2YL8A

Inhibition of the pneumococcal virulence factor strh and molecular insights into n-glycan recognition and hydrolysis
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
434
structure length
434
Chain Sequence
NEKLAKKKIVSIDAGRKYFSPEQLKEIIDKAKHYGYTDLHLLVGNDGLRFMLDDMSITANGKTYASDDVKRAIEKGTNDYYNDPNGNHLTESQMTDLINYAKDKGIGLIPTVNSPGHMDAILNAMKELGIQNPNFSYFGKKSARTVDLDNEQAVAFTKALIDKYAAYFAKKTEIFNIGLDQYANDATDAKGWSVLQADKYYPNEGYPVKGYEKFIAYANDLARIVKSHGLKPMAFNDGIYYNSDTSFGSFDKDIIVSMWTGGWGGYDVASSKLLAEKGHQILNTNDAWYYVLGRNADGQGWYNLDQGLNGIKNTPITSVPKTEGADIPIIGGMVAAWADTPSARYSPSRLFKLMRHFANANAEYFAADYESAEQALNEVPKDLNRYTAESVTAVKEAEKAIRSLDSNLSRAQQDTIDQAIAKLQETVNNLTLTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of the Pneumococcal Virulence Factor Strh and Molecular Insights Into N-Glycan Recognition and Hydrolysis.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
molecule keywords BETA-N-ACETYLHEXOSAMINIDASE
total genus 172
structure length 434
sequence length 434
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2011-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.90 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AF1782-like 2yl8A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2yl8A01
4P7OA 1SMDA 1BF2A 1F4HA 5EFFA 2XIIA 2XSAA 3WH8A 4BZYA 1NP0A 2CKSA 4GO9A 1XV8A 3B8SA 4IPLA 5A8QA 1E0XA 2YOCA 3UEQA 3ZT7A 5BYWA 5BXPA 2ZUMA 1V0LA 2BHZA 2PWFA 3UCQA 1CGWA 5CZKA 3MUAA 4UQAA 3MANA 3CZJA 3KE0A 1ESWA 1W2PA 2WK2A 3AS1A 2J47A 3N15A 3T2QA 3WF4A 3K8LA 1VRXA 2DT1A 4KMQA 2V38A 1UKSA 1JYXA 5CGMA 3VILA 3EMQA 3TTQA 2MANA 3GBEA 2X05A 3VD7A 4D6FA 4PTWA 4D6IA 5A6BA 1OD8A 1OCQA 5BXRA 1V0MA 5M3WA 3AIWA 4OKDA 4W5UA 2NW0A 1P6WA 3QR3A 1M03A 2VO5A 3MUZ1 4JFUA 2W61A 5KEZA 4OIFA 3LPOA 2J79A 5FOOA 2Y8KA 3W81A 4J27A 2GK1B 2ZWYA 4QLLA 4TTGA 1Q6FA 1W9PA 3WDRA 1B3VA 1G5AA 1TA3B 1UR8A 4P8UA 5I2UA 3VGFA 3AIUA 3W37A 1ISYA 1W9VA 1CLXA 2EBNA 2BXZA 2WCAA 3VIMA 3VDAA 5D4YA 6TAAA 1GHRA 4KH2A 3ZM8A 2VQUA 5TD4A 3AS2A 2Y24A 3NYDA 1JG9A 2C7FA 3VM7A 1NQ6A 1LWJA 4MNMA 3LMYA 1FA2A 2EO7A 3VMNA 4FF5A 4NRRA 5A95A 4GZJA 1QI4A 5ABGA 1M04A 3GH7A 5A8NA 3UR8A 4JL1A 3AIEA 1UWUA 4UFHA 5EB8A 1HKJA 2DH3A 4WKHA 1CTNA 4ZXLA 1CXFA 3VIGA 4ZE4A 2XFRA 1UOKA 3MSDA 1XD1A 3WDHA 1E43A 2VUYA 4UR9A 1UUQA 2DIEA 1HP5A 1V3MA 3W6LA 3WQ6A 3WNOA 1GZJA 1V02E 3VM5A 2VRQA 3W29A 1TZ7A 2J7GA 4S3KA 2W92A 4DWSB 3WD2A 1S46A 5IHSA 1W1TA 3SUTA 4X0NA 1E5NA 4PCSA 2EPLX 2WYSA 2BY2A 4NRSA 1NH6A 1E1FA 2J7EA 1V02A 2WHKA 4AD0A 1BYCA 2XWEA 2PC8A 1D3CA 4HMDA 2F2HA 2PB1A 2JEPA 3POCA 2X09A 4D1IA 2WMGA 3WBEA 1GUVA 3AXXA 3PZ9A 2ESCA 1ZS2A 4UFMA 1ZU8A 5AYBA 4F8XA 3CHDA 4PMZA 4KGLA 1RH9A 1NP2A 4CCCA 4NZCA 1BHGA 1V6WA 3UERA 3PTKA 3AMLA 2XFFA 4B15A 1R87A 1AMYA 2GDVA 1JXKA 4TVCA 1ZL1A 2WPGA 2D1ZA 1B90A 3VIFA 2D3NA 5AC5A 2F8QA 3GNRA 1QBBA 1X1NA 2VQTA 4HOWA 1UR4A 3W25A 1VIWA 4IPNB 4ACZB 4QLJA 2PWDA 1EHNA 5HDRA 1H0GA 3LPGA 2XHYA 3BAYA 4HMEA 3VGEA 5BWFA 3WENA 4U5IA 2JALA 1KQYA 3ZO9A 5KZ6A 3AIBA 3AZTA 1D2KA 5JIPA 1JZ3A 1UA3A 2D22A 4GO8A 4U3CA 4D6CA 4LGXA 1B3YA 4OOUA 1HKIA 3BSHA 1OWQA 1LL7A 4D6GA 1K9FA 1MXGA 1G01A 2VRJA 3GXFA 2BY0A 1HJQA 2Z1KA 3O2LA 3GYCA 3N13A 2YL5A 4AZ5A 1FP8A 2XVPA 3DYPA 1PIFA 1QVBA 3L4VA 5ABHA 5A6SA 3OLEA 1B2YA 2BVTA 2V5DA 1HX0A 1JZ2A 4XX6A 4UFJA 4CN1A 3FHQA 1TUXA 4QCFA 3WKZA 2FGZA 3OIHA 3BGAA 2PBOA 3D5HA 3WD4A 4HZ7A 4HA4A 1V0KA 3WH9A 3WDJA 1TVPA 3MSGA 3VGGA 1HJUA 1QHPA 3WD0A 2J74A 1UQYA 3K4DA 3VVGA 4Z2IA 1MYRA 3QGVA 1K9EA 1HN1A 1C92A 1UWIA 3QOKA 4DM1A 1TFVA 2D0FA 4HOXA 4HTYA 2BY3A 4AD1A 1E72M 3AIVA 4U3AA 1GVIA 2Y2WA 4HU0A 2ZX5A 1J0ZA 3WNPA 3WUGA 1SMAA 1VFUA 2CBJA 2FGLA 4ZFMA 2FHFA 3FW6A 4CN6A 1BGAA 4OOZA 2ZICA 3NSNA 2WBGA 1C8YA 6CGTA 5CSUA 3WD3A 3AQUA 1QNQA 5D8WA 1V6XA 2PMRA 2YIHA 2YLLA 1SYTA 1UWSA 4WLCA 4EK7A 3BMWA 2J7FA 4GI6A 1VENA 4PBGA 3BLPX 1ZB5A 3M6DA 5BRPA 2W62A 3FY1A 1PIGA 4BQ4A 2XVGA 2JNKA 1W2VA 4KGJA 3W82A 1GOKA 2XSBA 2PI6A 3G6LA 2CBUA 3ZR6A 4PTMA 2VRKA 4UZSA 4HZ6A 2OZNB 3U5UA 3M46A 4HA3A 4BA0A 4CU7A 5CXPA 1WAWA 2AOSA 4OBRA 4CD7A 3VDCA 4KRUA 1ISZA 2A3CA 4AZIA 4U2YA 7TAAA 2F61A 2WHJA 4C7GA 2YBTA 1G9HA 1OB0A 1JF6A 4U5KA 4J7RA 4AEEA 4LX4A 2CBVA 3IAQA 3AYRA 4B9YA 1VJSA 1CGTA 3MMUA 5LA0A 1K9DA 2WKLA 1GQJA 2WC7A 1VEOA 3W6MA 1WCGA 3AICA 2PBGA 4CVWA 3EDKA 4B3KA 5AYIA 1LLOA 4AZ6A 3W24A 2D3LA 3OGSA 1VJZA 1ODZA 1JYNA 1OSEA 1V6VA 3ARXA 3F5JA 3TTYA 3L4WA 2OYKA 3EMZA 3WSUA 1KXTA 2JFEX 4AD3A 3WQVA 4UFIA 5A2CA 1KBKA 3L4YA 3VX1A 4W8AA 3WF0A 1H49A 5HNNA 3K8MA 1JDAA 1J18A 2E0PA 3ARPA 4JHOA 4JKMA 5LA1A 1HXJA 3WL0A 3UR7A 3CUGA 3S6TA 1DWIM 1V3HA 2WZHA 3VIJA 4PSPA 1MVYA 4HZ8A 2WW5A 1NARA 1JD9A 1H41A 4QLKA 2X0HA 3SUVA 2Y8VA 3IANA 3CIVA 3RJXA 4OUEA 3AI0A 2WC4A 1E70M 1LL4A 3U5YA 2AAAA 1HKMA 1JXJA 3WF2A 1OGBA 3TOPA 4V28A 1B3ZA 1V3LA 3PTMA 4D6HA 3AHYA 1KGUA 1CBGA 2W66A 4LXFA 3CH9A 2CETA 4N0RA 3I3DA 3WEOA 3ARQA 4PN2A 3BLKA 3RM9A 2FHBA 3SUSA 6A3HA 2DQXA 1Q4NX 1B9ZA 3QHNA 4AIOA 1C93A 5HPOA 1CIUA 5BXSA 3QOMA 3SURA 3BSGA 1VFOA 4HPHA 3OB8A 3OGRA 3GXMA 1VBRA 4W89A 3L4TA 2V5CA 3WNLA 2PF0A 1PX3A 5A6MA 1R8LA 1TE1A 2E9BA 4P7NA 3NCOA 1UWTA 4M24A 2DSWA 1W32A 1BLIA 1DWFM 2WVSA 3W53A 5GQBA 1WDPA 5GNXA 2J7HA 1O6IA 1JZ7A 3PZOA 1CPUA 1MFUA 2EPOA 1Q6CA 4B3LA 2CITA 1ZBKA 3A3HA 4EAMA 2BHYA 2E9MA 2DIJA 2FH6A 2HISA 4W85A 3AFBA 2WLZA 1UKPA 2GFTA 4RE3A 1LF1A 1R86A 2O9TA 2CKRA 3WFZA 3WIJA 2VVNA 2ZXAA 1E40A 1HL9A 2WMHA 3MUY1 1E0WA 2VZUA 2QV4A 2WMIB 4Z2JA 4MADA 1EXPA 3VX0A 1UR9A 3WL1A 3CPUA 1HVXA 1B3XA 3ZIZA 3CHFA 1HKKA 3NDZA 1JGIA 3RIKA 1W9UA 3ZQ9A 3BAKA 1XSKA 2JIWA 4FLOA 3RCNA 3VD4A 4LYPA 1PEZA 1PAMA 1EO7A 4F9JA 2CNCA 2J7DA 3VOCA 1LQ0A 1E73M 3VD3A 3F4VA 3KEHA 3WNNA 1VF8A 4CVUA 3EDFA 4PCTA 2ZUVA 1E6NA 2GSJA 2OLHA 5LA2A 1W9XA 2ZX8A 1GHSA 1GQKA 1LG2A 3N11A 4JL2A 3WH5A 2G3NA 3GH5A 2QMJA 3ARVA 2WVVA 1XH2A 1J0IA 5FL1A 2VT0A 1M53A 4CCEA 3MKKA 4BF7A 3BCDA 5AY7A 2PWHA 4P8WA 2D2OA 1UKOA 1DHKA 3SEPA 4V27A 3L2LA 5HOSA 3PHAA 5FCZA 3AJ7A 1F4AA 1KGXA 4W84A 1AQ0A 1MXDA 4A3YA 1JDDA 3VMPA 3MU7A 2XG9A 4D1JA 1TVNA 3II1A 1KB3A 1G1YA 1WE5A 3ZSSA 2J4GA 3GH4A 1G94A 3RJYA 2E4TA 1WB0A 2ZUSA 3PZMA 1B31A 1FH8A 4PMXA 4W88A 2BVDA 2UY4A 3L4XA 3OLIA 2WXDM 1GOWA 4W8LA 3CUIA 1UZ4A 2CYGA 2E8ZA 3CBWA 4ZE5A 3ZT6A 2WCSA 4HA1A 3THCA 3IJ8A 3S2CA 5JBFA 4EE9A 1HJVA 1UD4A 1WZKA 5A8PA 1HJWA 2VOTA 5FL0A 2XTKA 1EIBA 2RGLA 3SUUA 4BQ2A 4F9DA 2WMJA 4DWSC 1XHGA 1U30A 2DSVA 1JDCA 2EEXA 3CZ8A 4R27A 2J25A 5CGTA 2W67A 1KWGA 1E6QM 3AHTA 4DUWA 2GJXB 1KXQA 1QNOA 1CDGA 1XCXA 1JFXA 2ZXQA 1H2JA 1XYFA 5E0FA 3O6AA 2DT0A 5CPQA 5FD0A 4AD5A 3SUWA 1J10A 3WQ8A 3VU2A 2YDSA 1M7XA 2ZOXA 1ITCA 4TTUA 2BNJA 3CMGA 4IUGA 1GORA 1BTCA 4L4OA 4E8DA 3EDJA 3VO0A 3ZT5A 2WLYA 2O92A 2VI0A 4FLRA 2QPSA 1OBAA 4AISA 4PMRA 2VZVA 4JZ5A 2OSWA 4LYQA 3WY1A 1YHTA 3WMSA 5A6BD 5BCAA 5IXEA 1KR0A 1TA3A 1UWQA 1JZ4A 4U33A 5BROA 1SR0A 3OGVA 5IDIA 4MJ2A 1OM0A 4AW7A 3NUKA 3L4UA 1HJSA 4W87A 3OZPA 4CGTA 1OGGA 1GJWA 5M5DA 1BPLB 1V3IA 3FN9A 1M01A 4GINA 2A3AA 1E9LA 1GONA 3WNMA 3I3BA 4OBSA 3WH6A 4AD4A 1LWHA 5E6ZA 3RILA 2J7BA 4Q22A 3W0KA 1BYAA 5I0DA 3B9AA 4Y7EA 2FDMA 1LL6A 3CMJA 1JAKA 3WQWA 4MB3A 2J7CA 4ZENA 2EXOA 3ARUA 2VR5A 3OZOA 5IFTA 1FHDA 1IZKA 1VEMA 3OLGA 2BY1A 3RPMA 2CBIA 2XWDA 2YA1A 4XB3A 1R7AA 1OT2A 3ALFA 4UFLA 1MQPA 4D72A 2XUCA 4IISA 4AZBA 2VZOA 3IK2A 1JL8A 1PX4A 1XH0A 4Z2GA 1VAHA 1US2A 2WBKA 3ZJ8A 1V0NA 1CWYA 3AXIA 3B9EA 1ODUA 1MWOA 2ZUWA 1V3JA 1PJ9A 1AQMA 2ZE0A 1E6PA 2WWCA 4P7RA 1FFQA 1AVAA 4ATLA 3EDDA 2DSKA 1V08A 5E6YA 2XVKA 5HXMA 1XRVA 4PMDA 1KCKA 3TTSA 1C7SA 1LG1A 3VD9A 1JIBA 4J3UA 1EO5A 1GVYA 4CUCA 1C8QA 5I77A 3SCRA 3AHZA 3CHCA 2ZXDA 1FHLA 2G3IA 5AC4A 1L8NA 1VEPA 4YHGA 1O7AA 3VKKA 4UQBA 7A3HA 1CXLA 1BYDA 1Z32X 2NT0A 1U2YA 8CGTA 5CQ1A 5JUVA 4M82A 1CGXA 4EKJA 1W1PA 2WZEA 1BFNA 1GQLA 1UZ1A 3LPFA 5CPTA 1W1YA 4C7DA 3SCVA 3N1AA 1BVZA 2WM0A 1ISXA 1QPKA 2AMGA 2DH2A 1US3A 4FLSA 4EANA 5F7UA 5D9NA 1SFSA 1NWTA 4MDOA 2W5FA 2CHOA 3FXYA 3MO4A 1E55A 2ZIDA 4WKFA 1B3WA 2VURA 2X2YA 4FK9A 3WF1A 2YDQA 4MTVA 2WSPA 4CN4A 1L0PA 3ARSA 3VNZA 1HP4A 1XGZA 2VL4A 1EOKA 3AISA 5A6LA 3PTQA 5E0CA 4GXPA 1HVQA 3KZSA 4YPJA 2PWEA 3N17A 5A2AA 3VIPA 2ZX6A 2FH8A 3VIKA 2WKGA 2J8FA 2XPKA 1QOXA 4H7VA 3K8KA 3BAIA 5D9MA 3CZLA 2V3FA 4H8VA 2VMFA 1FOBA 4LPCA 1HF6A 1BQCA 4RE2A 5DT7A 4H41A 2J62A 1KCLA 1JNEA 1H3GA 1I1XA 1ZJAA 2A3EA 1GCYA 3DYOA 1CXIA 1DP0A 2V3EA 4H04A 4NF7A 4DWSD 1PX8A 3AMDA 2BXYA 2ZUNA 2YKKA 5HPCA 4CD5A 4GPNA 1GW1A 3SCSA 4GI8A 1HL8A 3VMOA 1I75A 2WAGA 2CERA 4HP5A 1V6UA 1JYVA 2ZUUA 3HN3A 3T0DA 1E5JA 3POHA 5I78A 4H8UA 4F66A 2YL9A 2NT1A 1E6XM 5CLTA 3J7HA 1NOUA 2O9PA 3GDBA 4YN5A 5DF0A 3BAJA 2CESA 4M80A 2OYMA 2OO2A 1N82A 4FZOA 2CEQA 4J3XA 4OZOA 5ABFA 2JF6A 2WB5A 1XH1A 1DTUA 3WH7A 5A1AA 1Q6GA 1ISWA 4RE4A 2DDXA 3SCQA 1KBBA 2QHAA 3AXHA 3SCTA 4PMNA 1KXVA 4HU8A 3KL0A 1V3KA 4PMUA 3VUPA 1C90A 2GJPA 3WD1A 4U31A 3HJEA 1RP8A 1ZBCA 4QP0A 1E15A 1HT6A 4ATWA 3WMBA 3WBAA 4M81A 4BQ3A 2GDUA 3UG3A 3NIYA 3NJ3A 3W28A 2VJXA 3THDA 2Z1SA 2UY3A 4PUEA 4Z2LA 4A4AA 3U7VA 3ALGA 1QI2A 1V03A 1ZBVA 4UQ9A 1E4IA 5JBDA 4TOQA 5ABFB 3W26A 1OIFA 1B1YA 4AZGA 1Y7VA 1QI3A 3EMCA 2V3GA 2V3DA 1YQ2A 3VIHA 3GTNA 3DHUA 1JAEA 1WP6A 4TVUA 2VZTA 1CGUA 4BCEA 1KFWA 5ABEA 5E70A 1C8XA 3ARWA 3WUBA 3VGDA 3WNKA 3ZJ6A 1QW8A 1CXKA 3T0AA 1IT0A 1MW2A 1QBAA 1WDQA 3AIQA 4L4PA 4JIEA 2WNWA 1BG4A 2XVLA 4UOZA 4UNIA 4UQCA 4HPGA 2WWDA 2OYLA 2XYLA 4JFSA 4FZPA 3AYSA 4JKLA 2O9OA 4AIUA 2TAAA 2X0YA 1DWHM 2VTFA 3AHVA 4W93A 4UZUA 2VCBA 1C7TA 4ML4A 4TX8A 3WEZA 2VCCA 4BQ5A 4AXNA 1E4NA 1C91A 7CGTA 1PZ3A 4P8VA 1LJYA 3JUGA 1MFVA 1UA7A 3FHAA 2WMKA 5EFDA 1BAGA 4AC1X 4MDPA 2O9RA 1RD6A 1PZ2A 4MJ4A 5DT5A 5I6SA 5DO8A 1W9DM 1H09A 5IHRA 4JCLA 2YBUA 2CPUA 3N04A 4MNJA 5IFPA 4W7UA 3T0BA 1JI2A 2VX7A 3DHPA 2HVMA 4CD6A 3VD5A 3VIIA 2VZSA 4ATDA 3N18A 2YA0A 1EQCA 4ZXOA 2ZX7A 3QHOA 1PPIA 4DUXA 2GK1A 2XM2A 3AS0A 4WK9A 4DM2A 1E4MM 3CZKA 4PYSA 4V2XA 4CCDA 1CNVA 2ZXBA 3T2OA 3WELA 2BV9A 2OWXA 4MB1A 1UHVA 2E40A 4PEEA 4CU8A 1EA9C 4DWSA 3A47A 1J01A 4BS0A 1E3XA 5GPRA 3PZIA 3CZEA 2J75A 3BAWA 1DWAM 2DPEA 3PZQA 1UYQA 4OJYA 3GBDA 3VNYA 1EDQA 1W3LA 1X6NA 3ARRA 2ZUTA 2DT3A 4UCFA 1X6LA 4UTFA 5FKYA 3DYMA 1FH7A 1CENA 4H8HA 5EBAA 2EJ1A 2IXVA 4UQEA 4LQ1A 2E8YA 1FFRA 2CHNA 4QFUA 2A3BA 1NWRA 2G4FA 4UFKA 1OIMA 2RGMA 2VC9A 4FLQA 5D8ZA 4AZ7A 5A6KA 1WO2A 1TR1A 5I3DA 4C7FA 3HMCA 3N12A 1MW1A 4MB5A 2D0GA 3SCNA 2OSXA 3AMCA 1FP9A 3ZMRA 3WMCA 2YJQA 3VINA 3M7SA 4ACYA 4AMCA 1W9BM 3DC0A 1CYGA 1WPCA 3FNDA 5A69A 3RM8A 4M1RA 1MQQA 4X0VA 1FH9A 1XSJA 4PMQA 2W63A 3GZAA 3KL5A 3DECA 1QNSA 4TX6A 1EDTA 1BYBA 4TUFA 5CLWA 3PZVA 1KQZA 4J3WA 1MW0A 2IXUA 2EPNA 3OLDA 4PTXA 4RL3A 1JNDA 1Q6DA 3CLWA 3SCPA 5BXTA 3VIOA 2CIPA 3A4AA 1E4LA 4NI3A 4E8CA 4AZCB 3N9KA 1JYWA 3IAPA 4AYSA 1W3KA 4R5EA 1J0KA 1UQZA 1W1VA 4JKKA 4CKQA 1W3HA 4CD8A 2J77A 3ARYA 3F5KA 4UOQA 2YA2A 4N42A 3WEMA 2WVVB 1K9TA 3NDYA 3M07A 3T2PA 2PWGA 3PZGA 2WHLA 3ZOAA 3K46A 4WSJA 3AMKA 2ZX9A 3OG2A 4WSKA 3ZJ7A 1D7FA 2VNCA 3ARTA 5DEZA 2WHMA 4CD4A 1IZJA 3RMEA 2WVTA 4M29A 1OD0A 4QDMA 1W3JA 4W8BA 1XSIA 3PZUA 4MB4A 1NOFA 2BVYA 5A2BA 2GJXA 3NSXA 3U7BA 2B31A 2YLAA 4UQDA 1JZ8A 5I23A 1A3HA 4JFTA 4MPKA 1UH2A 1I1WA 4W5ZA 1MW3A 1VB9A 2QF8A 3BMVA 2NSXA 4MNKA 2D0HA 1RP9A 3UETA 1MQRA 2W4XA 4P8XA 5A8OA 1ISVA 1VFFA 2GVYA 1QI5A 2Y5EA 4PRWA 3W27A 3T09A 4HOZA 3AMGA 3OA5A 1OT1A 1ZBWA 3TONA 4TXEA 2UY5A 3PN8A 3MV01 3GNOA 1GPFA 2WANA 2QLYA 2XGBA 3CHEA 1NOWA 4AY1A 4QAWA 3CUJA 4GI9A 1GJUA 3WUFA 3AIRA 2QMKA 4GZEA 1UH4A 1NM9A 3L4ZA 5A6AA 1GOQA 3ZSTA 5A6JA 3UG5A 1KR1A 3PZTA 2G41A 3EYPA 5CJ5A 1WDRA 1E0VA 2WSKA 1ECEA 1E6RA 2JIEA 2Q8XA 2BFGA 3MMWA 2YL6A 5A8MA 4DUVA 5C8BB 3CUFA 1A47A 4XUYA 1JI1A 4U2ZA 5E9AA 1KWKA 4TVDA 4J28A 4GQRA 1J0YA 3WN6A 3HU7A 4IM4A 1ZJBA 5ECUA 2OWCA 4JFVA 1ITXA 4PSRA 2IUZA 2JF7A 5BRQA 1H0IA 1CXHA 3AROA 2A3HA 2EQDA 5EMYA 4M56A 1CXEA 2VX4A 3K4AA 4H2CA 4JFWA 3GNPA 5HBFA 2VVSA 1TG7A 4E2OA 2X8RA 3AHXA 1H1NA 5I24A 3SCUA 1HNYA 1GNXA 1J0HA 3BCFA 3I3EA 4AIEA 5DMYA 3VGHA 2D23A 2D20A 2Y4SA 3VTRA 1EOMA 4D6EA 1HJXA 3BC9A 1UKTA 4S3JA 1RPKA 2C0HA 2J8GA 5C71A 1E56A 1E6SM 1HIZA 1OINA 2VX5A 3GXDA 1CECA 2DT2A 4W86A 3RM4A 3KL3A 1CEOA 3VDHA 4KRTA 1U33A 1WZLA 1AQHA 1GOIA 4PTVA 3MV11 4ZEPA 1UKQA 3T08A 1WDSA 4A3HA 3O9NA 3W38A 2UWFA 1W91A 3FAXA 5GNZA 3IJ9A 3AZSA 2JEQA 3WF3A 1EGZA 2DEPA 3A6OA 4UOJA 3SCWA 3D3AA 3VPLA 3E1F1 2DSUA 1B30A 2YDRA 2XIBA 1XC6A 1TCMA 5CPSA 1H4PA 3L2MA 2CXGA 1DEDA 2XGIA 4JCMA 5C70A 1E3ZA 4CU6A 1QW9A 5A3HA 1E6ZA 4B16A 5CG0A 1J0JA 3BH4A 1GOMA 2G3JA 4J3SA 3CO4A 2ZWZA 1C3FA 1VFMA 5GNYA 3VGBA 4AD2A 3UESA 4D6DA 5JIWA 1UD5A 2C8NA 4GKLA 2W91A 2J78A 2XM1A 2CCRA 3U57A 1WKYA 3FAWA 4XZBA 4FMVA 3PBGA 3ZJKA 2VR4A 1VBUA 1DWJM 1E1EA 1BG9A 1CZ1A 4PUDA 4E4PA 2GJRA 4PMOA 2EPMX 4GIAA 1BSIA 5E09A 4D6JA 9CGTA 1BVNP 3WQ5A 1KGWA 4F79A 4WIWA 3RO8A 1UG6A 1Q6EA 1UD8A 2GUYA 4J3VA 1KXHA 3IJ7A 1UD3A 3UG4A 3WUEA 1XCWA 3PZNA 2WMFA 3WFLA 4AWEA 3GXIA 1DWGM 4ACZA 1EH9A 1K6AA 2VCAA 2XJ7A 1R85A 4PMYA 2OWWA 1UR2A 3ECQA 4GQQA 2BHUA 4WJXA 3AOFA 1QHOA 1CGVA 3WDQA 1QNPA 2DSZA 3RDKA 4HMCA 3A4XA 2QPUA 1UR1A 4MNLA 1UWRA 3MS8A 4PMVA 2WZIA 3WQ4A 2XVNA 3CTTA 2BS9A 1H5VA 4YHEA 4QCEA 1EQPA 2G3MA 3BXWA 1JF5A 4WKAA 4W7WA 3G6MA 1NWUA 8A3HA 4WF7A 1JD7A 1J12A 4J3TA 1G0CA 1QNRA 5M03A 3TP4A 1R7OA 4KWUA 3K1DA 4K68A 1GOOA 2D24A 4LYRA 3MMDA 1XD0A 5D9PA 3QHMA 3TA9A 1H11A 2E3ZA 3SCOA 4Q7NA 1XYZA 1E71M 4JAWA 2G8ZA 3APGA 1UR0A 1V6YA 1NWSA 3TTOA 5DFAA 2UY2A 4B9ZA 3WDIA 1UH3A 3GM8A 5M17A 1JZ6A 3AS3A 3VDBA 1BGGA 1TMQA 2E9LA 3EDEA 4X9YA 4NSBA 5A94A 5I5RA 4AZCA 3KWXA 3BAXA 3MUIA 4D71A 3ZR5A 2EPKX 1UD6A 1JZ5A 5CSYA 3B9DA 2XFYA 2X1IA 2WVUA 5JBEA 1CLVA 3A4WA 3W4RA 1PBGA 1CGYA 4MAZA 4AEFA 4XV0A 4P7QA 2WMIA 2DGAA 1EDGA 5FIPA 3SIMA 2WC3A 4Z2KA 4XZWA 3CZGA 5I79A 3OBAA 2VX6A 1OGSA 1UD2A 3WDPP 4GZIA 3F5LA 4Z2HA 5D9OA 4JHZA 1WNOA 1JFHA 3NSMA 4W7VA 2JE8A 3CGTA 2FHCA 1WZAA 5LYRA 4M8UA 1IV8A 3ARZA 1QI0A 2WCGA 3CUHA 1J11A 1QHZA 1EHAA 1GQIA 1B0IA 4URIA 3EBVA 3LPPA 2OSYA 1J9YA 3AZRA 4P7LA 2YL8A 4AZHA 1WZMA 4MAVA
chains in the Genus database with same CATH superfamily
1BTMA 4P7OA 1SMDA 4CCZA 1F4HA 2Q3RA 4ILSA 3TW7A 3A9BA 2B81A 3SRDA 4GO9A 5A8QA 4FA3A 1E0XA 3UEQA 1P0EA 3TSDA 2BHZA 1TIMA 5CZ0A 1BXCA 1LQ2A 1ESWA 4XZHA 2J47A 3T2QA 1I2RA 2FJUB 3KAOA 4JN7A 4LOCA 3DH7A 3TLLA 3M7WA 3NXFA 4C90A 4H1ZA 1R34A 4F2UA 5CGMA 4Y9OA 3VILA 3TTQA 3CV7A 3CEUA 3P5YA 1FKXA 1NY1A 4L56A 2DZUA 2HJPA 3LV6A 5A6BA 3G77A 5D04C 3AIWA 3F4NA 4PULA 1P6WA 1KBLA 3GR4A 1PKYA 3MUZ1 5KITA 3DGRA 3LA4A 2I7GA 3LPOA 5BWAA 4J27A 4PRRA 4H6RA 1YXYA 1S5WA 3G1FA 3QZAA 2ZZ7A 4YYFA 5I2UA 3AIUA 4Q32A 1ISYA 1W9VA 4N4QA 2EBNA 4NJHA 1XLAA 2BXZA 2WCAA 2DU2A 3PPGA 3JR2A 1EJXC 1KRAC 2L5HA 1XLHA 3CB8A 1JCJA 1EUNA 3VM7A 1NQ6A 4L6HA 1FWDC 3R0UA 4CLMA 3LMYA 2EO7A 4IW0A 5F4WA 2JKEA 4FF5A 3W2UA 4CNTA 2QT3A 1W0MA 5G5IA 3GH7A 3BLDA 3UR8A 3BUPA 3ITVA 5CBJA 2V30A 5EU9A 4LUSA 3OTRA 4YCPA 4WKHA 4ZXLA 1CXFA 2WSYA 1UOKA 4BNEA 5I3JA 2VUYA 4UR9A 4Y6GA 3DPOA 4UUIA 3LLDA 3WK3A 3DDGA 4LWWA 1GZJA 1ITUA 4MF4A 3W29A 1VCGA 2W92A 4DWSB 3QVQA 3KCJA 3SUTA 1F9CA 3WX7A 4LV4A 1E5NA 1FWCC 3ZVHA 1O12A 2GUUA 4GGHA 5AHNA 4F3HA 3ITGA 1XIHA 2WHKA 3LEPA 2DZVA 3P7YA 5DX7A 5B7YA 1D3CA 1OCNA 1JPHA 4LAUA 1XLCA 4EP8C 3MYPA 1PS9A 3MP5A 3D0CA 4QJ3B 3ELFA 3LRLA 2LXYA 1XQLA 3UVAA 3SI9A 4G6CA 1A5UA 3MUCA 3APYA 5AYBA 3T05A 1TPUA 2YXXA 2ISVA 4PTDA 3AXMA 3KRSA 4CCCA 3LMFA 1BHGA 4ADUA 1SVDA 1TV3A 2IMRA 4XKYA 2X41A 2VEKA 4B15A 4LF2A 3MCMA 1AMYA 2ZZ5A 4YU1A 2FKPA 3HFTA 1G4PA 4QJ5B 4TIMA 3WMLA 5AC5A 4GMEA 1QBBA 2VQTA 4JLCA 1JULA 3GG0A 1Q7QA 2V8ZA 4IPNB 3DI0A 1V93A 3TIMA 3KTSA 3EWCA 1H0GA 3U48A 1I60A 3KP1A 5BWFA 4U5IA 4IFKB 1KQYA 4QG9A 4HNCA 3AIBA 1K70A 1D2KA 1MUMA 4GO8A 4I5UA 4AWUA 5JVLA 3BSHA 2PGFA 2B0MA 4GYPC 3WLQA 2NQHA 4A2SA 4JEQA 3VKHA 1OWQA 4JD4A 4D6GA 3H54A 5A5WA 4EZYA 2C08A 1GNLA 1Q85A 3TN5A 4JDBA 3GYCA 1VHCA 3R0KA 1AK5A 5ECVA 2Z24A 3HJZA 3XISA 4GJ1A 4WRHA 4RNIA 4UFJA 2YIBA 3FHQA 4CQ9A 3GIQA 3ABSA 3BGAA 3UWYA 3D5HA 1TELA 5DRCA 5FEPA 1JPMA 1E9ZB 1XBVA 3V0UA 5HMEA 3GDKA 3HV9A 2BB0A 5TKYA 1XUUA 4HNOA 4QEHA 3O07A 4IMCA 4DX3A 3MSGA 2QUVA 1QHPA 3VGGA 5A6TC 2J74A 4H8NA 1UQYA 3K4DA 1UROA 3UA4A 4IIGA 1MYRA 2P5NA 1K9EA 4AWSA 1H7NA 5MHBA 4KPLA 2G5WA 4GI4A 4I3GA 3TOYA 2D0FA 3IPWA 4HTYA 1XLDA 2BY3A 5D2WA 3TWAA 2C71A 3AIVA 3RV1A 1J0ZA 2GVLA 3VOIA 1SMAA 1VFUA 2CBJA 3T47A 2RDXA 2H9AB 4JTHA 3E0FA 1SO3A 4NX5A 2AQWA 4O1FA 2WBGA 2ZA1A 4EACA 4JIQA 1SYTA 4WLCA 4XBJA 4KIKA 3RITA 3B0XA 1EC9A 2PDJA 3M6DA 4ZVJA 3VA8A 1W2VA 3MCOA 3DX5A 2EKCA 4GA8A 2HK0A 5FJPA 4JTCA 4XAYA 2DIKA 4O10A 3CAZA 2VRKA 4FX8A 2E1WA 1TIWA 2PU1A 2OZNB 3U5UA 4BA0A 4CU7A 2WQPA 4EZTA 3V36A 3L5MA 2YW3A 1WAWA 4O50A 1XG3A 4CD7A 4U2YA 4Q8NA 2F61A 2HTMA 2YBTA 1G9HA 1OB0A 5KZDA 5H8MA 1DYSA 4J7RA 4GNKB 2JGYA 1GQNA 4LX4A 5AKQA 3UVIA 1K9DA 4HSOA 3DPQA 1NIUA 4Y9MA 1D9EA 1BKHA 1PIIA 1VEOA 1KCXA 3W6MA 1G4EA 4JTSA 4RUBA 3UZWA 4AZ6A 3W24A 2D3LA 3OGSA 4AEOA 3P0XA 3LG3A 1ZNNA 4B92A 3R10A 3V18A 2OYKA 4EX4A 4EZZA 3WSUA 4ZFCA 3WQVA 4I7VA 4HSNA 3MHFA 5M2FX 3WF0A 3R7MA 1FUYA 1TPB1 3UGRA 4PUMA 3VKCA 1GKPA 3UXIA 2Z1VA 2ZRZA 3NZQA 3MI3A 1ZTVA 3DFQA 2WW5A 3SUVA 4QLKA 2X0HA 2Y8VA 3IANA 1ZJIA 3HMJG 1VS1A 1A53A 3CIVA 1P0DA 4OUEA 4IQJA 2E6DA 1LL4A 4H00A 4J40A 1OGBA 3TOPA 4V28A 1B3ZA 2WQDA 3EGJA 1KGUA 1KFKA 4HPJA 1DPMA 4D8AA 4N0RA 1TE6A 3BGGA 3TYUA 3XIMA 3SQSA 3IIXA 2C16A 6A3HA 1C93A 5D33A 3L21A 5HPOA 3G5EA 2PP1A 4Y9AA 5BXSA 3MSYA 1TJ2A 3IGHX 1Y5XA 3BSGA 3GIYA 1I45A 3WQFA 3E12A 3WNLA 2PF0A 5LSMA 3NCOA 1UWTA 2VEIA 5F2GA 1R2TA 3W53A 5GQBA 5GNXA 3TH6A 1I2QA 3CC1A 3ABQA 2EPOA 1QRQA 1Q6CA 5DLCA 4B3LA 2CITA 2NX1A 1ZBKA 1UMLA 3WZ0E 2V82A 2HISA 5SWUA 3PWGA 1UKPA 1TQVA 2GFTA 4RE3A 2O9TA 4AWTA 2ZXAA 2XN0A 2PODA 4LYKA 2VZUA 4Z2JA 2PD9A 2WPBA 1EC8A 1UR9A 3WL1A 4C6FA 1HVXA 2YFOA 4DZ5A 2PFHA 4OUIA 1JGIA 1W9UA 2Z6JA 3MC5A 4O1BA 3VUSA 3UXLA 1XSKA 1OYBA 1WKEA 2JIWA 4FLOA 3KTXA 4EWND 4PUWA 2OB3A 4XO6A 1EO7A 1NF7A 1ZP3A 2CNCA 3BLOA 3ABHA 3VOCA 1LQ0A 2D1LA 1TPWA 4IJCA 3VD3A 2GUBA 2EJAA 5G4EA 2OLHA 3DENA 3M0JA 1W9XA 1GHSA 1GQKA 1LG2A 1LRNA 4JQ3A 3N11A 5C9ZA 3B06A 5LHEA 3ME3A 2WVVA 1WBJA 3H22A 4C6OA 3MKKA 1PSCA 3GU2A 2AGKA 2AGTA 3MWCA 3SEPA 4Z0SA 1BVWA 3SZ8A 2HNEA 5FCZA 2TRSA 4WHBA 1VCVA 3BJFA 1AQ0A 3S46A 1MXDA 1GT8A 4A3YA 4IJBA 3VMPA 3E3HA 3PPHA 3QA8A 1TVNA 3II1A 2F7OA 3RRXA 2GGEA 1OG0A 1IIHA 2J4GA 4O19A 3AUJA 1G94A 2E4TA 4MWAE 3ZFHA 4PMXA 4W88A 3QLLA 4OQVA 3F2CA 2ELBA 2WXDM 1E51A 2DVXA 2V68A 4W8LA 2BMBA 4ZE5A 1TTJA 4KFOA 3FIGA 4S3CA 5FL0A 3ES7A 4C6IA 2OO6A 5IM51 2V6AA 2Z25A 3SUUA 3P67A 4BQ2A 1XUZA 3GNXA 3H12A 4O8RA 4QQ3A 3AUOA 2PDBA 3TQVA 4US6A 4KRZA 4O1AA 2J25A 1TQTA 1E6QM 3AHTA 1DXEA 3ITTA 1Q7ZA 4YL2A 1H2JA 2NQLA 3H2AA 3EOSA 3GW3A 4IF2A 1J10A 3KOYA 3WQ8A 1S2CA 3VXGA 2FYVA 1I4TA 1OAOA 4Y8FA 1Z6KA 2NLIA 4XAPA 3QC0A 2BNJA 3CMGA 3SRKA 4ZSTA 4GABA 3S5OA 4L4OA 3WQPA 4E8DA 4FOKA 4ML9A 4WJ8A 2DP3A 3ZT5A 5EY5A 2Q71A 3P2VA 2OSWA 5IOBA 5DANA 1QFEA 1GVSA 4NQIA 3BVWA 1KR0A 1TA3A 1JZ4A 1EP3A 1B9BA 1JJKA 4U33A 4PC8A 2FDSA 1X98A 5IDIA 1OM0A 2TMDA 3NUKA 1K03A 4TQTA 1ONRA 1OGGA 4L65A 5CKSA 1QMLA 1V3IA 3W6YA 1S5MA 4F01A 4DJDD 2HPIA 1F6KA 1YXCA 4OBSA 4AD4A 1AL7A 1M3UA 3BG3A 5I06A 2RDTA 1UBPC 3NO3A 3B9AA 1V5XA 3GE7A 2CZVA 3W74A 2PRMA 4HB7A 2IPGA 5LKYA 4MB3A 4K38A 2VWTA 4C6MA 3V0TA 3HIJA 2VR5A 4ZZ9A 1XICA 1EJUC 4YWSA 2OEMA 2JQXA 2PZNA 3HF3A 1KRMA 3LBMA 3C2OA 4P2VA 3MHGA 1TPFA 3PAOA 1SO4A 3S5SA 1XI3A 2FZ8A 4OVXA 4UFLA 1JUEA 4IP5A 4GE8A 4NUWA 3CNYA 3C8NA 1W3IA 1JCMP 4AZBA 1ECQA 3FA5A 4S38A 4NKCA 3LB0A 1US2A 1FVPA 3BUDA 1V0NA 4DO7A 3AXIA 3B9EA 3L12A 2FVKA 1QAPA 2RDWA 1TTPA 1IXNA 4G9PA 3WG6A 1AQMA 2ASHA 3W2MA 5DMNA 1RK6A 3NZ1A 1AVAA 2BGNE 2DJXA 3QEZA 3HPXA 4S3BA 4H2HA 3W84A 1XLBA 3HO8A 2ND1A 1A5BA 1EWEA 3B9NA 1EB3A 1PKLA 3FJ6A 5AZ0A 2Q09A 3SRFA 3SN1A 1EBHA 3T46A 1GVYA 3SCRA 4U4MA 2WNZA 3F7WA 1AA1B 3O15A 5CQ1A 1BWVA 4PMJA 3WLSA 4M82A 4R33A 1W1PA 1EYWA 3P3BA 2WZEA 5LIXX 1BFNA 1UZ1A 1FWTA 3FCPA 1W1YA 5AC7A 1TVLA 4RX0A 5D30A 1BVZA 9XIMA 2AMGA 1D8WA 1JCTA 3CVRA 3C0QA 1A4LA 2PRLA 4HJFA 1WUEA 3QR1A 4XSMA 1POJA 2CHOA 3FXYA 2ZIDA 4WKFA 1CW2A 4ZTYA 1UOZA 4I90A 4MTVA 3TC3A 3E6EA 3G3MA 1S5TA 3M47A 4BK9A 3PK7A 4GUFA 1GWJA 4N9EA 4EF9A 2VL4A 4PBEA 2BVWA 3AWOA 3KZSA 4YPJA 1DORA 2E25A 2EHHA 3VIPA 2FH8A 3VIKA 2WKGA 3H70A 3BTNA 4H7VA 3BAIA 4NSWA 1NDVA 3FGCA 4RE2A 3NQFA 5DT7A 4NZ5A 3NQGA 4D9PA 2A3EA 3DYOA 1GCYA 4UIOA 1SUXA 1A50A 2C1IA 4AF0B 2BXYA 4WXZA 4DQWA 4GH1A 1GW1A 5KTLA 3PG8A 3R8HA 4GI8A 2ZTJA 1RVGA 2CERA 2FIQA 3LOTA 3T0DA 4GQGA 1E5JA 3POHA 1OADA 1RV8A 4H8UA 2QCLA 3CKDA 4GISA 1DKXA 1R33A 4OT7A 1O5QA 4FZOA 1XLIA 4OZOA 3S2JA 5EMMA 2F1BA 2EAWA 1Q6GA 4RE4A 3DDMA 3SCQA 4KEZA 5E5CA 2VC7A 4FZIA 5G2HA 3N19B 1V3KA 4PMUA 4ZO8A 3VUPA 1JPIA 4O17A 2QEZA 4U31A 1TZ9A 1EUAA 1F61A 1RP8A 3W7RA 3F2DA 4QP0A 1E15A 1HT6A 5HMSA 3RPTA 5TNVA 3WMBA 5K9DA 1YTKA 3KFTA 2R91A 3C61A 4GH3A 1D8CA 3NJ3A 1TREA 2VJXA 2HV5A 4M6UA 3THDA 3GFXA 4Z2LA 4PUEA 4R7WA 2PURA 3TR9A 1S5NA 3V5OA 1QI2A 1V03A 1E4IA 5JBDA 4AHQA 3HM7A 2GGHA 1RA0A 1Z9AA 4GBUA 2W9MA 3EMCA 3QW3A 2V3DA 1YQ2A 1XIEA 1IXPA 4ZCWA 2HS8A 2ZTKA 4YTQA 3LZ3A 2B4GA 5FJUA 5ABEA 4WOZA 5E70A 4HCDA 1C8XA 3WUBA 3WNKA 3ZJ6A 3DFTA 1MW2A 1WDQA 5ENLA 4CQ8A 2BBFA 3DEQA 2WNWA 2VKZG 1XGDA 1UP0A 1RHCA 3N2OA 4JR5A 4UQCA 3RX3A 3QLDA 4JFSA 1PTGA 4QE4A 2BODX 3AYSA 4JKLA 2X3VA 1DWHM 1M1BA 5HJLA 2VCBA 4WPCA 3BV7A 1TQUA 3GB6A 4TX8A 2BWGA 2DV0A 1E4NA 4Q8TA 7CGTA 4P8VA 1WAUA 4Q6JA 1KRCC 3FHAA 2WMKA 3CQHA 5EFDA 1EJWC 5BOFA 4AC1X 1OX5A 1AZ2A 2A7RA 3FXGA 2A6NA 3D2EA 5DT5A 1W9DM 5J8LA 4GQ0A 2FMNA 1JI2A 3LCFA 1JCYA 3MA8A 4FF7A 2QVNA 2YA0A 1EQCA 4ZOCA 2ZX7A 2H6RA 4LRTA 3QHOA 3AS0A 3BLFA 3EA3A 1E4MM 4EZWA 3ZLFA 4FI4A 4V2XA 3FSUA 4CCDA 3L9CA 1UHVA 4CU8A 3VOFA 3A47A 4BS0A 5GPRA 3LN3A 1GZGA 2E28A 1DWAM 3W73A 2DPEA 3PZQA 1UYQA 3NVDA 3U2OA 3CQIA 1TPDA 1MUCA 3ARRA 1J2WA 2PWUA 2ZUTA 1KV8A 4UCFA 4UTFA 5FKYA 1FH7A 1HO4A 1CENA 5EBAA 3M0XA 4UQEA 4DRSA 4ADSA 4DYJA 2A3BA 1NWRA 4GRSA 3GKFA 1FCQA 1OIMA 4WPEA 1JCXA 3O0KA 1DQUA 3TXZA 5A6KA 1FCVA 1V79A 1TR1A 2HCVA 1RD5A 1MW1A 4MB5A 3E2VA 1JQXA 2D0GA 3SCNA 4PB3A 2XIMA 4O12A 4RPPA 3WMCA 4YCOA 2YXGA 1W9BM 3BLIA 3DC0A 4NY2A 2QCNA 5A69A 2D2JA 3QNIA 4G56A 5CC3A 4ES4A 1F8MA 4Q4KA 2GVGA 3SGZA 2PGWA 2IXUA 3E9AA 3OOQA 5JXQA 3SCPA 1K8ZA 2Y7GA 4EZPA 3KOWA 4E8CA 4LV9A 3E0WA 3TA6A 1XINA 5DCBA 3IV3A 3BICA 4O1DA 4CD8A 3F5KA 2E68A 3W7OA 1FXQA 3OEXA 1EC7A 1A0EA 4PUUA 4A2RA 4BF9A 3PZGA 9RUBA 3P61A 4XKYB 2X5CA 2DY3A 1SFLA 4GY7A 4FIQA 2O0TA 3AMKA 1A5CA 3STFA 4OECA 2VNCA 1IZJA 1T40A 3PUGA 2RUSA 2ZDRA 1YE4A 4RNJA 2PGEA 4QDMA 2YR1A 3KVJA 4UR8A 1EFZA 2BVYA 2GJXA 1LQ7A 2DW7A 2F1AA 4DF1A 1XYCA 2Q12A 1XR2A 3SIZA 3BCJA 3O6YX 4QGCA 1A3HA 3EJSA 4MPKA 1QT1A 3W1XA 1I1WA 1SJCA 2QF8A 2XH0A 4MNKA 1QWUA 1KFCA 2D0HA 1RP9A 1R3VA 2GVYA 2Y5EA 1QI5A 2CLOA 3T09A 3OA5A 4UC5A 4FNSA 4GOAA 1GPFA 2QLYA 3R13A 4HPNA 3ACOA 3CUJA 2OQLA 5FEXA 5AC8A 1XRTA 3UWUA 3H53A 3PZTA 5CJ5A 3BUIA 2WSKA 1E6RA 4R7OA 3FYYA 1W17A 1X39A 3DFNA 5FAGA 3F4DA 3MMWA 1XIMA 5EGRA 3CUFA 2V81A 4XUYA 5E9AA 2J27A 4A3UA 3LYEA 5I3HA 4GYJA 3N4AA 4BHYA 4N6EA 1ZJBA 5ECUA 4QHRA 4JFVA 5LNVA 1BKSA 3E2QA 3W70A 4F40A 2EQDA 2VD8A 4B4FA 2WZTA 4N2YA 1XDJA 2VX4A 1IEIA 1PYFA 1JUKA 3ORWA 2Z7GA 5HBFA 2Z2AA 1FCUA 2Q6ZA 3E2RA 2X8RA 3AHXA 3HAIA 1R9XA 3KOZA 3FLUA 4HNUA 2HQAA 5LHFA 4H9YA 1A5LC 1L6GA 3OBEA 1YKWA 1J0HA 1W1IE 3I3EA 5DMYA 5IRPA 4HU3A 2D20A 5G4WA 4L5ZA 5CAKA 1I0BA 1EOMA 4H4IA 4D6EA 4MLRA 1ZWWA 4DXVA 4WUIA 2PDKA 1XIGA 4W86A 1EKOA 1G4SA 3OP2A 4JTDA 1TX0A 3H4GA 1U33A 3B4YA 1QK2A 4JY9A 2Y0FA 1R3QA 4GQBA 3AALA 1WDSA 4A3HA 3QBUA 4JX5A 3W38A 4XKMA 3NM1A 2I16A 3SM0A 3AZSA 4C5YA 1EGZA 5C5BA 3NL6A 3VFLA 1OYCA 4HCHA 3SCWA 5DXXA 1B30A 1W37A 4N9BA 5TBOA 3UZYA 5CPSA 3LGEA 3L2MA 3IJQA 4DLFA 2XGIA 1O7DB 1YBQB 1XLJA 2AQVA 3GVQA 2REQA 2Q01A 4JWCA 4REQA 5A3HA 1J0JA 3WK1A 1YIXA 4J3SA 3B0UX 1C3FA 1HTYA 3GC5A 4LB3A 3W76A 4ZB0A 2W91A 3G3DA 3B8IA 1WKYA 3S6OA 4K7YA 2VR4A 4ONVA 3LHTA 3RLHA 3ZLHA 1E1EA 1G69A 1BSIA 1OG6A 5E09A 4ERAA 1OVDA 3REQB 3WQ5A 4B5VA 5EPDA 1Q6EA 5U4NA 1KCZA 1F2JA 2REQB 1J5SA 4QM1A 2E7FA 1LBLA 3JZUA 3NQ6A 4KEMA 1K6AA 3EEGA 2VCAA 1T96A 3LHVA 1R85A 1AH4A 3CLMA 2OWWA 1UR2A 3TAOA 2BHUA 2QCHA 3AOFA 3DESA 3EOUA 3RR4A 3NQ7A 1QNPA 5H8PA 1UR1A 3NVTA 4OBTA 4Q4QA 1ZY9A 1ZCOA 3CTTA 2BS9A 4C6NA 4YHEA 2GQAA 1EQPA 1A5SA 1JF5A 4NAFA 4Q4SA 8A3HA 1P0KA 1MMFA 4ROQA 5I07A 1LOQA 1KFBA 3CMFA 2CU0A 2A7NA 4X9SA 5BMXA 4GUGA 1R7OA 1FWFC 3K1DA 1X8CA 1GOOA 2D24A 4EZVA 3U2CA 4LYRA 3CYVA 3MMDA 3SJNA 3RR1A 1PTDA 5D9PA 1GOXA 5G1TA 2E3ZA 2PLKA 4Q7NA 1G7VA 1HXKA 5M1TA 2G8ZA 2GYIA 1DJYA 3L0KA 5I3KA 1AG1O 1Q6QA 3P74A 1J4EA 2A21A 1JEZA 4B9ZA 3WDIA 5AVHA 1BGGA 2AL2B 1TMQA 2VWSA 1OC5A 2E9LA 2QAPA 4X9YA 2GQ9A 1XIDA 4NSBA 5D02A 3QR0A 5C9RA 3C8FA 5DCEA 1TZZA 3KAWA 1UD6A 1BXBA 4DVOA 1LBFA 1QPQA 2WVUA 1XKYA 3GUGA 2NV1A 3A4WA 3KHDA 1PBGA 3MSRA 1X96A 4XBSA 1V7YA 4I7UA 2LLEA 1HWWA 2POZA 3UJRA 4M6PA 2OLAA 2PY6A 4JHZA 4S3FA 3SFWA 1OC7A 4NYUA 3SW6A 1WZAA 3H4WA 1IV8A 4XG1A 1GQIA 4O14A 3W2LA 4URIA 3EBVA 3LPPA 2ZVIA 4JIRA 2C91A 2OODA 3VYLA 3QMRA 2YL8A 4AZHA 4HK5A 4Y90A 4Q4RA 4L6DA 3TQ0A 1BF2A 4E81A 2XIIA 3WH8A 4BZYA 2CKSA 2X1UA 4IGHA 3URNA 3RCMA 3ZT7A 5BYWA 5BXPA 3LXBA 2PWFA 3MP4A 3CZJA 1N55A 4AKVA 5C5YA 1YW1A 5CH9A 1UKSA 4UTTA 3R43A 1GVEA 5BOEA 3D2FA 2MANA 2YYUA 3CPGA 1OABA 3VD7A 4KCTA 3S6DA 1ONWA 4JWEA 2PTXA 5TF0A 4UNLA 2NUWA 4JTKA 4FPSA 4W5UA 2NW0A 2WYIA 2PS2A 2QULA 2VO5A 3RGTA 3GR8A 3N3MA 4JFUA 4OIFA 2INZA 1U5VA 2J79A 3SB0A 3G1AA 2GK1B 3G1DA 4PCNA 3QW4B 3WYZA 4QLLA 1Q6FA 4JTRA 3QNJA 1W9PA 3WDRA 4GWEA 5CZSA 3V7PA 3IRDA 3NQDA 3N9RA 1RY8A 3W37A 1OK4A 3DPPA 6PTDA 1VFHA 1Z3NA 5D4YA 6TAAA 1GHRA 3ZM8A 4O8AA 3AS2A 2Y24A 2C7FA 2OEJA 3W1QA 3TU9A 2ICSA 4NRRA 5A95A 4LY8A 1QI4A 4LB4A 2Z00A 4UMBA 2YI9A 2DH3A 3E49A 4RKAA 3VIGA 4ZE4A 3AWNA 3WDHA 4LY4A 4RCXA 1HP5A 1V3MA 5HQEA 1L6FA 1IF2A 3LDVA 3WQ6A 1KFLA 4BFAA 4TX9A 3WNOA 1U22A 6XIAA 3AJXA 5CJMA 4RNHA 2QJNA 2GOKA 4X0NA 4LT9A 2H3BA 2WYSA 4NRSA 1NH6A 1FWEC 4F0HA 1PE1A 1E1FA 2J7EA 1V02A 3R4IA 1BYCA 5F2IA 5PTDA 2F2HA 3H4XA 2PB1A 3WBEA 4XAGA 4ECLA 3QE6A 2NVCA 1RJQA 2XN1A 4MGGA 1OFPA 4A6GA 2EPHA 4AG0A 5HQMA 3VOGA 3BURA 2ESCA 1N2VA 4UFMA 2FLIA 4KW2A 3QMSA 1ZU8A 4CEUC 3CHDA 1RH9A 1NP2A 4XD5A 3DI1A 3AMLA 3PTKA 1AZ1A 4XAFA 4WZHA 2WPGA 3G8RA 3VIFA 2F8QA 1BRLA 1X8FA 2J24A 2PDNA 1UR4A 3Q45A 1ML1A 3GTXA 1YEYA 1HGWA 4D2JA 3URAA 3FJ4A 3GVWA 3VKAA 3BLBA 1GGOA 3GSMA 2WINM 2PWDA 3MW7A 1DL3A 3NWRA 4M5PA 5HDRA 3O06A 3MWAA 3VGEA 3O63A 2HRWA 4MJZA 4O18A 3WENA 3URBA 5B80A 1AL8A 4AHOA 4JEJA 5KZ6A 3AZTA 5REQB 4K8HA 3BW3A 3L5LA 5JIPA 4GLEA 4GFIA 1XX1A 4FHAA 4FB7A 3DDFA 4LGXA 1B3YA 3TJIA 3B4UA 1HKIA 4RZ4A 2X40A 1I2NA 1LL7A 1Y5VA 4G7EB 3NQAA 1K9FA 3FEMA 1HFBA 2DORA 2VRJA 2BZNA 2WNNA 4MWAD 3TYBA 2YL5A 1FP8A 2XVPA 2FZBA 1W6TA 1PYMA 3KDNA 1ITQA 2JKPA 2ISSA 1HX0A 4XX6A 4S2BA 3TCSA 3QYSA 3OIHA 4JQ4A 3W01A 3WD4A 4DJFD 3GXNA 4H3DA 2OKTA 2NCZA 1QK0A 3WDJA 4JIPA 1PZ1A 1TVPA 4WD0A 4YTSA 2WM1A 3UR2A 3WD0A 3DYTA 2EX3B 3S83A 1TJ1A 2IKHA 4UTHA 1JR1A 4Z2IA 3NAVA 1HN1A 1QW7A 3UW6A 1C92A 1UWIA 4DZIA 3QH2A 4E4UA 2OBMA 3CHVA 4L9ZA 3C0LA 3RX2A 4CEXC 2D2HA 1GVIA 4F2TA 3I7QA 3COTA 4DELA 3PB2A 2RAJA 1T0OA 4ZFMA 5I3FA 4IT1A 4CN6A 1W5OA 3SRHA 2GAFD 3M0LA 3PJXA 3NSNA 4ICCX 1DJIA 4RLIA 5FJTA 4C91A 5CSUA 3H21A 1V6XA 1RQEA 3SO7A 4EK7A 2J7FA 5FSEC 2PDFA 4PBGA 2V9DA 3BLPX 2W62A 3FY1A 2XVGA 3HG2A 1DJNA 1QNVA 2XSBA 3G6LA 1FRBA 1XW8A 3R8RA 4PTMA 1FWSA 2WV8A 3JW7A 3HB9A 3P62A 3GZ3A 1TX2A 1TTIA 2NWSA 5D2TA 3ZXWA 4IX0A 3UWZA 4A3RA 4EZNA 3W7JA 2WHJA 1TQJA 5LXEA 4AEEA 5HR6A 3VOJA 1A0CA 4OWGA 2ANUA 5A8GA 2VFIA 5FEZA 1XIBA 1NQKA 5TQLA 4B9YA 4ZQRA 1AODA 4QG6A 1LORA 1GQJA 2X1SA 4JYDA 1GKQA 1Y5WA 1WCGA 5HNRA 1XC4A 5H2ZA 4B3KA 1EEXA 3FYPA 1LLOA 4KWWA 2Z29A 3M3WA 3OG3A 4AVMA 5D05A 3IACA 3MHUA 5FI8A 1VH7A 3QQ1A 1V6VA 3ARXA 3TTYA 3MO7A 3EMZA 1KXTA 4AD3A 4ZA0A 1SW3A 2ZQ0A 4UFIA 5G2IA 3SY1A 4OGZA 3VX1A 3EA2A 4NP7A 1H49A 5HNNA 3K8MA 1JDAA 1J18A 3T48A 4JKMA 3D51A 4XQ6A 5LA1A 3PLTA 3NOEA 3UYCA 1Q13A 1UZHA 4EZRA 1KKOA 1QDSA 2GSEA 2BSLA 3C52A 3R25A 2VELA 2WZHA 2C3ZA 1MVYA 4HZ8A 1VFTA 4RW3A 1NARA 1JD9A 1H41A 4JL9A 3BUBA 4IFRA 3BE7A 2PDPA 2WC4A 3ZLGA 4US5D 3Q84A 1KM4A 5JH2A 4D6HA 3AHYA 4IL2A 5BZAA 2PTYA 3C4UA 1CBGA 3P81A 3PAJA 5C6MA 4LXFA 2CETA 4GIRA 4KS0A 3BMXA 3RXZA 1RLCL 4BY3A 2FHBA 3GKAA 3UPBA 2DQXA 2BGSA 4Q8WA 3QHNA 4DPQA 1GYLA 4IG2A 1F8IA 1MEWA 2O7SA 3DUGA 5JQ9A 3HURA 3OB8A 1GEQA 3MPGA 1TMHA 1VBRA 4IPJA 4L9XA 2AKMA 4ICNA 3L4TA 4QBXA 4HHMA 4NZFA 1TE1A 4MVAA 4P7NA 4M24A 2QKFA 2DSWA 1RSCA 3V4BA 1W32A 1H7XA 2FVLA 1KTCA 1O6IA 1CPUA 2WSQA 3NQMA 4GUHA 2JKAA 3A3HA 3W83A 3MVTA 4EAMA 2BHYA 2DIJA 3AFBA 2WLZA 2CKRA 3WFZA 3EKGA 7XIMA 4AAJA 1J79A 1RBOB 4J2PA 4LCQA 2WMHA 3SAZA 1E0WA 1JRBA 1NJJA 1Z8AA 2WMIB 1VIZA 2Y89A 2ZYFA 4A21A 3VX0A 4O11A 4UDYX 2DZWA 3ZIZA 3CHFA 2PTDA 3ISIX 3PJUA 3SGGA 5G2WA 3ZQ9A 4Z1AA 4G5DA 5C2CA 3PP7A 3IVTA 2XIJA 1PAMA 5IBXA 3KUMA 5AOUA 4F9JA 3K2GA 2J7DA 1E73M 4F0RA 2KAUC 3F4VA 1TRDA 4DEFA 3EDFA 1GG0A 4CVUA 1E6NA 2PCQA 3A5FA 5MKGA 1VP5A 1M7JA 3IGSA 2QJMA 5CPNA 2CZFA 2G3NA 1PKNA 3GH5A 1LBMA 3ARVA 4YNGA 4TMCA 2YB1A 2VT0A 1M53A 4TU1A 4FXFA 2QDGA 5KSWA 2VC5A 5AC6A 5DBUA 5AY7A 2D2OA 1FY6A 3CT2A 1UKOA 4FX6M 1TWZA 4V27A 3PHAA 5C2GA 2QIIA 1KGXA 4W84A 4M19A 5HJYA 4EWJA 1JDDA 6ALDA 2XG9A 4A8RA 2RKXA 4WQ6A 4MKVA 4D1JA 3VNMA 2NV2A 4C60A 5CBBA 1IXOA 1KB3A 2YB4A 4Q33A 3GH4A 1QPOA 2XH2A 1YRRA 3R58A 2VD9A 1UR3M 1B31A 3W1UA 2BVDA 2UY4A 3L4XA 3EA1A 2J9YA 1DQXA 1UZ4A 2BOEX 4C1NA 4HA1A 3S2CA 1Y65A 2D4CA 1FX6A 1HJVA 4C6PA 2JBMA 1HJWA 2ZFAA 1EIBA 2NQJA 2RGLA 3GD6A 5C9UA 4NPHA 3PWIA 2WMJA 2W27A 1XHGA 2DSVA 4A8NA 1JDCA 2EEXA 3OZMA 1VD6A 1GNTA 1HUVA 1IGSA 5CGTA 2W67A 3BVUA 4KF1A 2GJXB 4F0KA 1CDGA 3TROA 3PBYA 3O16A 4ZO9A 3QTGA 1XYFA 5E0FA 4QRNA 1EPXA 2IKJA 1UB3A 3O6AA 4HIBA 1IEWA 3OZYA 4AD5A 5LIWX 3EWBX 3I01A 3BJSA 1JGMA 2GF4A 4Y8EA 1EX5A 4F00A 3UXKA 4JNZA 3RRAA 3PJWA 3GO2A 3I2WA 1GORA 1ONXA 2VDIA 4FLRA 2YCEA 2QPSA 1OBAA 3D3FA 4JZ5A 3WY1A 1YHTA 5A6BD 4Z0JA 1XWYA 3M0IA 3PPFA 1XCFA 1WV2A 2ADAA 4GBDA 5CZTA 4IOTA 5BROA 4KWOA 2A1YA 1EX1A 1SR0A 1IE7C 3OGVA 1R9YA 4MJ2A 3UT0A 2CFFA 4RPQA 4AW7A 3C7NA 3L4UA 4PUKA 3TUUA 4QS6A 4LUTA 4CGTA 5LIUX 3A23A 1GJWA 5M5DA 4MPQA 2QR6A 3ONCA 3WH6A 5DELA 4OTKA 3RILA 5FJJA 2GZXA 1RCOB 1Q2RA 5CC7A 4J1OA 4XZLX 1V8EA 3WQWA 5CEWA 3IEBA 2YGYA 4N9DA 4CQDA 2DVTA 1HQTA 2XN2A 4RW5A 4GC4A 2EXOA 4LVFA 1RQHA 2QUTA 3OZOA 1HTIA 1G4TA 5EKYA 1FHDA 3BANA 2ND0A 5DXYA 3NTYA 2NXHA 4JNMA 5EMKA 3BW4A 4QE1A 4GVGA 2QFFA 4ZQNA 2BY1A 3RPMA 3NGJA 2YA1A 2CLIA 3ALFA 1MQPA 3VE7A 4D72A 3W7EA 4I6KA 1F3XA 4L64A 1ELSA 2XUCA 1E9YB 2VZOA 2IQ0A 3N2BA 1PX4A 1BEUA 4F48A 4Z2GA 4QXIA 2WZMA 2ACSA 4GGBA 3ZJ8A 4Y9NA 5H6HA 1NEYA 2Z0VA 1ODUA 1MWOA 4R5JA 3IUDA 3USZA 3SFKA 2ZE0A 2WWCA 4P7RA 4NQ1A 4QAIA 4XIAA 4GVIA 4F2BA 3OHMB 3GXTA 4H8SA 3LSBA 5E6YA 4WR3A 4H9UA 1C7SA 3N73A 4PGLA 4J3UA 2HXTA 2AQOA 1E9VA 1C8QA 5I77A 1OZMA 2C19A 1Y0EA 1GZ1A 2G3IA 1JDEA 4REQB 2FFIA 4FR6A 4NX0A 3B8DA 3UU0A 5RUBA 2NT0A 4H19A 4AIBA 3QSRA 4Q7BA 2I57A 3LPFA 1JQKA 4C7DA 1VHNA 3TDFA 4HR1A 3N1AA 2WM0A 1OCBA 3EJUA 1OHLA 4WSHA 4E3TA 1ZLPA 2JGQA 4FLSA 1ADDA 4B91A 3KRUA 1SFSA 4LS1A 4MDOA 5I00A 2DZBA 3UP8A 3MO4A 3L3PA 4B5XA 2VURA 2X2YA 1H7RA 5XINA 2YDQA 4CN4A 3G1VA 1HP4A 4NG3A 1WBHA 4EZSA 5A6LA 4M0MA 1XLKA 2RAGA 3A12A 3N17A 3P8JA 5A2AA 2CHRA 2QCMA 2ZX6A 5EA9A 2J8FA 2ZC8A 1WUFA 3BG5A 3MKCA 5DQPA 1LLZA 2V3FA 4H8VA 2VMFA 5HNUA 3G9GA 1FOBA 4LALA 4NILA 3S5NA 4R5LA 2J62A 1FHVA 4QISA 2J88A 5C55A 4C6BA 3EXRA 4RNFA 4V1YA 1QWGA 1DKZA 2V3EA 4XVDA 2RAKA 2ZUNA 4MSSA 1VJIA 1XRSA 3CAWA 5CPLA 1I75A 3V1HA 3EEZA 1Q45A 2ZUUA 1TR9A 1E6XM 2V5KA 2HPMA 3J7HA 1O1HA 2O9PA 3MB9A 3QFWA 5CPMA 3PY2A 1N82A 1ZZMA 4I6VA 2JF6A 2WB5A 3DBPA 5GJMA 1XH1A 3O0FA 4IJRA 3WH7A 2ZZ4A 2DDXA 3AXHA 3SCTA 3F7JA 1KXVA 4DJED 4GJIA 3THQA 3O8AA 3M0ZA 3E96A 3PG9A 3HJEA 3Q67A 2HROA 3ZR4A 4BI5A 5HQLA 2PMQA 1XFBA 3A24A 1QU4A 3A98A 3P82A 3STEA 3UG3A 1UC4A 3W71A 2QCFA 5JU6A 4A4AA 4UQ9A 2I9UA 3M44A 5ABFB 5HINA 1B1YA 2F84A 1XM3A 2VFGA 3SQMA 2X3WA 4JTAA 3CL8A 3EX2A 3BZJA 4DNMA 3N34A 3QY7A 4HCLA 4LBSA 2J8TA 1P6CA 2HE5A 3GTNA 3DHUA 4PCFA 1OZQA 4L1XA 1TPEA 3R0DA 4IMAA 1KFWA 3WLTA 1O5RA 1OCJA 3ARWA 1WDZA 3W1NA 3G0UA 4EPEC 4B9QA 3G1XA 4FX7A 3TYAA 2UBPC 5C5BB 2NQZA 3EAUA 1R3SA 4UOZA 1QX1A 2HBXA 1OA1A 4K36A 4HPGA 3QKEA 4F0LA 4YVVA 2XYLA 3T4AG 4FZPA 4B3ZA 2VR2A 4E8GA 4AIUA 3H7UA 4JIHA 3OIXA 5FA5A 4KFPA 1O60A 2HDJA 2X0YA 2VTFA 1JRCA 4W93A 4UZUA 4LEQA 6XIMA 1C7TA 2C1GA 4ML4A 1Z44A 2HWGA 3I7SA 4NXKA 2GSHA 1YXDA 2E5CA 2DZPA 4BQ5A 3DXIA 3ES8A 4KQNA 1C91A 2PE4A 3JUGA 1MFVA 4IGNA 5I3GA 2Z6IA 1L6YA 4LTSA 5C9WA 4AX6A 3QQ0A 1VYSX 2HVOA 1RD6A 2BTMA 1H09A 5IHRA 1T7LA 3PR2A 4DHGA 3RUBL 4BWLA 5FF0A 2HVMA 4GVHA 4CD6A 3VD5A 1SW7A 4ATDA 1OFQA 4GG9A 1HW6A 1PCKA 3KOXA 3THAA 1RAKA 1BQGA 4IZGA 5K7JA 2PDIA 5I3IA 2XM2A 1MZHA 1K8XA 3EKZA 2G96A 3IWPA 3M5YA 4X63A 4EZXA 1N8IA 2FZMA 4PYSA 3R79A 1CNVA 1DJGA 3LTSA 1J2BA 3T2OA 2BV9A 2OWXA 4MB1A 4HJWA 2E40A 1VCFA 4FNPA 3BLLA 1J01A 3CZEA 1R2SA 3BAWA 3GU1A 3H55A 3GTFA 1EDQA 3DZ1A 1X6NA 4LFYA 2Z2BA 2OT1A 2F6XA 4V33A 4XUGA 3DYMA 2VGIA 2EJ1A 2IXVA 4J35A 1VC4A 3S5YA 2E8YA 4HSHA 4JHMA 3W00A 4UFKA 3W72A 2VC9A 4FLQA 3CQ0A 1WO2A 4HYRA 2G37A 4I5XA 4Q8MA 3OO2A 4ZO6A 2OBLA 4ZOBA 2VM8A 3TMQA 2OSXA 1FP9A 3LCGA 2IQTA 1WDWA 3ZMRA 1CYGA 3FNDA 1KM6A 3F03K 4CNOA 1M9HA 4M1RA 1UPPA 4LCRA 2W63A 4TX6A 3KBVA 1FWRA 4TUFA 5CLWA 3VEBA 1KQZA 3LLFA 1U1HA 3OW1A 4KESA 3OLDA 3BQ5A 4RL3A 1Q6DA 3TAKA 3QPYA 2PGRA 2G97A 1WOAA 1E4LA 1U83A 1JYWA 4H7CA 1RVKA 4XD4A 1YYAA 3GS6A 1Q8AA 4R5EA 1J0KA 3VC5A 1UJQA 1ZENA 4CKQA 1W3HA 2J77A 3ARYA 5REQA 3WLHA 1W9MA 4UOQA 4XAZA 3ZS4A 2QF7A 4R85A 2WVVB 1UP3A 1K9TA 1B4KA 2WOQA 3NDYA 4LBRA 4JNYA 1QWKA 3ZOAA 3CXOA 4G7EA 3BLEA 4WSJA 4JNFA 3I68A 2ZX9A 2HSAA 3OG2A 5DEZA 1TRIA 4W8BA 3PZUA 2X7VA 4MB4A 4GIEA 3W1AA 3TKFA 1IEQA 3U2EA 1NFGA 2ZRWA 5CAHA 3U7BA 3LS9A 3ITXA 2B31A 3QFEA 2YLAA 4DUOA 2Z27A 2AMXA 2R82A 3HG4A 1JZ8A 3LM3A 5I23A 3SADA 4XZNX 4CQBA 3F2BA 1P4CA 1L2UA 3PFRA 2YDAA 4H01A 4W5ZA 5FEWA 4AUBA 1MW3A 2NSXA 4JPGA 3H23A 2E6FA 1U1JA 3WK0A 1MQRA 3W1MA 4R53A 1VFFA 4PRWA 5CG7A 1PVNA 3UXDA 2O0I1 1EEPA 4D8JA 3MV01 3N4FA 2WANA 5XIMA 3ABXA 1XYMA 2XGBA 4IWWA 3CHEA 3PPCA 1NOWA 5E93A 3UQNA 1VYRA 4AY1A 2QPXA 2PDCA 2YPIA 3NQBA 1O5KA 1UH4A 4GZEA 1NM9A 4XSLA 5A6AA 4BF5A 4C6JA 4DJFC 1XRFA 3ERCC 2WJDA 1WDRA 3QN3A 1YDNA 3B53X 1H7PA 5A8MA 4LH8A 2VEPA 3VKBA 4ZTXA 1FXPA 1EYEA 4TVDA 2IW0A 1J0YA 1F5ZA 1O94A 3LY0A 1A80A 7TIMA 1A49A 4EZUA 3H2OA 1H0IA 1MRAA 4LSBA 4JWDA 3AROA 2CWNA 2A3HA 2G0WA 4JYEA 3UNTA 2CLMA 4JTFA 1FBAA 3S1VA 3RG6A 3VNJA 2VVSA 3IRSA 3HQ1A 1XBXA 2NLYA 5LNSA 2NX9A 5I24A 2WYHA 2VDGA 3B04A 3SCUA 1HNYA 2GGGA 1RBLA 1SM9A 2HS6A 3EZ4A 1GNXA 4E3VA 3VZXA 3W7DA 3VGHA 3N14A 3VTRA 3RCYA 4S3GA 3L5AA 3U2ZA 3QF0A 4S3JA 2C0HA 1GK8A 1VZWA 5C71A 1E56A 1E6SM 3INPA 4R3UA 3BUQA 3VDHA 2ZRXA 1URUA 1E1CB 3T4WA 1O4UA 4IP4A 3PULA 2V5JA 4ZEPA 3EJQA 4QROA 1UKQA 1E0TA 2QJGA 3T08A 3CH0A 1Q63A 3TZFA 4JX4A 1DVJA 4UR7A 4JTGA 3T42A 3CYJA 1ZFJA 2JEQA 2HE8A 3D6NA 4A22A 3E1F1 2DSUA 1B3OA 1OF8A 2YDRA 3IJ6A 1XC6A 4ZL1A 2CXGA 1H1ZA 1DEDA 2GA9D 4JCMA 5C70A 1EJSC 7REQA 4H6KA 1ENUA 1PHWA 3BH4A 4Z17A 1QTWA 5F2MA 2NZLA 4E4FA 1LLWA 1YDOA 1OY0A 2ZWZA 1I4NA 1YPFA 4B5WA 4LVAA 4AD2A 1Q66A 1F74A 3VKDA 1TO3A 1UD5A 3BSMA 2C8NA 4NJIA 5HUOA 1CCWB 3DFOA 3TR2A 2VUNA 2NQ5A 2J78A 4O15A 5HNTA 3U57A 2RJHA 3MT1A 4XZBA 3ZJKA 3HG5A 5TAOA 4K37A 1DWJM 1REQB 2ZE3A 2X3XA 4E4PA 1DJQA 2OKOA 4PMOA 2Y1HA 1XBYA 2VDHA 4D6JA 4LAOA 3IIPA 3KRZA 4F79A 3RO8A 4DXXA 3OA3A 2GUYA 3TN4A 1DOSA 1KXHA 3N2CA 4WCJA 3GVVA 3UG4A 3WUEA 3R2GA 1XCWA 5JMUA 3PZNA 3G1HA 5EYWA 5EMUA 1DWGM 1EH9A 3CQJA 3WLMA 5T9BG 3T4CA 3NO1A 4GKTA 3OYXA 3IJLA 2ZRUA 2PZ0A 4B5SA 1QHOA 1CGVA 3RDKA 3IGXA 1Z69A 3A4XA 3BPWA 1UWRA 4PMVA 3MS8A 1YADA 2XVNA 4QCEA 2G3MA 3E02A 1W3TA 3O1NA 4L80A 5T26A 4W7WA 1VKFA 1OX6A 1Y2OA 1R2RA 4HY9A 2R24A 2IPFA 4JN6A 3EX3A 1HG3A 4CNUA 1QNRA 4JYFA 2HNHA 4FNQA 3HQNA 1ZPTA 1MJGA 4UMCA 4ZQPA 3TA9A 1W5QA 1H11A 3GWQA 5I7GA 4LUIA 3BVTA 1LRQA 1M6JA 3H2FA 4IM3A 3S1GA 1E71M 3HGSA 5AYXA 4JAWA 4IIFA 3TJLA 1UR0A 3U4FA 2IQDA 1EP1A 3N6QA 3TNBA 3MDWA 2J6XA 1UIOA 3THUA 4ORIA 5A94A 4FR1A 4AZCA 2X1RA 4OV9A 4K2SA 2ACQA 4HMNA 3LENA 5CCZA 4QR6A 1JZ5A 4GUJA 1KO0A 1NFBA 5JBEA 2XFYA 3P80A 4Y9PA 1GTHA 1R46A 3W4RA 4FS9A 3A64A 3WO8A 1EJTC 1QUMA 2QCGA 3GC4A 2OVLA 3S9ZA 4P7QA 2WMIA 5FIPA 4UTWA 1KA9F 5AYYA 2ACUA 3CZGA 3ITYA 1IWAA 2J6VA 1IT7A 1OGSA 1F3WA 3K1GA 2XH7A 1I2PA 2E77A 1UD2A 3UR5A 5ABTA 2YBVA 5D9OA 1XGEA 4LNCA 2BP1A 4UDXX 3FA3A 4M8UA 4N6FA 2WCGA 3CUHA 1JPKA 3V0SA 1QHZA 3T49A 2GGJA 4JTUA 2VEFA 1H1YA 1BXNA 1LOSA 2WNQA 3WLLA 3LSCA 1XF0A 3AZRA 2O55A 1SO6A 2IS7A 3DC8A 2FZNA 4Q4MA 1B4EA 1LOLA 1IXQA 5G1MA 3PB0A 1R38A 2R1KA 5EFFA 2XSAA 2EFKA 2FTYA 3P0WA 4IPLA 7ODCA 2NQ9A 3ITOA 2OX4A 2ZUMA 2YCLA 5H8UA 4NI8A 3MANA 2PPGA 1DIKA 2WK2A 2ZADA 3WF4A 1ZUAX 3K8LA 3VCNA 2TODA 2Y70A 3S9IA 1VRXA 2DT1A 4KMQA 4KIEA 2BG5A 3IARA 3KLKA 3TLQA 2X05A 4PTWA 1Z7AA 5FSDC 1OD8A 1OCQA 1P7TB 4IXXA 5BXRA 1V0MA 5M3WA 4OKDA 5FF7A 2ZKMX 3WQDA 1M03A 1QWNA 2R1PA 3OVRA 4C1NB 5KEZA 2QJHA 2GWGA 1S2TA 3B3DA 3DKJA 3NEVA 2Y8KA 3W81A 5FESA 3W7MA 3WCZA 3Q94A 3NPXA 2DZTA 1G5AA 4KCUA 4V15A 4S39A 1UR8A 1G67A 4IX2A 4NJGA 3VGFA 3GDLA 4H9MA 3IUIA 2ZA3A 3FYOA 4RK8A 3G24A 1UBSA 4KH2A 1TWDA 3NYDA 2KZHA 4RDYA 1P7TA 1JG9A 4B5UA 2JK2A 2I5QA 2PDXA 3KVMA 4IIDA 4MNMA 1DJHA 3ZVHB 3KDRA 3W7NA 3VMNA 3GVGA 1OFAA 3ZEDA 4GZJA 5ABGA 5A8NA 2ATMA 4JL1A 3AIEA 3IGUA 4H9VA 4O54A 2B7NA 4UFHA 5EB8A 1G7UA 1HKJA 1KBIA 5E1QA 3GW0A 2XFRA 1A0DA 3MSDA 1E43A 1UUQA 3DKLA 1JQVA 1DXFA 2NVDA 1VGAA 1AD1A 1ZCCA 3UA3A 3TQKA 1V02E 3VM5A 2VRQA 2E1DA 3AC0A 4S3KA 3WD2A 3HPAA 1S46A 5IHSA 1MXSA 1E2UA 2FYMA 2ABBA 1FTXA 2J9ZA 4BEUA 4QITA 2EPLX 2BY2A 1H7OA 4D8ZA 3KXQA 1I2OA 4WY0F 4AD0A 4O0QA 2PC8A 2Y7EA 4HMDA 4Z1BA 2R1LA 2WMGA 4BEQA 2OEKA 1TKKA 1TUFA 3AU2A 2QUMA 4B2DA 2XGZA 4Z1YA 2QZRA 1A3XA 2QQ6A 1DBTA 3EOEA 4L1GA 4LC6A 2OMAA 3DGBA 4GUIA 1XJBA 1Q3NA 1MO0A 1V6WA 3PBVA 3ENLA 2MUCA 3W1TA 2O4MA 5T8GA 3S4TA 3BK0A 1R87A 1J96A 1ZAIA 2XIOA 3R8GA 4R5IA 2ATSA 2D1ZA 1B90A 1VPXA 4GX9A 3RN6A 2Z7KA 3P14A 2D3NA 4O4VA 4IWQA 3A4JA 4DN1A 4ACZB 4QLJA 3QYQA 4E2VA 4DF2A 4GYKA 3M6YA 4F0MA 2PU0A 2W79A 4FZSA 3LPGA 4GNJA 4HR1B 1R6WA 3BAYA 2QCEA 2JALA 3ZO9A 5DRIA 4X2PA 1TWIA 3FA4A 5AHIA 1UA3A 2D22A 9XIAA 4U3CA 4WDUA 2QCDA 1XISA 4OOUA 2PDYA 4NAFB 2Q8ZA 5FJOA 3OVPA 3GFYA 3W7QA 1GW9A 1X04A 2BY0A 3V1PA 3C2YA 1HJQA 2PEVA 4AZ5A 4MJMA 2Z4GA 3DIPA 3L4VA 1H60A 3LU2A 3QQWA 5ABHA 1SZRA 2BVTA 5C9XA 1H5YA 2V5DA 1JZ2A 3V3WA 1QPNA 4CN1A 4AMAA 1TUXA 3WLRA 4QCFA 3WKZA 2FGZA 2PTZA 2PBOA 4WOQA 1AW5A 1MRQA 3DAQA 4HZ7A 4HA4A 3WH9A 1OX4B 2E6YA 4O1CA 4YMZA 1HJUA 5G4HC 1B54A 3BJTA 3R89A 3TN3A 4FNTA 3WBWA 2QW5A 2PDMA 4JBRA 4JGDA 3QOKA 3DERA 4C65A 1TFVA 4HOXA 1L8PA 4ZB2A 1E1DA 4AD1A 3HPZA 4U3AA 2Y2WA 4DJDA 3WNPA 5E0KA 3EB2A 5C2XA 1UUOA 4B5NA 2FGLA 2FHFA 3SOGA 1BGAA 4QJ1A 3RLUA 6CGTA 1QNQA 3NL3A 5D8WA 2PMRA 5BU9A 2YIHA 1UWSA 3BMWA 3MJYA 4QS5A 2TYSA 2Q8LA 1VENA 3GAKA 3VZZA 3B51X 1AW2A 3HGRA 1PIGA 4KGJA 2XINA 3W82A 3UWWA 1GOKA 3LVTA 3HG3A 3PBWA 3ZR6A 4QJ4B 4HZ6A 3NO5A 1IHIA 4IFOA 3RMJA 2FTWA 3UXAA 1XQKA 4G8TA 4IXHA 4NVTA 3MCNA 5FF2A 1OJXA 3LGGA 3H2MA 1ISZA 3GDRA 4KRUA 4LUTB 4Y2WA 7TAAA 1SPQA 4EZQA 5AHLA 4U5KA 4S3EA 2CBVA 4IICA 3IAQA 3LHUA 4G1KA 3RO6A 4CQAA 2PD5A 4PCPA 1VJSA 3B05A 2GPTA 4EPBC 1GJPA 3QM3A 2WC7A 4XIMA 3EWYA 4LVDA 3NFUA 3AICA 4E2DA 2PBGA 4CVWA 4GD0A 3FFSA 4LAMA 1Q7MA 1KNWA 2PLMA 1P0BA 4NZ1A 3VEAA 3TW6A 3M5XA 1WKFA 4DYEA 3NEHA 3DX2A 2JFEX 1OFEA 3BVXA 2OTDA 3CASA 2E0PA 2GVJA 4DLMA 3ARPA 2NVAA 4I8DA 4GNVA 7ENLA 1YBQA 1NVMA 3VFCA 1HXJA 3QV9A 3SJ3A 3EJTA 1EF2A 2W6RA 3UR7A 1DWIM 4FEZA 4MHBA 1V3HA 2OX1A 3ITLA 3VIJA 2TPSA 4INFA 1ZYLA 1XL9A 4HN8A 3I6TA 5HAOA 3UJFA 3NM3A 3VAVA 1QO2A 3NQCA 4KKXA 1RCXB 4K1WA 1TV7A 3U5YA 2RJGA 4I5RA 1TV8A 5D38A 2AAAA 1HKMA 4K3ZA 3FVMA 4DBWA 5MF5A 4ASTA 1UCWA 1V3LA 4P5UA 3W23A 2W66A 3CH9A 3I3DA 1CI1A 4PN2A 2EKGA 3S1UA 3KBMA 3W87A 1SO5A 3P60A 3QWEA 3SR7A 3QV6A 3H2NA 3TTEA 2CLPA 1IYXA 1ZSXA 4PH6A 2E09A 3UPMA 1PDYA 2F6KA 2RH9A 4X3ZA 1VFOA 3D47A 5F1VA 4ORMA 4W89A 2V5CA 1PX3A 1S2AA 1TPVA 5A6MA 2E9BA 3LLLA 1ZQ5A 2YZRA 4U28A 2WVSA 1WDPA 2Y5SA 2QIWA 4MKNA 3GTIA 4DBSA 4HHPA 4M6QA 3C0JA 1Q5MA 2Q02A 1EGVA 4W85A 1LF1A 1R86A 4HYVA 4C1LA 2Y6ZA 1RZMA 1DE5A 2VVNA 1E40A 3W7IA 4MADA 2OW6A 3UF9A 3CPUA 4DO6A 2O4QA 1LTDA 5H91A 1XLGA 2V2CA 3BAKA 4Z42C 4TV6A 3LRKA 2FZDA 3RCNA 3NQVA 3QJAA 3S42A 3VD4A 3QTPA 1JDFA 2X7WA 2KHOA 1F73A 3CIWA 4GY0A 1Z89A 3KEHA 2OFJA 1VF8A 4NNCA 2WJZA 2ZUVA 2CLLA 3HAJA 2GSJA 5LA2A 3VKJA 4MY1A 3T8QA 4M6VA 4MLJA 5L9FA 2DZSA 1S2WA 3TZNA 2Y63A 1E9IA 4IH3A 5I09A 1J0IA 1SGJA 3L3OM 5FL1A 3CV5A 2V69A 4CCEA 3NURA 4BF7A 2PWHA 3WLOA 1DHKA 5CSSA 1C9WA 1S3TC 3QPEA 1ZALA 5C54A 3RAOA 3TJ4A 2ALWA 4JICA 2OQHA 4YLWA 3TMLA 3MU7A 2AAMA 3PTDA 1HO1A 3IIVA 2VFFA 3NYZA 1G1YA 3L67A 1TCDA 3EWXA 1WB0A 4N02A 1FH8A 4CNPA 1KM3A 3QRHA 3OLIA 2R6OA 1GOWA 3TWBA 3W7GA 3T7VA 3CUIA 2CYGA 1YPXA 4MIMA 2I1OA 1SZFA 3ZT6A 1X7IA 2WCSA 3WJXA 5JBFA 2PTWA 1NDYA 3OPSA 2RDUA 5BRBA 5A8PA 2VOTA 2PDUA 1GEHA 4NIRA 3CV6A 4WDWA 3K4WA 3W9ZA 4NASA 4B90A 2XDFA 1WOBA 4LANA 5DCDA 1U30A 2E5DA 3CZ8A 1SW0A 3A22A 1FKWA 1KXQA 3D4YA 4Q4OA 3W1LA 1XCXA 2ZXQA 1JFXA 2P3ZA 3RLGA 4AQLA 3RLVA 4RDZA 2DT0A 5FD0A 1EA0A 1OC6A 3SECA 3T9PA 3CTLA 2CLHA 4XZ9A 3N25A 3G8EA 4JS3A 5IDZA 1KC7A 3PANA 1QOPA 4HKPA 2OW7A 3GR7A 3IJIA 4UB9A 3UZXA 4IUGA 5CSRA 4FIRA 1BTCA 5F1UA 3VO0A 3R1ZA 3P84A 5K2ZA 1GYNA 1C9DA 2QYGA 3I6RA 1N8WA 2VZVA 2VOMA 4LYQA 3I7RA 3UBPC 3CAVA 3LI1A 3WMSA 2P8BA 1UWQA 4WX2A 4AC7C 2OCZA 1RCQA 1XXXA 2DZXA 1HJSA 2IPWA 4YTUA 4IQDA 4ICMA 2A79A 4Q8QA 2WJEA 4X2RA 5HK4A 1BPLB 4W9TA 3FN9A 1M01A 3I3BA 3W22A 5FF3A 3M4HA 1R3RA 4Q22A </