GOQA 5I00A 1R85A 1W17A 3S4TA 4L1WA 1PXGA 3QE6A 3O6DA 5FKYA 4V27A 2GVYA 1WKDA 1A5BA 3K46A 4HHPA 3GDRA 2X1UA 1VF8A 1SU7A 4IG2B 1XLAA 4DNHA 4ES4A 1ITXA 3O15A 4PH6A 4FHAA 4GX9A 3VYLA 3PWIA 3CEUA 1NTHA 3USZA 2DDXA 1Z8AA 1X39A 1S2TA 3QV7A 1XSJA 5CGQA 3RLVA 1T8QA 2QYGA 1WZMA 1MSSA 1V6YA 1DQXA 3GR4A 4MAVA 1OVDA 2VWTA 1PL9A 4LYPA 1KLZA 3WL0A 2H8ZA 2ALWA 4PMDA 3W37A 3PAOA 1PYFA 1Z48A 3FS2A 4HYRA 4F0KA 2D22A 3FYOA 3WUGA 3TYBA 1TTPA 3ZSSA 3WENA 1T5AA 2BODX 3ANYA 2GPTA 2ZZ4A 1B5TA 1ZJBA 3P93A 3PZGA 5G5IA 1EGZA 4PCFA 5CG7A 3QHOA 1EC9A 4L6OA 3GHUA 1E1FA 1E1CB 4FX7A 3ORWA 1TB3A 2VFIA 4FNPA 2BASA 3PPHA 1CXKA 3T2OA 3QXBA 4DWSB 4JYFA 1S38A 4FA3A 2PF8A 4GCXA 3T0TA 4F01A 3G1VA 4M8UA 2TSYA 3ME3A 3NO1A 3OVRA 1VH7A 4WOZA 5CPLA 2Z7KA 3KVMA 4XUGA 1JPMA 3W7RA 1XIHA 3UJRA 5CPSA 3W7MA 3LRKA 4GNVA 1SMDA 1V4YA 1EDGA 4QG6A 4I3GA 2Q3OA 3DDFA 1WZAA 4L1GA 4P7QA 3W83A 3RX2A 3RNDA 1VLIA 4BF9A 1OIFA 4J7RA 2VZTA 1UJPA 4I9JA 4LUSA 3QY8A 3M46A 1ECEA 4FNTA 3AMGA 3CHCA 3TKFA 4LNCA 4N0RA 4YTQA 4KFPA 3E0LA 4LCSA 4I7WA 4IIHA 1Q7MA 2Q13A 4GVGA 5A2AA 3AIEA 1EDQA 2G8ZA 2XHYA 1VFTA 2FPYA 3D50A 2FZ8A 3PF3A 2WNQA 1H7OA 1I8JA 5DMLA 3FLUA 3QV6A 4C6EA 3RPTA 5CPMA 3L5MA 1QNOA 3WK1A 4QEEA 1H0IA 1N55A 4D6DA 3WEOA 1OFBA 3VOFA 3CZGA 4BEQA 2CBJA 4YTTA 3NDYA 3GXIA 1OK4A 1B1YA 1R3QA 1NQ6A 4DY1A 3THUA 4IFKB 3DDGA 2G0WA 2HK1A 2YCKX 4PSPA 5H91A 1DIEA 1WO2A 1QOQA 4CNPA 3TWBA 3VEBA 3DU0A 2CLMA 3PFMA 3SIMA 4C6JA 5FSEC 4IQDA 1R6WA 4FF7A 3IIVA 3G1YA 3OZYA 3AC0A 2EG6A 3TV8A 2ZE3A 4QITA 2WZTA 3ARXA 1TV7A 2A6NA 4FAMA 2XM2A 2VX7A 1J79A 4PBEA 4LY8A 5HNRA 3NSMA </