2YLHA

Structure of n-terminal domain of candida albicans als9-2 g299w mutant
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
311
structure length
311
Chain Sequence
KTITGVFNSFDSLTWTRSVEYAYKGPETPTWNAVLGWSLNSTTADPGDTFTLILPCVFKFITTQTSVDLTADGVSYATCDFNAGEEFTTFSSLSCTVNSVSVSYARVSGTVKLPITFNVGGTGSSVDLADSKCFTAGKNTVTFMDGDTKISTTVDFDASPVSPSGYITSSRIIPSLNKLSSLFVVPQCENGYTSGIMGFVASNGATIDCSNVNIGISKGLNDWNFPVSSESFSYTKTCTSTSITVEFQNVPAGYRPFVDAYISAENIDKYTLTYANEYTCENGNTVVDPFTLTWWWYKNSEADSDGDVIVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Broad Specificity to Host- Cell Ligands by the Pathogenic Fungus Candida Albicans.
pubmed doi rcsb
source organism Candida albicans
molecule tags Cell adhesion
molecule keywords AGGLUTININ-LIKE PROTEIN
total genus 69
structure length 311
sequence length 311
ec nomenclature
pdb deposition date 2011-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11766 Candida_ALS_N Cell-wall agglutinin N-terminal ligand-sugar binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ylhA01
2.60.40.2430 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ylhA02
4F24A 4MBRA 4B5ZA 2Y7MA 3IS1X 2F68X 2Z1PA 4F20A 1R17A 2Y7OA 4F27A 4LEBA 4JDZB 2Y7LA 3ASWA 5CFAA 3V10A 2VR3A 5IHWA 4B60A 1R19A 3IS0X 1N67A 4LEEA 4MBOA 4LE8A 4F1ZA 2RALA 3IRPX 2YLHA 2F6AA 4JE0A 3AU0A 2Y7NA 3IRZA 3AT0A 5CF3A 4JDZA
chains in the Genus database with same CATH superfamily
1R5VA 4TUOB 2W65B 2E9GA 1JK9A 4JQIA 1B0GB 3V79C 2XN2A 4R26L 4L3CB 1EJ8A 4I18C 4CU6A 4K3EH 2V2WA 4M7ZB 4XBGA 1DFBL 5AWNH 4KJPC 2ZOWA 4QHNB 5J1AA 4L0PB 3L3HA 1K6QH 2YIHA 4JJHA 2V9QA 1NBVL 4R9HA 1U92A 2ZOKB 1K5WA 3TP4A 2DWTA 3QUYA 5TQ0L 2W88A 1UURA 1J7VR 4LCWA 1UD8A 1G6RB 2X7LB 4N2IA 3F6JA 3B1TA 4HEPA 2XTJE 5C71A 5AW5B 3BAWA 5HDQH 3BD3A 1IL1B 4UU9B 3WFZA 5C2UB 5IEKB 5G5DA 4HS8L 2DMKA 1YPZB 4JRXB 2AGJH 5EEXA 3VXNA 4EN2A 2APSA 2KQNA 5TGBA 2X28A 5F9OL 3BP6A 3CHOA 4JY5L 5A1AA 4P04A 4LHUG 2XX0A 7CGTA 2F74B 4P49A 1ZHKA 3C6SA 4IMKA 3DX8A 3UBHA 1CK0L 2F53E 3HRZC 2EDDA 1MJ7H 4LSTL 5IESH 5JOPD 3QHFL 2KPWA 4NC2B 3PWPA 2HG5B 4BSWB 3SE9H 3VYPA 2R1YB 2OZ4A 2GSGA 1CXFA 1D9KD 4CAGA 5DD3L 3KPSA 1KLUB 3FN3A 3CVIH 3SPHA 1FJ1A 3UMTA 4WY7H 4DUVA 5L4FA 1OCWH 1S7UA 4XNMB 1ES0B 2R2HB 4OF0A 2CGRH 3MJ9L 3OB8A 2IAAC 4MXWH 4P46B 3U46A 3CBRA 1SJHA 2EABA 3H7LA 4HETA 5IB4A 3WD5H 1L0YA 2WSDA 4PY8I 2IOOA 1VESA 2XTLA 3QEGL 1ZEAH 3QUKB 4YZFF 3ME0A 3CFKB 3CSTA 2YRBA 4HFWA 4DFIA 3BUPA 4UT9H 3ZQWA 3PXJA 4XVTH 4DF9A 1A66A 1PX3A 3O2WH 5MERB 3PAVA 3D0LA 4IHOA 1OAZH 1I7RB 3GSWB 2WUBH 4YSAA 1JNLH 3T8XB 2AJUL 2Q5BA 5C0BE 5HI3C 3WHXB 3IPEA 3L4YA 4MZ2A 5E6RB 1YMME 3WXWL 5I15H 2OMNA 4A7VA 2VIRB 4PJCA 4RQQB 2Y25A 5IBUG 4AYDC 3QWRA 1OHZA 3MV11 5IHZA 3MOAH 2Y2TA 3RIAF 2A9NL 1AO7D 2WXQA 1RMFL 3BSGA 3MODL 1XH3A 4EI5B 1A6VL 2I32A 2XKNB 3QULB 1BQHB 4DPCX 3KDMB 5F9OH 2LGNA 3RNKA 1JNJA 3STZA 4DN4H 4J3OG 4JY5H 1IGTB 1LO4L 3RGVD 4PWIA 3L7EB 4PJCB 2QGDA 3N44B 3ISWA 2QVFB 1RUML 2JKJA 4X7EC 3RL1A 4E9YA 2OXGB 2DWEA 2PTTB 2XACC 2ZSVA 4HH9B 3EJYD 2F53D 2V7HB 4UQBA 3GSNB 1AO7E 4H1LA 3L9EA 4WW2A 2PPEA 2XIIA 2ZUXA 4FTDA 2B9BA 3RDTC 3PPSA 5SX4H 1UXSA 2E75C 4HGWB 2PW1B 2X1WL 2DI7A 2WLYA 3O9WA 3DUSA 4HWNA 5ESVB 4DHLA 2FT8A 3JT2A 2FD6H 3RB7A 1MCWM 3HE6A 3QXDB 1M7IA 4HXBH 3L1OL 2O5XH 1EEYB 1KN2H 1S7UB 3IFPA 4PJIA 3GZPA 4AEHL 1OGAB 3UG4A 3VJ6A 3L13A 2OS7A 1KLGA 3EGDA 3GMRA 3TO2B 5ACMA 2WKOF 3EOAB 4WCYL 3EZJB 1DBKL 2YLKA 4ONGH 4NKOA 1OW0C 1DUZA 4F91B 3RKPA 1JGLL 2J4WH 5J13C 3Q01A 2A6IA 2Q2LA 3B3IA 3QNXA 3VFGH 4RWYH 2X09A 1NCGA 2JVUA 1M05A 2J6EH 1MCRA 3MU3A 3ZGIA 5GS1C 2B2XL 1FGVL 2OR7A 2NCMA 4PJIE 1MH5A 3EF7A 1MCKA 5DVOA 5HHME 2PXYD 4M7JH 1HZKA 1SYSA 3WDJA 4UQ9A 3W57A 2YRLA 1NWOA 5DD5L 2H2PC 4DCQA 5JOPE 3BKCH 4M9PA 3ZKMD 1EJOH 1H6EA 1HHIA 4B9FA 2HVJB 3B3IB 4K9JA 2B0SH 1OQXA 1INEH 1KBKA 5SV3A 3OQRA 1FN4B 4UOW1 1DQJB 4PJBF 2CWRA 4Y5VB 1WLHA 5GRJL 3L3IB 4QUOA 3PV6A 3C6LC 3U7YL 4TQ8A 4OBRA 3US9A 1IAIH 3IFNL 5ES4B 3GJEA 5ANHA 3WNIA 1JD7A 2NYKA 4MLSA 1T3FA 3LNDA 4FA7B 4D3CL 2AKRA 3FNKA 1KT2B 2WB7A 2VDQL 3RY6A 1CLCA 4J4PD 4U3HA 5DYOB 4TULH 5H2BB 3SDYH 5FDWB 4KDTA 2VLMD 3SCMD 4L8CA 5TE4H 2BVQB 3ARGA 1AHWC 3GIZH 3TV8A 2MIZA 1J0IA 3V9EA 1BOYA 2D0FA 1E8WA 3CXHK 3GDCA 5DJ2B 2WC7A 3BZ4B 1A5FL 4HG4J 5IY5B 3ARQA 2NRDA 1FRGH 3GJEB 2IADA 1A22B 5DD0L 1AZUA 3VQ2C 3ZDXE 2C4FU 4U2ZA 1HINL 4M7JL 3P11H 1ZMYA 4RLDA 3CLEL 2VDQB 5IFAL 5MEPA 4XCCH 3BE1H 3S0PA 3NIDE 1MCPL 3BDXA 3V6FB 2CK2A 1T7ZA 3UX9B 2J1YA 2XPGB 2ROXA 4X6CB 4ZFGH 4GIOA 2HPTA 1EHNA 2Z93B 1TTAA 4YO0A 2UWEB 3W38A 5FAAA 3X1EA 1XEUA 4FI7A 5F7DA 1ETZA 3L5HA 3MSPA 3NFPB 4KVPA 3W0WD 2VDKH 5IB2A 2QSQA 2Z0BA 4X99A 2BW4A 1IC5L 4OLEA 4R5TA 3N40F 3N50A 4A2LA 4XX1E 5FUOL 5SWZD 4BFFA 4HIJB 3BH8B 3WFBH 3EW3B 4MAUL 2OP4L 3IDXL 3OKDB 2Z4TA 4XO5A 4Z0BL 2RFXA 2ZSWA 2VDLL 3RVWC 4LVEA 3VG9C 3RTQD 1R3JA 2WLMA 5A6IA 1XF5B 1YPZE 3NAAH 3TIEA 4XE0A 2J72A 1OGAA 1FV1B 3U6XS 4H26A 1A3ZA 3SYCA 3ABKB 3BPCA 4WWID 1WFNA 1AJ7L 2GJ6D 3RHWK 3ILEA 4WSJA 4M5YL 1UWYA 2DKUA 5ALCL 5I24A 2P8LB 1JSYA 3MGOA 4LSVH 3IDJA 3QUKA 5AUMB 4OGQC 2D31B 2E7DA 3GSXB 5J8OA 3VWKA 1JN6B 3QQDB 4U05A 5TE7H 1YDPA 4JQVC 2FEDC 4OI8A 1FNSL 2BM3A 5T3XE 2HLFC 1E4KC 2ADFH 4OZHB 4EDXA 1INQB 3MLRL 5G4MA 2GBUA 3WN5A 3MLWL 4NN7B 3WGUB 5JW3L 1OSEA 3HFMH 4FGMA 4OJAA 1CTNA 1KLGB 3EGDB 3GMRB 3KPTA 4PB9H 3BX7C 4X4ME 3GTVA 4N2OA 4DPRA 2QMKA 1A6UH 1A6ZB 2AERT 2FSEA 1WO2A 5J1SC 3WTWA 2EDWA 3DBSA 1IE5A 1A7PH 3IDIB 1E4JA 3GHBH 2J21A 3ARYA 1K4CB 4NUGH 2HVKA 2IWFA 4J3OF 2YAFA 4TS6A 3PABB 5KUMA 3L95B 4Z7WA 2FB4L 2F7QA 3CD4A 4QRQA 2CO7A 3BP5B 3DMMB 3TBYB 2JXMB 3O2WL 5I0DA 2J57A 4PRIB 3IDGA 4ELMF 2G0LA 3I9AA 5I0ZA 4U1SA 1CFSB 4MNQD 4N90E 3H7BA 2DWYA 3SPVB 3Q2LA 1NIFA 4FRWA 4PGDA 3AQZA 3UTQA 5DFVC 4NYLB 5KSAD 4AYEC 1HYSD 4JCMA 4UIMA 3GUFA 3RBGA 3TA3C 1F8TL 2X6BA 3UCRA 5TH2B 3ORJA 3P02A 3IMWA 4LRIA 3EYSH 2ZG2A 1FL3A 2JCWA 1OQOA 2Y1AA 4NQEE 3W0WB 4CNIB 1OTSC 1CE6B 3LXUX 4DN4L 1THCA 1B9ZA 2O6EA 2DQFB 1AGDA 1XCQA 2Z1KA 4G5ZH 4PRAB 1BX2B 5EFIA 4IRSC 3QIBB 4MB3A 4X4XB 2HWZH 3FTZA 3KYNA 2NY5C 3BWZA 1BCIA 4I3RL 2G60L 2I85A 4OZIB 1DBML 1Q9WA 3MJ7A 3P73A 4UILL 5MP6H 4GBXA 3TESA 1ZE3H 2HAZA 4XBPB 1IQDB 1A3RL 4QMEA 5KEZA 4UDTA 1IAIM 4A55A 2J8UE 4KKCD 1UG9A 3GGWB 1CU4H 4HIHB 3P30H 3MBXH 1ZLVH 1DSFH 3F62A 1L9QA 2DYPB 1YNTA 3TH2T 4YO0B 1KCLA 1OSPH 2G9HB 1EDQA 4HJJH 3UAJD 4AM0B 4GAYB 4NN5B 1QAWA 2WZ5A 1SN5A 5EA0H 4JPIA 1NDMA 3IU3A 4YXKH 5SWSA 1URZA 4KFMA 5J13B 4M5ZL 4R4FL 3EAKA 4P4KD 1EH9A 4CRPA 1TSHA 4ZMXA 4NHCH 4PJDB 1G0YR 1WAAA 1XF4A 4OLVL 4Y5XC 2M2DA 1OP3K 5B8CC 4K7PX 5IJCC 1DSWA 3GK8H 1T0PB 1I9RL 1S5HA 4QDGA 2OTUA 4MRBA 4YFEA 1JI2A 1QRNB 1A6WL 1HQ4B 2QT6A 5IMMA 2VDKB 2JELL 4H8WH 1KXTA 3L9RB 4NUGL 4AQ8C 1NGYB 1UENA 4N4YB 1GCYA 3BWSA 3B4NA 3HI1B 1SQ2N 4XP6H 1JI1A 1F3DJ 2EAEA 3MREA 1ITBB 1DBBH 5F7UA 1HEHC 5MEND 5IESL 4QO1A 2OZ4H 3CGTA 3IS1X 5FDWA 3VI4B 2E4FA 2ICEC 4BV1A 5C0JB 4HLEA 4LLVB 4ODXA 5HDOA 4FC3E 5CJXA 4YDNA 2VXUL 3TN0B 5DJAB 4G8GE 1E4KA 1PY4A 2VDPB 4L1LA 4GMSL 4WHYH 1KENH 4FXKA 1NM4A 1GJIA 4PIBA 4GMTH 4AE0A 4XVSL 5IV2A 1IEAB 4LEOA 3OKLB 2ESVA 3BP4A 2NR6A 4G7SB 4JB9H 3TCLA 4ALAL 1FFTB 3FCBA 5BQ7A 3MOBH 5I1GH 2IGFL 5D7HA 3SE3C 1AZBA 1ZA6A 1D9KA 3QRFM 1YUHB 2TSAA 4E9SA 4WGWB 5F3HB 3A3YB 3SDDC 5AB0A 3DXAE 1JGUL 1F00I 1G9HA 5JIDA 3FN9A 3QCUH 5E4AA 4ZNCD 1UWXK 2XV0A 2WZPA 3TEZA 4WZ9A 3HNSH 3OKYA 4MJHA 1CXIA 1JD9A 2UZPA 4URTB 2A2QT 5D7LE 3FONB 1L5GB 2QV2A 5FB8B 2ZUSA 1OGTA 3C5SB 4GXVL 3V0WH 4JZJA 4KK5D 1QFOA 3T0DA 4ZS6C 1UASA 2AK4D 4PY7B 4QIRA 4X4YB 1TCRB 4WI5A 1F4YL 1GW0A 4DKFL 3NJXA 4DTGL 2NNCA 5L0QB 3GS7A 2WCSA 4ZQKA 1JUFB 4K0OA 3V5KA 3VA2C 5HHPA 4OGAC 4DERA 2C9XA 3TYGL 4O5LL 2ZZUT 3GUTA 1ASQA 43CAB 1XCQB 2ICWI 3Q9PA 4ATWA 6PAZA 2BWIA 5IOPB 4KZ0A 1QWUA 4NZ8A 3FCSB 3AWGA 4M1CC 1SQMA 3O6FD 1JK8B 1NC4D 1O7DC 3MLYH 3DHMA 4IIQA 3V4UL 4AJWA 3GGWA 3N9GL 5SWQB 3H9HA 2JKTM 5H37H 4Q9QL 1AYOA 5HYSA 5I5RA 2ZYIA 1JV5A 2YO3A 1HYSC 1TTRA 2K7PA 4AYID 1OPGH 3I3BA 4HOMA 1KFAL 3S4SB 3CCHA 4E9XA 4JM2B 4EOWH 3MBWA 2NW2B 3T0BA 5C7XH 1GC1L 4BFRA 2BIHA 4EZJA 4UZSA 3PRZA 4GQZA 2V17H 3HLAB 4RGNE 2ED6A 4E41E 1B4JH 2K4AA 1Z0MA 2PPFA 2WWKT 1JGDA 5E51A 5IB1A 2JMRA 1D6VL 4H8VA 5DUJA 5MERA 1QRKA 2ITFA 3PABA 3T09A 2X9YA 3UTPD 1H6FA 1MEXL 3HZVA 2HVKB 5AOJA 5GS0D 1T5WA 5F7MC 1M1SA 1DE4A 3QDMA 5E03A 3QWOA 4XPTL 1R3IH 25C8L 1XBDA 1JPTH 4ZS7L 5L9DH 2F08A 3VU2A 1HOCB 2BSSA 4N25A 3RPIA 4PGEB 3QJRB 4U1SB 5KSBE 4TUKL 4JVWA 1XXDC 1DO6A 3JVGC 1F2XK 1J87A 4L2LA 4F37F 1GAFL 5T3ZE 4WF7A 5E94B 1I8IA 2J1ZA 1F45A 2VLKE 3SHSA 4OD3H 1G7MB 1UEYA 3KPQB 2LQRA 4LAQL 5CGBA 12E8L 3J2PA 4TTDC 4AK2A 1FCCA 2DLGA 4GSUA 5B4MC 3NCYP 3MGOB 4GNKB 1HFUA 3SDAA 1I1AD 1IBGH 2UY6B 1RUKH 4MHHI 3OM3B 2A1WL 4PJAA 3B9DA 3HG1B 1QWNA 2K4WA 2BVPB 2PYED 1JXFA 2H47C 3ARDB 1YNLH 3KPQA 2LVCA 3T8MA 3G9VA 3U46B 2H8PB 3ZYOA 3K2UL 4W93A 4Z7OF 4GO9A 4MRCA 4WUUD 1UJ3B 4C54A 5ITBH 1G1YA 1TPXC 2BXZA 4KAQH 3DHPA 1S7QA 1DL7L 4QXGH 1DUYB 3DDFA 3M8OL 3ATAA 4HK0A 4QXTB 3MV01 4OD1H 4XMLH 5FXCH 25C8H 3FBKA 4OSUH 2BERA 4D0BB 1D5IH 1JPTL 1WICA 2W9EH 3II2A 2GK2A 5IVXF 1GGBH 5MEQA 2L7JA 2EIZB 1SMOA 1ADWA 3SD5A 4BFGA 4X99B 4EZKA 4L9DA 1G9NH 3VNZA 2GCYA 5CINL 3IYLW 5HGDA 1BQUA 1ZRUA 4ORGB 4YE4L 2I9LB 1D6VH 2IOMA 2V2WB 5LCVA 3RU8H 2IH8A 4G6AD 4XGZB 2ZUYA 1HSAB 4WTZA 1ZVNA 4WAFA 5J3HC 5EOQL 1BXXA 2V9RA 2P43B 5EUOA 3EYOB 2WP3T 4K94H 5HJ3A 5E00A 1PIGA 2OSLA 4G6AC 2WXHA 1P0SE 4JAMA 4NZTL 4DH2A 1BAFL 2OSWA 1J1OH 4ZAKA 3V0HA 1EEZB 1SLXA 3VXRD 4A6YB 4KO7A 4WKXA 5AAWA 4JN1L 2H1LM 1IU1A 1KB9J 2WQXA 2IH3B 3OV6A 4HAKA 2BIOA 1RJLA 2UY7B 3LS5H 1LE5A 1OE2A 3O0RH 5KBDA 4HPYL 4JPKH 5AL0A 1MCHA 2DD8H 1MFAH 5FGCB 4JUSA 4ZUSA 3JTTA 4MMYA 4OF7A 1KPVB 2RCSL 3GI9L 2PP8A 4I5BA 3KGUA 5C0EA 2BJML 3DUHA 1G9ML 4FQHA 4TQPA 3PIQB 1F6AA 5BRQA 5IFAH 2YR3A 3CX5J 4DAGH 3DPDA 3WI9A 2A6DA 5CKGA 4Z0XB 2WNGA 4WU7A 3WBDA 3VDAA 2JKNA 5DRWB 1BJ1J 1JVOA 3ARFD 4H40A 2P8MB 2Y7QA 4CVZA 5ACZB 5E23A 4HBCH 4PV9B 3V5KB 1V3KA 3ZTEA 1JP5A 3GHEH 2OW6A 1GIGH 5I18H 3LRKA 5JHMA 4APQA 4YDJA 3POHA 2IV9A 1I1FA 2OR8A 3B9KB 4CBZA 2H6UA 1NGQL 2EIMB 3LZQA 4QTHB 4UTCA 3KYKH 1D2OA 5A6MA 3FUNA 1LM8V 3CDYA 3WJLA 1U42A 1RI8A 4G9FA 4OFIA 4KJWD 1E5YA 3KDPB 1TUPA 1IFGA 1ZVYA 4O00A 2IANB 5AVRB 5ABDE 3WIIL 5DT1H 1N70A 3ZX1A 5B7FA 3QJXA 4FZ8L 3QARA 4FCAA 2EIEA 2IPKB 3FT9A 3LSOB 3UTPE 3ZDYE 4BSVB 4ZMLA 1SEBB 3RWGA 4CADA 3B1UA 3GTNA 4MQXD 4AGNA 1EJOL 1TVBB 1YNKL 2AQSA 3LHPH 2X10A 1JXJA 3MOBL 3VXMD 3C8DA 5DVLA 3D85D 4WUKL 1JHTA 3LQAH 2CHZA 3S3CB 4UTAH 3TO2A 4UILH 5B7EA 1AD0A 5JR1L 1XT5A 3HG1A 2COVD 2I7OA 4ODUB 2UVFA 2GFBA 4YDKH 3A4AA 3KL0A 4YZWA 4LEXH 5E9DD 1YSOA 3Q13A 3ZZSA 1SYVB 3MNZA 5I1CH 3VNYA 3AG3B 5GJTL 4B41A 3L9YA 4BKTC 2BWDA 4G8EA 1DBKH 3O3DB 3EOTH 3DUSB 3Q2VA 4QXWA 1G7IA 3LPWA 3BPOB 1ZGLB 1OCCB 1MJ8L 3ABLB 4TPRH 4M03A 1W72L 2WWOA 1I1AC 4EXPX 4OCNC 3JQOB 1AHKA 3ERXA 2VXTH 3D07A 3KCWA 1OP4A 2R23B 3CV5A 3WY4A 2DMHA 5BOJA 2F58H 2VLRE 4NAMA 5LNEA 4P06A 1ZVHA 3EYVA 3T0EA 3EO9L 3MVSA 2AQRA 5CJOH 4HJJL 1NCAL 2P9RA 3APMA 3OXSA 4GSQA 4H25A 3Q6GH 1P4IL 3V0IA 2WUCH 4KXDA 3B5HA 3P3UA 1NCCH 4XMXA 2XKNA 4U1KB 4P9ML 1T5WB 3NSFA 5DS8A 1ASPA 4ZO8A 2GHWB 5IHLB 3P4NA 4MA8L 3F6LA 5BXFA 4F33B 3SEPA 2UYLB 3JWNC 4RFOH 2APFA 2Q87A 4BFJA 3Q06A 4NQCD 3GQFA 1AQDA 1AZZC 4NO0B 1X5GA 2PTTA 1TXKA 3WEXB 1IIKA 1NMBL 1T5XB 1TO5A 3E1ZA 4JVUA 3UYRL 1BQKA 5F71A 2MPAH 4Y9FA 4NO5A 3TVMB 2HRLA 2P7TB 3GSWA 4FLOA 2ZKYA 4K73A 3QVAA 2L7UA 1SM3H 3ECQA 3TBVB 3NTCL 1DN0B 2J8HA 5HY9B 1NEZB 5LBSL 4MJIA 4ABWA 2CPCA 1SLVA 2B59B 2VN7A 5DLLA 3VRIB 3TZVD 3PNWB 4CVWA 4M62L 3QDGD 1Y18B 1L0XA 2YARA 3QIUC 4XP9H 1RXLA 5GQBA 1IGIL 1V8HA 1JGEB 3IDNB 3KWUA 2VM4A 4UAOB 5IHZB 4AYGA 5KANI 1J9TA 1XCXA 1FSKC 1BSIA 2BNRA 2WSPA 4WVRA 2X6VA 4Y88A 3V0AC 3VXOB 3LZRA 2VLJA 4IDJL 4AZ8B 1P4IH 1E43A 2DRUA 3FU7A 2OCFD 1HH9B 4WFGD 4Z3GA 1AFVH 1N3NA 3TCXA 1ND0A 4KGLA 4NO2A 4YJZL 1TEYA 3L54A 2ZKMX 2CHDA 5IF0A 1FG9C 4U33A 4P4KA 1YAIA 4U4IA 4IU3A 4Z5RB 1TJGL 2FBRA 3K4DA 3KHQA 3WG7B 4IJ3C 5E4IA 4P5MA 3P30L 4LP5A 3GKZA 4P2OD 3GRWL 4LLWA 4NUMA 1YEGH 4RAHA 4X6EB 1NGZA 2F74A 2OBGA 5GZOC 3ROOA 1SFHA 1RZJC 2FB4H 2LFGA 4QNPE 4MA3A 1JRHH 5B8CA 2BVQA 2V7NB 5IVNA 3QXWA 5AFAA 1WZLA 3RX7A 5KYYA 1BVOA 4LARL 2DQTH 3PS6A 4IMKC 4PREB 5AALA 2NNAA 1IBBA 4OFPA 4WIQA 5F8QC 4APXA 3CN3A 3GTTA 4X7SL 2M26A 1QX1A 2B1HH 4QWWC 2HT3C 4YN3A 5ICZA 4NKDB 4OLWH 4IOSA 3K6NA 1PFCA 3F5WB 4Q9BA 4W9KC 3QB7C 1INQA 4ELME 1T80A 4DW2L 1DQJA 5C0JA 5F6HJ 2ADFL 5IK3A 3R19A 4YSDA 4XI5D 4AYBA 5JOFA 1CD0A 5J1AB 1QA9B 1A9EA 3IRZA 2FO1A 4MDJA 4HF5H 4Z6AT 1AJ7H 2BNUA 4X98B 2BS71 4POZC 5EULV 1PZUB 1OALA 4Q14A 2BSTA 3MV8B 5BQDA 3WIHA 1PL3A 1TPXB 1U36A 2FSDA 2X4QB 5FCUH 5GGRY 3IXTB 4Q0XL 4ZOCA 2R0WH 2KL6A 1XIWB 4NC0B 4XN4A 5GS3A 3QIWC 3LQMA 2NXZC 4XZ4A 2IH9A 4ABUA 4B60A 3D0AA 1A7BA 3H0TA 3BWUF 3KYOB 4L1SA 2WGNB 43C9B 2IAND 1ADQL 3W9DB 2XWTB 1Z0NA 4FP8L 4NQVB 4X6CE 4GRMB 5D6CB 1TNNA 4KKCC 1QR4A 3B5GA 5MEOB 1EJFA 5DI8B 3V8OA 1MIEL 1K3ZA 4BQCA 1I9IL 4JO5A 3MV9D 4PTTB 2VN5A 5GRWA 4G1EB 3SGDI 2JJSC 1GGCL 4Y1AB 3BVDB 5I28A 5CZKA 3BD5A 2FQDA 4K3JL 1CFVL 1RURH 1FVDB 3MRBB 5CD5D 2PR4H 1E9QB 4Z7VB 1QSFA 1BHGA 1SJXA 5B38B 1DJZA 1U21A 2AEPL 2X4RB 1ZT1B 2N7AA 3B2MA 3HE6B 3SO3C 2CIIB 2J8OA 2VLKA 3MLWH 1M7DA 2H2SC 1NSNL 2GJZA 2FATL 1TVHB 4GSDL 3GI9H 4Y1AA 4LF3B 5DHMC 3QJSB 2JNZA 2MWCA 2OCJA 4K7FB 5CIPA 1XF2A 1I3GL 4GUCA 2ALWA 3TURA 4HMEA 4OIBA 4HCFA 4JFXB 2W0PA 4QKTA 3AM8C 1MFCH 3QUYD 2FQEA 2Q2EB 1IKFH 3VAEA 4KHXH 1BQSA 1HHHB 2Z7UA 1C1EL 4XNBA 3W0WA 5LAXB 1DZ0A 2O1AA 4TLKA 3EYOA 4UQDA 1W0VA 3F84A 3H1ZA 4PY8J 4Y16D 4FG6C 3UZQB 1LTXA 4PRAA 1PZBA 1MI5A 2N7SA 4U6XB 4A7SA 3D2UD 1EZVY 3RWIB 1RZKH 1IARB 4HJIA 5H2BA 5KJRL 2RJMA 4NYLA 2GKIA 1IAII 3NP3A 5E5UB 3R06A 3ZBMA 4H13C 5D70H 5A2AA 1EXUB 1UB5A 2MTPA 4H1LH 1G9MC 1A9EB 1OCRB 3K5RA 3RU8L 3PGFH 1F4WH 2PLTA 1CGSL 3ZDZF 1HL8A 2ODIA 3B9VA 3IXAB 4D0BA 2MFNA 4L5FL 1CGWA 4HALA 1R3HB 5GRJH 3RFZB 2AC0A 5I1KH 2XBZA 1J9SA 3DYPA 3SDCB 3N43F 3F5WA 2V3FA 3BLKA 1Q0XH 3WFEH 1SNRA 3C12A 4Q89A 4X4KA 2YAQA 2X2YA 3B34A 1UHVA 3V9CA 5E6UB 1QLEL 4PJ5A 5EF0A 3PDOA 1O6SB 4L48A 3MRIA 4WHTA 4PB0L 3OAYK 3IDIA 4PBDA 1EERB 5C6PB 3OGOE 2C4FT 5EMYA 3HNVL 1Q0YH 4FERA 4JDZA 1W6LA 3B7UX 3HI6L 2WZAA 1DVFD 5F7FA 1J0JA 3TO4A 3VFGL 2VZUA 3WTXA 2FX7H 1HNGA 3H56A 4P2OC 4GP8B 4WFED 1HEZA 2VN4A 2JWYA 3K3QA 2A1WH 3ZRFC 4YHKH 2VLLA 1U8JB 4KH2A 3EFFA 3H9SB 3VACA 3AS3A 4JRXE 2J4WL 3B2UC 2YEZA 3MOAL 4KNUA 1CL7H 3MA9L 4ELDA 3L3JB 1I3RB 1ZK9A 4YFLI 3RTQB 3C75A 3K71A 1CICC 3QI9A 4QKXB 5AW7B 4F7PA 1AKJB 3LEYL 3E1F1 2X70A 4NO3B 1OCOB 3M17A 1JRHL 3NRPA 4ANKA 4Q97A 2Q76A 4M8VA 1T0NA 4LLUB 3V52L 2OMZB 3FSOA 1IBHA 4EEEA 3GSXA 2F5AL 5FO8B 5D7SL 5LAXA 1RJYB 3FFDA 1OARH 1NPNA 1Q0EA 5H37G 3A47A 4KI5D 5D7JC 1PKQA 1CFTA 4IEFB 3G5WA 4PJHE 1YN6A 3VI4E 1AGFA 3HBPA 1X4XA 4Q4EA 4KO9A 3VB9A 2OTWB 1OL0A 4LF3A 4R90H 1NKRA 3DSFL 5I1GL 5F44A 3VE0B 4C83B 3L2LA 2IXQA 3HG1E 3CVIL 1DDTA 4LOFA 5IVXB 1Z1WA 1A21A 2R2EA 2UXGA 4UZUA 3DRTA 3CX2A 4D0DA 2L3BA 5FF6B 2VXUH 2VDNL 3WO3B 1CTOA 1EO7A 5DMKB 3QISA 5DJDB 4H7VA 3WSQH 3FK3A 4H0GA 1FZKA 3CSBA 1HH6B 4FFZA 3LOWA 2R69A 4RQQA 3ARGD 3V0FA 4MDIB 3EDEA 4NQVA 4P23B 1Z3GL 5JXEC 4LNRB 2ZUQC 4UM9D 2GJZB 4MQSB 1HAWA 1ACYL 1B2WL 4CMMB 1OF2A 2O5XL 1OAZL 4MCYA 3ZO9A 3VSUA 2WUBL 2PWHA 5T3ZL 3WFHA 4QLRA 4Z18A 1PQZA 4HUKB 1E9QA 3ZSTA 4P2QE 4Y2NA 5FGRA 1Z7JA 5PAZA 3ZW3A 4GT0A 4Z7VA 3KLAB 5I1LA 3RVTD 3V0VA 4IRJD 5AVUB 1NOFA 1UM6H 3L5WA 2EINB 5DD1H 4FQXB 4ODTL 5DWPA 3RVWD 4JLRA 1WFMA 5TDNB 1YO4A 3FU9A 3DVNA 1DJSA 2AK4B 3QRGL 4P5SA 5C6TL 5EEYA 3QEQB 2FHFA 4FFVD 4KKAC 4IQHA 4HLZH 1JPGB 1PZ3A 5C0IA 4HW6A 4JY4A 5CXPA 4N85A 3LB6C 4XP9L 2IAMD 4K71B 4G6FB 4LKCB 3SKOA 1ORQB 2XTJB 1IEAA 4LEOB 3P4LA 3CWGA 1U92B 2ZOKA 3KBHE 3LS4L 4B95C 1HS6A 3FO0L 3EOBA 3VSVA 1CK0H 3SBPA 3F7YB 2ZWNA 2FEDD 1T04B 4JB9L 4YSCA 4E5XA 2AJVH 4H8WC 4U7KA 4HP5A 1IGCH 1RHFA 3FSZA 3P9WB 4YDKL 3EJZD 3BZDA 4TQIA 1TKWB 4QGYA 3KWWB 1A1NA 1FFNA 4IK6A 1HC1A 2WY3B 3ILPA 5D5MF 2D7TH 2P80D 3OC8A 3BUYA 1EHAA 2OMWA 1D5MA 3DSFH 1IT9H 2QADB 3CQPA 2GBAA 3IMTA 5FM5O 2EKSA 4LDCA 2CO6B 1PG7H 1RZ8A 4PI2A 3VD5A 2DBLH 5FECA 1NC2B 3APNA 3LV3B 3WUWA 1MFUA 4HFUL 2CHWA 2QPDB 2R29L 5DQ9A 2WVVA 3U6RB 4HD9A 3AACA 4MB4A 1P9MC 4N2GA 2F54E 4AVHA 2ZUTA 4LNVA 4MAUH 1NGZB 4S2SB 4I9XA 4YIQA 2BXYA 1ZDQA 4Z7QB 3T04D 2Q6WA 4X8JB 2PWGA 2PWEA 2D03L 4OLYH 3HEIB 1XR8B 3MBEB 1OLLA 3HC3L 4ZW8A 1V05A 1ODUA 3LZLA 4OKVA 5EWIH 4FYRA 3HZKB 1IM3A 2W07A 1N6QL 3ZZQA 2NX5A 2W60A 2EVIA 1HXMB 4OZIA 4KVNL 1OTUD 2BOBA 3BVXA 4ABVA 1UH3A 4K9EC 5C0DB 1VFMA 2FDBP 1R75A 2VMEA 1HE7A 1C5DA 3I02A 4M3HA 4H1LB 3V4PH 4EN3D 3HG3A 3IWUA 5HGHB 5IZ7A 1ANUA 4I0PB 3NZ8A 3EFDL 1HZHL 2J8UA 3ROLA 5DD6A 3IAQA 4JHAL 4HS3B 5ID1A 2DWDA 4NCC2 1I7TB 1P7KA 4WUKH 1NC4B 4QRTA 3SPIA 2J2ZB 4UTAL 3ULVD 1FF5A 3BUQA 4AGOA 4D8PB 2Y06H 2V3DA 5DUPL 4KTDH 1TQCB 3TYFB 1OP5H 4S0HA 1ZSHA 2AJSH 2GJ6A 5B3JF 2AV7B 1YQVH 5I6XC 1B6UA 1NCWH 2V0AA 5FYJL 1A02N 3L8QA 2R23A 4GINA 2B8OT 1NANH 4PLNC 4UMGA 3L16A 4WV1C 3ULUD 1T2QH 4DFHA 5I2IA 3Q5TA 2MH4A 4QXTA 3AXHA 2XYCA 5I8KH 1HIMH 2QPUA 3UDWA 2A4CA 3N1GC 4D8PA 3FYEB 4FEIA 4X6BB 1ETA1 3FCTB 2FHBA 3DOSB 3P2DA 4BFNA 1S9YA 2B5IB 4QF1A 3GHEL 4G1MA 1NC2D 4QRFA 3H4FA 2B3RA 4P3WA 4LEBA 1UJ3C 3QO0A 3Q6FB 4PJDF 2VWEE 1QLEB 4HBCL 3SODB 2HRGA 1R5WA 3N85H 3ZK0A 5EC2B 2ENSA 1C1EH 3AB0B 2NSQA 4ONOA 5B21A 5ADPH 1U8KB 5CR8A 3DJZA 1JIBA 1GS7A 2K3HA 4R96B 1P4LA 2K0RA 4TRPH 1AR1B 4Z7VF 2PCFB 4GW1B 1TZAA 4UQAA 1YNLL 5CEXA 4BHUI 1JNHA 2WWMC 4CVXB 1S7VB 3DARA 1V55B 2FECI 1WC7A 2BSSB 5FHBH 1T0MA 3QZLA 4DJMA 3FTGA 2ZUWA 2DTMH 2XU9A 1L7IH 5IB5B 4OZIF 3D33A 1ETB1 4NKQB 2V9UA 3GSUB 3PJNA 4GQ9H 2BCKA 1FC2D 3GIZL 3NABL 5F0JB 1BVLB 3P9LA 4FI6A 1EHKB 4JFQB 4G6ML 3OB0K 4TTDD 3ROLB 1CS6A 3BKMH 1X5LA 3JT0A 1TIUA 4OAWB 3Q8EA 5FM5M 4BXVA 4D3CH 4KZEH 4M8QA 3T4YA 4Y19A 3IFNH 3QZWG 4I18B 2X0WA 3OR6A 1JYNA 2B1AH 2H41A 4B0MB 2GJ6B 2QPEB 4JRWA 3SBWA 4RGOL 5DHEA 5BS0B 3CFDB 2XJKA 1WVZA 2B1AL 4UAOC 4YDVA 4IIQB 1B0GA 3RUGF 4E2OA 3KWVA 1IC0A 3LKNB 2FJGA 1BBDL 4U1GC 5GGUA 4B3EA 3JTTB 3GSNH 5LGJB 2ZAGA 3C08H 1NAMA 4TLUA 4Y5YB 2XWEA 3NEXA 1X5YA 4O58L 5INDB 3O9WC 4G6KL 3QYNA 3FTWA 1JVKA 2X3BA 1U8PA 2D4DA 1ETJA 5C1MB 1PX8A 3E2HB 5C0IB 3FXIC 3GM0A 1WZAA 4OD2A 5J3HD 4M02A 5ACZA 2Q7AA 4MCZB 1JDDA 2AJ3A 3L3OC 1BJ8A 3PAZA 5DVPA 5E9AA 1JF1A 5IMLA 4NFBA 2JJTA 2EC9T 1KN4H 4JFUA 2F7RA 3ARFC 3WE6B 4N9GA 3QUMB 1CFVH 2XWBA 12E8H 2BLFA 3EH5B 5LO7A 5IKCA 3VX0A 2H3XC 3TF7C 4NC1E 4BHUA 3WAKA 3IN0A 5D1QA 3ARBD 3NJJA 4WO4D 4JGUA 5ICYA 3RWEA 1KJ2B 2QLYA 1CIUA 2AEWA 2C9PA 2OV0A 3A6CL 3CZUB 3G7TA 2NYYC 4OZHF 5L2JB 2PCYA 2DQ6A 4LKXB 3BP4B 4NN6C 4OV6F 3V4PB 4QJ4B 4L05A 2K6ZA 3OKLA 1AGBB 3UYOD 4AW7A 4OT1H 2P5WE 2PUQT 5I6NA 1O6TA 4A7UA 1I9JH 1F3JA 1KIUB 4EBQH 2BC4B 2OKMA 4NOFA 5FLVA 3VXPA 2VQUA 4FQPA 4JCWA 1QNIA 3GKWH 4LLAA 2K7QA 3EYFB 3GLZA 1YEEL 4IS6B 3IMUA 4KJPD 4P3DA 4Y5VA 5EU6E 2KZKA 5GGSY 1B4JL 4QRSA 5DJDA 4F8QA 3WV0A 2YZ8A 2ZP9A 1AKJD 5CJ8A 3ASWA 5CBEA 5LWYL 2O6DA 2Y5TA 1CT8B 2B3IA 2HKFL 1ZV5A 4NM8H 5EF2A 2VGLM 3T6XA 4C4UA 1B2YA 3OC5A 3V5HA 4WDIB 5LBSH 1OSYA 3W81A 3FQUA 3OKOB 4ZJ9A 5JQHC 1NCWL 3EOBB 4R84A 5CBAB 4QAWA 3O0LA 1MJUH 5GZNA 2EYSB 3FT4B 2NZ9C 2OL3B 1II4E 2VQTA 3TN0C 3RVVC 1IGJA 3KH3A 5D7IA 3A67H 3P0YH 3S5LB 1ZLWH 3ZDXB 3HBZA 3GXDA 3UAJC 3ETTA 3DX4A 3IKCA 1WA2X 1N0LB 3RZCB 3SKMB 4KKBC 4TXVB 2VSCA 4KXBA 1GYVA 3H3PH 5TPWH 5D9SA 2X9WA 3IN2A 3HG2A 5DHYA 5EU6A 5FV2A 1H19A 3GINA 4X6CF 4N8VB 1DYZA 1FFOB 1OGPA 3ZHLA 2XYBA 3B3BA 5F3BB 3VW3L 3GYRA 4HUWA 3TYGH 2Z4QA 2H9GA 5K9QI 4GAYA 1T7XA 2H2SD 1G9NC 1QLFB 4HJGA 2WD0A 4P2QA 2JJSA 1YEIH 3R0MA 4UT9L 3FTGB 3I9IA 2JELH 4H8WL 4P5TB 4GEJA 3BIAX 4GW4B 3K71B 4OLYL 1S9WA 2VZ3A 4LSRH 3LTVA 3RKDC 1FG2B 3RQ3A 4NHCL 2WZ0A 5KVGL 4K2UH 1KLFB 1TU2B 4K5MA 1WT5C 3D39E 4AQAA 5SWZB 4HJ0D 3EYUH 1N64L 4HS6B 3ATBA 4ZDHA 3P3YA 1I7UA 1LJMA 4FQXC 2ZKHL 3MBXL 2LFEA 5D1XD 3FT2A 1V27A 5JW4Q 2IGFH 4YGVA 3BGFC 4UTBH 4MJIB 3RNKB 4EVNA 5I0VA 3QUZB 5DEGB 3TBVA 5MP6L 2NXZB 3D3VB 4JGNA 5D5ME 1KENL 2F2HA 3VMOA 2YXMA 2WXLA 4WI0A 4FFYH 3KEDA 2B20A 3MZTA 4JANB 4AX3A 3OR6B 4N8CL 3AADB 2NY4C 2YPKA 1FNGA 2KERA 3BSZA 3MV9A 2E27H 1INDH 4HIXL 3S2AA 2G5RA 5G55A 4R4BA 2CO7B 3CFIC 1BV8A 1QHOA 4AE1A 4DZ8B 2UYLA 5HYSG 3R06B 4L4VE 4RMVA 4GRLB 1Q9KB 4RAVA 5C07A 2WSKA 3QUXD 3FUIA 1J8HA 5DMGD 2OSXA 2R9HD 3WEMA 3PWNB 4UINL 5DRZA 4LOVA 1A0QH 4OLVH 3BXNB 4ZZFA 3IJYA 3ECUA 3OR7B 3DX3A 5IB5A 4DSYA 4R4FH 1A6TA 43CAA 5D1ZA 2CHXA 1PZCA 5F1NB 1QKZH 4NZJA 4TQEH 3FB5A 5HHOB 3SDAD 1A8ZA 1F11A 3QT2A 3DMMC 3K74B 1MCLA 2AQ2A 6TAAA 4YUEH 1ECZA 1HXYB 2MNWA 4Z7UF 1X5FA 2CBMA 4JFZH 2DQJL 1ACZA 4P2OA 4X6DE 4P57B 4X9GA 5BS0D 4PS3A 5F96L 3IKCB 2AXHA 3LQAC 4FABL 1ROWA 2E7LC 3WN5B 2J73A 5D71H 4LVHB 5GXBB 3ML8A 1KGCE 3HR6A 4Z3JA 2R8SH 2OJ1A 4ZW7A 2KYIA 1EVUA 4JE0A 3I75B 2VL5B 4JGMA 3N1MC 3VWKB 3KPSE 4HCIA 3HC0B 3EH4B 2IQ9H 4N1CA 4OGYL 4QRRD 3T1FA 3WKNA 3UGXA 3BAKA 5AQ0A 3T3MB 3BKYL 3GC3A 2Q10A 5L7XH 5HHQA 1HT6A 2ITDA 2NNRA 1WFUA 3ZDWA 1Q0XL 1E27A 3MJ8B 1I82A 3OLEA 3U0TB 3W56A 3HAEH 4NKIH 2G2RA 5K1NA 1Y7VA 1ZY9A 1HI6A 4YHOH 4BFBD 3TTYA 4U1LA 1YYMH 2H2PD 3MHZA 4X5WA 4BRJA 3UAFA 3WIHL 5EOQH 4GG8B 5LUMA 4JDVA 5I5IA 3OMZA 3NCMA 4L8SA 3TOPA 1DVFA 2X89D 3MA7A 1NFKA 5KSBF 4LU5L 2QBWA 3DGDA 5D1QB 4AEFA 2BHYA 3ATEA 3QJVB 1DJHA 3U48A 4Z7OB 1DVQA 5J11B 3CZEA 1BPLB 3RJDA 1AXSA 3FQRA 4G82A 3MRDB 1S3KH 2IGLA 1F1GA 3B83A 4FYTA 4L4JA 1J10A 2W1NA 2MCAA 3G6DH 3MAWA 3RFZC 5GPRA 1ACYH 4LP8A 2X9XA 4W4OC 1HN1A 1E9PA 4MMXA 3ZRSA 2NXZD 1NCTA 1NJ9A 1VIWA 3PQYD 4M4PA 4BWTA 2O61B 1LEKB 1T7YA 3SD2A 3ULUL 3O6FA 1SJMA 3C2AH 3QZNA 1MAML 2ARJB 5JW4R 2CJSA 4FX5A 4TVSa 3PWJA 1T89C 1FL5A 2PYFB 3BAJA 1U2CA 2NZ1A 3TIDB 2XWBB 3DRTB 1DEDA 4R3SB 5I1AA 4O9HH 3ALXA 3BZ5A 1LEKA 3NJNA 3KG5A 4RMRA 5K33A 1QPXA 4QGTA 4UTBA 4WI3A 4WKZB 2XG5B 3B7SA 3JSSA 2ICEA 2FT6A 3FH5A 4LT7A 5ALCH 1ZE3C 1DQLH 2VDML 4R90L 1KDIA 4XWOD 3ZQXA 3ZXAC 4X5QA 1CLZH 1YN6B 4KNTA 3SCMB 1ZHLA 4J3OH 3ES6B 1G9NL 4QRAA 5C09B 1V7ML 4OT1L 8PAZA 1MEXH 4NQEA 4BH8A 5G4OA 2V7NA 1DVUA 4AGPA 5DEGA 2F5AH 4V2CB 4P59H 2IQAB 5DZNA 4AYSA 2WXNA 4Y7OC 5JXAH 2RACA 3ZKND 2OMZA 1UZ6E 5BV7H 4JM2F 1JTPA 1JFHA 5DEZA 3SE8H 2FIKA 4RSYA 3NRFA 1MLBA 3MMEA 4XCYA 4K8RH 4EPSA 4AY0A 1TQUA 3KVDD 1T5XA 3X1GA 5I66B 1MFVA 3V95A 3X1NA 1S7SA 1JZ5A 3IB4A 1SLUA 2X6UA 5AW6B 3GMQB 2F7IA 4UM8A 5E0FA 3ARRA 5FYLL 4D7PA 1UJ3A 3RWFB 4GAGH 3LH2L 4O2CB 3RRQA 2VLLB 4W70A 3LKRB 1RUKL 1URIA 2JI3A 5F93C 4FYQA 4FZEH 4YHKL 1K5NB 1EEQA 2YC1A 4ES9A 3IDNA 3S34H 1CDCA 1KJMB 3RFRA 5LDSA 1CGYA 3G5YA 1K85A 1P53A 3AZUA 3LDBC 4LPCA 3S3SA 4CW1A 1BM3L 4HG4K 5KN5B 1U41A 1FP5A 4NN7C 4OB5H 5E6ID 3HTLX 2MCG1 3IJSB 2X44D 4HUWB 5F0LB 3WFHB 4CVXA 3JWOH 4JR9H 2W0LA 5IF0B 1TT6A 4N0FB 5EU7C 3REVA 4M43H 2F5BL 2DQHL 4P57A 4K71C 2XI9A 5FWQA 3QHZL 1E5UI 2PPAA 3QO1B 2ZCLL 4UI2A 5T1MB 1ZWIA 5E7FA 35C8H 2VLJE 3LYRA 4QHLA 2X4NB 1SUHA 1AIFB 2IAMB 1QI3A 3KD4A 4NN5C 3QNZA 1Z5HA 3ZMEA 1IIIA 5K59E 3ULVC 3GS4A 3QO0B 1Y18A 2QTVA 3S48A 3PNWA 3QEQD 4KFZC 5D6DA 1KYFA 3LD8C 5AAMA 4C4KT 5JLZB 1ETZB 1LLAA 4ZUWA 4MJIE 4NUJB 2QHLA 3OAUH 4DUWA 4G6MH 4PG2C 1CB4A 2BO0A 3DETC 2OXHA 1YEJH 4A63A 2XWCA 1YQVL 2PETA 5C3LD 4YZFE 1IVLA 4BINA 4RBPH 2XPGA 4KTDL 4JFDD 5CAYB 2AJSL 1FNFA 3OKDA 4X8GA 1U58A 4MJJA 3LPGA 3VGDA 4N8CH 4BWUA 4JE4B 4AQAB 1LO3H 4IBWA 3VI4F 4ALAH 1RY7B 2I24N 3HN8A 2ZWYA 5KBNC 1S8DB 3DHUA 4RMTA 1NFDA 3FB8A 3B2VL 1IV8A 3HB3C 3QORB 1KWGA 1MHCA 1B0IA 1W16A 4GAJH 5DS8B 2C1OA 2KMWA 1NSNH 1OM9A 3PE9A 4JY6A 5E8EA 4YNYB 5C2BH 1ZTXH 3TLRA 4I8DA 2LLLA 4W6XB 1ORSB 1TCMA 2NY5L 2FGZA 4X7SH 2VITA 2IQAA 3F6IA 1N6QH 1MAMH 1SVZA 4PWJA 4FG2A 3P9MB 4MQTB 3U4EA 1KIRA 3Q6GL 4J4PC 3VXSD 3ZHKA 4J8RA 2WTPA 1N64H 1KCRL 4Y4FB 3AT0A 4RGMB 5CIPH 5CJOL 1CDGA 3QUMA 5ENWB 3U7AA 4E5XG 1QRNE 1I3RA 1UT2A 2EICA 3MLUH 4PTTA 4A68A 1GA2A 4H88H 1FZMA 1T2JA 2XY2A 4OU3A 2VQ1B 2K45A 4K2UL 5T1KD 4IMLA 2BOLA 1OAUH 1E4XH 1NIAA 5JMRA 2LTQC 3PDGA 3FUKA 5SWSD 1HKFA 4WNSA 1S9VA 4PRPD 4A7GF 2XCMC 3CFJB 3QFDB 3EGSA 3KPRA 5CCKL 2FX8L 2CIIA 3VGEA 2F19L 2XXCB 4P5TA 5I66A 1TZ8A 2W80C 3DX9A 3BIKA 1XGPA 4AM0Q 3WXVL 1VEOA 3T2NH 4G7VH 1U8MB 2ZJSH 3DX7A 2VUOA 5CMAA 4AG4H 1UUNA 3R8BB 2BP3A 1UEMA 9CGTA 4Y5VC 3FQYA 4QTHA 1AYRA 2NQDA 3AY4C 1SOXA 3ARVA 1HCYA 1B0WA 3S37X 1D7FA 4X6FA 1X3DA 1CICB 4WI9A 1ZS8B 4LOUC 3TO4C 4QRSB 2P26A 2R2CA 2D7NA 3DTUB 4M4RB 1GZQB 2KT6A 3I3DA 5INCB 4W81A 4FLQA 4YFLF 2ZNXA 1HE8A 4I1PA 4JFEE 4XC3L 2X1QA 2ZF9A 4D2NA 2H7WA 2ZYHA 5C0GB 4Z0XA 1D2PA 3DURA 1QBMH 2DJUA 2NXYB 4UT7H 2OQJA 5K69A 3GF8A 4PVBA 3I6LD 1E3FA 1M6OB 2H3NB 3SBWC 4CJ1A 5ICYB 4PN6A 3LPOA 3NEOA 5D2LA 4XVUC 2WBJD 2VN3A 1VSCA 4BRVA 1A4BA 3ZE1E 1BXUA 1I8MB 4JFOB 4RFNC 4YHYB 1XCTB 3NJVA 2UXTA 5ILTL 4FABH 4XP5L 3PLYA 1B9KA 4OV5A 2ED9A 3CU1A 2X6CA 4QCIA 4EKJA 3EYFA 1S7VA 1S9XB 5GGVL 2ZXWB 1KTDA 5LKNA 1JZEA 5EA0L 4X9FA 1MFMA 3CFQA 2VRAA 3EO9H 4OIFA 3U2SA 2AAVA 4PP1C 3UZVB 3L3KB 4O02A 4JMNA 2YAMA 4LNRA 1LP9E 3S37L 4OIIL 3FTSA 1CURA 2AEOA 4JQXA 5T1KB 3VXOA 5T3ZH 3II1A 4I4WB 2G3MA 4FQJH 4G80B 2C9UA 2VERA 5DC4B 1J05B 4R0LA 1A1MB 5DC0A 4ISVB 5HHOD 1U8HA 1VFOA 3FB5B 2BSBA 3EHBD 2AXGA 3KLLA 4P2RA 1FNAA 1G6RL 1KGJA 5EO0B 3H85A 3B2PA 4JRYE 4LQ1A 2OYPA 4CSSA 2HKHL 1CXHA 1TTGA 4ONFH 1PW3A 2BMKB 5B1KA 4U6HA 2ZTBA 2DY2A 2XZCH 3H9YA 1YRKA 2KZWA 1I8LC 1JS4A 3WMPA 1UM5L 3GSNA 5FYKU 5IEHB 2WLNA 2MPAL 3UAAA 3GSOA 3MCLH 3O4LD 3FU7B 5FFGA 3X11A 5JQ6H 3BI9X 3ABGA 2IOIA 2O6CA 3BQUC 3IDYB 3BAEH 5EFIB 5DFWH 3EBHA 2ZF8A 3LY6A 4ZSOA 4NZTH 1KJ3L 4WFHD 1U93A 4F7MA 2IDSA 2ATPA 3CVHH 4N3TA 4WI0B 4X7TB 4NN6B 3HE6C 1JXDA 3SZKC 4RWHA 5BUGA 4IBZA 4MQ7B 4LSPL 1JZIA 4ESKA 1D6EA 2NY1B 4EF3A 2ERJB 3S7GA 5JXED 3ZE2E 4QHMA 1RLWA 1J88A 4GH7B 1JNNH 3E38A 4HUUA 3BYTA 1SXNA 1JAEA 2F58L 1W9XA 2Y24A 4XTRD 1BQRA 1KLUA 2VMFA 1NH6A 4KU1A 3QI9B 4I18A 3VTTA 4F7PB 3VFSB 5DUBA 4DK5A 3V52H 4F58L 3QNYB 1NAML 3LN5A 3INUL 4IRSD 5T1MA 1JDAA 1KBPA 2XZQH 4DOHE 5HHXL 4XN2A 3MLUL 5HHNA 4IU2A 1J9RA 4PJEF 3IJHA 1ZLSH 2MSPA 2HN7A 4I88A 4PGCB 4HZAA 1GR7A 4PG9B 4FJ6A 4ZX6A 5C08D 3BH9B 4NQXA 4J3OD 5GGVY 2Y7MA 3D3VA 3ECWA 1RPQA 3ZLQC 1T1ZA 5G4NA 3EUDA 5H35B 1MFCL 2IDTA 5T5NF 4CGTA 2GABA 1PZAA 4MYPA 1RULL 5GIRB 3GZKA 2Y7SA 2DEXX 5KAQF 1BMWA 1AVAA 1SDDB 2CDEA 4HT1H 4N8VA 4XZUA 5F3BA 3SQBA 3L4WA 5DURB 4PGCA 4UIKL 2VDLB 2Y69B 1S7XB 3EYQC 2GSGB 4PS4H 5C3IA 2OYMA 4N2MA 5JHDE 2F8IA 4MNHB 4XTRC 4H20L 3QFJA 5AZEL 5CUSL 5MENB 1HCVA 4MD5A 5DJ8A 3N1PC 2DQDH 4XRCB 4DNLA 2CRZA 3NCJH 3S5LA 1FLRL 2VH5H 4JDZB 3Q44A 5I76B 3NSXA 4QRPD 3O3UN 1AHMA 1A5FH 3HG0A 1RURL 1KSRA 5CHNB 2Z6FA 1CYGA 3WJMA 3OAUL 1MY5A 4ACPA 5I1KL 4ZMTA 1S2EA 3VXUA 1A7NL 2J12B 3V9FA 1NEZA 2VW6A 3HS9A 5E1AB 4FNPA 5HJBA 2IBBA 2COQA 4UOJA 4I77L 5D2NC 1G4MA 4PYGA 4OFYA 2YXWA 4FP8H 1AAJA 3CN2A 2Y5TB 4UM9B 4GKSA 1QFPA 5EUOE 4AENB 4D0CB 4PLKC 1WZ1L 4QYAA 1NUFA 4JL1A 1SVCP 3NJFA 3OLGA 2B4CH 4APQB 4DQAA 2GUOB 5ETUA 3FHEA 3QIUA 1V7MH 2YSSA 4OF5A 4M7ZC 2OR9L 2WLLA 4BKLA 4P3CH 5CIPB 1E67A 1KLFA 1TU2A 4KHXL 4AL8H 5JHAA 1KJ2H 3D12B 3VXTB 1R4XA 1TJHL 3O6ML 4FL4B 1A7RH 1LNUB 4PLJD 4XBEH 5DJZB 4BE5A 1KCBA 1H5BB 3IGUA 3R7QA 5ITBL 5IB2B 4W68A 3RUGE 1WGVA 1DCLA 2R7EA 3NCWA 3QRLA 1H6TA 4YSPA 4WK0B 4RRPG 4WEBL 4EI5C 5IOPA 4GSDH 2X2HA 2ENPA 2J25A 4ORZC 3EDJA 5D8JL 2R39A 2DMCA 1FGVH 2R0ZH 3LNHA 1ML0A 2IALB 3MRBA 1GSKA 4I9WD 1S5HB 5AG9A 2C9VA 4KOBA 4Y2DC 4F7MB 5CEYA 1VKXB 3V7AE 1VRSA 3MUGA 5GZOA 2WTRA 5E8PA 2B1HL 1BD2E 4N2KA 1GL4B 2NY7H 5KVEL 1TOXA 3G6JF 3TPUB 1YYCA 1F3JB 5F1OB 3BWAB 3TPKA 1GOHA 3ULUH 3CTTA 4K9EL 4YHNB 1QI5A 1OGTB 3O3EB 4NFDA 2YN5A 4NWTH 7FABH 1BVNT 2PMZA 1E3XA 3GWJA 3HZMA 2PCPB 4F92B 2R9HC 5CEYB 2XN0A 2OYLA 2AEQL 4HDIB 1QLRB 3DRQB 3NH7H 5AENA 1I8MA 2J8UF 3QCVL 1EDHA 4A2GA 5HI4C 4ZD3L 2N0KA 5ABAA 4MWFA 4E9WA 3WKQA 2R2EB 2VDNB 2VAAA 3CPLB 5FCUL 2X4TA 3F8UB 2R0WL 4MMZB 5FECB 3DMMD 1BG9A 1SOQA 3O6KL 3OZKA 1EO5A 3QIBA 2FNBA 1DUYA 3UAEA 4OD2B 5E2JA 5CF3A 2P5EE 2CRYA 1AG0A 4E0RA 1Q9OB 4N3UA 4YDZA 1U6AH 2AJXL 3FT0A 4MVBC 2CDGA 3N41F 4GLRH 3TN0D 3QJHA 4ZOBA 1TG8A 3D39B 5IQLA 1QASA 1KTCA 1P2CA 1NAMB 2LAAA 4P4KC 4MVBD 4E9VA 4PCTA 1T7VA 1OM3L 3P9LB 5IFHH 1T03H 2BINA 1I7ZB 4XXCC 3MTXA 3MRHA 1NCBL 3L9RA 4LPWA 5E1AA 2WP3O 2YEQA 1J1PL 2UZYB 4MD5B 3VQ1C 1EMTH 5AVTB 1GYCA 2YWZA 3AQYA 4LGSB 5IW1B 1XH2A 2XJLA 5C09E 1WAAE 3V4UH 3FQ4A 4CMMA 2ZKWA 1OKEA 3K6SB 4DGVH 1YJDC 1H3PL 3G04B 3CDGB 4JO3H 1A1OB 1FIGL 1ED3A 3X14A 4AMKL 5E4OA 1CJYA 3S3JA 3VJ6B 4BUQA 1JZDC 3S5YA 4DQOH 4AGLA 4U31A 4B50A 3D9AH 3PJLA 4QJ3B 4ENZA 1A4CA 1GYAA 4IOIB 4LSSH 1KYAA 3HBQA 5EEUA 3O2DL 2HG0A 1DSFL 1M2VB 4OFQA 2DJMA 1ET5A 2X5PA 5I8KL 2EYRB 1G7MA 1TITA 1UD4A 3FRUA 4IRZH 1UC6A 3QCUL 4GQRA 4N20A 4J3SA 5KSBB 1KGUA 2ERJC 2V17L 4LEEA 4Y5XB 3SKJH 5KVFE 3ZKSD 4G8FA 3GB7B 1NEPA 1SDYA 4KVCL 3QQ9C 1Z2KA 4NKIL 5E00B 1MZZA 4FMFA 2YA0A 4JANA 4OZFB 3WY3A 3QNYA 2HWZL 1FHGA 2CGYA 3QS3A 4IEFA 4F3FA 5DUPH 5BRZA 1DE4B 2AQNA 4NUPA 1QFWM 1IGTA 4HOXA 2KI6A 3V4VL 2LU3A 4HJ0C 4PYHA 3ARZA 4Z7OE 3H9HB 3QCTL 4JRYB 3MNWA 3TBTB 2X4OA 4LIQL 3CK0L 5DWUL 2NSXA 5MEQB 5KG9B 4XMPH 4PMEA 4B3VA 1R3JB 4MQ7A 1P7QA 2NUPA 5D7KE 4NO3A 3V5DA 2JJVA 3IRPX 5GJSL 4Z7AA 1N59B 3HUJE 5K9JL 4XAWL 2Y4SA 1HZLA 1HL5A 2NW2A 2PF6A 4PRHE 1J8HD 4Y1SA 3UPAA 4LESA 5I1JL 2F19H 3H9SA 2NW3B 2BP0B 3DBXA 4HWZA 3HC3H 4AQ8A 2KS0A 5KVGE 2FEEI 4DP7X 2W60B 4GRWE 5E6IC 4KJWC 1VFAB 3GLDA 1FPTH 2ZX7A 3KYKL 2E8YA 4CN6A 3HCVA 3JYBA 2W81C 4AIEA 1RIHH 3FMGH 5KBMA 4XOEA 3TA3B 1LP9A 4HS3A 1JXGA 5GRUL 1OP9A 1FYTB 4HLJA 3FU8A 5GZNC 4L4VB 4N2EA 5HPMB 2YC1B 1LXMA 2SODB 2YMOA 1ZV9A 3E9UA 3EG9B 4HIIA 5LBVA 2GFBB 4BK5A 4YQXL 3BZEB 3DXAB 1LMKA 1U8CA 2QKSA 3I02B 4L3ED 5IBTH 3SKMA 3RZCA 5I6KA 1VEPA 3D1MC 4I85A 3HHRB 2VAJA 1MJ7L 4Q74A 4Z7UE 3UIYA 2WXRA 3OKKA 1DANU 5DK2B 5EN3A 2P49B 1XR9A 1A3RH 2GSMB 3A6BL 3C60C 3K1KC 5JW3H 3BT2L 4XPHL 4PJ9C 4FFYL 2LE9A 2MCPH 4NQTA 2GJJA 2UZYA 4OKVB 3IDJB 3NJHA 4PV8A 2P5EA 5AUMA 3U1SH 3WEBA 3QW9A 4G8IB 3PY9A 5JHLA 2R1WA 1MCSA 3A67L 1S7RA 4FLRA 1UZ8B 4LHJB 2AJXH 3UFIA 2AJVL 2OM5A 4X98A 3VI4A 3WEAA 1LGVA 4TUJA 5C0CE 2E74C 1HTYA 3QP3A 5DDHA 4ODHL 1AQ8A 3OWRA 4GP5B 3QJQB 1YLBB 2VJXA 4RCAA 4Y4HC 4Y4KB 2Q9OA 1J1OL 2JI2A 3UG5A 4FHJA 3QPKA 4JFXA 2H0JA 3GEWB 4P2YA 1A6WH 5HD8C 4IRSB 1WWWX 4NBYB 4P23C 1SDAB 3S8GB 5HPOA 2ZWKA 3NSCA 2QPSA 3V6ZA 2IANA 1NKOA 4FKEA 1NGQH 1R3KB 4H8QA 5HD8D 5I8EB 2GC7C 3KXFB 3DX7B 1AQKL 4OFVA 4YXKL 4C56A 1U91A 3CIQA 1NMCB 1CICA 2GT9B 2P28B 6CGTA 3HZ3A 1YEIL 2W59A 3WS3B 2EXTA 1D5IL 5JPMB 2VR7A 5KVEH 1PDKA 3U82B 3V0VB 4UQ2B 2J1XA 3HRPA 5HP5A 5M95B 2G9KA 4D9RD 4QYOA 5C0AD 2GTZA 2P42B 2OI9C 4JR9L 4DGVL 1XSOA 2C9QA 3RIFK 1UM4L 2WXOA 5DJCB 4DP2X 1XF2B 1MDAA 2C7UA 3W39A 4W9GC 2YD0A 2XZAL 3EJTA 4FYSA 3E8UH 4IRZA 2Q3ZA 4JY4B 1LE9B 2W0KA 4ODVL 4WKZA 4M7KH 3I84A 3WLWD 1KIRB 3BZFB 4P23D 5AKSA 2DV6A 3D5OF 5JO5B 1KZYA 2PWFA 2WN3A 1TZGH 1HXKA 3DROA 3LKSB 4YXHH 3BUYB 3MNMA 4L37A 3SBQA 2UZIH 1KPVA 4JFDB 2DH3A 5D4IA 4OUUB 3RGHA 1EAPA 1HWWA 4HSAC 2XKSA 3M6DA 1XZ0B 4KXZI 3N0PB 4WV1A 3BSZH 1ORSA 3D2UA 3X2QB 2R2BA 2DMBA 3GI8L 1KIPA 5I0YA 3I6GB 3PGFL 2ZWLT 1NFAA 2ORBL 3O6KH 2ZOLA 4HH9A 3TCLB 4ANXA 2FTAA 4ETQA 5GISL 3HNTL 3AMLA 3L4ZA 4YC2C 3TBWA 3MACH 4X2UA 1F4XL 4WSKA 4MNGB 1BVNP 1CD8A 3HNTH 4O2EA 1VZGA 4OAWA 3LEVH 3SGKA 2ODHA 4KUCF 1RZGB 2QFRA 4F33A 1DQQA 3UTTE 2IAMC 3SQOL 5JLZA 2BNUB 3D09A 2GTWB 3FFDB 4PRIE 1FLTX 3QXDA 3DC0A 1MQKL 5HJGA 1OK0A 5CEZD 1VEMA 4PJAB 4PW4A 1E2WA 3EDDA 4ELMB 1WE5A 5DK0B 1ZS2A 2VR6A 3FUMA 1NZRA 1W0YT 3M45A 3SE4C 3T2PA 3ARWA 3UTQB 4FKHA 3SDDD 1W15A 2RTTA 4C57C 4DGWC 1MAJA 4RWYL 4KROD 1RULH 1HI6B 2G3NA 3ZUCA 4BFEA 4B96A 5FKAA 2YMXH 5CJXC 2XUWA 1DDHA 1UXLA 1PLAA 1NDMB 2AV1A 3IU3B 4Y2OB 2F6AA 2Z34A 3FKUS 4JJOA 4XN5A 4I3GA 4ZS6D 3P77A 4FADA 3MFFA 2HJFB 1M53A 4P4RA 3MO1A 2V2TA 5ISZA 4YXLL 1JF5A 5I74C 3GMPB 1QFWL 2ZX5A 4ZMWA 1TLMA 1OIOA 1N9PA 1AS7A 3T5WA 4Y9GA 5GS2H 1D9KC 2DM2A 3MRPA 4JFPB 2WOYA 2X38A 3KPOB 4NZRL 5T3XL 2DPKA 3QYCA 1WDAA 5K1JA 4XBPA 4FTVE 2OR9H 1KTKE 4J27A 5IQ9A 2GSIB 1JOIA 2E6QA 3CZJA 3CSPA 3QEHA 4WJ5A 2XN9B 2JQAA 4JHVA 5LXGL 3ZRCC 4OFKA 4BSWA 4JGJA 1CGSH 1CUOA 2EILB 1S6NA 3DJ9A 5JHLL 4RZKA 2BY0A 5H94B 4OF3A 3T1WA 5JHDA 3H3KA 5IJVA 1M2OA 1YY8A 3C09C 3CVDA 2WBJA 2J88L 1FH5H 4UBDD 2EDMA 3VH8A 2GG1A 1XH3B 3FH8A 1EHLL 2GJPA 3UG3A 3L81A 1OB0A 3I2CH 3DVFA 4XNXL 3VTAA 4X83A 1J18A 4XO8A 3MNDA 3EYVB 1XD0A 2D8KA 4IGBD 1FORL 5FOBA 4Z7NF 2EDRA 3MGTA 2IO5A 1MWAB 1G7QA 5E08H 3MNVB 5EHFA 3BGFB 4BQ8A 4OIAA 4ZFGL 4ZDHB 1U3ZA 2HP4A 3N9GH 4YVNA 5ISZE 3MLYL 2HKHH 3QUYC 3QG7H 2Z1PA 4TRPL 2BVOB 1T21A 3UL4A 2WNWA 2KKQA 4JO1L 1GMIA 1SXCA 1WF5A 4Y2DA 5CSZA 1B0RB 4YX2H 4O5LH 3SJVE 2G3ZA 4PJBA 4U49A 5IW3A 4NENA 5MI0C 2QEJA 1EZSA 1JL8A 3O2DA 4I5BB 5GS1B 1DJIA 2C34A 5EN2A 4PGBA 5LDUA 4EQ2A 5BW7C 1K4DB 2HRPH 2CA4A 3KPMA 3P3SA 5I0WA 3O4LA 3BDYH 4MTMA 2DWXA 3T4AC 3WJJA 1RZ8B 1VFUA 3TC9A 4HV8A 1AD9A 3TEWA 3X12A 2RQ8A 2NXYD 4V1DD 2YLHA 3FS9A 5IIEA 3ABMB 1DJYA 3MC0A 5BRZE 2HJLA 4PVLA 1P5UB 3T3ME 5K9JH 4XVJH 3P69A 1I1YB 2H32A 4U7SA 1I4FB 3C9NA 2GT9A 1CXKA 3TN0A 4ZMZA 4LO9A 4G6JL 4Y19E 3FYIB 5T5NG 5LNDA 4Y16C 3CK0H 3LZPA 4PJFA 5DWUH 1FAIL 1Q94A 4WJKB 5DQJB 1H8OA 3HUJF 4UQ3B 2OAAA 2EZ0C 3K8MA 3RL2A 5BQ7B 3MCLL 3BVWA 1WZKA 2H4EA 3H9ZA 3CLFH 4B9PA 1F97A 1H3GA 4LL1A 4IDLA 1QSZA 4GG6A 1ID5I 2P80A 1BEYL 1M9WA 1K8DA 3DGGA 4N2BA 5DJAA 1NMAH 1CI3M 3UTOA 1IGJB 5JPNC 3HR5B 4PRPB 3IJEB 2ITEA 2C9AA 3TONA 4DCQB 2ICCA 5SWSB 3ULVH 2AJUH 3L5WB 3N6YA 3AWEA 4RDQF 2VOTA 2WXMA 2JIXA 3CPLA 1A64A 4NERA 4PI0A 3TEUA 1HNFA 1EBAA 4IKJA 4RDQG 5F7AA 3TJHC 5DSCB 3VFOB 4IBUA 3QH3B 2ARWA 3HG4A 5GGRB 4Z23A 1L9NA 2NSMA 3L3GB 1WT5A 1RU9L 2PW1A 5C09D 4P2OB 1VACB 1MRCL 3L17A 2JSFA 2Z65C 5ICUA 5HYQB 3G08B 1IGFH 2CKBA 3QFJD 4JDEB 1G7PA 1LEGA 1ZXQA 3MKKA 4HEMA 4M48H 4NKDA 4W9IC 5BUAA 1IJNA 4KDWA 4P2RD 1WFTA 1BBJA 1WWCA 2PO6C 4XPBL 3H0TB 2D7TL 4BEIA 4WO4A 2PPCA 4HMDA 3BFQG 2BNRE 4TVPL 1JPSH 1A7PL 1I1CA 5TK2A 2PO6D 5AOKA 4DZBB 2MQ0A 2BK8A 1SM3L 1Q4NX 1DVXA 4GYBA 2EDKA 4UT7L 1HCFX 3MRQB 5A16A 1OK8A 5D5MB 3QZPA 4WK4B 2BSDA 2W95A 2E5EA 2FEJA 5C0CA 3BO8A 5LGKA 3RPKA 1IEHA 4PRDB 1D5RA 3RVXD 3DJRA 4ZFZB 1ND0B 4JM4H 4GBXD 3UJJH 1D7DA 3KXFD 4DETA 3MRJA 3PGCB 4FQLL 4AQOA 3VFPA 1YMMB 5D4QA 3X13B 5KG9A 1CFTB 4GBXC 4WU5A 2YPKB 3HRZB 4PSPA 2HT2C 3D4GA 1CE1H 2FJFB 1JZJA 5FW6A 2LU4A 4LMQI 5CHNA 3FFCE 3KDMA 1YEDA 3D51A 2DWSA 4MZIA 5F89B 2RB8A 4APQC 5KYYB 2JCCA 5SWQA 2R4SH 3S5LG 3IFLH 3FT3A 1OT4A 3J8F7 2VDRB 5KJ4A 2XVBA 3VRJA 15C8H 3NJIA 4KXCA 5C8JB 3QJFA 3T0EE 3GUTB 4XNAA 5FM8A 3NT0A 4GP4B 3GDBA 5CLTA 1X9QA 1C08A 1PJ9A 4OCLC 4ZTOL 1ESOA 1UXWB 1H3PH 1JNHB 4D9QD 3US0A 1HWGB 1U95A 4P9HC 5DTFA 2F0CA 1RZQA 4IBSA 5F1KC 3Q8AA 5HDWA 1KN4L 4FD0A 4JFVA 3S36L 4K3DL 4PP2B 3TCTA 3HI5L 1S5IH 1KIQB 1MFEL 4JO8A 4JO4L 4UMSA 1CI5A 2BCMA 4L3EB 1T22A 2OMYB 5FYLE 4LSTH 1X7SA 2FL5A 3HZYB 4PCSA 4U1KA 1XMEB 3S2CA 2NY3C 4PBVC 1UB6B 4JJ5A 4G83A 3IJHB 3MNZB 4G42A 3MO1B 4HZ1A 1I75A 3AB0C 5ECGA 4GFXA 3B2VH 4NXKA 2PXYA 2ESVD 1XXFC 3NGBB 4ZTPL 2NY3D 2L04A 3MRKB 2AW2A 1MOEA 4GKLA 4PWEA 5D96C 2HFEA 2H6PB 1XF5A 5FYJE 5IW1A 3UGUA 5JHLH 1HHJA 1XDTT 1M56B 5EV7A 3WKYA 4A2MA 2H0PA 1I3UA 1YEJL 4PR5B 3N41B 3PU7A 1QEWB 1NCIA 3KPLB 3O3DA 1OY3B 4F1ZA 4WV1B 4F57H 2W0FA 5AOMA 1B4LA 1E5AA 1BGXH 4LLDB 4Z3IA 1MNNA 1DFBH 5AWNL 3DV4B 3IFOB 3MXWH 4C56D 4HAFA 3BGMA 4N0YL 2CG9X 2R69L 3QHTC 4TKWA 5L88H 4PFEA 3WGVB 1TF4A 4UCFA 2EDHA 2R0LH 4P0DA 2EUVA 4F8OA 5CGMA 1KG0B 2J8UB 4OM1H 3P3TA 4M56A 5GSRB 5EIQA 3S97C 4NCC1 5IJKA 4MB5A 1CFBA 2VDKL 4J3XA 4ZSOB 5JORA 2YD9A 3AS0A 3H9SE 4YXHL 3BKCL 3C09B 5F9DC 1HXMA 4LGRB 3BHBA 4Q9QH 5EOTA 3LSOA 4FXLA 4ZT1A 5F6HI 5C92A 3G6JB 2DLIA 4ZFFA 4KK9D 1EZVX 4FQQB 3ZT5A 1J0YA 2Q7NA 4ADJA 2PCPA 5D55A 5FR3A 1R46A 2QQKH 4F7CB 4XAKD 1MF2L 3U9UA 5IB4B 5D7LB 5E2TL 4FI8A 4RETB 4MQXC 3LRSB 1KCUH 3CSGA 5D1XB 2P45B 3FL7A 3UZVA 5DZ9A 3KBPA 4NBZB 5D1QD 1N8ZB 2EDTA 1JZ8A 2LT9A 3AMKA 3D69A 4TULL 1O9VA 2BW5A 1KNOA 2UUDH 4L4TE 1PJWA 1W72A 1F4YH 3QIUB 3QR1A 2WBKA 4ZFOA 5EEWA 2B14A 5IQMA 1EEZA 4K8RL 1EQWA 5LGYA 4QHKJ 4L5FH 4JM2C 4V11A 3DO7A 4ZMOA 2A83A 3PHQB 3ARDC 1Y07A 2C3XA 1BLNA 1HIML 4N0UE 4ZMYA 5D4JA 1MFNA 4JRFA 1HHIB 4NQDD 1KYOJ 3PAYA 4UWQB 3ZYJA 1CE6A 1YYML 3QDHA 5A2IH 3LNIA 4X9HA 4I3SH 1Z5LA 1B88A 2CHNA 4NWUH 1WD9A 1CBVH 4WI7A 4TOYH 1KGIA 1C5BL 3KPLA 5J57B 1LE5B 4F93B 3VWKD 2KDYA 3WUWB 4FQCH 4NZUH 5GZND 5EO9A 2PTVA 1G4RA 4KRPB 4KZCA 2LU5A 2X05A 2ESVB 5SX4I 5E9DB 1E2ZA 4OB5L 4RSVA 4LKCA 4YHZH 5L2KE 1DSYA 5I75C 2FATH 3QYMA 4XO4A 2OMWB 4CKQA 3NSDA 3EFDH 2A7BA 3SCMC 2JCCF 3GFUA 3ASOB 4L0YA 2VR3A 3TBYA 5B1CA 3RX5A 3UP1A 1B4RA 3LZNA 5EPMB 2R15A 1G7HB 1PNDA 1NBYA 4OR1A 1CPUA 4H2CA 4IBTA 3MREB 3CFJA 1DBJL 3QFDA 3KPRE 3C2AL 3NIGF 1TLKA 1VLXA 4JVPA 3SOTA 3L2NA 3GSUA 3SDYL 1ADQA 5KVFH 4LSUH 5KVDH 1OAKL 3BIKB 4YUEL 1QMUA 1MCBA 3IE9A 3TJPA 1FDLH 2GBTA 3ULVF 2KDGA 3Q2NA 3L2MA 4XPGL 4PWFA 1NGPL 4P5RA 3AXLB 3KYAA 4X9BA 1F4HA 3VMNA 3MUGB 1BFVL 2OMUB 4I77H 3QUXB 5JXAL 4BUHA 3ULAB 3MYZA 5IHHA 5HPMA 5IMKA 3FRPG 3RTLA 4HJEA 1AMYA 4Q0XH 2AXJA 4R96A 2WWMD 1ZEAL 2BNRB 2CR0A 3OL2A 2HTKC 3OR7A 5HI3D 3NPSC 5I16B 3IMBA 1CZ8H 3WOVA 4JY6B 3SB3A 1CU4L 4JFEA 3ZDXF 2LTQB 4MX7A 4M6MH 3INOA 3QZBA 4DGYH 3CFBB 1JHLH 1YEDB 1UWFA 2I9LA 3DTDA 2W0FB 4HJ1A 4DN3H 2VSKB 3DK2A 1B3JA 1QSEE 1YY8B 3K4AA 2EXSA 3VXUD 1J9QA 1R24B 3MJ7B 3P73B 2IBGA 4BZ2A 4XMZA 1N67A 2VMDA 1WIUA 3F05A 3SPVA 1HHJB 1MRDH 2J1WA 3LKQA 4LRNL 2AV7A 2FT7A 1SZNA 5AAWC 3ZE1F 4NGHL 8CGTA 5IROA 4IGBB 3BRFA 4W4OA 3SYPA 4M6AA 1O5DT 3KLDA 3PGDB 2RD0A 5C0NC 2CU9A 2X1XR 1R24A 2DQTL 5FK9A 2ZUUA 4XNDA 5K9OB 1MUJB 2WO2B 4RFOL 1JNLL 1JYXA 2DICA 3MI6A 2Y6SC 1AR2A 3OJVC 3GXIA 2CUHA 4WWPA 4G7RB 4AYMC 4UNUA 4FQJL 3C2SA 2Q1EA 1KEGH 4G3YH 2Z64C 5TQ0H 1GZHC 1BBJB 1OCZB 3BJLA 3QFJB 3PGCA 2MPVA 3L3JA 3VXSE 5J6HA 1XGQB 3CAFA 2HFEB 1FJ1B 1LO5A 4JM2A 5DJ0B 2Z31D 5CP7A 5JIQA 4OZHA 5GGQL 1MHEA 3T71A 4EDXB 4X5XA 4JKWA 1G7JB 1GY1A 4XMKL 2DQUL 4NS0A 2ZAHA 2GJRA 5AVWB 4G71B 2XIDA 2C1PA 3C60B 3V6BR 4HJGB 3CVHL 1P5VA 3FU0A 4JHUA 1JGUH 3CQFA 4IKLA 3FAXA 3Q2WA 4UT6H 3VA6A 1QABA 1K5NA 2P52A 3R7RA 2A73A 4IOIA 4ZTEA 3DGCR 2AKRB 4N1HB 3QWNA 3ARDD 4Y2OA 1FQ9C 1L9SA 3SE9L 1OLZA 1N10A 3PFUA 1WQVT 5D6DC 1MLCA 3HRZA 4NP9A 4ENED 4ZMPA 4EXKA 3HLKA 3V0DA 4YEFA 4EMZA 4NP4L 2XZZA 4WO0A 1G94A 1KTDB 4TF4A 2Z8RA 3HS8A 3MRJB 1NCDL 5EU4A 2P48B 4G9FE 1FNSH 1JPSL 3BH8A 3V0JA 1EAJA 2B9AA 4YBQC 1ZS8A 3HMXA 1RFDL 5CS7A 5DEFA 1BZ8A 2VDMB 3K91A 4ELMA 3QEQE 3CXFA 3MN8A 1KEMH 3BP6B 4N8VG 4AITA 4DGYL 5GS0L 5D5MA 2DQIH 4MZRA 4JFDA 3ZE0E 1A4KB 4NOBA 1PIFA 2EYTB 2JQMA 1YEHH 4X50A 4CC0A 4TVPD 4OZIE 4I48B 2FECL 2C4XA 4HEPG 2ZX8A 1NCAH 3BRDA 1DQDH 2HUEA 3EGSB 3ML9A 5DHVB 4E68A 2CDGB 4HULB 5D1QE 1FYTD 3EF4A 1HESA 4Z7WE 4E0RB 2VDPH 4G3YL 5I9QC 1BQHG 5IIEB 1IVTA 2YHGA 5BOZG 1ZHLB 2A5UA 1D5ZA 4QOKE 5DJ6A 4M5ZH 4DP9X 2VXQA 1RK1B 4XAKE 3T65B 5BVJA 3CXHJ 4AJVA 2A3TA 2OJEB 3K80A 1Q72H 1X7QA 4AQ1A 4XBGB 3N2JA 3K6FA 5B1JC 3IGKA 1BZ7A 1Q94B 3T0WA 1KPUA 1JFQL 1IMHC 1DBJH 3U9PH 3ZTNL 1TETL 2P47B 2EH8L 2XXFA 4KNQA 3FONA 5DR5L 4N1EA 4R3SA 4F5CE 2FR4A 4G80A 4WGKA 4ZO9A 4DESA 5T1KA 5E8EB 2AS5M 1J5HA 3VGFA 3U2JA 3TTSA 5AB2A 3BYYA 4ATTA 2P4AB 3TL5A 5DU7A 2IV8A 3RZWA 4AQ1B 3EKCA 3WDIA 2K3TA 3FTVA 4G6JH 3TVMC 2HZHA 4DN3L 4BCXA 4RRPA 1WIOA 3GS0A 4XHQA 4FXTA 1IC4H 2VISA 5ENWA 4G5ZL 4M5YH 4R97C 5INDA 3QJOA 4PJFF 5CN2A 3WJJC 3L4VA 5FYKD 3ZDYB 1N0XH 3LJ3A 1QO3B 3VD2A 3LNGA 4MJ2A 3L7EA 3TV3L 1QBLH 3VGHA 4L8BB 5TQ2H 1SYSB 2GBVA 3CXDH 3X1FA 3K2IA 2JB6A 4ADGA 4F8PA 1CGTA 2ZP0T 4CL7A 4K23H 1FL3B 1UYWH 2K70A 4Z77A 3LCYA 4N6RB 4HWEH 4FQ2H 3OX8B 3WFBL 4WSGA 1PPIA 4ERSH 4D0DB 1F02I 3QNXB 4JDVB 2EIJB 4CU8A 2X41A 1M1XA 4LCWE 4RA3A 1WEJL 1XR9B 1WUZA 1AH1A 4OZHE 1PF3A 2YXFA 3PWPD 1ZIBA 1GHFL 1U2YA 4LCCC 2FZ3A 5C0RL 4RX4D 4WI2A 2O5NA 4HSCX 4KNSA 1MWAA 4GKZB 4AGQA 2EP6A 3P4OB 4A7TA 1KBBA 3U25A 3H9SD 1FH2A 2CALA 3L4UA 3VO0A 4JG1L 2IMNA 4N2HA 3QUXC 1I8KA 4AMWA 2KQMA 2GI7A 3O8XD 2RMNA 4G8AC 4KI5C 2FVNA 3WJMB 3CSYA 1RZIA 4PJEA 1NMCC 3SE3A 2CK0H 3VH8G 3DBXB 2NW3A 4LGPB 4TLTA 4JN1H 1XMWA 2EKJA 5CZVL 3FSVA 1UFGA 3E9TA 1LO5B 3QSKB 4G6FD 2DS4A 4JO2H 2BP8B 2DM3A 3BUDA 4KRPC 3TO4B 4HGMA 4PJ7E 4IJ3B 1JG9A 5F1NA 4DIXA 2QSVA 3D6GA 1RJZA 3FFCD 4W9JC 1GYWA 4K94L 5EBMA 4AI7A 3OHXC 3L1OH 3MXWL 1BBDH 2XDHA 2W8CA 1BEXA 1ID2A 3W5NA 2XVGA 2Z31B 3MNWB 5BO1L 2VM3A 5SV4A 5D7JD 4F20A 3KH4A 4KV5F 3FQXB 3E3QC 1ADQH 1MUJA 4F8LA 1BF2A 1BWWA 3HAEG 5CILH 4Q52A 3CVBA 2YD6A 2DTSA 3QJZA 4PRBA 1T1WB 3RGVA 3RWFA 3KWTA 4NEHB 4PJ5B 4X80H 1NPUA 2GHZA 2YD3A 1J8HB 1K8IA 2X2JA 3ESUF 5I8CA 1SXZA 2HT2D 5J6SA 5FUCC 2BHZA 1DL7H 5GGSB 4HBQA 4AUYA 2Q86A 2APXA 1FVEB 2CZNA 3QORD 4C58B 3WTYA 1T2XA 1L9RA 3SGJA 1CFSA 3HMWH 4O4YL 4Y4FC 2HLAA 2GSIA 4Y8DC 2ZP8A 3K2UH 4NNPH 5HYJD 4U6TA 3ZL1A 1HU8A 5DK0A 2YMXL 1XO8A 4FOMA 1ACCA 3DK0A 1U8NA 1P7KB 3MODH 3BKYH 1J11A 5IJKC 2AHIA 4GRLD 3U0WH 3WJLC 1PY9A 3APFA 4HS6A 4BFIB 4R2GC 3HE6D 1KTLB 3QQ4A 3QWQB 3B37A 4K3DH 4JG0L 2R0ZL 1TTCA 1VGKB 2V33A 3HB3B 1WS8A 4MCNA 4OM1L 5EORH 1CGUA 4QHLB 3TVMA 5HVHC 3CDGA 2DYRB 4IBLT 1VCAA 4YL9A 2YD2A 2F7PA 5JDSB 2HFGL 4OCWH 4HUCA 5D71L 2ZX6A 3OJ2C 3D3VD 4OF8A 3K81A 3KLQA 4ZS7H 4YLCA 2R1YA 1U8QB 5E6ZA 1J8RA 1ET7A 5FW8A 3OJDB 4Y2LA 3WYRA 1OANA 1ICTA 4YDIH 1ZT7B 4B9KC 5AB9A 5D72H 4LFHD 2IH1B 5TE4L 3NIFE 4GI9A 2YD5A 1V7NH 3QEGH 4RGOH 5BZXA 1WZ1H 2Z3FA 2RA1A 5GISH 1MIMH 5ISZB 2YA2A 4IOFC 1PEZA 1SJHB 3A21A 4HH8A 3V0WL 2CXGA 1SMAA 3S96B 2WHVA 32C2B 5EDSA 4NAJA 2XVLA 1S7WA 4PJ9B 1RL1A 1A7NH 4QD2E 4O02B 2EDYA 4W9LC 2IFFH 1XGRB 3C5JB 4ODUA 1FNLA 3V8CA 1O7DE 1NCDH 5EIIA 5BVJB 2CJTA 2ITDB 2KH2B 4RNRB 2DMGA 4KXAA 1TTFA 1YPZF 1KYUA 2VDRL 1IQWH 4QRPB 2ARJQ 5AW0B 2WZPD 1G7IB 4C4KO