2YL8A

Inhibition of the pneumococcal virulence factor strh and molecular insights into n-glycan recognition and hydrolysis
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
434
structure length
434
Chain Sequence
b'NEKLAKKKIVSIDAGRKYFSPEQLKEIIDKAKHYGYTDLHLLVGNDGLRFMLDDMSITANGKTYASDDVKRAIEKGTNDYYNDPNGNHLTESQMTDLINYAKDKGIGLIPTVNSPGHMDAILNAMKELGIQNPNFSYFGKKSARTVDLDNEQAVAFTKALIDKYAAYFAKKTEIFNIGLDQYANDATDAKGWSVLQADKYYPNEGYPVKGYEKFIAYANDLARIVKSHGLKPMAFNDGIYYNSDTSFGSFDKDIIVSMWTGGWGGYDVASSKLLAEKGHQILNTNDAWYYVLGRNADGQGWYNLDQGLNGIKNTPITSVPKTEGADIPIIGGMVAAWADTPSARYSPSRLFKLMRHFANANAEYFAADYESAEQALNEVPKDLNRYTAESVTAVKEAEKAIRSLDSNLSRAQQDTIDQAIAKLQETVNNLTLTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-N-ACETYLHEXOSAMINIDASE
publication title Inhibition of the Pneumococcal Virulence Factor Strh and Molecular Insights Into N-Glycan Recognition and Hydrolysis.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
total genus 172
structure length 434
sequence length 434
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2011-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.90 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AF1782-like 2yl8A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2yl8A01
1E15A 5FL1A 2YBTA 2J79A 4WKAA 2ZX9A 3AHVA 2J62A 3IJ8A 4GI6A 2G41A 2ZUMA 4HMEA 1J0ZA 3B9EA 1E9LA 3GDBA 3AZRA 2J4GA 4GO9A 4YHEA 4JKMA 1EDQA 3BH4A 2VOTA 1SYTA 1TFVA 4GXPA 5EFFA 3FN9A 2D20A 2ZUSA 4MNMA 3T2QA 2QPUA 1GONA 1JFXA 1WAWA 2JF7A 4AD5A 1RPKA 3VGGA 3K8KA 3SCNA 1DP0A 1UZ4A 2W4XA 2V5DA 1JI1A 1UWRA 5HPOA 1I75A 1B3WA 1G0CA 4S3JA 1B31A 7A3HA 2JIEA 4U5IA 4GI8A 3EDEA 3BSGA 1J0HA 1XYZA 1A3HA 3TA9A 4ATDA 5BCAA 3ZO9A 5EB8A 3WMBA 2BXZA 4D1IA 4M82A 1JIBA 3QHMA 1B3XA 3VUPA 4BQ2A 3OLEA 5I2UA 1CXLA 1KBKA 5A6BD 3SCOA 1E3ZA 4PTVA 1CXKA 3W0KA 3ARTA 4PMUA 5A8PA 1DEDA 6A3HA 4WK9A 2EPNA 5JUVA 1KBBA 4HZ8A 2VURA 3W81A 5AY7A 2YA1A 5FL0A 3GZAA 4ZXOA 4HOWA 3PHAA 3W82A 1H09A 4TUFA 1JF6A 1M53A 2XGIA 1E1FA 5M17A 2VNCA 4PRWA 1WCGA 3WNNA 1UQYA 1AVAA 1D7FA 4HP5A 5IDIA 3N13A 2PMRA 1CNVA 2WAGA 1EA9C 4DWSD 1XHGA 1VBRA 3CHDA 1HL8A 2W5FA 4W85A 5M03A 2YL5A 5JIWA 3WD0A 2O9RA 1BLIA 1JZ5A 5A2BA 1H49A 3PBGA 1H3GA 3L4XA 4OUEA 2ZUNA 4CVUA 4U3AA 2PC8A 4Z2IA 2V3GA 1XSIA 3ZT6A 4ZXLA 4V2XA 2EPMX 4W8LA 3BLKA 3ZJKA 1OGSA 2OWCA 5BXSA 3VOCA 2XHYA 3IAPA 4MAZA 1XH0A 4CN4A 1QNQA 1E55A 2A3BA 2JEPA 1UWTA 2OSYA 4MB5A 4HZ7A 3ARXA 3VGBA 1W2PA 4PMYA 1MQQA 2VI0A 1CGTA 3EMCA 4H04A 1KWGA 4E4PA 4C7GA 3W29A 2JEQA 5ABFA 1GJUA 2FH8A 1OWQA 2DT2A 1PX4A 1HT6A 1UWSA 2WC7A 1E6NA 1CENA 4TVUA 1CGYA 1GHSA 3O2LA 2J77A 3AXIA 4LYRA 3WH5A 4KGJA 3WF0A 1JDAA 5GNZA 3F5LA 4PSPA 5JBFA 2W63A 1C7TA 4LX4A 2J75A 5A6KA 3K8MA 3O6AA 4PEEA 2DSKA 4XUYA 3VIIA 1K9EA 3SCTA 2NW0A 4FLRA 2J47A 1ISVA 1SFSA 1J12A 2WCSA 2X2YA 2OWWA 3RO8A 2EXOA 1KGWA 2UWFA 4CKQA 2QPSA 2OWXA 5A94A 4FZPA 3ZT5A 5GQBA 1QHZA 3T2OA 1E4IA 4JFWA 4AISA 5BRPA 4KH2A 1W3KA 3BSHA 4GKLA 2DH3A 5HNNA 3VGFA 2X09A 3CZLA 1W9BM 4QDMA 4CD7A 3FY1A 2BNJA 4CU7A 2G8ZA 2VMFA 4NF7A 4OZOA 5ABFB 1US2A 3CGTA 3SIMA 2D2OA 4HU0A 3OLDA 3VGEA 1VRXA 3EDFA 3NDYA 2EPKX 1GCYA 4WKFA 4D6DA 4MADA 1SMAA 2EEXA 4B3KA 4PBGA 4H8VA 1VEPA 1E73M 3WEZA 3VIHA 4CN6A 1CPUA 2W67A 4MDPA 1CYGA 3NJ3A 4UFHA 3OB8A 1BHGA 2IXVA 1GOMA 3VDHA 1V6XA 3GM8A 4J3SA 1PIFA 1CGVA 3ARYA 4TX6A 3N12A 4ML4A 3MV11 4ATWA 2CXGA 1XCWA 2F61A 3L2MA 5F7UA 3ZOAA 1GW1A 3RM4A 2FGZA 1FFRA 3JUGA 1PJ9A 1W9XA 1TE1A 3A4XA 4AZCA 1VENA 2BY2A 1V3IA 3VMPA 4AIOA 3MUAA 5D8WA 3VD7A 4CCDA 4QAWA 1FA2A 2CKRA 3WDJA 2WPGA 4ACYA 3ZJ6A 3AMKA 2JFEX 2C7FA 4MDOA 4J28A 2YA2A 3THDA 2VQTA 2XM2A 2OSWA 4UQ9A 5BYWA 1E3XA 2OZNB 5GNYA 1OD8A 4QCEA 3GTNA 1V6UA 4W93A 2DSUA 2CKSA 3AMLA 1H4PA 3AS2A 1ZBVA 2WMGA 1KB3A 1BGGA 3PZMA 2BFGA 3GNRA 3SCPA 4HOXA 3L4VA 1FHDA 1KR0A 3VMNA 1L0PA 2EO7A 3E1F1 4N42A 3WMCA 4A4AA 2WZHA 3W38A 4B9YA 4OBSA 4Q7NA 1XH1A 4GZIA 3GXFA 2JNKA 1SMDA 1HKKA 1VIWA 1TA3B 1JNEA 2FGLA 2GK1A 3CMJA 1EGZA 1KWKA 1BF2A 3AROA 1WDPA 4AZCB 1E5JA 3B9AA 3RM9A 2QHAA 1EH9A 1UD6A 3ZSTA 3VX1A 2AMGA 2DT0A 2ZUWA 1E56A 1HX0A 1NWRA 1FP9A 2WM0A 1GQIA 1CZ1A 2JIWA 3AFBA 2CERA 3AJ7A 1W1PA 1IT0A 1BVZA 3EMQA 2WSKA 4MB4A 3AI0A 1WP6A 1CLXA 4W7UA 1HJQA 1R86A 1R8LA 4HOZA 1SR0A 1TZ7A 2VT0A 3EYPA 1BQCA 4BZYA 2J7EA 3UESA 1ZS2A 4XZBA 4GQQA 1OT1A 2HVMA 2J25A 2OSXA 3GH5A 1KXVA 4MB3A 5CLTA 2Z1KA 3BAYA 1GORA 2ESCA 2BY1A 2Y8KA 1UR4A 3BAWA 3VGHA 3ZQ9A 5JBEA 4AD4A 3GXDA 4W84A 1MQPA 5CZKA 3ZT7A 3CHCA 2WCGA 1J0YA 1C93A 1CLVA 3SUUA 2NT0A 3MKKA 3A47A 1V3HA 3AMDA 3ARSA 1JYXA 1PX8A 1MFUA 1J10A 1TUXA 3ZR6A 1XD0A 1JZ2A 1X6LA 1B0IA 1P6WA 1ISYA 3DHPA 3A4WA 1ZBWA 2XWEA 5CG0A 4YN5A 4HPGA 3WD2A 3VGDA 4MNJA 1XCXA 4F9DA 4W88A 2WMIA 5IXEA 2X1IA 1ECEA 2VC9A 1W3JA 1AMYA 1PZ2A 1KXTA 1ISZA 5DO8A 1CXEA 3FNDA 3HU7A 4UOQA 1DWIM 4ACZA 1M03A 4PMOA 1LL7A 4S3KA 1M01A 3ARWA 2DIJA 4PMQA 4AMCA 3OGSA 3AS1A 1B3YA 1G94A 3AQUA 1E6XM 3HN3A 1K9FA 5HXMA 4XZWA 3UEQA 3WKZA 1JXKA 2RGLA 5TD4A 3UG5A 3F4VA 2GJXA 3SCQA 1QNPA 4ATLA 1OINA 2C8NA 2DDXA 3AXHA 3GH7A 4TOQA 3QOKA 1JZ3A 3PTMA 2V3EA 3MMUA 4UTFA 1NH6A 3ARVA 4V27A 4BCEA 1W2VA 2OYKA 2MANA 4AD1A 3FAWA 1E0WA 4OOZA 2BV9A 1V0LA 4AZIA 1XSKA 3KL5A 5A95A 3WSUA 3L2LA 1E5NA 2BVDA 1ZBKA 4JL1A 3W24A 3MS8A 3SCUA 1OGBA 3WH6A 1DWJM 2VX5A 2AOSA 4D6HA 3VNYA 1QVBA 1DWHM 3VIMA 1R85A 1UD5A 2YDRA 4AEFA 4HZ6A 1NOUA 4PTXA 4URIA 2XG9A 1BG4A 2ZX5A 4PMVA 4DM2A 3BMVA 2WWCA 3VPLA 4ACZB 1XD1A 1UKPA 5IFTA 3T08A 4JHOA 8A3HA 2D3LA 2E4TA 3VNZA 1W9UA 1W9VA 4DUXA 1Q4NX 4PN2A 1NM9A 4IM4A 3AS0A 1B2YA 3WNKA 1J11A 2X8RA 4AYSA 3TOPA 1J18A 2PWHA 1U2YA 1JZ6A 4MTVA 2GJXB 5LA0A 1BAGA 3AYSA 4HMDA 1LL6A 1VFUA 4MB1A 2O9TA 4J3VA 1PIGA 4NI3A 4M29A 2ZUTA 1BSIA 3L4TA 4XB3A 7CGTA 1G1YA 2D1ZA 4FLQA 2A3HA 1JD9A 4BQ5A 2BS9A 2CEQA 3WQ8A 4JFTA 5M5DA 5IHSA 4QFUA 3DC0A 3W28A 2J8FA 2YDSA 2OLHA 1GOKA 1YHTA 1NOWA 7TAAA 1W3HA 3DHUA 4JFUA 4UZSA 3AIUA 4W89A 4QLKA 3MUIA 4ZEPA 4FMVA 3VD5A 1OSEA 3VD4A 1IV8A 8CGTA 1O6IA 2VVNA 2VVSA 4DWSB 3CZKA 2X05A 2J7HA 4RE4A 1CEOA 1E6RA 4AXNA 3IJ7A 4TVDA 2QMJA 1CWYA 3AS3A 3DYOA 1H11A 1UH4A 1V08A 3HJEA 1D3CA 2UY4A 3KL0A 3I3BA 3U57A 1QW9A 1EO7A 2CYGA 4TVCA 5D9MA 1LWJA 1MFVA 4UQDA 1H1NA 1CGXA 4CD8A 1QHPA 4LQ1A 1JF5A 1WDQA 3UETA 2EQDA 1JAEA 1ZL1A 4XX6A 1MW2A 3AIWA 4P7RA 9CGTA 1W1VA 1E4MM 1JNDA 2CESA 1G5AA 4B15A 1H41A 3APGA 2WYSA 3FAXA 4PYSA 4Z2GA 1ISWA 1QPKA 4W87A 3VTRA 4UFMA 5FIPA 4BF7A 2J74A 1QNRA 2CNCA 4TX8A 4D6IA 2E0PA 2WLZA 1GQLA 3VD9A 2GFTA 3SUWA 3VIGA 2FDMA 2NT1A 4Z2HA 1VBUA 2XSAA 5CQ1A 3WH7A 5I3DA 1KGXA 4JKKA 4NRRA 3CZGA 2PF0A 2Y8VA 2WNWA 2WVVA 2OO2A 4C7FA 2YOCA 1EXPA 1J0JA 3OGVA 4UQCA 2PWGA 4L4PA 3RM8A 1WO2A 3BMWA 2O92A 1V6YA 4PMZA 2A3AA 3SURA 1FH7A 3VIPA 4PTWA 4Q22A 2CBJA 3CUIA 2UY5A 3WD4A 5I24A 2DT1A 3EDJA 3D3AA 5DFAA 1UZ1A 2CETA 1GJWA 3QHNA 4P8UA 1TMQA 3PZTA 4MPKA 1LJYA 1U30A 2VTFA 5A3HA 4HU8A 1LL4A 3U7VA 2PI6A 3QR3A 2BY3A 3GNOA 1XV8A 2WK2A 1V6VA 1ITXA 3K4AA 3AHZA 3K8LA 3SUSA 3WQ5A 1HVXA 5C8BB 5FKYA 2VR5A 3WDRA 4UOZA 1UWQA 3OA5A 3W6MA 2XFFA 1G01A 4M1RA 4UQEA 2XFYA 5HOSA 2YKKA 2ZXAA 5ABGA 1BTCA 2WVVB 2ZUUA 5KZ6A 5IFPA 1EQCA 2DSVA 2WXDM 1OBAA 3AZTA 4U31A 2WSPA 4E2OA 1KCKA 1UKTA 3L4UA 4R27A 3WNLA 1JDDA 1W9DM 1BVNP 1W1YA 2PB1A 4AZ5A 2VRQA 3WUGA 3CMGA 2ZWZA 2VQUA 2XUCA 2E9BA 4LPCA 1MW3A 5DT7A 1UR1A 1VJZA 4CU8A 1FOBA 5D8ZA 3PZVA 5A2CA 1VEMA 3L4YA 3SCWA 2TAAA 1E40A 2DEPA 2W92A 4U3CA 3IAQA 2GSJA 3LPFA 3BAKA 2BY0A 2XVPA 4Z2JA 1EDTA 1JZ7A 1UD8A 1VB9A 4GIAA 1B1YA 3WQ4A 1ZB5A 3W4RA 3AHYA 1OIFA 1H0IA 1V3LA 4BA0A 2VX6A 5BXRA 1MXDA 5CSUA 4X0NA 1CDGA 4UOJA 4UFLA 1HJUA 1BFNA 4QLJA 1HNYA 1FP8A 1PBGA 1JYWA 5GNXA 1PEZA 3CUFA 3RIKA 1XH2A 4WKHA 3ZMRA 1UWUA 1MQRA 3IJ9A 5A6LA 3G6LA 1UD3A 3MO4A 3G6MA 3THCA 2E8YA 3CPUA 2W61A 3PZ9A 1MYRA 3F5KA 3ALFA 2PWDA 1JFHA 3PTQA 4AC1X 5DF0A 5A8MA 3UG4A 4UQAA 1QI4A 4E8DA 1EQPA 5E6ZA 4HA1A 2PWEA 5FOOA 2YL9A 1FH9A 1NP0A 1RP8A 1QNSA 2BVYA 5AC4A 4GZJA 2DH2A 4W5ZA 1OIMA 4CCCA 3VDBA 1NWTA 4B3LA 4N0RA 3OG2A 1E71M 1HKIA 4PSRA 4AZHA 2BHUA 4F9JA 1W32A 1FHLA 1JI2A 2JALA 2WW5A 2XVKA 4F79A 4JFSA 1JYNA 2WWDA 3LPOA 2J7BA 4KRUA 5LA2A 3M46A 3EDKA 3MV01 1UUQA 2VCAA 3BC9A 5AC5A 1UD4A 4TTUA 2C0HA 1JGIA 2XYLA 1US3A 5GPRA 3KL3A 2ZIDA 4XV0A 2XGBA 4PMDA 4V28A 2GVYA 4L4OA 1MXGA 1KR1A 3CBWA 4UQBA 3EBVA 1TVPA 3AISA 1PZ3A 2XM1A 2V5CA 3VU2A 3WBAA 3W53A 3TTYA 1Q6EA 1E4NA 1OT2A 1KQZA 3RJYA 1OB0A 1AQHA 6TAAA 3NCOA 2X0HA 3W6LA 2ZXBA 2VZVA 1HKMA 3OZPA 4DUVA 1KQYA 5DMYA 1XC6A 2UY3A 1J9YA 1B30A 2DSZA 1NWUA 1GVYA 1HKJA 2QMKA 1BYDA 4X0VA 5JBDA 1ODUA 1X1NA 2HISA 3OBAA 3CZJA 2GK1B 1BG9A 3W25A 3U5YA 2VZUA 2D3NA 1TVNA 6CGTA 4WIWA 3TTQA 1JAKA 1NOFA 2VO5A 1B9ZA 4JAWA 4CD6A 1C90A 1OD0A 3WENA 3DYPA 1E43A 4LXFA 1V3JA 2CPUA 4DM1A 4K68A 5I77A 5A69A 3WL0A 1C8QA 1QI5A 2YDQA 2ZE0A 3PZGA 3K4DA 2WB5A 4PUDA 1BGAA 1D2KA 3UR7A 1Q6CA 5C71A 2WKLA 4PTMA 1R87A 4HTYA 1KXQA 1WNOA 4FK9A 3A6OA 3LMYA 3PTKA 2WZEA 4Z2KA 1E0XA 5CLWA 1C7SA 4OJYA 5KEZA 3A3HA 3BLPX 3CUHA 2CHOA 5LYRA 1KXHA 3AIVA 3WELA 4WF7A 2XVNA 4OBRA 4H7VA 1UKOA 3WBEA 3KE0A 2WVUA 3B9DA 3RJXA 3N18A 4P8XA 4D6CA 2Q8XA 2JF6A 2WHMA 3M7SA 2AAAA 3WF1A 5A6SA 2VRKA 4UNIA 3ZSSA 2WZIA 3RPMA 4BS0A 2WMFA 1JDCA 2DT3A 4GO8A 5CXPA 4J3XA 2GDUA 2VZOA 1LG1A 4CGTA 2EBNA 3KWXA 1I1WA 5A6AA 2D22A 5I79A 4AWEA 3VVGA 1VFFA 3FHAA 1N82A 1QHOA 4LYPA 5A6BA 1CECA 1V02A 4WSJA 1PX3A 2WMIB 2WMKA 4GI9A 2G4FA 2ZUVA 2VX4A 1DTUA 1EOKA 5FCZA 2VR4A 2EPOA 1C3FA 4PMRA 1CXFA 1ESWA 3PZOA 5HBFA 1JZ4A 1H0GA 4EE9A 5A2AA 4W8BA 4IUGA 2W62A 3ZM8A 4AD3A 4H8UA 5I0DA 2YA0A 3M07A 2RGMA 3DYMA 1XSJA 2FHCA 4KRTA 2W91A 1JZ8A 1HJVA 3ARQA 3WNOA 4KMQA 1UG6A 2X0YA 1C8YA 5A6JA 4HMCA 4BQ4A 2VJXA 3PZNA 2F2HA 1WB0A 2EPLX 2ZOXA 4NSBA 3OLGA 3CIVA 5AYIA 3CUJA 5D9OA 3CLWA 4RE2A 3RCNA 3UR8A 3ARUA 4F8XA 2ZXDA 4U33A 2VRJA 3SUTA 3AHTA 1CXHA 3CUGA 4AIUA 3MUY1 3VILA 1V02E 1WZKA 2FHBA 3B8SA 5A6MA 3BGAA 1W1TA 1K6AA 2VL4A 3WEOA 2IUZA 3OZOA 5LA1A 3TP4A 1H2JA 5BXPA 3KEHA 3WMSA 5C70A 4MNKA 1AQMA 3AHXA 2DIEA 1W9PA 2D0FA 2YLAA 1QBBA 1F4HA 4H41A 2G3JA 4D6GA 4JKLA 1B3ZA 1JD7A 5A8NA 1ITCA 1UA3A 3WF2A 1IZKA 2J8GA 1J0IA 4C7DA 4J27A 4EAMA 3GNPA 3N9KA 4U2ZA 4WJXA 4UFKA 2VZSA 3WDPP 3WN6A 1Q6GA 1V6WA 3EMZA 4W86A 4AW7A 4P7OA 1GQKA 1I1XA 3WH9A 1HF6A 1XYFA 3D5HA 2ZXQA 1FH8A 4AZBA 1LF1A 5CJ5A 3FXYA 3OLIA 3WQ6A 3WNPA 4RE3A 3PN8A 3CZ8A 1FFQA 3UCQA 4PUEA 4AZGA 1DWGM 1WKYA 2ZICA 5A8QA 5CGMA 1CIUA 2WBKA 3DECA 5FD0A 4Y7EA 1DWAM 1KFWA 3WUEA 1V0KA 1WE5A 5A8OA 2WLYA 4MAVA 2A3EA 1H5VA 2CIPA 4OIFA 2DSWA 2V38A 1TCMA 4R5EA 1JG9A 3K46A 1V3MA 1ZJAA 4J7RA 1OM0A 4X9YA 1CGUA 3CO4A 2BHZA 1MWOA 1UHVA 1JXJA 1QNOA 3WY1A 1WZAA 3BCDA 2GUYA 1UH3A 1E6QM 4GZEA 3CH9A 4H8HA 4OKDA 3VINA 4H2CA 2XPKA 1BYAA 3S6TA 1O7AA 1UOKA 1U33A 1XRVA 1HP4A 4GPNA 4GINA 1NWSA 2DQXA 4PCSA 1MVYA 5HDRA 3UERA 3POHA 1F4AA 3VIKA 1RH9A 2WHKA 1S46A 1A47A 4UFJA 1HL9A 5BRQA 2YL8A 2YJQA 3AMGA 4B9ZA 5E9AA 4E8CA 4DWSC 2XVLA 1AQ0A 4U5KA 4ZENA 4B16A 2ZX6A 3RMEA 3T0DA 1C92A 1E1EA 4CD5A 2Y5EA 3WDHA 2UY2A 4AIEA 5HPCA 4TXEA 5CPSA 3ZJ7A 4MJ2A 2IXUA 2BHYA 1UR0A 1WDSA 3CHFA 3N15A 1B3VA 5EMYA 1R7OA 2G3IA 3ZR5A 5E0CA 4LGXA 1OCQA 4D6JA 3A4AA 1J0KA 1V0NA 1GVIA 1PPIA 1UQZA 4MNLA 1LLOA 3NDZA 5DEZA 2XSBA 3N04A 5D9PA 1YQ2A 1BYBA 2V3DA 4MJ4A 3WD3A 2Y24A 4AD2A 1WZMA 3VDAA 3WD1A 4YHGA 1V03A 3PZIA 1GQJA 2WC3A 1TR1A 1Q6DA 3GXIA 5BROA 3GXMA 5E09A 4J3UA 3W26A 3QHOA 5DT5A 4PCTA 3AIQA 5CGTA 3BAXA 1GHRA 5ABHA 2D0HA 2WCAA 3PZUA 1GNXA 3WL1A 5IHRA 1B90A 3AIRA 4UZUA 2CBIA 4W7WA 1HVQA 3W27A 1E72M 3VIOA 5I78A 2VCCA 5CPTA 2G3MA 1HJSA 2Y2WA 2Z1SA 2YBUA 4KWUA 4AEEA 1HJWA 4P7QA 1VJSA 2EJ1A 4CVWA 3WDIA 2WKGA 3TONA 1GZJA 4J3WA 3WUBA 1NP2A 4QCFA 3M6DA 3NUKA 1ZJBA 1OGGA 4CCEA 2Y4SA 4JZ5A 3WEMA 2DPEA 2GJPA 1UD2A 2WMJA 3MU7A 4AD0A 3SCVA 1ISXA 3RDKA 3TTSA 5ABEA 3ALGA 1JYVA 2J78A 2J7DA 3AYRA 1M7XA 4FZOA 3LPPA 4JHZA 3ARPA 4EKJA 1GPFA 1K9DA 3VD3A 2D0GA 1TA3A 2J7CA 2V3FA 1LG2A 3VDCA 3AXXA 1EDGA 4NZCA 1V0MA 2PWFA 3AZSA 1GOIA 2F8QA 3O9NA 2E9MA 4HPHA 1WPCA 3ARRA 2D23A 1DHKA 3QOMA 3VMOA 3VM5A 4HA4A 4JCMA 4M80A 5BXTA 3T09A 2E8ZA 4ZFMA 1EHAA 4JFVA 4IPNB 3GBEA 3NSMA 3AIEA 4KGLA 1VAHA 4CN1A 4M56A 5D4YA 3T2PA 2QLYA 3U7BA 3II1A 3GH4A 4AZ6A 1CGWA 3PZQA 2W66A 5CPQA 2DGAA 2CBVA 2NSXA 1E6ZA 1HN1A 2VZTA 4WSKA 5EFDA 3IK2A 3FW6A 4D6EA 3WH8A 1C91A 2BVTA 5I5RA 4AZ7A 2JE8A 4D6FA 2CBUA 1E6SM 4P7LA 1UR9A 1Z32X 1E4LA 1NARA 3BAIA 3L4WA 5CSYA 2WMHA 3S2CA 1UR2A 4P8WA 3I3DA 3WF3A 2G3NA 3ECQA 2QV4A 1HP5A 3TTOA 1G9HA 3OGRA 4W7VA 1Y7VA 3MANA 3ARZA 4EANA 3AICA 3POCA 2ZWYA 4J3TA 1Q6FA 2O9PA 2FH6A 1W91A 2WBGA 3BCFA 3N17A 3K1DA 3NYDA 1LQ0A 1R7AA 1UH2A 3CZEA 1WDRA 2CITA 4TTGA 3T0BA 3W37A 4OOUA 4U2YA 4FF5A 3GBDA 3QGVA 1QBAA 1XGZA 5EBAA 2XVGA 1VEOA 3GYCA 4M8UA 2OYLA 2PBOA 2O9OA 3MSGA 3SUVA 3VIJA 1GOWA 1GOOA 3AOFA 1EOMA 4JL2A 3MUZ1 2J7GA 3HMCA 4FLOA 2WVSA 4W8AA 2BXYA 3SEPA 2QF8A 3WFZA 1TG7A 2WHJA 4A3YA 1EIBA 1EHNA 2XFRA 2XIBA 1DWFM 1HIZA 5JIPA 2VCBA 4YPJA 4ZE5A 2YL6A 1X6NA 1UYQA 1HXJA 4CD4A 1J01A 2XJ7A 3IANA 1GOQA 2GJRA 4JIEA 1QI2A 4Z2LA 1UWIA 1BPLB 1ODZA 1LWHA 4UR9A 1RD6A 3BAJA 3VIFA 1MW0A 4RL3A 5D9NA 3RILA 3KZSA 3MSDA 3N1AA 5AYBA 1V3KA 3ZJ8A 5I23A 3WDQA 5ECUA 3CTTA 5I6SA 1NQ6A 2CHNA 4PMNA 1E70M 2XTKA 2D24A 1ZBCA 1VFOA 1UA7A 3WIJA 4D71A 3MMWA 1ZU8A 2B31A 2WHLA 1HJXA 4JCLA 5M3WA 4HA3A 3OIHA 3AIBA 4P8VA 1UR8A 1EO5A 4A3HA 1KCLA 4IISA 1L8NA 1QI0A 4CUCA 4W5UA 2E3ZA 4LYQA 4QP0A 4NRSA 3L4ZA 3LPGA 4UCFA 4WLCA 3SCSA 3T0AA 1M04A 2XIIA 2ZX8A 2OYMA 4ZE4A 1VFMA 2FHFA 1QW8A 3CHEA 2CCRA 4CU6A 3I3EA 2A3CA 4D72A 5E0FA 3NSXA 3J7HA 1BYCA 1RP9A 1CXIA 1JL8A 2YIHA 5E70A 1CTNA 1IZJA 1UKQA 3UG3A 1KGUA 1PAMA 3U5UA 4AY1A 2GDVA 3FHQA 2J7FA 4UFIA 1UKSA 2ZX7A 4BQ3A 2E40A 4FLSA 4DUWA 1GUVA 1E6PA 1VF8A 3BXWA 4F66A 3WUFA 1CBGA 3NSNA 3WNMA 3ZIZA 5BWFA 2VUYA 4M24A 5A1AA 3MMDA 3NIYA 2XWDA 3VM7A 4D1JA 2WC4A 2VX7A 3SCRA 4EK7A 4P7NA 3WQVA 1MW1A 3AMCA 3F5JA 2PBGA 4PMXA 1W3LA 2YLLA 3N11A 2E9LA 3VKKA 5E6YA 1WZLA 1K9TA 3WF4A 2WVTA 4DWSA 1C8XA 3EDDA 1E0VA 3VX0A 4M81A 3WFLA 4QLLA 3WQWA 3VO0A 1QOXA 1QI3A 4GQRA 2WANA 4IPLA
chains in the Genus database with same CATH superfamily
1E15A 5FL1A 2J79A 1NQKA 4NZFA 5AZ0A 2VEPA 3TEVA 4H19A 4QISA 5HK4A 2G41A 4TO8A 3EA3A 4JIQA 1E9LA 4NY2A 1DJIA 4HT3A 1I4DA 3NXFA 5AFDA 1EDQA 3V0UA 1SYTA 5EFFA 1ZWWA 2Z1XA 1TE6A 2D20A 3O16A 4KEVA 2GVLA 1DYSA 1GG1A 4YTQA 2W4XA 1U5JA 2NX3A 2B7PA 2V5DA 1Y0EA 1JI1A 1FWNA 5HPOA 1Y2OA 4RXFA 4RDVA 3TSBA 1B31A 5HQMA 2QDGA 1Q2SA 4HHMA 4LBRA 1US0A 3DXIA 1K02A 3BSGA 1J0HA 3DN5A 1F6YA 1V4YA 4XO7A 3VNIA 3VKJA 3ZO9A 2YDAA 2VWTA 3R7MA 2N3KA 5EB8A 3WMBA 2RJGA 1WKDA 4IFOA 4M82A 3GVQA 3LD5A 3UJ2A 4US5A 1QPRA 3TN4A 5A6BD 4UBPC 5FACA 4ZQPA 5A8PA 6A3HA 3NNTA 4WK9A 3ANUA 3CPGA 3W81A 3W82A 1H09A 3GDRA 1W5MA 1JF6A 1E1FA 5M17A 2VNCA 2XIMA 1WCGA 2DUXA 4ORMA 1UQYA 1OF6A 2FVMA 4JIPA 3WLPA 1D7FA 3U48A 3N13A 3GKFA 4EZYA 1MRAA 2EKGA 3V0SA 1UR3M 4BJHA 1HL8A 1TR9A 1P48A 5JIWA 2O9RA 1FXPA 4MPQA 2RJHA 4C90A 4U3AA 1J79A 1BTMA 1PWLA 1XFBA 3TJIA 2BG5A 4MYXA 4AUBA 2E67A 3STPA 4W8LA 3ZJKA 1UJQA 2OWCA 3VOHA 3SY5A 3DHFA 3QQ1A 1QW7A 1XFCA 1XH0A 3GU9A 3EWXA 4MB5A 4M51A 3IJLA 1HZYA 4GKTA 4H9ZA 3W7KA 3H2CA 4E4PA 3VE9A 1DKYA 3OODA 2FH8A 1OWQA 2DT2A 3CQHA 3CT7A 3GHRA 4XAPA 2TODA 4Y9MA 3I7SA 1GHSA 3L0NA 4C6PA 3WH5A 1XYMA 3B53X 5AC7A 3F5LA 4PSPA 2W63A 4LX4A 5C0QA 3O6AA 4PEEA 4RZ5A 3VIIA 1K9EA 4PUMA 4FLRA 1SFSA 4IQDA 3UU0A 3S3GA 2WCSA 3FVDA 2EXOA 4OU1A 3TOYA 4HZMA 3FJNA 3ZT5A 1RQHA 1E4IA 4JFWA 4AISA 4PUUA 1VPYA 1W3KA 4KH2A 3VOGA 3ABOA 3ZVHA 4WVXA 1AH3A 3GYEA 1NEYA 3MTWA 4O11A 3CZLA 1ICQA 1W9BM 3NQFA 4QDMA 5D02A 2E6AA 5KTLA 2I56A 4BI6A 3QQWA 2G8ZA 2NX1A 3RO6A 1KO0A 4Q8PA 4HU0A 4ZCWA 2EPKX 5DCEA 1A3WA 3ITVA 3T4WA 2DUZA 4B3KA 2VGGA 3WEZA 1I45A 3D3FA 3DFHA 3MJMA 1OFDA 2RDXA 2ZZ4A 1CYGA 3R94A 3OB8A 2IXVA 3GM8A 3Q67A 3ARYA 3O0KA 1F6PA 4ATWA 1XLEA 1XCWA 2H3BA 4JNFA 3L2MA 4N6FA 2O4QA 3RM4A 3KUMA 1LQ2A 3N2OA 3MSRA 3TWBA 4DJDC 1LTDA 2XIQA 1TSIA 2PDLA 3A4XA 1K7XA 1IZCA 3UWYA 3G8EA 5D8WA 1ZAJA 4QAWA 1FA2A 3LENA 2WPGA 2YI8A 3LHYA 2YPIA 2WJEA 2C7FA 1CB7B 2VQTA 3THDA 4F0RA 4LV9A 4JY8A 4UQ9A 3GWQA 2OZNB 5GNYA 4W93A 3EJPA 3EJSA 3AMLA 2EKCA 2PP3A 1NELA 1BGGA 5FF4A 3L4VA 2V2CA 4B5TA 5C54A 1L0PA 3E1F1 4N42A 2Z7GA 4A4AA 2IS7A 4M7TA 5HNRA 2F7QA 3BOFA 4DXKA 3W7GA 4C6NA 3CWOX 3BWWA 1HKKA 1JNEA 4JL9A 3ABZA 2GK1A 1I0DA 4FF7A 4O4WA 2OQLA 1WDPA 2GGHA 1F3WA 1SJBA 5EKYA 4O1FA 4NAFA 1EH9A 3UITA 1UD6A 4Q4RA 3ZSTA 1HQTA 2AMGA 3LBMA 2F1AA 5ENLA 3AO0A 1NWRA 4LUSA 3MKCA 2H90A 4WY0B 2WM0A 2QEZA 3AJ7A 2V5BA 1IT0A 3EMQA 4HSNA 5DQPA 3C7NA 3N6QA 1F6KA 1GGOA 5C9ZA 3NQAA 2VT0A 4PO2A 2QAFA 1DVJA 4ZL1A 3KS5A 1KTCA 3IPWA 1PZ1A 4GQQA 2BXVA 3AUOA 2HVMA 2OZ3A 4IG2A 3BOLA 5D30A 3GH5A 4NAEB 5CLTA 2ESCA 2BY1A 3RFAA 4AD4A 3MY9A 1O94A 5CZKA 1VS1A 3FKRA 2DZTA 3CHCA 1J0YA 3T9PA 3MKKA 3A47A 1V3HA 2G95A 1EJVC 3NG3A 2ZRVA 3ARSA 1JYXA 1KRAC 3DPPA 3KBJA 2OXNA 1XD0A 3BLEA 1KA9F 3BZJA 2D2GA 1P6WA 4L65A 2ZA3A 3STGA 3TXZA 5FJUA 5CG0A 4HPGA 3LBOA 4F9DA 5IXEA 3M5XA 4E6MA 1AMYA 1IR1A 3W7NA 1CXEA 2POTA 3EZ4A 4H6HA 4ACZA 4O1DA 4DPPA 3BUQA 2DIJA 3OGSA 1G94A 2FMNA 3DC8A 4GFIA 2V30A 2RGLA 1B3OA 3W22A 2RAKA 2HK0A 2GJXA 3SCQA 2REQA 2DDXA 7REQB 3B0VC 4V27A 3QPZA 3HQOA 1PYFA 1U22A 1SGJA 2OYKA 2MANA 1FHVA 4GH3A 1KKOA 4Z42C 4S1FA 1G4EA 2BV9A 1XSKA 3S5SA 3BICA 3WSUA 2BVDA 5DY2A 2OO0A 1OGBA 4DJEA 4CQDA 2VX5A 2AOSA 1OX6A 1TRDA 3PC0A 3VNYA 4HR1A 4QSHA 3S2JA 4URIA 2A2IA 1I4NA 3VPLA 4TV5A 1XD1A 1UKPA 1NJJA 5CC3A 4J3ZA 2OEKA 8A3HA 1OX4B 4PBFA 1BXNA 4O1CA 4RZBA 4DUXA 3SYVA 4PN2A 1NM9A 3PG9A 1IEXA 3AS0A 1B2YA 2PGEA 2A6LA 4GIRA 3CXOA 4MTVA 1BAGA 2F38A 3EX3A 4HMDA 2QXLA 1LL6A 3H7UA 4BEQA 3LM7A 4Q8TA 1TWIA 1BKSA 2O9TA 3H26A 4J3VA 3RNDA 1IGSA 4B2DD 3L4TA 1PKMA 4QX4A 1FTXA 1XIFA 3EX1A 5G1TA 3WQ8A 3V0TA 1SU7A 4QFUA 1XXXA 2J8FA 1EWEA 4PCFA 5D37A 3O05A 1GOKA 2ZZ3A 1H50A 1W3HA 4JFUA 3WX7A 4UZSA 3AIUA 1XBVA 5BOEA 1PS9A 1XQKA 1RLCL 4QLKA 1DQXA 3PBWA 1G7VA 2YYTA 5E9XA 4WZHA 3VD4A 1IV8A 5AHNA 2VVSA 2EX3B 4DWSB 3QJAA 3P82A 4E2VA 3TJXA 3IJ7A 1IWBA 2QT3A 5EYWA 2QMJA 1CWYA 5G5IA 3N25A 3C8FA 2I5GA 4YVPA 4EZSA 3M0YA 4C65A 1B4KA 2PDNA 4KQNA 5I03A 3KP1A 3KL0A 3XINA 4FOJA 1NFBA 3I3BA 3R25A 2CYGA 4TVCA 1LWJA 1GYMA 5HULA 4GJJA 4UQDA 1CGXA 4X2PA 4DN1A 1WDQA 3UETA 1Z7AA 1JAEA 1NDZA 1VHNA 1ZL1A 3A22A 3IJDA 9CGTA 1PE1A 1VQTA 4CNNA 2CC0A 1XS2A 3VNDA 1H41A 3APGA 2WYSA 5MKGA 1QPKA 1QWGA 2OBMA 1S2TA 3QC0A 3UNDA 3UJRA 2OG9A 5FIPA 3PM6A 2NQ9A 3S5NA 2CNCA 3KRSA 1KC7A 1M1BA 4LUYA 4TX8A 4D6IA 2IPGA 2R1LA 3VD9A 1GQLA 1XLDA 2VFHA 4QE5A 3HZ3A 4H6EA 3S9ZA 3CKDA 1O60A 3VIGA 4XZLX 2PD9A 1VZWA 4R34A 2B4GA 1L8PA 4NI8A 1KGXA 4Y9NA 4JDBA 3CZGA 4KWVA 4EXQA 2PF0A 2Y8VA 2WNWA 2OO2A 4OUIA 4C7FA 4DI9A 2YOCA 3ATZA 2I17A 3OGVA 1TKKA 3GKAA 2GVGA 3LI0A 1GNLA 3RM8A 1WO2A 3BMWA 3E74A 3VIPA 4PTWA 3EJRA 2CBJA 3CUIA 3W74A 3GC4A 1IWPA 3EDJA 3D3AA 3F2CA 1UZ1A 4Y2WA 3I68A 2YCJA 1HO1A 1TMQA 5G4EA 1VLIA 1LJYA 1FKWA 1U30A 2FFIA 2BZNA 3G1VA 1LL4A 3CWHA 3GNDA 3QR3A 3N2BA 3U4AA 4I7WA 2WK2A 4RW3A 4ZO8A 3T47A 4UNKA 3MBFA 4XKMA 1V6VA 1I2RA 4JTDA 2DZUA 1OK6A 3O3NB 3PPGA 3SUSA 4HU4A 5C8BB 5T9CE 2C16A 4O0ZA 3EAUA 2KAUC 4ZO9A 1GEHA 4M1RA 4UQEA 4AYGA 2ZXAA 1S3TC 1LRNA 2OU4A 1RCQA 2Q01A 1EBHA 3NVTA 1PDZA 2WXDM 1U83A 4E2OA 3DDMA 1KCKA 1SFTA 2Y7EA 1X97A 4R27A 3CTLA 3EB2A 4AZ5A 4HKPA 2O7QA 3WUGA 4LPCA 1MW3A 2GSEA 3W1PA 3W88A 1VEMA 3L4YA 2H6RA 1PSCA 1E40A 3QNIA 3C2FA 3IAQA 5BMXA 4JPGA 4QNEA 1DE5A 4JEJA 1QOPA 2BY0A 2X0SA 1EJXC 4Q7IA 3OVQA 1JZ7A 1UD8A 1VB9A 4GIAA 4K1WA 1FDJA 3E0WA 3P2VA 1XGEA 1M65A 1GVOA 5CC7A 3D51A 1ZB5A 2NQZA 3GXPA 3W4RA 5B7ZA 4BA0A 2GA9D 4B4FA 5BXRA 5KZMA 2PE4A 4ZB5A 5CSUA 1HWWA 4GG9A 4X0NA 2INFA 3L7RA 3QFEA 4OTKA 1CDGA 2PU1A 1BFNA 4QLJA 1HNYA 3TQVA 2DZXA 4R5LA 1PBGA 1FQ0A 5GVJA 3CUFA 1XH2A 4WKHA 1RBLA 4HYRA 5A6LA 3CASA 4DXVA 2E8YA 1DJGA 1TV3A 3SSJA 3B0YA 3PZ9A 3C8NA 2RT6A 3SSZA 3RAOA 2BGNE 2PWDA 1W1IE 1E9VA 4BWLC 2W3ZA 4LRTA 4E8DA 2E68A 1EP2A 3PR2A 3P3BA 4H9MA 5FOOA 2NQLA 1FH9A 4IWWA 3F2DA 5PTDA 3VE7A 4R85A 4GBUA 2DH2A 4W5ZA 2H8ZA 4EPBC 2R94A 4B3LA 4N0RA 3OG2A 3IV3A 2Z2BA 4KWOA 2JALA 2XVKA 4F79A 3K5XA 2BODX 5KMYA 3MV01 3MP3A 5EMJA 8XIMA 3CAVA 2C0HA 1CB2A 1JGIA 5GPRA 4RNFA 3R89A 1K6WA 4AU0A 3BJTA 3USBA 4V28A 2DW6A 1FWIC 1MEIA 1KR1A 3CBWA 4UQBA 3R10A 3UQNA 3GFYA 3EKGA 3IIPA 4Z1YA 5CJNA 1PZ3A 2Q13A 2BP1A 4F4RA 3VU2A 5KITA 4ZQRA 3VUSA 4L5ZA 3LZ3A 3RJYA 4C6CA 1YDVA 3DBNA 4KIEA 2ZVRA 4MFDA 2ZXBA 2VZVA 1HKMA 2DZSA 4DUVA 1KQYA 3W70A 3WBWA 5DMYA 5FEPA 1XC6A 4ATMA 4HYBA 3G77A 4O28A 4EOUA 2CLPA 3L5MA 5JBDA 1E9IA 1ODUA 4NU7A 3LZ5A 1PCWA 3CZJA 3URAA 1XI3A 4AF0A 2Y85A 2GK1B 4R5IA 3DFYA 4IX2A 2D3NA 2RUSA 4QEHA 1VH7A 5T8GA 3I04A 3TTQA 2YFOA 1JAKA 4HNCA 2GJNA 4WDXA 2J6XA 3IUDA 4LS2A 5DBTA 1X7IA 2YYUA 3GY1A 4PMJA 2CPUA 4DM1A 4V15A 1C8QA 1QI5A 4YXGA 3CEUA 3SIZA 2YDQA 4MM1A 2YCKX 2ZFAA 4GUGA 2O0I1 3B8TA 5CG7A 1TYGA 1YTEA 4WDTA 5M1TA 3DG3A 1I4LA 5HWNA 1CCWB 3B03A 3LMYA 1XDLA 2I5IA 4Z2KA 4GY7A 1WDWA 1RCOB 2Q71A 4LNYA 1ME9A 1H7OA 5A8GA 2RAGA 3AIVA 1JDEA 3EPOA 4RK8A 2HCVA 2WVUA 2BLEA 1P1MA 4PZVA 3T55A 3N2TA 2YXOA 2C13A 4M0MA 5HR7A 4D6CA 3UPWA 2D4CA 4KRZA 3DPOA 3WQPA 5HMSA 5KZEA 3ZSSA 4HU3A 3Q45A 2QF7A 4JTFA 3TLQA 4AWUA 4LOCA 5HR6A 5CXPA 4IM2A 3OHIA 2GDUA 2NSOA 4JBRA 3QR1A 4NX0A 5I79A 3R58A 1N82A 1QHOA 1CECA 5AHLA 7ODCA 5F2IA 2VFGA 1J6PA 2J27A 4GI9A 2YZ5A 2G4FA 2ZUVA 5C9XA 4PMRA 1CXFA 3PZOA 4DBUA 1H0GA 4EE9A 5FI8A 4IUGA 1F05A 4FM3A 4IMDA 4EZOA 2YA0A 3M07A 4XAZA 3QZAA 4KRTA 2F9RA 2H8XA 2W91A 3B40A 1Q6OA 4OHQA 2REQB 1C8YA 2E1DA 4O57A 5REQA 1Q4WA 5KZDA 3PZNA 1A4MA 4ZMGA 1HFBA 4KIRA 5D9OA 3CLWA 1JR1A 3MYOA 3UR8A 5JVLA 3HG2A 1RBAA 4R9XA 3TAOA 2VRJA 5DMLA 3CUZA 2YFNA 2DZPA 3AHTA 3STCA 3M0IA 4HSOA 4HHLA 2HDJA 3MUY1 1V02E 3EOUA 2B7QA 3BDKA 5A6MA 1UW9A 1W1TA 4IUOA 3WK1A 1M6JA 1SJCA 1KCZA 4JIRA 3ABSA 1S5TA 2IUZA 3TP4A 2OO6A 1FWHC 1AH4A 4ZGYA 4GFSA 4C1KA 2GJLA 3LHTA 1F4HA 1L6WA 3WCZA 1B3ZA 2GQAA 4JR5A 3E0VA 1OFRA 5LNSA 3QYQA 4L61A 3KBNA 3WF2A 3KHJA 2DVTA 3MBDA 4NQ1A 2Y7FA 3N9KA 4WJXA 2GPTA 4JTQA 1Q6GA 5XIMA 3EMZA 4AW7A 3DDFA 4HHHA 4P7OA 1GQKA 3WH9A 4MZ8A 3U9IA 3D5HA 2ZXQA 3VZXA 4AZBA 1LF1A 2FZ9A 4RE3A 1W5QA 5MF5A 3CZ8A 4PUEA 1DWGM 4YTSA 4EF9A 1SZGA 4UTIA 4C5ZA 1WKYA 3LS9A 5G4HC 1TZ9A 4KEZA 5A8QA 3V18A 1CIUA 2R1KA 3A64A 1POJA 1UP0A 1DWAM 2Z4GA 3WUEA 1RA0A 3EWWA 4PB3A 1WE5A 5A8OA 4AX7A 5M2FX 4OIFA 8XIAA 2PGRA 4R5EA 1JG9A 3KWSA 5GJPA 3CZNA 1OM0A 3DPQA 3LK6A 5HMEA 1K7FA 2KHOA 1JXJA 1QNOA 4NNCA 1WOAA 1E6QM 3EEZA 3U2OA 4MWAA 4HNOA 3CH9A 4H8HA 4OKDA 3AU6A 3VINA 1LRQA 3H4WA 1O7AA 5DXXA 1UOKA 2F6KA 4IGHA 1RCXB 3FJ6A 1FCQA 4GINA 4PCSA 3B0XA 3SRKA 3P7YA 4A29A 2XH2A 3DHDA 4UFJA 4JYDA 4DWSC 3BW4A 1DJWA 1AQ0A 3RLHA 2BOGX 4ZENA 3I4EA 3P60A 3RMEA 3T0DA 3HOJA 4C6JA 3HGJA 3IVUA 4CD5A 3WDHA 2UY2A 4NQIA 5HPCA 3ZJ7A 3KVKA 3E38A 1WDSA 3N15A 1S5NA 1E1DA 1R7OA 1GZGA 2AGTA 4IT1A 2NVAA 4MSSA 3ZVIA 1OA1A 4LGXA 3IJ6A 4D6JA 5CPNA 2ABBA 1J0KA 1V0NA 2P53A 4Q3MA 1GVIA 2ZBTA 3KBSA 4MNLA 1SUXA 3NDZA 3NQVA 3N73A 5DEZA 1OFAA 1YQ2A 1DHPA 3PJTA 4MJ4A 4N02A 1XLAA 3BQ5A 3KBVA 4AY7A 3BVVA 5HNTA 3B8WA 3PZIA 3NQEA 3HPFA 4PRRA 5C5BA 2C19A 2PCEA 4BR1A 3GXIA 4J3UA 3WLNA 1XLKA 4PCTA 3L0KA 4GQBA 3BAXA 3EKLA 5LIYX 1OY0A 2OZ0A 3NQGA 2D0HA 4GWEA 3WL1A 3AIRA 4J5NA 4GYFA 2IKGA 3MDWA 4GGBA 1IIHA 1J96A 2EJAA 4A8NA 3LTSA 5J04A 1HJSA 2Y2WA 3V3WA 4H01A 5HUPA 3LCIA 3ORWA 2FQIA 4J3WA 3WUBA 5E0KA 4HSHA 3M6DA 1QPOA 3IS4A 1OGGA 4CCEA 4LC6A 4JZ5A 2GJPA 2WMJA 3SCVA 1ISXA 2NXHA 5ABEA 1JRCA 4MF4A 3ALGA 2J78A 3KVJA 3VCNA 1LOQA 2J7DA 1XLJA 2XINA 4FEZA 2RH9A 2V81A 1GPFA 3U0HA 2GQ8A 1TA3A 3SO7A 2J7CA 2V3FA 3PJUA 3C2OA 4XAGA 4DF1A 2PWFA 5LIKX 1Q3NA 3TSDA 2E9MA 1WPCA 3GTHA 2ASHA 1SO4A 1DHKA 5LNUA 3UXLA 3VM5A 2CWNA 1W5OA 1H61A 5AHEA 3WZ0E 4JCMA 1OZQA 1LUCA 4LC8A 2Z24A 1Z42A 4LVFA 4LSBA 3PPCA 4JFVA 1K8CA 1VKFA 3GBEA 1VAHA 3RLUA 5D4YA 3U7BA 3II1A 4LB4A 4LAZA 4MHBA 3W7OA 3LRLA 1E6ZA 2VZTA 4WSKA 3IK2A 4D6EA 4YYCA 4AZ7A 2JE8A 4Q8MA 1JQVA 1XG3A 4JTGA 1UR9A 1DQWA 4HCDA 5CSYA 2WMHA 4ZOBA 3MC5A 2G3NA 2Z2AA 3DH7A 2QV4A 1VP5A 5LZLA 4W7VA 3QY8A 1Y7VA 3POCA 1D9EA 4J3TA 2O9PA 1BVWA 1W91A 3WYZA 3QRHA 4AVOA 3C0QA 1X8CA 1R7AA 2EAWA 2P76A 3FJ4A 3P14A 3KLLA 3LMFA 2YSWA 3ANYA 2X1UA 3GBDA 2YIVX 3CNYA 1D8WA 1AL8A 4ALDA 4MZ1A 2PBOA 1AW1A 2ZZ1A 1GOWA 1EOMA 4A05A 3MUZ1 3HMCA 2F7FA 1GKPA 1BRLB 4FLOA 2R6OA 4W8AA 3QSTA 4XSLA 1HUVA 3RK8A 3MCMA 1O95A 1REQA 1X1ZA 3HGSA 3VNLA 3ICJA 3IRSA 3WQDA 3HTWA 4WCJA 1EHNA 1DWFM 4WX2A 5AVNA 4DF2A 2PGWA 4J1OA 2FGBA 3OBKA 3FA3A 2YX0A 4CD4A 4Z1BA 2FPTA 2R14A 3FX4A 4ZOAA 2UZ9A 3G24A 1UWIA 1BPLB 1ODZA 1LWHA 3GS6A 1FDZA 3VIFA 3H2FA 1MW0A 2CLMA 2OGYA 5BNKA 1FWGC 2WSYA 2FZDA 2Y89A 4ZSTA 3RILA 3KZSA 3MSDA 2OB3A 4F0SA 2BTMA 3FJLA 3MWAA 3LBCA 1V3KA 1UUMA 5I23A 3G1XA 2ICSA 1R33A 5ECUA 4LUIA 1NQ6A 1XLCA 4IIEA 4PMNA 3UWVA 1E70M 2D24A 2FDSA 4CNTA 4D71A 1W3IA 2B31A 2WHLA 1KM2A 4GX9A 4NZJA 1BD0A 3NVDA 4GLEA 1DPMA 1S5VA 1Q66A 1EO5A 1GPWA 3CWNA 4H3DA 3QR0A 4W5UA 5XINA 1FY6A 2VP8A 3F03K 3L4ZA 1RZMA 4QEEA 2XDFA 4UCFA 4WLCA 3TKFA 2PGFA 1UP2A 1M04A 2XIIA 3GNXA 4ICNA 3TA6A 3EXSA 4QGCA 3R11A 1QW8A 5B7YA 4XVEA 4D72A 1I6NA 2GUBA 1PZ0A 3LHVA 2DJXA 1KKRA 1MEHA 4UR8A 4IP7A 5E70A 3WO8A 1UKQA 3UG3A 3GZ3A 1JCXA 2GDVA 3CZSA 2J7FA 4L6OA 2ZX7A 4GUHA 4BQ3A 4LAMA 2EHHA 2QDEA 3ZIZA 1D8CA 2ZRUA 4G8TA 4I7UA 1P4CA 4X9SA 3S5ZA 5LKYA 1KTNA 4D1JA 2WC4A 3NEVA 2E5BA 2WZMA 4GK8A 5AHMA 4PMXA 1DXEA 5AYYA 3N11A 4EXBA 4FNUA 3V5CA 2E9LA 1Y8BA 1K9TA 3WF4A 4KIKB 3GO2A 5FSDC 3VX0A 2GF4A 2YZRA 5FF3A 3WQWA 4GQRA 1PS3A 4IWOA 4IPLA 2YBTA 2ZX9A 3AHVA 4CNUA 2YB1A 3DKJA 3WJSA 5DMNA 3IJ8A 3KBWA 2ZUMA 3B9EA 3GDBA 3AZRA 4M6QA 4IGNA 4S3EA 1JCMP 3NAVA 3GR8A 2HJPA 2ZYFA 4HK6A 4UTMA 5J5DA 2ZUSA 2HVOA 4I3GA 4C1NB 2HWGA 1GONA 1JFXA 2OCZA 3VGGA 1KFEA 1DP0A 1UZ4A 4OFCA 2G4JA 3KTXA 1A5CA 5CZJA 3BLDA 1B3WA 2F1BA 4F3HA 3SFKA 3NQBA 4G6CA 2JIEA 1BSLA 2X7WA 4U5IA 4WEVX 3PPFA 2R9RA 1W5PA 5D2WA 4LEFA 2Q3RA 2OX1A 1SQ7A 3IACA 3QPEA 1X96A 4FNQA 3R43A 1PCKA 1PKNA 1Q7MA 3BUIA 1B3XA 6PTDA 4IQLA 4AIBA 2AKMA 1DXFA 3S6OA 4DLMA 5I2UA 1TWSA 1CXLA 4KF1A 1G6CA 3SCOA 4LTSA 4PMUA 2EPNA 3LGDA 1EKOA 1KBBA 4B5NA 4HZ8A 2VURA 1TZZA 1M53A 3ITGA 3K1GA 5CAKA 4GYPA 2R1PA 3E6EA 1BWVA 1AVAA 4HP5A 1TMHA 2MI7A 2V5KA 3O0FA 3TU9A 1S38A 1CNVA 3UPMA 1EA9C 3C6CA 2W0UA 1VBRA 1LBMA 3CHDA 2W5FA 4W85A 3W1NA 4XKYB 2R1NA 3EB3A 3N9SA 1BLIA 3WQOA 1H49A 5A2BA 3PBGA 1H3GA 3L4XA 3N2MA 1G67A 9XIAA 4DZHA 3QMRA 3ZT6A 3CUXA 1FCUA 4DJEC 2HNEA 4JX5A 3BLKA 1OGSA 5U4NA 2OR2A 3NOEA 1SU8A 4XISA 1QNQA 4F2BA 2OSYA 3W7JA 2J13A 3APYA 4HZ7A 3ARXA 1R0MA 3V35A 4FR6A 1K8YA 1MQQA 4PMYA 2VI0A 1CGTA 1G4SA 5ABFA 4XAFA 4OECA 4DVOA 4O54A 3U8GA 3WJZA 1HT6A 1UWSA 2WC7A 2AL2B 4BFAA 4B5XA 2RKXA 1MNSA 1CGYA 3S83A 1KBIA 3MI6A 3CL7A 3JVAA 2J77A 1UUOA 3UG8A 4MYAA 4KGJA 2WNZA 1JDAA 4HB7A 4EZUA 5JBFA 1C7TA 1A49A 4EZXA 1XRTA 2J75A 5JXQA 5A6KA 1R30A 4XD6A 1T41A 1XX1A 4XUYA 3JZEA 3W72A 4Y96A 2C71A 3TX9A 3RO8A 3C2VA 1KLYA 1KGWA 2UWFA 1RVGA 5F4SA 4CKQA 8RUCA 4FZPA 2Y61A 4GCXA 4PFMA 2P88A 5GQBA 1QHZA 2CWXA 4PB4A 5BRPA 2XH7A 1TMLA 5HAOA 3LXBA 1Z69A 1R2RA 4S2CA 3OIXA 2VYOA 1UIPA 1DOSA 3KOWA 1XW8A 1XPYA 3MHFA 4CD7A 1FCBA 3WLTA 2BNJA 4CU7A 3MWCA 2VMFA 2Y8UA 4DBEA 2OEMA 4Q33A 3CGTA 3VGEA 3OLDA 5LHFA 3NDYA 1EWDA 1XCFA 1GCYA 4Q6XA 3OA3A 1CT5A 1O5KA 3C0JA 3BGJA 4ZFCA 2UBPC 1E73M 1EP3A 5IBXA 4CN6A 1CPUA 2W67A 4IFKB 3EOLA 1OADA 1PIFA 2ZKMX 1UC4A 3N12A 2ZCGA 4NILA 3Q2DA 1A5BA 3SDOA 3MHUA 2D2JA 2F61A 4IIDA 1FFRA 4F48A 1F9CA 1PB0A 1W9XA 1TE1A 2INEA 3G2GA 2ZA1A 1EEXA 1VENA 3PULA 2BY2A 1V3IA 2OKOA 1LT7A 4CCDA 4PA8A 2EG8A 2CKRA 2DZWA 2V0OA 1DIEA 2HQAA 4J28A 1R3WA 1G69A 1ME7A 1WOBA 2O55A 3F4DA 2E1WA 2A7PA 2ISVA 4UXDA 3AS2A 1KB3A 2BFGA 4HOXA 2MNRA 4EF8A 3G3DA 4H6KA 1AW5A 1F3TA 3S1WA 4B9YA 3PUEA 4OBSA 4GZIA 1R34A 1VBHA 1VIWA 1TA3B 3KX6A 4R53A 2XN2A 1EGZA 2QCFA 4FZSA 2OODA 1BF2A 2QCNA 4QG6A 1Q7QA 4AZCB 2V5LA 4Q4KA 4AKVA 1WXYA 1K8XA 2QHAA 3UW6A 4A22A 3WQFA 3DGRA 1B9BA 1YX1A 1GQIA 4C6DA 5FF0A 2WSKA 1GWJA 3AI0A 1Q8AA 3FEMA 3APTA 2MUCA 3JZUA 5BOOA 4BZYA 3UESA 1ZS2A 4KT2A 3O7UA 2EWFA 1OT1A 1PKLA 1SZEA 4QS5A 4CEXC 2DFAA 2OSXA 5A6TC 4MB3A 1GORA 2ND1A 1C29A 3BAWA 1AD4A 4W84A 5LNVA 2WCGA 1C93A 2XH4A 3BPWA 4GIYA 3CYJA 5K9CA 4IWQA 1YBQA 2QVHA 1MFUA 2QPXA 1TUXA 5ABTA 4NKCA 4B2DA 1QT1A 4LVDA 4DY1A 3LLFA 5EY5A 5FLEX 3KW3A 4Q8NA 2YCEA 2XWEA 5CBIA 3ELFA 3HF3A 1EJWC 3PY2A 3VGDA 4WDWA 3P8JA 4W88A 1HL2A 1W3JA 1KRBC 3W00A 5DO8A 1REQB 1QRQA 3HU7A 4UOQA 3TXVA 3H24A 2QKWA 1M03A 4S3KA 1Y5XA 3LCLA 5EBUA 3ARWA 1XGDA 2HPMA 2QCDA 1E6XM 2OLSA 1V77A 4XZWA 3BLBA 3UEQA 2FTWA 1JXKA 4IJBA 4MY8A 3F4VA 2Y62A 1QNPA 3VZZA 4ATLA 4D2JA 3MSYA 1OINA 1T99A 2C8NA 2CU0A 3AXHA 3KCJA 3ZLFA 1RQEA 3PTMA 3MMUA 1NH6A 3D6NA 1GG0A 4MY1A 5AZ1A 2GYIA 3FAWA 3R8RA 3O15A 4QAIA 3KL5A 2F84A 2OQYA 3VOIA 3SCUA 4GQ0A 5HNUA 4D6HA 4NZ5A 4G2DA 4Q8QA 3BVWA 3FYYA 1R85A 2YDRA 3IIXA 4AEFA 4HZ6A 1NOUA 2XG9A 3R0KA 2ZX5A 4PMVA 3W2LA 3BMVA 1EX5A 2PWVA 4BEUA 4B5WA 4K7YA 3P81A 3C0LA 1O7DB 3EPNA 1R3YA 1KNWA 4K38A 1W9VA 4Q4PA 1P1XA 4QSFA 3OK8A 3W7MA 4N9EA 4HBKA 2HBXA 3GAYA 2X8RA 4JNMA 4AYSA 3TOPA 3GFXA 1J18A 1U2YA 1PDYA 2PS2A 5LA0A 3AYSA 1JUBA 1VFUA 3N2CA 3WFAA 5I3JA 1G1YA 4FLQA 2A3HA 6XIAA 4S3CA 3P84A 5M5DA 1N8IA 1XQLA 3DC0A 1DIKA 4EZQA 3VKDA 4QBXA 1NOWA 3TJLA 5H8MA 1V51A 1XBZA 1AW2A 2NWRA 3QW4B 4ZEPA 4M6UA 3CC1A 1ZGDA 5F1UA 8CGTA 2HV5A 1ONEA 2PY6A 2VWSA 4AVNA 4R3UA 4F2TA 2X05A 2J7HA 4RE4A 4HNUA 1E6RA 3OYXA 3OHXM 2X3XA 2I9EA 4TVDA 4FR1A 2GL5A 4K2SA 3I4KA 1J5TA 1V08A 3HJEA 4WPEA 2IPJA 4YMZA 2OKTA 1C8VA 3CHVA 1KV8A 3U57A 4CCZA 2ZZ5A 3L0GA 2VUNA 5D9MA 1H1NA 2DZAA 4WUIA 2NV2A 2YIBA 1K70A 4XX6A 4WY0F 4C6QA 3L67A 1HGWA 1W1VA 1E4MM 2CESA 1G5AA 2HEJA 3REQA 1YADA 4PYSA 3YPIA 1ISWA 1TWDA 4XBSA 3VTRA 4NASA 2P8BA 2WZTA 2E5DA 2IKHA 4FZIA 1QFEA 4BWLA 3RV0A 1QR7A 2B81A 2Y70A 3W7HA 4Z2HA 2FDMA 2LLEA 2XSAA 1ONWA 3WH7A 3WLIA 5I3DA 2FLIA 3SQSA 4IP5A 3MB9A 4JKKA 2CFFA 3O63A 3QMSA 4RZ6A 4D9PA 2YI9A 2VGIA 3TNOA 1EXPA 1W31A 4UQCA 1LORA 3THAA 5A5WA 3FFSA 2PWGA 3CM4A 4L4PA 2O92A 3GR7A 1FH7A 1ZPTA 5HJLA 1NY1A 2X40A 3BE7A 2UY5A 4KETA 1LCOA 3QHNA 4P8UA 1TQWA 4QRNA 3IGXA 3A3WA 1C9DA 3PZTA 5EPDA 3NFUA 4LVAA 3IGHX 4AX6A 1B54A 3U7VA 3RX2A 4I9TA 1O1HA 3AYTA 2P0OA 1VLWA 1J93A 2P0IA 3UNTA 3CK5A 3GVRA 4IIBA 1AFSA 3IIOA 3ZLGA 1RAKA 1GTHA 3WQ5A 3I6EA 4ADSA 5FKYA 2VR5A 2CLIA 3TH6A 2XFFA 5HOSA 4RZ4A 4DEFA 5ABGA 2WVVB 3P0XA 5KZ6A 2DSVA 4PGLA 1Z44A 1OBAA 4U31A 3G0SA 1K4HA 2WSPA 1TPH1 3AUJA 1UKTA 1W9DM 4XZIA 2PB1A 3SY1A 3AWOA 1YNYA 1Q8JA 7PTDA 3NQCA 2VRQA 2ZWZA 2E9BA 4GRSA 2ZC1A 1RQBA 3K4WA 1UR1A 1VJZA 4CU8A 5LIXX 2CZ5A 2A7RA 3IJQA 5D8ZA 3N6JA 3TR2A 3D47A 3SCWA 3RITA 1LDCA 4EPKA 4K36A 1UPXA 3LPFA 3BAKA 2XVPA 4E4FA 2C1IA 3WQ4A 2OW7A 1AQFA 3KOFA 1XLIA 3GI7A 4IMGA 3BVTA 4H6IA 3KAOA 4IX0A 4B90A 3CAZA 2FTPA 3TYDA 3GU2A 2PDHA 1EFZA 3C5QA 2GQ9A 4R5JA 1K7EA 1TPVA 2PEVA 1PEZA 2ZZ2A 3M0VA 3RIKA 2A4AA 3TVAA 2L5HA 3WLJA 2JBMA 1UWUA 3G6LA 2C18A 3G6MA 4DF0A 2G96A 2HE5A 1XLFA 1PIIA 2JQXA 3BLOA 3SECA 4DAIA 1J2WA 3T6CA 4AC1X 5DF0A 5A8MA 3QNJA 1R2SA 3UG4A 4INFA 4YJ5A 1QI4A 5I02A 1FWJC 1EQPA 1TUFA 4UMCA 2D1LA 4HA1A 1EC7A 5TF0A 3PB2A 2X5CA 1LLWA 3GVGA 1NP0A 4N2YA 1RP8A 5FA5A 4G7EA 3DX0A 4GZJA 4E3VA 1OIMA 4I1QA 4CCCA 2DVXA 5C9RA 4LS0A 2WSRA 3M0XA 4PSRA 3T0CA 1JI2A 3NL5A 1OCBA 2J88A 4JTHA 5DANA 2WW5A 1JYNA 3W85A 1UROA 4LBUA 3WQCA 2WWDA 3LPOA 3RHGA 2EFKA 4MWAC 5LA2A 3M46A 3EDKA 1OC7A 3EOOA 3W1AA 5C2CA 3BC9A 2QDDA 4LANA 3ERPA 3BV7A 1Q6LA 1UD4A 4TTUA 2ACUA 3VCRA 3KL3A 1A50A 1ZYLA 4XV0A 1GEQA 1AG1O 4Y8EA 2GVYA 3DX2A 3IVSA 1H7RA 3BANA 3IK4A 4G1NA 3UYCA 1TVPA 5F2MA 1IXPA 4NT0A 2PDPA 4Q6JA 5EMKA 1OF8A 2I16A 1LQ7A 1Q6EA 2YXXA 2R91A 1OT2A 1TX0A 1KQZA 4JTAA 1OB0A 3UGRA 2HS8A 2G5WA 4NJIA 1XYBA 3E5BA 2B0MA 3V4BA 4I8DA 5I3FA 1DQUA 2ALWA 1AL7A 2PF8A 2I14A 1BYDA 3O6YX 1SO5A 3OBAA 2G0WA 2X3VA 2QAPA 4J2PA 1XLLA 4EACA 1DJXA 1BG9A 4REQB 3U5YA 2NQ5A 2VZUA 3W1LA 1PTDA 2VO5A 3KRUA 4JAWA 2A5HA 1C90A 1YXCA 5HQEA 3T4AG 1E43A 2BASA 1K03A 5BU6A 3VKBA 4H9YA 3CV7A 1SR9A 3DGBA 1HO4A 5I77A 5A69A 3N14A 1SO3A 1TTIA 1JUEA 3L23A 2PPGA 4DNMA 1OYCA 4L64A 4RNHA 1Q6CA 5C71A 4PTMA 1WUFA 2I57A 4AH7A 4HTYA 1KXQA 3W87A 4R7WA 5CCZA 1C7SA 1EGVA 1UZHA 1X39A 3BLPX 4E5TA 4L4MA 3QY6A 1M7PA 3JR2A 3GXTA 3LCWA 4C60A 3DZ1A 4FOKA 2Z1WA 3FKKA 2DZBA 3QKEA 3T0TA 3RJXA 3DFOA 4P8XA 4QROA 2Q8XA 5BRBA 4LALA 3GIYA 4XQ6A 3UR5A 3PAJA 1X8FA 3R6IA 4XWUA 4BS0A 3P61A 4L9XA 3H6OA 1TJPA 4KWSA 1W3NA 3P6LA 2HRWA 2PZNA 1TV2A 4GABA 2VZOA 1LG1A 1I1WA 3D52A 3EWZA 2D22A 1ME8A 4JHMA 4XD4A 3DKLA 1V02A 3K2GA 3NR0A 3EX4A 1EZ2A 1DTUA 5FCZA 4WXYA 3LEPA 1JZ4A 1OC5A 4OQVA 4W8BA 1PXGA 2A1YA 4ZBCA 1MMFA 2W62A 4KBXA 3UYIA 5I0DA 3NEHA 3DI0A 5CZ0A 2RGMA 3DYMA 3H2AA 2VFFA 1FHUA 4GJIA 3LGEA 1QWKA 4C6EA 4KMQA 2LXYA 4M19A 5A6JA 3W2NA 2VJXA 6TIMA 4NNBA 2F2HA 1WB0A 1ONRA 1HTIA 1FWBC 3TFXA 3OO2A 2V5JA 2RHGA 4YNGA 3RRXA 4RE2A 3TJ4A 1JDFA 5I00A 4JDYA 1H7WA 2ZXDA 4U33A 3AXKA 3S5YA 3H54A 4GHRA 1CXHA 3D2FA 2R8WA 1VCGA 3CUGA 3TK7A 4AIUA 4D8LA 3B8SA 1XIEA 1GZ1A 3BGAA 2FTYA 1K6AA 4MJZA 4IMCA 1KM4A 3BZGA 3W1XA 1H2JA 4FXRA 4XO6A 4LUTB 1JEZA 1XL9A 5C70A 1GTEA 3M7WA 2D0FA 3TC7A 2YLAA 4M3PA 3PUOA 1AJ2A 4ZTYA 4H41A 2G3JA 3Q94A 4JKLA 1UPPA 2ON3A 3ITLA 3M0HA 5A8NA 2QUVA 3DDGA 3ER8C 3RCMA 1AJZA 1O1ZA 4HVXA 1IZKA 4JD4A 4AC7C 2J8GA 1J6OA 4C7DA 3UY7A 4J27A 2TYSA 3GNPA 1QPQA 4U2ZA 3GG7A 4K39A 4UFKA 2VZSA 1ZJIA 1HW6A 1X1OA 2VM8A 1I1XA 4AHOA 1HF6A 1XYFA 3VXGA 3FLUA 2WJFA 2OT1A 2AGKA 5CJ5A 3ABRA 3WNPA 1NAL1 3Q58A 2DIKA 3A98A 3S42A 4L6DA 4F2UA 2WO5A 5K7JA 4ROQA 3DECA 4Y7EA 1XISA 1V0KA 4DQWA 1O7DC 3V36A 2A3EA 3F2BA 3P8IA 4EPDC 4ZQOA 3N19B 1TCMA 3K46A 3ANVA 4ZQMA 4X9YA 1MWOA 3EWYA 3VDGA 3ABQA 3ZR4A 4RCXA 3GG1A 5D03A 1WZAA 3BCDA 5FJJA 4GZEA 1CX9A 3REQB 1L6SA 1T5AA 4A21A 3VFCA 3M3WA 1P5BA 3NA8A 3T4CA 5AKQA 3S6TA 1EUNA 2QW5A 5GJNA 1U33A 1F74A 1OG6A 4GNVA 4GPNA 2DQXA 3KS6A 5HDRA 1UOZA 2Y5SA 3GW0A 3UERA 3POHA 1F4AA 1YNQA 3VIKA 3W7PA 2WHKA 3S2MA 3TYZA 3VYLA 3GD6A 4DIAA 2W6RA 3JRKA 1X6UA 1XIDA 5E5CA 1AJ0A 4O50A 3H7VA 4U5KA 4EVZA 1Z6KA 4B16A 5TBOA 3Q65A 1E1EA 1A0EA 1IEVA 1TQXA 4JTEA 1W8GA 4M6PA 2C3ZA 3CHFA 1UR0A 3LU2A 5EMYA 2VDHA 1PTGA 4JN8A 2G3IA 2GLKA 4JYEA 3ZR5A 4RNJA 3HPSA 4JTRA 1UQZA 1DKXA 5JH1A 3I65A 1TVLA 1U5VA 2YCLB 5D9PA 2V3DA 2BX7A 1T8XA 4AD2A 3LQLA 1WZMA 3VDAA 5ECVA 3NQ6A 4DWDA 1ADOA 1V03A 3UZWA 1GQJA 3SB0A 2QIIA 3W26A 2JGQA 3F7JA 3OVRA 3OBEA 3AIQA 4BK9A 4BY3A 1SM9A 4TV6A 1EJTC 1GHRA 2GWNA 1ZRQA 2ACSA 2Z29A 1B90A 2X2GA 2CBIA 4W7WA 5IDZA 4U28A 4BHYA 1E72M 1XIBA 3VIOA 4YS1A 4D8JA 3H4XA 1Z41A 3MHGA 5I78A 1AA1B 1A5MC 4GH1A 4ORIA 3W71A 3GB6A 1GVQA 1VJSA 2EJ1A 4CVWA 3WDIA 4H9UA 3TONA 4GZ7A 4QCFA 2ATMA 1VYPX 2ZTKA 2NZLA 2Y4SA 1P6CA 3W1RA 1GQNA 5C55A 3W7LA 3RDKA 3G3MA 1YXDA 3GG8A 2EF9A 3ARPA 4EKJA 1K9DA 1F73A 4H9TA 2D0GA 4JQ1A 4IQJA 5E84A 1EDGA 4GYPC 4NZCA 2PTZA 2HK1A 4LAKA 5D32A 2VKZG 2WM1A 4O0KA 4KCTA 3E12A 3HB9A 2D23A 3TQKA 1DJYA 1IT8A 4HA4A 5BXTA 4DYEA 4G6QA 3M9YA 4ZFMA 3TAKA 3SRHA 5E1QA 3NSMA 4EAYA 3AIEA 3CAKA 4KGLA 4QJ4B 1SUFA 1P7TA 2FZ8A 5D05A 2KZHA 4YWIA 5TAOA 3B8UA 3RU6A 1CGWA 3OZYA 3T81A 3F4NA 1S1PA 3E02A 3GC2A 2NSXA 1W1A1 1TQTA 5BMWA 5EFDA 1OFBA 4A6GA 5EMLA 3FDKA 4PTDA 1B4EA 3UP8A 4D6FA 2CBUA 1E6SM 1VPXA 1NARA 3BAIA 3L4WA 3S2CA 1UR2A 1L9WA 2QKFA 4KW2A 4O18A 3WF3A 5DCBA 3TTOA 4WHBA 4GCAA 3MA8A 3UWEA 2NXIA 3MANA 3HAIA 2ZWYA 3GXNA 2FH6A 2RDUA 3RMJA 3ERCC 5C2GA 1TPWA 2WBGA 4LFYA 1IQ8A 1LQ0A 1T96A 1A4LA 2PC4A 4LY8A 2QYGA 1MDRA 1XRFA 4XUGA 2RDWA 4TTGA 3W37A 4HTBA 4U2YA 1VJIA 4FF5A 2PZ0A 1Q85A 4GNJA 1J8VA 3GW3A 5EBAA 1G7UA 2GZXA 2IPFA 5LNRA 2EFLA 4FNPA 1O68A 1OFQA 2OYLA 3GYCA 5HWMA 1ZJHA 3MMTA 3SUVA 1GOOA 4JL2A 2HXTA 2J7GA 4JTIA 1R38A 3I7QA 2XN1A 4AMAA 1H60A 3PP7A 2QGYA 5K3VA 4PULA 3EPMA 4HJFA 4Y9AA 3LCHA 1W1B1 3WFZA 2OOGA 1VBGA 1BWLA 2X1TA 4A3YA 2IQTA 1EIBA 4PBEA 4N9DA 1TRIA 1P0BA 1OZMA 4ZE5A 4DPQA 1ITQA 4IOTA 4FALA 3XIMA 4OT7A 3EGJA 4UR9A 3LY0A 1OCJA 3JS3A 3CV2A 5D9NA 3NL2A 4LCSA 4H1ZA 5IBXC 1FDYA 3MI2A 1SU5A 2GGGA 1WAUA 4ZA0A 3WDQA 3BMXA 3CTTA 1R9XA 1LBFA 2RAJA 4IW0A 1I9CB 3LRMA 4S3GA 2CHNA 5I6SA 3WG6A 1KFBA 4OBTA 4JNEA 4JQAA 1ZBCA 4H8SA 5L9FA 3VK5A 3WIJA 1I0BA 3S47A 5M3WA 3MJYA 4HA3A 3EB4A 3M0KA 1UR8A 1YTDA 1L6YA 2VENA 1KCLA 1L8NA 3LLLA 4ZQCA 2Z0VA 4LYQA 3TTEA 1QJWA 4RPQA 1DORA 3SCSA 3WQEA 4H7ZA 3T0AA 2ZX8A 4FNSA 1BXBA 2OYMA 2FPYA 5H8PA 3LHWA 3R4IA 3LI1A 3RV1A 3QPYA 3SJNA 3T78A 5E0FA 3W2MA 3UXKA 4BI7A 1DJNA 1CXIA 2E25A 1CTNA 1IZJA 3OJGA 5I7GA 1KGUA 3S4TA 1PAMA 3U5UA 4DO7A 3FHQA 2E40A 3DESA 3H7RA 4DUWA 1VF8A 1H51A 3U2CA 3NSNA 3WNMA 1M5WA 2VUYA 2F2KA 5A1AA 1XBYA 3VM7A 1NTHA 3TQPA 3PB0A 3F5JA 1W3LA 3MQTA 3ENLA 2A7NA 3N4FA 4G56A 4E4UA 3VKKA 5E6YA 3UWZA 2QCLA 1TTJA 2X41A 4IL0A 3SADA 4MLJA 4O52A 4GD0A 3EDDA 3P62A 4U4MA 4M81A 3VO0A 1QI3A 2WANA 1XKYA 4UWMA 2J62A 4GVGA 4CEUC 4C6BA 1J0ZA 5FJOA 1XIIA 2J4GA 5LGZA 3O3RA 4JKMA 3BH4A 3W7RA 4GXPA 1ONXA 4HNNA 4AY8A 3FN9A 2V69A 4ASTA 2OVLA 1WAWA 2JF7A 1RPKA 3NL6A 3RUBL 3MP5A 2WNQA 3K8KA 3SCNA 7ENLA 4LS1A 2ANUA 2Q12A 1UWRA 3LRKA 1V7YA 1TPEA 4QM1A 1H5YA 1G0CA 1ZY9A 7A3HA 3AYVA 5DELA 1XYZA 4LF2A 1A3HA 3TA9A 6ALDA 3SGGA 2EG6A 4IMEA 3RRAA 4LAUA 3VKCA 1DXIA 2ZZ6A 5U7SA 1XIJA 4MUZA 2OMAA 3VUPA 4BQ2A 1Q45A 3OLEA 4O17A 3OWGA 3G18A 1XIHA 1KFCA 3IEBA 2ZADA 1EEPA 2QJGA 1H1YA 1CXKA 1RJQA 2VDIA 4PUKA 3ARTA 4R33A 1DEDA 4HK7A 5AY7A 2YA1A 3GZAA 1TJ0A 3PSWA 4ZXOA 3PHAA 3VZYA 4C91A 4Q8UA 2XGIA 1NDVA 3PFRA 3WNNA 2PTXA 1EZWA 5IDIA 2PMRA 3HG3A 3UWUA 1QAPA 1XHGA 3TN3A 4OE7A 2C1HA 5M03A 1EPVA 3KHDA 1KCXA 4YL2A 1MSSA 2WYIA 3W9ZA 4M7SA 5H6HA 5HANA 3EWCA 1V7AA 3WD0A 1JZ5A 2J66A 4OUEA 2ZUNA 2EGZA 4CVUA 4Z2IA 1XSIA 4Z08A 4IGSA 4ZXLA 1XLGA 4V2XA 3RLGA 3TR9A 4PH6A 4MOZA 2BOFX 2EPMX 2QJIA 3B9NA 5I3KA 4AEOA 4PUNA 3IAPA 3UXDA 4EZNA 1XBXA 4MAZA 5I07A 2IPWA 3PSVA 2J24A 1OX5A 3LHZA 4CN4A 4L6HA 4XAYA 1E55A 2A3BA 2JEPA 4JWEA 5HJXA 1UWTA 3PJXA 3VGBA 1W2PA 2DU2A 4FOUA 3EMCA 3PANA 4H04A 4E3TA 3M64A 1KWGA 4C7GA 2JEQA 3FA5A 2OPJA 3H23A 3G0UA 1E6NA 3ER9B 1DJZA 4TVUA 4JTCA 5HINA 2PRMA 3AXIA 4LYRA 4Q4OA 1AMKA 2BMBA 4IICA 1EX1A 1KFKA 4GA8A 4ZSUA 3K8MA 2DSKA 2JKEA 1W0MA 2DQWA 2NW0A 1ISVA 2OWWA 2QPSA 2QJHA 3V1HA 5I3IA 5MHBA 3E0LA 4F01A 2PRLA 5JQ9A 4NXSA 4GKLA 2DH3A 3DBPA 5HNNA 3T49A 4GUIA 3VGFA 2X09A 2PDBA 4KS0A 2YBVA 2QVNA 3BUPA 4QJ1A 1TPC1 3S46A 1VPQA 4FXFA 3FOKA 4NF7A 4OZOA 3SR7A 4H7CA 1US2A 3SIMA 2D2OA 3CO8A 2GQ3A 3EDFA 3TW6A 2DUAA 4LH8A 3HPXA 4MADA 1SZFA 3OEXA 3LSBA 3XISA 4JN6A 2EEXA 3EOEA 3L9CA 4PBGA 4H8VA 3RR1A 4AFYA 3VIHA 2DY3A 1NDWA 1SSDA 4MDPA 2VEIA 3NJ3A 4UFHA 4HNTA 4JIIX 1BHGA 1V93A 1GOMA 1HXKA 3P74A 1GVEA 1E51A 1LOSA 1JCTA 2OEJA 4J3SA 3IGSA 3MV11 2X30A 1MXSA 3QVQA 2J6VA 3KDNA 4GIEA 1EP1A 1A0CA 5F7UA 3ZOAA 3T8LA 1XC4A 2FGZA 3ABHA 2VXNA 3JUGA 3S1GA 4DUOA 4PR4A 2TRSA 4B5UA 4O10A 5G1YA 1A5UA 3ZVHB 3A13A 3GHSA 4WOZA 2A6NA 4MG4A 1GVRA 3VMPA 1WDDA 4AIOA 1W1ZA 4ZQNA 3MUAA 3VD7A 4I9MA 3PFMA 4ACYA 5HQLA 4NJGA 3AMKA 3PTDA 4ZO7A 3ZJ6A 4FX7A 3TV8A 3V75A 3D4ZA 2OSWA 3PLTA 5BYWA 4QJ3B 1E3XA 5FSEC 3GR4A 4QCEA 3W2JA 4AHQA 2HVNA 1H4PA 4NZ3A 3M5YA 3PZMA 3SCPA 3GNRA 3S6DA 2NXGA 1FHDA 3TDFA 1KR0A 1KM1A 3WMCA 1QTWA 3W38A 4RR4A 3D0CA 1T6MA 4Q7NA 3OHMB 5CJMA 2JNKA 4NAEA 5C7HA 1PHQA 2XZ9A 3HGOA 1CI1A 3CMJA 2TMDA 4DJFD 4XBJA 1TX2A 3G22A 2GUUA 3WBYA 3AROA 3IVTA 5KSWA 1ZAIA 1FCVA 3HMJG 2BSLA 2H9AA 3RM9A 4NNAA 1SJDA 1DBTA 3SI9A 1TJ1A 2DT0A 1E56A 1HX0A 4M6VA 2Z0IA 4E38A 3TC6A 3H70A 3QV6A 2PURA 2VD9A 2JIWA 3AFBA 2CERA 3MT1A 7XIMA 2NQJA 3OW1A 1VC4A 4FX8A 3BO9A 1BVZA 1A5KC 3FGCA 2X3WA 4E2DA 3MCNA 3PK7A 4MB4A 5H8UA 1WP6A 1CLXA 4W7UA 1HJQA 1KM5A 1R86A 1R8LA 4HOZA 4NL1A 3H2NA 3KTCA 3EYPA 2QCEA 1BQCA 4XZBA 3TW9A 3F1QA 3PUGA 3S1XA 4RXGA 3B3DA 3GRIA 4O19A 2ZRZA 4HN8A 1LZOA 1KXVA 2CZFA 3LXCA 3N4AA 4ERGA 2Y8KA 1UASA 3VGHA 3ZQ9A 1YLVA 3DENA 2NLIA 1C9WA 1QK0A 1MQPA 2Z28A 1PL9A 2NT0A 4NAFB 3TIMA 1DL3A 7REQA 3B0PA 3AMDA 3SQLA 4RX0A 2E28A 5I3HA 1GT8A 4YCPA 4IM0A 4LUSB 5CPOA 3RX3A 5CKSA 4IIGA 4DYKA 3HBLA 1X6LA 3GK0A 4D8ZA 5FESA 1M3UA 1HKWA 1B0IA 3ITXA 2AQOA 3S2NA 4FB7A 1JCLA 3R8HA 1VYRA 2SFPA 4YN5A 1ZENA 2BOEX 1XCXA 3KAWA 3R0UA 3HG5A 5H91A 1OJXA 2X1IA 1ECEA 2P1FA 4JYFA 3LTPA 1PZ2A 1YKWA 3BCJA 2Z1BA 3FNDA 4IG2B 1DWIM 5T9BG 3SZ8A 4PMOA 1LL7A 4B91A 1OX4A 3PVFA 3ME3A 4PMQA 1OEPA 3AS1A 1B3YA 1PKYA 3HN3A 4K7VA 1K9FA 5J8LA 4MKVA 3WKZA 5TD4A 3UG5A 3ATYA 3AALA 1TV5A 3HV9A 1O5XA 4TOQA 1JZ3A 3T40A 4UTFA 2Y6ZA 3UY8A 1W2VA 4AD1A 2ZDSA 5C9UA 2O4MA 2Y88A 3UJFA 4QS6A 4XIAA 4OOZA 4AZIA 5A95A 3M16A 3L2LA 1J2BA 1E5NA 3T07A 3MS8A 4RE0A 3BURA 4NJKA 1DV7A 5F2GA 3PBVA 3BW2A 1QVBA 1RY0A 1EL3A 1WXJA 3DYTA 3T05A 4PTXA 4AVFA 4Z1CA 1LP6A 3W23A 1GN9A 1J5SA 4ACZB 3OVGA 5XIAA 3T08A 4JHOA 3LCGA 3VNZA 2E4TA 1EC8A 1MDLA 1W9UA 4FS9A 1Q4NX 4KFNA 2AMXA 5CC5A 4A2RA 3AWNA 1D7KA 1X04A 1WQ5A 3WNKA 4GY0A 2PWHA 2GJXB 2ZRXA 4YTRA 3DFSA 2F6UA 4MB1A 1WX0A 3MVTA 3CAQA 2PODA 4YIWA 2FVLA 1BSIA 1JJKA 3W1UA 7CGTA 1T40A 1JD9A 4BQ5A 4JFTA 5IHSA 3W28A 2HPIA 4FA3A 4CQ8A 2OLHA 1ZUAX 4GVIA 1LQAA 1XLHA 5C5YA 7TAAA 2ZA2A 2GGIA 4GE8A 4HR1B 3QEZA 2OZTA 4W89A 1TJRA 4XTDA 2V2HA 3C56A 2QQ6A 3W1MA 3H2EA 3HA1A 1O6IA 2VVNA 1N7KA 1EPXA 1YDYA 4H9XA 4K8GA 4AXNA 1QOQA 2PLMA 1TIMA 3M0ZA 1RV8A 1UH4A 2XU2A 5AOUA 3L5LA 2UY4A 3HFYA 3SGUA 3U6WA 2CLFA 4HYWA 5D2XA 1MFVA 4ROPA 1JF5A 3LV5A 3W73A 1E0TA 1Q6RA 3AIWA 4Z0SA 4P7RA 4JOMA 1THFD 3W7CA 3ZS4A 4DAFA 4B15A 5HATA 4Z2GA 4W87A 1O12A 1EIXA 4JNZA 1EUAA 1WA3A 3W02A 4RKAA 4BF7A 1Z9AA 1QNRA 5HWJA 4HCLA 3LV6A 4M5PA 2C08A 4Y90A 3NTYA 3Q0KA 3CIXA 4WD0A 3NQ8A 2PMQA 1H7XA 2OELA 2QZRA 3FSTA 2NT1A 4V33A 1VBUA 1ELSA 5CQ1A 1TREA 5RUBA 3UXAA 4PC8A 1QO2A 5LGXA 4GUFA 3DX4A 5CAHA 1J0JA 3V5OA 5FAGA 3O6CA 3BL3A 5FEXA 4PMZA 2A3AA 3SURA 3A9BA 4R5GA 2IQDA 2V6AA 3VABA 4Q22A 1SJAA 3WD4A 5I24A 2DT1A 2CZDA 2CETA 2PTDA 1GJWA 3BUVA 4L1WA 3W76A 2VTFA 5A3HA 5MKGB 4I90A 3E96A 1EC9A 1XV8A 2O0TA 4ZZ9A 3S9YA 3SOGA 4IJRA 3K4AA 2Q8LA 2V82A 3STEA 1HVXA 2QXWA 3WDRA