2YLHA

Structure of n-terminal domain of candida albicans als9-2 g299w mutant
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
311
structure length
311
Chain Sequence
KTITGVFNSFDSLTWTRSVEYAYKGPETPTWNAVLGWSLNSTTADPGDTFTLILPCVFKFITTQTSVDLTADGVSYATCDFNAGEEFTTFSSLSCTVNSVSVSYARVSGTVKLPITFNVGGTGSSVDLADSKCFTAGKNTVTFMDGDTKISTTVDFDASPVSPSGYITSSRIIPSLNKLSSLFVVPQCENGYTSGIMGFVASNGATIDCSNVNIGISKGLNDWNFPVSSESFSYTKTCTSTSITVEFQNVPAGYRPFVDAYISAENIDKYTLTYANEYTCENGNTVVDPFTLTWWWYKNSEADSDGDVIVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AGGLUTININ-LIKE PROTEIN
publication title Structural Basis for the Broad Specificity to Host- Cell Ligands by the Pathogenic Fungus Candida Albicans.
pubmed doi rcsb
source organism Candida albicans
molecule tags Cell adhesion
total genus 69
structure length 311
sequence length 311
ec nomenclature
pdb deposition date 2011-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11766 Candida_ALS_N Cell-wall agglutinin N-terminal ligand-sugar binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ylhA01
2.60.40.2430 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ylhA02
4LE8A 1R19A 4F27A 4B60A 3ASWA 3AU0A 5CFAA 4MBOA 4B5ZA 2VR3A 1N67A 3IS1X 4JDZB 2RALA 5CF3A 2Z1PA 4LEBA 3IRZA 4JE0A 2Y7LA 4LEEA 1R17A 3V10A 2YLHA 4JDZA 4F1ZA 2Y7MA 3AT0A 4F20A 2Y7NA 4F24A 3IRPX 2F68X 2F6AA 4MBRA 3IS0X 2Y7OA 5IHWA
chains in the Genus database with same CATH superfamily
4X7CC 3HN5A 5EEWA 5F1IB 1UGNA 2ZG1A 5E6SB 2Z31A 1N12A 1ZPUA 2OMVA 5DO2C 3GXUB 4AIZA 4KKLC 4Q0XL 5F3BA 3UGXA 5KYUB 2DRUA 4HHGA 2VZTA 3LPPA 4FZEH 3LH8A 1CFVH 3U1SL 1OALA 5AALA 3U9PL 3X1EA 1T20B 4UU9A 2QHRH 2YRZA 1GH7A 3AU1B 3CH1B 1A8JH 4KRNA 3S3BB 1D5XB 1R46A 4LKXB 3ZE2B 3D2UB 1FF5A 3QUYC 2Z0UA 2HH0L 1WGOA 1PZ5B 2F54E 2VDPL 5DYOB 1AQHA 4N1CA 1KJVA 2CLVB 5KAQG 3QDAA 5T5FL 3OKLA 4Y1AD 1EFXD 2QLVB 1WA1X 5ADPH 5PCYA 4KHTL 2A9DA 2EDWA 4UT9H 2VO5A 2J20A 3BW9B 4K2UL 4NO3B 1KCWA 1XCTB 1LO0H 4ISVA 3IFOB 5E7BA 3EG9A 2H1PH 2BJMH 2JNZA 4WDIA 1PLBA 4XMPL 1QBMH 1THAA 1NWPA 3LNGA 4WI9A 1I7TB 5EBLB 2WIMA 2H0PA 4CC0A 1G1OA 1M3IA 1Q1JL 1HWHB 2VXQL 4DAGL 1F11B 1XAKA 2CM6A 2EINB 4XPAH 3ABMB 3T8VA 3H1ZA 2EEBA 3JWNE 1FNSL 1AKJD 3HNTL 4A2EA 5JHLH 1BQ5A 4A7SA 2OMUA 5DHVA 4HOZA 3AAZA 4QRSB 5E56A 2NXZB 1LILA 4O02B 3TOPA 2IANA 1FIGL 4RMSA 4Z7WF 2J6EA 3KJ4C 4MMZA 5DJZB 1F1DA 4KPHH 1GGCL 1PSKH 4DP9X 1C08A 1CFMA 1URLA 3OV6A 4A2MA 4AK2A 2F53E 2EZ0C 4JQIA 4LSDA 3RDJA 1NL0H 3QDGA 2HFFA 4YEEA 3NEEA 1E9QB 4NQXB 2GW5A 3F83A 4W4NA 2W0FA 3D2TA 1TU2A 1RIHL 2C9PA 4HJGB 5EZOL 1RUKH 1BM3H 2J8UF 1XIWC 1K4CB 2FJHB 5ECGA 4DP1X 4Q74A 4H88H 4XWGL 3MJ8A 2IOMA 4OI8A 5AW4B 1PDKB 4HDIB 4MTMA 1CGVA 1GC1L 4X7SH 4NBYB 3RL2A 3WY3A 4TL4A 2VE6B 5I73C 2VSMB 4UQ2B 4ORGA 5A2KH 4Y4KC 1JZ2A 3D3VD 3P73B 4NWUL 1DDHA 2BP3A 3MRGA 4HPOH 5GISH 4PUBL 3FB6B 5CMAB 2EIMB 5DC0A 1RZFL 5D7JB 4CN6A 1F4WL 4OU3A 5CCJA 3IMBA 2CLZA 3Q13A 2B1AH 3TT3L 4B5EA 4I0PB 4XVSL 5GIRB 4P46A 4WNJA 4HPYL 3RKDC 2OMZB 5LUMA 4PTTB 4HWZB 5IVOA 4HYTB 1M71B 2XPYA 4G80A 4OAWB 4U1SB 3US9A 2FO4B 3MXWL 4DN3L 3NA9L 3I9AA 2YBRB 4NRYA 1OAYH 5BS0E 4N2AA 2JB5L 4YSEA 1YYLH 4APQD 3TA4D 4G8EA 4HS3B 3AJ7A 5TK2A 1UXSA 3QORC 1EHLH 1BD2A 3TP4A 3B3IB 1EQWA 1JZ7A 2BFGA 1CPUA 2XTJC 3CZGA 4ADIA 3K8LA 2XG4A 4MCZA 3ZRFC 4K9EL 2ZSVB 3BUBA 2FATH 3I75B 1TJIH 4XBEL 4GRWB 2EDEA 3CK0H 5ESVB 3NACH 2ZXWB 1DP0A 1D6EA 2HKHL 3C6LC 3LS5L 1ZHLA 1BZ8A 1M2OA 1NICA 1QLRB 2AEQH 4XMWA 3ULVL 3LQAL 1IAIL 3EJQA 1HS6A 3ATBA 3EOAB 2IH3B 2DQTH 1RSFA 3P30H 1H5BA 2IDQA 1LWJA 2YXMA 4ZMWA 5LWYH 4JDTL 1A22B 2L3BA 2IV8A 2Z91B 2CO2A 3LD8B 2KERA 4G72B 2EO1A 2BVOB 2JKNA 1XCXA 3BVXA 1JGVL 2UY7B 1OK8A 3EOBB 4ORZC 4LP4A 1XGQB 3GMMA 2DTML 3A6BL 2QLYA 1B2WL 3FOLA 3MYJA 2X4OA 5DK3A 1AC0A 4GKSB 5ISZA 1P1VA 3JTSB 3JUZA 4U1JA 1YSOA 1CFNA 2FLMA 3HJEA 3MRRB 1P2CB 3HNSH 4W4OC 3NIFB 3HN8A 4HUXB 3L2MA 2YOAA 1UB6A 5GSRA 4DGVH 2NT1A 4K0OA 4H0GA 2G0KA 2Z35B 3LB6C 2EXSA 2ZKMX 1I8KB 3FFOA 4QAMB 2IGTA 4MD4A 1DLFH 3GZKA 3VYOA 1HCZA 1HZLA 2HYMA 2O5XH 3O45A 3C08L 5DRXB 3P1VA 3K1DA 5F7NC 3R1GL 2J71A 4CUCA 3LZNA 1OO2A 1BLNB 5JUEH 5SWZD 1O6TA 4KY1L 4Q89A 4QRPD 1MJ7H 2GY5A 3MBEC 5E4OA 3AW5A 3D52A 1BAWA 5KSBA 1F2QA 3IXAB 2AITA 3ECUA 3RAJL 1RZIA 4R83A 3RPIA 3IFNH 3UEQA 4GSQA 5I1GH 2EYSA 3BOVA 4UZUA 2CHNA 4YR6B 1A1MB 1T7YA 2IC2A 3OMNB 3SPCA 5MP6H 3ZYIA 3AFLA 4A2GA 3E6FA 2PCPA 2J57A 1SM3L 4TPRL 3FN3A 5C07E 3SGJC 1J0JA 3BDXA 3V4PB 4DTGL 4OFKA 2H9GB 2X2UA 3MLZH 4BQBA 3EOTL 4E9TA 4R97B 3DYPA 4J3VA 3EGDA 1XGTA 3V52L 2WD0A 2F8OA 1YNTF 3EJYC 1R3LB 4JFYB 5CR1A 1EJ6A 3B7UX 2A74C 2ZWZA 3C87A 4YIQA 5E2UL 4MJIB 3BSZL 1PY0A 2ED9A 3F7LA 4TSBH 1R33A 1PZDA 3BAKA 1TF4A 5KVMC 1JK9B 5CLWA 2P42B 1JNNL 4HS6B 4MWFB 4OCRL 4XNQA 4XZUA 2MCAA 4LE8A 2Y2WA 5C09E 4KUCF 4ZO8A 2HT2D 3HHSB 4EVNB 2DEXX 1KT2A 2GABA 2JMRA 1P6AB 1T1ZA 3SGDI 5DC4B 4F5CE 4PJ8D 4ZYKA 4CDGC 1C5DA 2FE0A 3AUWB 3QWOB 4AMXA 2GITB 2K1MA 1KLGA 1I1RA 3Q6FA 2IDUA 4K73A 5GQBA 4URTB 1ES0A 1E9OB 1UA6L 4CADA 1M6OB 3HCVA 4JCWA 7FABH 5E1HB 3O3DB 2DEWX 4KZDL 4MD5A 1ACXA 2FRGP 2NDGA 4UILH 4AGLA 5CJQH 1WISA 5EBMA 1TMCB 4AENB 4DFIA 4IKLA 4NJAH 4X9YA 4J3UA 2Q87A 5FYLH 3WGVB 1EFXB 4S1RL 2W9DH 1F56A 4L0PB 1WZ1H 1FVEB 3DROB 1PKQE 3FB8A 4GG6E 4BGLA 3AB0B 4KKBD 3QJUB 4GIOA 4WCYL 1GSMA 2AJSH 1TMQA 3LNHA 2HMID 3MRLB 3RWJB 2LGNA 5C0EB 4PTUA 4WI7A 4WJ5B 2ZICA 1HZHL 4RQQB 3IPFA 1MCNA 4JY6A 1I1AA 3B56A 4GAFB 1JYXA 3R4RA 5HDBB 4HWBA 2GI7A 4Y5VC 1H8LA 3IWUA 3QG7H 2WGXA 4XNZC 3FBKA 4BUHA 1AKJB 1CN4A 4U6HB 4BFOA 1LDPL 4PBXA 1SOSA 2R39A 3HNVL 5C6TH 4AE0A 1RAMA 4HCRA 1I3VA 2IPTL 3K6DA 5FR3A 2HKFL 3T0EC 4W9FC 4Z3JA 1WF5A 4H4NA 4FQJH 4U6TA 5L8JB 3QHZL 1INQA 4WW1A 4D9QE 1TZIA 2IPUG 3SE4C 3FTYA 4Z6AT 2FSEA 5ECJE 1BVNT 4NZJA 2P46B 3RFZA 1BF8A 5JOPE 1HH9B 3HMXA 2BHYA 2LQRA 3VXQA 2PWGA 4YHYC 5J9PB 3ENEA 4LASL 4DSYA 4G5ZL 1U58A 5EIIB 3HAEA 1RKRA 4GQ9H 4XCNB 5DJ6B 3MTXA 4JO8A 4X5WB 3ML9A 3Q9PA 2BSDA 3H54A 3DSNA 3W0WA 3DUUB 2AJ3A 4NP4H 2XWXA 4WRLA 1KEGH 5FYJL 5IFAH 4Z18A 4MB3A 3MV8A 4AM0Q 5IK3B 2XZCH 2WTRA 4M43H 3WHXA 5HHPA 1AZCA 3OAUL 4PD4J 2PWEA 3MNVA 5C70A 5F6HI 1XL4A 5I8OL 1N6QH 4GKZA 5F1NB 1MWAH 1ZGLA 3BLBA 2QTEA 4G8IA 4KQ4H 2M2DA 3PLYA 4XNYL 1K8IA 5LCVH 3K46A 5BZXA 3QIBB 1NGQL 4Z0BL 4Z95L 3AABA 1MCHA 1TFHA 4JO5A 3DJRA 4BK5C 2WYTA 3TEWA 1AY1H 5AVSB 1HYSC 1OOAA 2I5YL 5GGTL 1A6AA 5IJCC 4CAGA 1NDMA 4LPWA 3AXLB 1DVSA 1M1SA 4AQ8A 4APQB 1AQKH 2VDLH 5IB2A 2WQWA 2VXSH 2X4QA 1U92B 3APDA 3EYUH 4WY7L 1MAKA 3MVSA 5EFIB 3PWPE 2ZT9C 4K3EH 3RJDA 2BNUA 3TBSB 2LU4A 3FOMA 5INDB 3T4AC 3WLBB 2BHFA 4FJZA 3S4SA 4AZ8B 1NGZB 1J0KA 1MFVA 2YGNA 2DB8A 3EADA 2CBTA 1Z32X 4JHWH 5B8CB 5DC9B 3T8XA 5DC2A 2YK1L 2ENYA 1IGIL 3CD4A 3KJ6H 4GMTL 4GRLA 3WFHB 4B6ZA 1IARB 2HJFA 1D5MA 4PY7A 3O4LE 4P2YA 4PU2A 3B34A 3RBGA 4BH8A 5E8DL 1ONQB 5EC1A 1RJLB 2QMJA 4FNQA 1L9QA 3K72B 4ONFH 3BGMA 3MTRA 3BUYB 3L5JA 4TVUA 4TTDD 3L8QA 2ENQA 2YSSA 3MLTB 4LLDB 2YPVH 3KLLA 3BX7C 3GTVA 1EJOL 4JM4H 3KBEA 4UT7H 4JO1L 4ADGA 4GBXD 5K1NA 3ZUNC 3CQQA 3QDJA 1FFPB 1CF1A 2BOLA 2A0LC 2R51A 5DVMA 8PAZA 5K39B 1KTLA 5GGVL 3EYQD 3FFDB 6FABH 4HUVB 1XEUA 4M61B 4MXQD 1U8CA 3OJ2C 3MX0B 4GAGH 2BP0A 2EH7L 5KTEL 4YXHL 3W1ZA 4PGDB 1U2YA 3NCYS 3LVEA 3UGEA 4E36A 1QR1A 1WA0X 4X4XB 1MQ8A 4LOUD 1X5XA 2EXTA 5GGSY 5IW6A 3BYTA 3M17A 4PRHE 3U4BH 5EEZA 1AQDA 1MEXL 2ZCKL 4RZCB 4AKQA 5J0BA 5D6DC 2V3FA 1EEYA 5ITFB 4PJAE 1JDDA 1JWSB 2WBJC 2FSDA 1W6LA 3RNQB 3QUXA 4HS8L 5AKSA 2AABH 3OF6A 1QWNA 2CM5A 4IBTA 5HVHC 3MLPA 4QRPB 5HP5A 3C5SB 5C0DB 1I9RH 1C16B 2I69A 3ZTNL 1QLFA 5I2IA 2EO7A 5CEXB 2I07B 5HYIA 4E68A 2F7RA 4G3YL 4IOSD 3CZUB 1U6AH 4B27A 2QKIB 2O6CA 1IGTB 2NY6D 3PDDA 4U7MA 4BD4A 4TNGA 4IJ3B 3CFBA 5IHZB 1JFHA 4OLZH 3T3PF 3D9AL 3WIAA 4XN7A 1ZS8A 3I50H 4ZPTB 3U9UB 2BXZA 4JRYE 4JHVA 4M5ZL 5TF0A 3WJMA 3QGVA 3STLA 2R0LH 2MCMA 1EAPB 3LH2L 3VFRB 1FNGB 3Q1EA 2JKSA 4LKCB 3OWEA 2WUCL 4QPEA 3SQBA 4NQUA 4KKPA 3MLWH 3RGVC 4MLIA 4KK9C 3V10A 1AHWB 1YEDB 2JWYA 2JTDA 1UZ8A 5E4EB 3H55A 1I3GH 3WDJA 4U3CA 1DQTA 4HF5H 3BP6B 3ETBJ 2G75A 2AS5M 1QTSA 1VRSA 2P26A 1HTYA 3DGDA 1EZLA 3GDCA 4CSSA 5BXFB 5TQ2L 3GDBA 2A77L 2OP4H 5E2TH 2B39A 3DTDA 4PJ8B 3MKKA 1GZPA 5AVYB 2OZ4H 5ICZB 1A2YA 3EJZC 4HK0A 2BNRE 2D73A 2JTYA 2VXVH 5JW5B 3X3GH 1JD7A 4WU7B 4P2QE 2GSMB 4E5XA 1QLEH 2GUOA 3NYKA 4J4PD 1ZLUK 4C57C 1RUPH 3S34L 2XG5A 2X4TB 3DXAB 2VABB 3BQUA 4CVXA 2UXTA 1OSPL 4N0UB 2WLHA 1MCOL 1XSIA 3DO7A 1TCMA 3EIFA 1HHIB 2WVTA 4PRAB 1XL6A 1D7CA 3BKMH 3V4LA 4IIQC 5E5RB 1OAZL 3SDAD 1MKFA 2HVBA 5IKCB 5EF1A 4RISH 3MV9B 4UMGA 2WVSA 2XWTB 4GSXA 3C8KA 4FXGB 2ADGA 3WU1A 2B4CL 3QQXA 2BM3A 4I0KA 4U1GB 1PX4A 4AEHH 3WIFA 1LO2H 1HI6B 3PV7A 3DOHA 4LLMA 3QJZA 5C9JA 3BAIA 4L8CB 3REWB 3WS3B 3C60A 4I4WB 2YPLD 3NEXA 3KYKL 2H8PA 3IDIA 5D7IE 3B5TA 3NCJH 4LLVB 3N5AA 2OM5A 3QUMH 4D0CA 3ARXA 3L5XH 2ROXA 3PUUA 4BKTC 1I8UA 3TTSA 3QCUH 1XF5A 3CVHH 3ZSTA 2EDRA 1J8SA 2YEZB 4JRXA 5EUOF 3LZOA 3H7BB 1E50A 4OQ1A 1TPXB 4G6ML 3WYRA 3LIUA 3MOBH 1QUNB 3F5WB 4ZMQA 5CEZH 5JW4M 2F61A 3IJ9A 4F58H 1D9KB 4UTBA 2BSTA 3UDWA 1T03H 4R8WL 5EH1A 3LEXB 1JK8A 3MYZA 3BDBA 3RWIA 2KT6A 4JN1L 5AZEH 1FBIH 2MTPA 4OTXH 1QZNA 5E6YA 4HA1A 4BQ6A 1IFHH 1LE5A 4OJYA 1KYOJ 2APTA 3L1FA 4WHTA 3RPBA 5JXAH 4TRPH 1A7PH 3ARFA 1XGYH 5DD5L 1A02N 3IXTA 2PTVA 5BQ7B 2CLRA 2JI2A 1C1EL 1ETZB 1KPRA 2Z0BA 3QORA 4G6AD 5DWUL 2YMXH 3AS1A 2J56A 4H2AA 2FB4H 2GAZB 2E7MA 5LBSA 3FO9B 4JFXB 2B1HL 4JZJC 5SWSD 1I1CA 4L4TA 2W9LA 4R7XA 5EU5B 1PLAA 1ZSHA 3LN4A 4RMTA 4UIMA 3NZSA 3UBXB 2ALWA 1MCPL 4J3OC 3BZ4A 4J27A 4YE4H 2F0CA 2FBJL 5AZUA 1MJUH 1JXFA 3L9BA 5E2WL 3SPVB 1SJHA 1EBAA 5BCAA 4OLVH 1ZTXL 1KUMA 3UG5A 5SV4A 1G6RB 1E28A 3O2DL 4ZX4A 2XN9A 4PGBB 5AW0B 2WXHA 3CFCL 3BSHA 4ZMAT 1YEGH 2FWLB 2I24N 2NY0D 5GGRY 3VJ6B 4K5OA 4S0HA 2GTWA 1CICA 1MDAA 2F58H 3CDFA 4HD9A 2VAAB 1J87A 1JXKA 2L04A 2WXMA 4NZTH 4X8CA 5IVXB 1KBVA 3FQXA 4NQDD 4AIOA 1Q38A 2W65A 2NT0A 4IBLT 3LNFA 2YKKA 3D12B 4FNLL 4QHLA 4JGUA 3IKCA 4LSQH 1JZJA 1YJDC 5JHDD 1ZPLA 4G1EA 1BVOA 2ODIA 2A83B 3KPLA 1B6UA 4O2EB 1AQ8A 3ASNB 5CBAB 1PX3A 2HLFD 1ND0B 3VSQA 2CIKA 5HI5D 4LLUA 1PBYA 1TQSA 4M8QA 4K71C 1NUFA 3T6ZA 3NFPB 3P2TA 1DBJH 3M1BB 4L05A 4OW6A 1IV8A 2UZIH 5LBVA 1OD9A 5D1XE 2OS7A 3ZE0B 1KY6A 4NQSB 5JYLA 5HI3D 3HMWH 2KI6A 4PJIA 4KJPD 1YNKH 1Z3GL 1TVDA 4X7TB 3QP3A 4DO6A 3SPHA 3JWNC 5E4IA 3WFZA 5C71A 5JYMA 3IJSB 3DBXA 1V10A 2WXNA 3AROA 4E9RA 2X5PA 4R6UA 3VFVB 5FO8A 5K9QI 5G4NA 2N0MA 1EZUA 5DS1A 3HE6A 4M3JA 2B8OT 1FSKB 3HI1A 3DX7B 4GBXB 5DD1L 3HFML 2XY1A 5EN2A 2AJYH 2X7LB 3WIHH 4PD4K 4YZFF 5D96B 2PYFA 1TKWB 3P9MA 4JANB 4ODVL 1JBJA 5AVQB 3FU9A 5JLZA 1L3NA 4JCLA 1UB5A 3V5HA 1G9NC 1CLCA 3SCMA 2ICEC 5I23A 4OCWH 2N01B 4FABL 1R3KA 2Y1ZA 3V2AR 2DLFH 3FMGH 4WLCA 2B9BA 3ROOA 1MNNA 3BKJL 2OL3A 2Y25A 5EU7C 4I9WE 3UL4A 2XIIA 3GS7A 3H3PL 2EH8L 3LKOB 4ZNCD 5CP7A 5JMOC 3NDYE 4NRZB 4LAQH 2QPFA 2A74A 1HJCA 4JPVL 1EK3A 2Q3AA 1B4JH 2WO4A 2I25N 5LJYH 2EYRB 4CC1A 1PPIA 4M1DH 3OAWA 1H6TA 3N41B 4LNRA 1F02I 5F0LB 3SBWC 3OKEA 2HTKD 1X6NA 4HQQH 3SJVE 3KVDD 4PCKA 3E7JA 3HS9A 1Q9WA 1WIPA 1NFKA 1MAJA 4UUJB 3T0AA 1P1ZB 3WI9A 5C08D 2AJXH 5BO1L 4GUPB 4LARH 4QF1A 1R24A 5T1LD 1F4XH 3SO3B 5IROA 4WI2A 5DJYB 1L9OA 3KNBA 1CR9H 3ARYA 5IB4A 2VT0A 2G9HA 1E2ZA 2NY6B 2ZCHL 3HG0A 1ZTMA 2AANA 3JYBA 4P57A 1Y6NR 4JG1H 5T3ZH 1SOQA 1PQZA 4EBQL 4GQRA 4OCYL 4IEFB 1QRNA 4MDRA 3RUGA 3F2LA 3S37X 1M57B 2PPDA 1KTDB 4F3FA 3NSYA 1MJJB 3RVWD 3PWUA 1EHXA 3MV7B 4FA7B 3EYVB 3T0DA 1HOEA 4HCFA 3H85A 1OGAA 3QNYA 3TNNA 3VG0L 2VDOL 1IJNA 4YVNA 5DUBA 1BFOA 2IMNA 5C0CA 3JVGC 3OSKA 5FDWA 2I9LA 3HAEG 3ZKXB 3V0VB 5FLUA 4DK5A 5A2BA 3O41B 5F89A 1Q0YL 3SBRA 3DPBB 3VMOA 3E8VA 4K7FA 3VXTB 5IEKB 1BZ9B 4NKIL 1KXVA 3RWEB 2V2XA 1ET7A 1JV2B 1PG7H 3UPCA 3Q9QA 4P23D 5KBNC 4AQ1B 1BQUA 1KBGL 2I26N 4Y5VA 3V6OC 2YAQA 1NCJA 2FJGB 1P53A 2ESVA 1AO7A 1SDDA 2Y6SD 2XQYK 3BAJA 4HMCA 4RMWA 5GGRA 1OCRB 1PAZA 1TNNA 5FHAH 1H6FA 2NR6D 4XCEA 5FUCE 4B9PA 4L3EA 4GI6A 2RGSA 4AXWB 1U30A 3APMA 1U8MB 3CE1A 5KSBF 5D2NE 1IGML 2LTQC 3DVNB 4PJGB 4U1LB 3TH4T 1SLVA 3ZZQA 1IEAA 4MAYD 4F8TA 1ROCA 4XP5H 4YBQC 2CUAA 1I7UB 5DZOA 1H19A 3MRCA 3PJNA 2IAMA 2CGRL 1KB5B 3BI9X 3EXJA 1I1YB 3U82B 4GNKB 2HFGL 2R2BB 4OZGA 1JGDA 3A4FA 1NCWL 4X8GA 3BKCL 4WTXA 4XXWA 1YN7B 2AK4D 2R2HA 2R7EA 4JG0H 2ZAIA 1NFIA 1IGYA 2YPLB 3N40P 2XFXA 3VXRE 5AQ0A 1AJ7L 3GBLA 2M83A 2FX7L 3I02A 4QO1A 4H1LB 4LLYA 4NKMA 1ZE3H 5GRXG 3S4SG 4BZ2L 2APSA 3L4YA 1X4XA 3EHBB 2R29A 3RZCD 2DLIA 3QCVH 1UC6A 1RP9A 4YHPB 3VB8A 1IAKB 1SNRA 5CFHA 3C6SB 4FTVE 4NM4L 1SBSL 3FPXA 3DURB 4FQQB 3SKNB 2ZXGA 1AVAA 1CE1L 4MS6A 4F24A 5J6HB 1MPAH 1W72A 4WK0B 5IJDC 3PHOB 1YEIH 2J88H 1TR7A 4AUYA 3DX3A 4WKXA 3UBXI 2P45B 3GSXA 3Q43A 3S37L 1ZCRA 1XR8B 4JY4A 2WQVA 4JVUA 1MQKL 1UFUA 1NBYB 2APVA 2X0VA 1KJ3L 1NCDL 1J88A 2A6IB 2X4UA 2XKUA 4PRPE 5CN3A 2QL1A 2CNZA 1NAML 2FIKA 3HC4H 2H3NA 4HFUL 1ZGLP 1KCVL 2QELA 3VXNA 3QZOA 5DT1H 4RZKA 3UZVA 4FLOA 4NDMA 5SWSB 1Z7JA 3JV6A 1EGJA 3OX8B 3SDXE 3Q05A 3D50A 5DK0A 1ZVNA 1S7XB 3C5XA 4GXUM 2FDBP 1VB9A 2YSTA 4AC2A 1UZ6F 5DS2A 4QUOA 4GSDL 2MNWA 2R15A 4FNSA 3PAUA 5JPMC 2H3KA 3DC0A 4IGBD 4Z3TA 1X4ZA 3MRQB 3CZFA 4LSSH 4CGUB 2H7WA 5C0ND 5MEQB 3VD1A 4OUUB 3WFBH 4R4FH 2ZUWA 2P48B 2DMHA 4JNXA 5I8EA 5HYQA 1NBQA 2QPSA 4PWJA 2VWEC 5EUKB 5L2KE 2NY0B 4TQEL 4U4IA 5D2LE 2AQQA 5EZJA 2X4NB 5DJ2B 5EU3A 5A6LA 3O9WC 3FF7A 4DKFL 4KGLA 4OQTL 4APXB 1F0LA 4AV4A 5IGXH 5EF3A 4NQDB 5DLMH 3VI4B 1JNHA 5DHVH 4Z77A 3DSFL 3QXDA 2P8LA 3BO8A 5DFWH 5I1IH 5L6YH 1UCBL 4OR1A 3VFUA 5JHDB 3VCLB 4MA3B 1WS8A 12E8H 4C58B 4D0DB 1OT2A 1GKOA 4XP4H 4ZW3A 4X6BB 1BECA 1HE8A 1CD1A 3K0WA 2JJUA 3AT0A 5D1ZD 1PEWA 4JN2A 5AAWA 5L8LB 3FTZA 2BS8A 4XHJD 1OPGL 4YLCA 1JFQL 3KH4A 4Z7OE 1IBGH 3WHE0 1LK3L 4WFED 4F93B 4ONHB 1CI3M 3FAXA 2B2XL 2CBPA 3E38A 1BJ1J 3CXDL 5H37A 1KYOK 2EKJA 4YDIH 4S1DC 1FE8L 1RHHA 2ADJA 3ILPB 1ESOA 1Q0XL 3N9GH 3VD9A 3S5LA 2OTWA 4X6CE 3ZL2A 3F84A 5KYWA 2E74C 4ZUVB 2IH1A 3ZL4H 4H26B 2Y36H 1C5CL 2H6PA 5CJOH 5GS1C 3LRHA 1TQBC 4NCC1 4K5PA 5JQHC 4X4ZA 5KJRL 3F3HA 4FG4A 5I5IA 3PGFL 5KVFE 1YEHH 1NJ9A 2DQDH 4YFLF 1IL1A 3JWDL 4QHKI 2NYZA 3DTUB 3QWRA 5CHNB 1E4WL 2C9XA 1WAAA 2OW7A 4F8LA 2X42A 3QZWB 3EYSH 4UMSA 1BQRA 4YSRA 3GZQA 4E5XG 3GMPB 1DQQB 3I6SA 4WF7A 1XVSA 3NSDA 3ZVVA 3O6KL 3H0TA 1XMEB 4HAKA 5D7EA 3ZE2E 1KELL 4JPIA 4Y2DC 1J1PL 4J8RB 5LXGH 2EDHA 5F1KC 3GXDA 1ZLSL 3IWVA 5FW8A 3TJHC 3N91A 1TJXA 4KI5E 3LN9A 4WV1A 5IQ7H 3NIGB 3VRIA 1A3ZA 5IY5B 1QSFE 3RIKA 5EORL 3RGVA 4P3DA 5AAMA 1XMWA 2EC8A 1EO8L 2NSMA 5TDOA 2UVEA 4JZOB 2N56A 5MERB 1A6VL 4ZMYA 4ZBJA 3ULUH 4JLRA 1GPOH 4KJYB 4HXAL 4D9RD 3EW3B 2OR9L 3IJEB 4OJFH 3QVAA 2E8ZA 1K9TA 4FXKB 1F90H 5F9JB 5FK9A 3VFWB 2FEEI 2P5WD 4LDLB 4IRSA 4LCWB 5C08B 3QIWD 3K6IA 4M7LH 2IDTA 5C0IB 1BREA 1A3LL 4KKBC 3GS4A 4Y5XA 5DQJB 2ERJC 1S5IL 1YMHA 2OSLA 2MNUA 2EUWA 4C56D 3LS4L 4WWKA 4M62L 4X5XB 4NAJA 2JJTC 1SXCA 3P02A 2PPEA 2P52A 2YN3A 5HHNB 3MRPB 4ZS7L 4BZYA 1H6EA 1QUPA 1WA2X 3QR0A 4OGYH 5T5NF 4Z3IA 4JG5A 1BX2A 2VDPB 1JPEA 5I26A 1GS6X 4A1RA 4C83A 1LEKB 5C0FA 3MNZB 4F57H 1GYCA 1BVKB 2TAAA 3M86A 2VLJA 1AHKA 2JLLA 1X5KA 1DVXA 3GI8H 3DOSA 1I4FB 1N59A 3GHBH 2X41A 4KROD 3I3EA 2ZUYA 4MSWB 3STBA 5D1QB 3IJ8A 2LT9A 1FVDA 1RUAH 2HVJA 4WFHE 4DH2A 2HH0H 2ZUUA 4UOW0 2WXOA 5F9OL 3TCLB 3TIEB 2VDPH 1HINL 2YD6A 4L3FA 4BINA 2GEEA 2EIZB 3B9AA 3ZE1F 5HYSB 1ASPA 1OP5H 1X5GA 4YSDA 1N64H 2YPKA 2KMWA 3VW3H 1KNOB 5LKNA 1JYVA 1OV8A 3TH3T 1JGUL 4KHTH 4YSAA 2AV1A 3KPRD 1E4XL 3LHPH 4YDJB 4FI6A 4IOIA 3ROLB 3W11C 3BZFA 4AT6A 4HFWA 5I74B 2CJUH 3N42F 3G08A 2HN7B 4PRIA 5K9KA 1RY7B 2VXQH 3MUHL 1HXYB 4N86A 2PXYC 4K4KA 1B90A 2L4OA 4FF9A 3VO0A 5IV2A 3MUY1 2NZIA 3V6ZB 3NPSB 4ZODA 4DZBA 4XVTH 3LDBB 1T5XB 4KO9A 4TULL 1SN5A 1CBJA 3DK2A 4Q6IB 1YEJH 5AVXB 1DO6A 2AK4B 2NY3B 4WO0A 1CCZA 2X40A 4YHIB 4FFZL 5FW6A 3LPGA 1IAMA 4LHQB 1A1OB 1S5HB 4N2NA 3TBWA 4NFDA 5D5MB 2P24B 3VA2C 1PNDA 4PB0L 1DL7L 2Q8BH 3VX0A 5I9QB 4F2MB 3KW8A 4MVBC 2X4SB 3B2VH 4JZJA 3ZQ9A 3ELQA 3WIIH 1WZAA 3GHEH 3RZCB 5AW1B 1Q9KB 1CDCA 4FL4C 1SRDA 1A14H 3VQMA 1FNLA 3RG1C 3DX6A 1QG3A 1NIFA 2V5YA 3CC5A 3JV4A 3OLEA 4ZFGH 2X4PB 3ZZSA 5HHME 1RIHH 5G2NA 3MA7A 3Q5YA 4AW7A 1BGXH 2BWDA 4F9LA 1H3UA 4XWGH 3R7RA 3CVIL 3OGCA 3QQDA 3D07A 3T3MF 3NBNA 3SOBH 1GC1H 3KM2A 2NSQA 2J7LA 3JWOC 2P43B 1A5FL 3ARED 1BVLA 1SVZA 2PKDA 2F7OA 4PUBH 3UG4A 4G8GA 4NT6A 5E5LA 2OLDA 2F54A 2HSIA 3PP3H 1KCUL 2MFNA 4ZUTB 1A8ZA 4XO9A 2DWTA 3NJXA 4XVSH 3MRDA 4JJ5A 4GEIA 1V8HA 3M07A 3G5XB 3ZHNA 1HQRB 3DBSA 1N0LB 4KK8D 1DSFL 2DM7A 4LVOB 1UOLA 1AOHA 3OXRA 4XC1L 5EIVA 1OANA 1YY8B 2VLRD 2CWRA 4XMXA 3FSWA 1CQYA 5BZWA 1JV5B 1FYTD 1J9CT 3CLFL 4M93B 5CILL 3NZHH 5GSVA 4R26H 5FYLD 4JS7A 4Z7VF 5HGAB 1MFUA 3PYCA 3NIFE 2JIXA 4XPFH 2QGBA 4MXQC 3O4OC 3B7SA 5K59F 3SYAA 4D3CL 4MA8L 1KPUB 4P4KA 4PJ5E 2XA3A 4NQVB 5E9DB 4UINL 4TSAH 2PP9A 4LO9A 4LOUC 3O8XC 5GXBB 4FS0A 2HX9A 1CDGA 1KGCE 3D7PA 1YPZB 4AJVA 2AK1H 3DX9B 4DWHA 1JPFA 4NNPH 1UM4L 4N8UA 4N3TA 4XO4A 2HKHH 1RUMH 4N0CD 3R8QA 1EBPA 2A73B 4YPGA 5B4MD 4YEFA 5I66B 1EXHA 3LQAH 1FNHA 3EBIA 1FFQA 3MNWB 4TQIA 1LO3L 2F53A 3CUPA 3WO4B 4HG4J 1EJ8A 2X2JA 4JMNA 4YX2H 4M6NH 3ME0A 5D1ZB 1XT5A 1BMWA 4FKEA 1RI8A 4RGNB 1YN6A 1AGFB 4JREC 3FT4B 1MRCH 4MQXD 5DUPL 2CNYA 4JO2H 1X5ZA 3WTXA 3OJMB 1ZVYA 3L6FA 5F2FA 3CFJB 1NTDA 3WEOA 3HAEH 1B2WH 3GSUA 4E41D 1DVFD 2H5UA 2P44B 2WQXA 3GD1C 1MI5E 3QFDB 1I3RB 1AXSA 3L17A 4JPSA 4MJIE 3KWTA 2SODB 3FF8A 1WP6A 3BDYL 3SBWA 2H26A 5DMIL 3T0VA 3IDYC 3TPUA 5IF0A 5MENB 2WKOA 3O3AB 2EQDA 1D7DA 4A55A 2MOQA 4K23H 2HA1A 3CU1A 3OGOE 4X4KA 4KNQA 3ARDA 5BZDB 4QRUA 1UH3A 2IGFL 3C08H 3HS0B 1WBYA 5BS0A 1INEH 2XZAL 2ZG2A 4L9LC 2XXFA 2E9BA 5IBLD 3DKHA 1XZ0A 32C2B 4KY1H 1BLIA 2E76C 2ENPA 5TDPB 1GJIA 1EJFA 1NMCB 4FG6D 4I13B 4S1SL 4Y16D 1XD1A 4NXSA 3RAJH 3VFMB 1I8LC 1MVUB 2HTLD 1OP4A 2OI9C 3DVGB 1GSKA 3FC8A 1VADB 4J4PC 4RBPK 1Y7VA 1VKXA 1NPNA 4FYQA 2NMSA 1TVBB 1N5YH 3QXVA 4W9HC 5I19H 2VUKA 4TPRH 3DO4A 1J1XH 2CO3A 1AE6L 2AEPL 1WCQA 3V7MA 3SDAC 1ECZA 4FFZA 4HOWA 3R0MA 1EDQA 4Z7QF 2YA0A 1U8OA 4Y1TA 4HLEA 2DIAA 1YMMB 1MIEL 3PL6D 4MNGE 1QFHA 3MZTA 1Q94A 5FO2A 4XMUA 2Y06L 4AYFA 2YGOA 2OK0L 4P2CG 4A7VA 4YNYB 5ID0A 2J2ZA 4PJIF 3UXFA 3V0DA 4ZS6C 4DEWA 1M1XA 3RLSA 5HDBE 5C2BL 2FCBA 2ZOKB 2JJSC 3ARGC 3DMMB 3FK3A 3W37A 1NWOA 1JNNH 1XCQB 1T6WA 1G7HA 3AM8C 5F7DA 4AVKA 3EJTA 1RK7A 2X9XA 4GYBA 1C12A 5FYJU 2CR3A 4PJEE 3KPNA 5FWRA 3KPMA 1WWAX 5G5DB 1IM9D 1QR4A 4Z0XA 1ZWIB 4W6XB 4ZUSB 1JF5A 3U6RB 3OJDB 4BFFA 2HG5A 2KHAA 3GEWB 2PW2A 4GAYA 4OH2A 2G3ZA 3UZQA 4QRAA 1NUNB 4N22A 3VA6A 4RRPM 3QUGA 1CLOL 3LV3A 5J57B 2C5DC 3KEDA 4KROB 3TO2A 4XX1E 5D1XC 4DP8X 4OLXL 3ZQWA 3O6LL 1SQMA 1J05B 4EN3B 3KLQA 1H8OA 1N9PA 1ZLVH 4GXVL 4Y4HD 1X7SA 3KPPB 1GY2A 1YG9A 4NO0D 3DI3B 4KZ0A 1X4YA 4FQPA 4YSCA 5EO0B 1A3RH 2E46A 2R9HC 2IWKA 2BIPA 5ANMB 2A6KA 3QEQB 1QABA 3BUQA 1QHQA 5CNHA 3KPRB 3M7FB 1WCBB 5EU6B 2DBLL 5KSUB 3AACA 1K5NA 1MUJA 1RZJH 4M1CD 2ZCLL 2OSYA 2G4GA 1AD9A 2M26A 3QDHA 1OE2A 2AXGB 2OKMA 5JQ6H 15C8H 1CXFA 4PG9B 4P06A 4R2GC 4ZAKB 1AZRA 4IRJA 5AB1A 4ODXB 1WBZA 4ZDHA 5C07A 4AQAB 3ZY7A 43CAA 4LVNC 4P9HL 2B9AA 5E00B 3SDCA 3WELA 2OFQA 2NRDA 3HBQA 1GYVA 5DK2A 1L9NA 1MFDL 4MRCA 2YA2A 3L4UA 1VESA 2B08A 3LXAA 4QT5A 3EBGA 2WN2A 1T0NB 1NPJA 4HKZA 4JBSA 5EOQH 5MEPB 3KWWA 4BCYA 3QHZH 1Z5LB 2VNCA 5DFAA 1ZDSA 1VHPA 4OIAA 1T2XA 3G3LA 1CFTA 2NQDA 4X9IA 3GBNH 5LDUA 1FGNL 4GQPH 5L88H 4HT1H 5H37G 4P9MH 3T1FA 3UG3A 4XWOD 2NYYD 4HZLA 5IOPB 1G9EA 4G5ZH 4PY8J 2GCYB 3S5LG 1SXSA 4BWTA 5FV2A 5K9OA 4HHWA 1QFWL 1D5BA 4LFHG 3CDGA 4MMYB 4E42A 3X12A 1PZ3A 1FVCA 1IAOA 4KUCD 2DQUL 4RAUB 2A3TA 3F64A 3L7FB 3O9WA 1NOFA 3BH8B 3ABGA 4UTAA 2J5LC 4ODUA 3WJJC 1ZT7B 3OB0K 3OAUH 2HZHA 1HQ4A 3HG3A 4F1SA 4NGHL 3KPOA 1IAII 4NLHA 1KSRA 5E95B 3H9SD 3TBVB 4GG8A 1U3HD 4XNYH 4YSSA 4M4RA 5EZPA 4Z0BH 4Z95H 1VLXA 2YMOA 2EXYD 4QXGL 1EXUB 1PKQA 3BIAX 4F7EA 4NAMA 2ITDB 1BBDL 3BJLA 3X2QB 5CGMA 1G9MH 4I5BB 3WCYA 3KLAA 3OPZL 3MGTB 1U8NA 2ZF9A 4LXFA 4WTQA 4X9BA 5IQMA 2GJ6E 3QCTL 1FYTB 3D6GA 4OZGF 5IVZA 1TZ8A 2R69A 3OR7B 3PPSA 2BVEA 2Z8VC 4HX1A 5L0QB 3TEZA 3BWAA 3M46A 3GMLB 3N04A 3EZJB 2CIIB 5E23A 2AGJH 3TJEH 2W07B 1FFNA 3X1FA 2XA8L 3BLKA 4CMHC 5ID1A 4MXWL 4XCFL 5D6CB 5FUCC 4PJ9A 1AZUA 3NH7L 3DHMA 4FFVD 1FV1A 4MLSA 2BCMA 2CQVA 5D2NC 1GXEA 4EDXB 4D7BA 3E8UH 2XBDA 1XF2B 4GSUA 2XN2A 3F01A 1IC4H 3L3KA 1IGIH 4S2SA 1R3JB 4PS4H 4N2GA 5ESQA 2X4RA 3QIUA 2IIJA 2HTKC 1ORSA 4UTBH 3RIFK 4Z3FA 4HUMB 3OXSA 5CN1A 4KRLB 4NNYB 1UOKA 4L8SC 3QI9D 5KYNA 1N2RA 4Z7WB 3E3QE 3LKPB 1Y1UA 2DWSA 1PCSA 1HHGA 1RZ7L 1NLBL 2DWEB 1A7BA 3IS1X 4ERSL 4AMKH 4Y2DA 2J21A 3GMNB 1LE9B 3NUKA 4EMZA 4BQ9A 5DURB 4LEXH 4Z7AA 4XPBL 3MLSH 1DVUA 3GGWB 5EBWB 4XNXH 3SDDD 1DYZA 1WEJH 2P8PB 1IM3A 2Y6TE 4M5YL 3T1WA 5LBSH 4P2OD 2FEDD 2NLJA 2FWUA 4NN6C 1OHQA 4GW5B 4YXHH 1Q9LB 2WLLB 1MRFH 3GMRA 3FQRB 2BIMA 4KVNH 5DTFB 3MOQA 3CX5J 4KDTC 1L9PA 2ZCKH 1MLBA 1OZTG 5ELIA 3VDBA 1GIGH 4P2RE 2IF7A 4A6YB 3O3EB 3A0OA 4BIKA 3HG4A 2W59A 4R7DB 2PNDA 3H42L 3C09C 3QJXA 4HZAA 4P23C 3NSFA 4Y16B 1NC2D 3ZTNH 5CD3B 3DXAE 5DQ9A 5J6GA 4D8PB 1AHMA 5JPNA 3PWPA 2Q86A 4N0UE 5FO9A 3UTSD 2VM4A 4AK1A 1ETJA 5ACLA 2CUMA 4XP6L 3RWDA 1DDTA 3K8KA 4FQXB 2NR6C 4QTHA 4DZ8B 1C5BH 1RJYA 4MA1B 3MRFA 4C47A 1NC4D 2WPGA 1EEZB 3MV9E 2VO8A 3O6FA 1OEZW 2EEXA 4YHKH 4RDBA 3WE6B 2F5BL 3KCWA 4HG4K 5T1KA 3B2PA 4RLDA 4MAYC 3ZDYB 3D9AH 3CMOL 3O4LA 3QFJB 1LM8V 4B9ZA 1FYHB 2PO6C 1TETL 2QZ5A 3D06A 1AS8A 3BE1L 4XB7A 1NCHA 2FNWA 1CUOA 5CEZE 1NGPL 2Q20A 3NAAH 2X6BA 4G1MA 2WUCH 4G43A 3QO1A 3LN5B 4K8RH 3PQYD 3L4XA 1T83C 3B8YA 1U21A 1FO0L 4PS7A 3OKKB 4Y5YC 4YHMH 3PWNB 5A2IH 1I1FB 4F15B 4Z8FL 1F86A 1GGYA 2BSSB 4KTEH 4HK3J 4OZIE 3HG1D 3MXVL 1VFAA 5DD6B 2XPGA 4PFEA 1SOXA 2DYSB 4B0MB 1A4CA 5IUCA 5CEYB 3WFCL 2KKQA 2YQ3A 2JI1A 5CZVL 2WLIB 4BQCA 2EE3A 3TV3H 5DDHA 2NX5A 1OTUD 1HNFA 1UWXK 4RMUA 3TA3D 2Y3NA 4CC4C 4PPTA 4Q52A 4LCYB 4L8DB 4F8OA 2ZUXA 3VRJA 3VFTB 5EC2A 4OFPA 1PW3A 1OSPH 3WMQA 2CRMA 2OL3H 1FN4A 3RVUD 1JHTB 3JV5A 4PJAA 4NO0B 4KFMA 1OAZH 4OD1H 4ZZKA 3G04B 2NCEA 3B37A 4N6QA 1RP8A 2ARWA 1TYRA 2BLFA 2DPKA 5FLVA 5TDNA 1BQHA 2CO4A 2AQ3A 4R0LB 2HJLA 3BH9B 1A7NH 2ZX8A 4H8HA 1Y0LA 2IGLA 3KVPA 2QT6A 4V1DA 3D8MA 3EFOB 3WV0A 5JIDA 1JNLL 1RVFL 3L3JA 2R56H 3ZKND 2HLAA 1KXQE 2YWZA 3JWNG 2LFEA 3B2UD 4DT2A 4G6KL 2NY5L 5ICYA 2L8AA 2OPCA 2N7SA 3GNML 3IMTA 4FE9A 4IGBC 2TSAA 1EZVY 3D18A 2ZE0A 3SE3C 1DVQA 1ADQL 1WD8A 2OQJA 2D9CA 3RIAK 3V7AE 3ZDZF 5CM1A 1QO3B 2HRHA 3SQOL 3QEGL 5E24E 5M7QA 4IJTA 3WFEH 4N1EA 5DQDH 3BFOA 4FC3E 4XO5A 5C6PB 1N6VA 1UVQA 1DUYB 5IW1B 4I18B 4JRYA 5IVXE 4QHUA 3L4CA 1NGWB 2WNWA 3P0YH 4KI5C 3VXSA 1LO4H 1K3IA 2DQJH 3OMAB 2CDFB 1SYSA 1DBKH 5DI8A 3HW7A 3CX2A 2YQ2A 3QH3A 4I77L 3LZRA 4MKTA 1T5WB 1E5UI 4LEBA 2XY2A 4XAWL 4P2AA 2E4FA 3RWHA 1DN0B 1U8HA 4QRTB 4GW4A 1YNTB 4I2XE 5DD5H 1GGIL 3K2IA 1P6FA 1W8EA 2C1OA 3L1OL 3OHXB 1TTUA 2B59B 2ADFH 2CO6A 1AGBB 2DYPA 3I6KA 3HA0A 1C1EH 1EH9A 2FQDA 1B0GB 1Q9OA 3FRUA 3SDYL 3U83A 2BNRA 4I3RH 5KSVA 1HSAA 4FDWA 4P2QA 3V5KB 2VLKD 3L3IA 4QJ3B 3O8XA 5EOTB 2EKSA 5F7MC 3WNMA 1I9IH 1LNUA 1N3NB 4N9GB 4W9KC 3TO4C 1UG9A 5JHBA 2CKBL 4HH9A 2LR4A 5E2WH 5KBMA 2JB6B 3CLEL 4CNIB 1ZTXH 4XCYB 3H9SB 1XO8A 3OHMB 4C4UA 3BP5B 3K2UL 5TE4L 4WI0B 4EXKA 5J7CC 3OG4B 1E7UA 43C9B 4JKPL 3EH3B 4FCAA 1UWEL 5JTWA 1K4DA 2GBAA 2EE6A 4QXVA 3H3BC 1XGRB 3C5ZA 3VXOB 3GJFB 5DVPA 1XFPA 5EMYA 1O7VA 4OZHE 4MFHA 2QVKA 5A7EA 5D7IA 3MN8A 4NZUL 1IGFL 5CD5C 2YO3A 3PFUA 1OQXA 1HKFA 3S35H 4L29A 4G8FB 4PJDA 4HLJA 4O9HL 3NJHA 4B50A 1BEYL 2BSRB 1QA9B 5C6WH 1WFMA 2F68X 2SEBA 3BAEL 5JOFA 2R29H 3D85A 1A4BA 1IO4C 5J12B 4J3OF 4OD3L 1MN4A 2F7PA 1UWGH 1OB1B 3QPXH 3QUHA 2AHIA 4C55A 4X98A 1A0QH 1HHJB 4X4YB 3QNXB 1W72H 1ZHBB 5T3ZE 4L9DA 1KEML 1DQLH 5JIPA 5IG7B 1G7LA 3CLWA 1WV7T 2NY7L 2Z31D 4LEEA 3NJNA 4QRRD 5JDSA 3D4YA 4FCHA 1BSIA 4BZ1A 1WVZA 2NTSP 4X9HA 3HUJE 4Q9QH 3OKMA 1YRKA 3INUL 4GRMA 1RD6A 3HFMH 5LAXA 3M88A 1NCBL 1I8LA 3M45A 4WO4A 1KTJA 1Z5YD 4ODVH 4KQ3L 3SDDB 3JYCA 1XTMA 1V05A 3H9HA 5HYJD 3MV7E 4K94H 4XH2A 3WDHA 1TTBA 1JZ4A 2ICWA 1EGJH 2RCSH 3QPQC 1FCCA 1E4KA 3PG2A 1SXNA 4IQHA 3BWZA 3BKJH 3LNEA 4MZ2A 1AANA 2FWSA 3MUGA 4L5FL 3GI9L 3LEVH 2MHAB 3NSXA 4LL1A 2ZX9A 5ITBL 4R7NB 4X5RA 4AUUA 2E7LC 1AP2B 1OD7A 4X7EC 1VCAA 1IUZA 2EDMA 3BQVA 2R8SH 1U93B 4LSUL 2R1YA 1RIUL 3VNYA 1TYJA 5KOVC 1KBBA 3BPOC 4BFJA 1IBYA 2X3BA 4U05A 5DHYA 1V7NL 4TMPA 5JHMA 3HS8A 3MHZA 5FDYA 4FKKA 1MFCH 4XOEA 3E0GA 4GKNB 5IJVB 3CFEB 5DRWA 3Q3GA 3HZMA 3R06A 1TCRB 2CJSA 1S8DB 1MFEL 4X50A 4PRNB 1GHFH 4PJGE 1OP3H 2X2HA 4FA8A 4MKMA 4BKSC 2BFVL 2VDOB 2ZCHH 3VFNA 1QQDA 4PCYA 2IAND 5I8KL 4KMTL 2NCMA 4F7MB 3U4AA 5EEYA 2DH3A 5FOBB 1YVLA 3P3RA 4OCYH 4ELKA 2B14A 5AW3B 1X5AA 2CDGB 1TSHA 5K9JL 3KCPB 4HKXA 3F12B 5IBTH 1S7UA 1KN4H 2WNXA 3MLRH 3V4UH 3PQYB 1O7DC 2W88A 3UMTA 4ZOEA 5C3LD 3VG0H 1MHHA 1IAIM 5E8EA 2DIBA 1SFHA 3IN2A 1QW8A 5KANG 3WKMH 2B1OA 2OJZL 4NUPA 5DD0L 5DJCA 3BAYA 4OKDA 2PYEB 1WLHA 2WKOF 4BUQA 1Q0YH 4DQOH 2E59A 2BZ7A 4LCUB 4MNHA 4CSZA 1Z9SB 3G5WA 4G9DB 3DRQB 5I30H 4NKIH 1S7SB 5B3JE 2JCCE 2I7SA 4KKCD 2MPVA 3EYFA 4WI5A 1BV8A 4OGXL 4MDIA 5LNDA 3D30A 1RPUA 2VL5A 3IDNA 4MMXB 3IDMB 5B1AB 2EIJB 2BVUA 5D55A 1WAEA 2BNQD 4P46D 1Y18A 2QADC 3DDGA 3MGOA 5D8JH 5EULV 1ZLUH 3A6CL 2IO5A 3MFGB 3E6HA 4Z1PA 4YN3A 1MH5B 4QRQA 4U1NA 5C0BE 2EUZA 3AREC 1QPXA 2ZXQA 4JDZB 3GXNA 3FB5B 2EC9U 2ZUQC 3LKQB 5H94A 4G5AA 3D69A 1U8QB 3SJVA 4O2FA 1JF1A 2QQNH 3FSZA 4YLBA 4OF0A 2HFGH 4P5MA 1BD2D 3ZDXB 3BKCH 2PW1A 2WOBA 1MHEB 3CSYB 3GSNA 3IU3A 3OAZH 1K2DB 2WLYA 4JVPA 4QEGA 2RA1A 3U36A 2WMPB 2EDNA 3FCSA 4L4VD 3K8MA 3A67H 4AE1A 4PJHA 1K8DA 5TH2A 2AP2A 4FXLA 5AZ2H 1XX9C 3MFFB 4NZ8A 1DZ0A 1PF3A 4PGEA 5DHXB 1KCSH 4Z7UF 3WJJA 3J2PA 2G3NA 4WKZB 1P7KA 1Q1PA 2IPKB 1JPGA 1CE1H 1A7OL 4ZQKA 1A4KB 3VI4E 3WGUB 3QDGE 4EUPA 4IRZL 4LP8A 1NAMB 1M7IB 2ZSWB 4LIQL 4M7LT 4AGNA 4ENZA 1AIFB 2EEDA 4FFYA 2ARJA 3G6DL 5CSBA 5FF6B 4WVRA 4ALAH 1FNEA 3TVMC 4HKJB 4ZFFA 1QI4A 1QEWA 2XQBL 3T0WA 3OM3B 2QR0A 3FFCB 3B9KA 4RH4A 1HILA 5JW4R 3GC3A 4CN1A 5HJ3A 4TS6A 4MAUL 1M7DA 2DW5A 5DHDA 2ORBL 4LLWB 5ISZD 1NAMH 3MLVL 5LGJA 2DS4A 1VGKB 3QEHA 1Z9MA 2DQFB 1L9MA 3EO0B 1XGPB 4RGOL 4AG4L 5GRYA 3QJFA 5EO9A 3UJJH 4C4KO 3K71A 3IFLH 3OZ9H 4TUUA 2Z7ZA 3LKNA 2GY7B 1A6UL 1AS6A 4XVJL 4R4BB 2A6DB 5BW7C 4AMWA 1I8IB 3CFDB 3VWKD 4GSDH 3NZ8A 3QO0A 4JZNA 1DO5A 1BJMA 8FABA 1S7QB 4AQEA 1A66A 2GK0B 4WFFD 2NW2B 2NXYD 4XI5C 1IEBB 1E8XA 4KVCH 1E40A 5IFHH 2KYIA 5DJDA 3C5JA 4ICWA 5EF2A 4BFNA 5CINL 2QVMA 4G83A 3REVA 4OFYA 3WUWB 4KHXL 2IXQB 1OCCB 3IPBA 4F9PC 4HSAC 1MG3C 2Q76A 1A1NA 2ZCZA 3VXRA 3DV4B 4NN7B 1HEJC 2OTUB 4P05A 4LAJH 3DSFH 3OBAA 3ULUE 5FS5A 4H5SB 4U1IB 4O51B 2ZUSA 5FECA 1C8PA 5IBLC 3F7YB 1DQMH 4L37B 4ELMB 3KHOA 3DO3A 4XGZA 2PR4L 5D7SL 3TCXA 3ZQXA 3NIGE 3SE9H 3ZK0A 4XZ4A 2GHZA 5E5MA 2Z6FA 3ULSB 1JPTL 2QSQA 2HTLC 1J9RA 1LK3H 3FDWA 4C54A 3SN6N 3V4VL 3CVBA 2X28A 3CXDH 5BRZD 1P5VB 4EO5A 3MCYA 1MLCB 4LCCB 1FE8H 2CUIA 1FFOB 3SD2A 1Q0XH 2WXPA 4ZSOB 4M3KB 5EUOB 4LCWE 2DJMA 1L7TH 4QRRB 4I3SL 1YAZA 3ISYA 3OPUA 3RDTA 5BUAA 1XH3A 1KYDA 2D7OA 4NEHB 3CFKB 2FUQA 4NUJA 5KJRH 4HGMA 2Q7YB 3RVVD 4PRPA 3RY5A 1I9JL 5E6IA 4XNMA 2ZOLB 3MRBA 3OKDB 1VEOA 1CXEA 2Q9OA 4GI8A 2Q1EA 2YARA 5ETUB 2I7OA 5I1JL 3K5SA 2GFBA 4UU9B 2Y72A 5T1MB 1E27A 4DEPC 1RK0B 1N7MH 4YHOL 1KB9K 1A7RL 3IJHA 4JR9L 4N2BA 3E9TA 1DVTA 3SDXA 1FHGA 3PWLB 3VWJC 2LU7A 1OB0A 1T1XA 4GG6F 2YFOA 1HL5A 5HYJB 2X2YA 3RVXC 1GOGA 3LKSB 1WWCA 1V27A 3Q2LA 3C75A 2WLJA 5CZXC 1IC1A 1E5AA 2GT9A 3UAJA 5D1QE 3DYMA 3U9WA 5TTRA 2PO6A 3RA7H 4X7FC 3SEPA 4M8UA 1OAKH 2VLME 3HG2A 4RFEA 3WMPA 5L2KA 4OF8A 4PMFA 4RVBA 1BQHG 4DERA 1JZ5A 1AAJA 1DFXA 2CGYA 1QVOA 5DFVC 3VXMD 4YWGH 1BVNP 2GSGB 1OARL 1EO8H 1T22A 4Y5YA 5E94B 5JXEC 2R4SH 5DEFB 5A3ID 5KBDA 2Z7WA 2BVPA 4JRWA 4Y4HC 1SDYA 5HGBB 4HHAA 1MRDL 3MRJA 4HXAH 1UJ3A 3BVTA 4POUB 4ILDA 5LQBH 1J5HA 1QX1A 4OF5A 1XV8A 1I1AD 3PV6B 4HUWB 2W60A 2FVNA 2EACA 3KYNA 1FZKB 2FO1A 4JKMA 1Y07A 4H25B 4IIZA 5HDQH 3KZ8A 2HWZH 4S1QH 2QFRA 3TEYA 1CE6B 1JVKA 1JE6A 1ZVSB 2CR6A 3RU8H 25C8H 4NI6A 3QDMB 5FM8A 4AL8H 3AAZB 4LF3A 1ZK5A 2JJWA 3SKUD 2ZXAA 3LS4H 1UXWA 1J5DA 4QY8B 4M9PA 1MIML 1PLCA 3KDMA 3D0LB 1BCIA 1EANA 3N1GC 3QPKA 5IEHA 4OJEH 4AYMC 5C0RL 5ADOH 3KPSB 2F8VA 4NQCE 1C08B 4WUUB 4X6CA 3NJLA 5T3XL 4EE2A 1EERB 2G60L 4A67A 4JHUA 1QFUH 3NJMA 4JKKA 3IRCA 1H8NA 5C0AE 5B7MA 5DEGB 5F1IA 1T21B 4N0YL 1G7PA 4NN5B 3WEXB 1DEEB 1XD0A 2VLLB 3D4ZA 4TQHA 5E2VH 1KTCA 2HFTA 4MA7L 5ERWB 4OCXL 5HHQB 3ML8A 4DPAX 4H8UA 4P3CL 5F9OH 5GJTH 5KYUA 1NH6A 3K2MC 2CH8A 2RFXA 2H1XA 2VERA 1NUDA 3B5HA 4ORGB 1PD6A 3MJ9A 3BHBB 1T20A 3MV8D 4Z76B 1HHHA 2NYYC 5BVPL 3AU1A 3CH1A 1KGUA 1D5XA 2G5BB 5CJBA 3HHMA 4PP1D 4U6YB 4YDZA 4LKXA 4O5LH 5K93A 1E4XH 4FYSA 4UV4H 1J5CA 1YYML 3MODH 4HC1L 2BNQB 3D2UA 3S97C 4N2KA 2X9ZA 1PZ5A 1KLUB 3L3OB 5DYOA 4TVPD 1NCGA 4UQIM 3BT2H 4G80B 1QSFA 2CLVA 4X83A 2H0FA 5L9DH 1X5YA 1IFRA 2VMJA 3WN6A 1NFAA 1T80A 2DBJA 3AT8A 4PMEA 3NGBB 4EIBA 4IOFD 4RWYH 5CGYC 4CMMB 1G7QB 4FADA 5C0JB 1R19A 3Q7JA 3BW9A 2MH4A 2UXFA 1YJDL 3MRIB 1SY6L 1U3HC 4NO3A 1XCTA 1IGJB 3I6LD 5JHLA 3UTZB 5L2JB 1U4EA 2EXYC 3FO2B 2I27N 1Z9PA 5LLIC 4BH7B 4FFZH 5FGBA 5EBLA 1I7TA 1IGCH 2GI0A 1DL7H 2XG4B 4OJDH 4TLTA 2AJVH 4JVWA 3BUIA 5ALCL 3L4ZA 3QHFL 4L4VB 3MNDA 1F11A 4PBVC 4Z7NB 3ULVE 1RSYA 4P5TB 3P11L 3Q8EA 5E9DE 2E7BA 3K81A 3TO4A 2V5RA 2VDKL 4GRLD 4XX5A 2C9RA 4NIKB 5JIMA 4QRSA 2ZPKH 3VGHA 1AZZC 4O02A 4NHCH 2YGQA 4DOHE 2WYZA 4WK4B 3BVNB 1UWYA 5DJZA 1PYWB 4P5KB 4Y4FB 5KSAB 4BSVA 3FCUB 4J1UA 4MQ7B 5D7KD 2XTLA 4GS7B 1CD9B 4DKTA 3DETD 3P77B 1KXTB 4W9DC 2X1QA 1A5FH 3PABB 2YKLL 1G0YR 3LKRB 4QMEA 1E9QA 3IRPX 4NQXA 3W0WE 1JL8A 4M6AA 3GLZA 2LHAA 3FUIA 3GMMB 2DL2A 1HE7A 4HJGA 5BO0D 4KXCA 4RGNE 1D7BA 4X99B 4ZFZB 5ISZB 2D7TL 2FJHA 3IDGA 1JDCA 3JQOB 3QA3A 2YUXA 3QI9C 4OLUL 2BWIA 2N59A 3KD4A 3NK3A 4HDIA 4PJAF 2ZWNA 1DSFH 5GRUL 3PDOB 3I85A 4UAOC 2VE6A 4LSTL 1Q4NX 3P73A 1GRWA 3TN0C 3AGVA 3FB6A 4LHJB 4UQ3A 5CMAA 4PJ7B 5D7JA 3VWKB 2PABA 5B38B 3L3DB 1U9KA 4JPWL 5CILH 3FYEB 1TVHB 1NANI 3CHRA 4I0PA 3CSTA 3ZX1A 5MENE 1JRHL 4WJKB 5GIRA 2NXYB 4P2OC 2FEDC 2P9RA 4B0MM 2OMZA 4NENB 3VD3A 4TUKL 4MA8H 3KLHC 3OF6D 2V7HB 4PTTA 4HWZA 1NCNA 1V7MH 4KKLD 3DI2B 4OAWA 1XAUA 2A6JB 3X14B 2FO4A 3PP4H 3EYOB 1N67A 1W8OA 1HESA 1IRAY 2D9QB 2YBRA 3CTTA 1HKLL 4RGMB 5I82A 1HXKA 2R4RL 1HNGA 1YDPB 1GL4B 1BPLB 2F7IA 5INCB 1L6XA 2AZUA 5TF1L 3RPIB 5IFJB 4GUOA 4LVEA 4I0CC 2EYSB 1OTSC 2V7NB 4HS3A 1WITA 2E27H 2Y07L 4HPHA 3BH4A 1HDMB 2NW3B 2ZD0A 3B3IA 1R34A 1SMAA 3RNKB 3N3EA 2WWNA 3NFSL 5DSCB 3CN2A 4AYGA 4U6VL 2NNXA 2IWFA 4LDOB 1N70A 2ZSVA 3BZ5A 3I75A 2DD8H 1UYWL 3HN3A 4NRXB 5ESVA 1PX8A 2Z9TA 2R0ZH 5D70L 3KLDA 5BRZB 2E7LA 2XX1A 4IS6B 4KTDL 1QLRA 3DECA 5LB1A 3IAPA 2EECA 4DIXA 3MRMB 1YMME 3HBPA 3BPCB 3HRZC 3Q8CA 1BP3B 4OZFB 3EOAA 2IH3A 5IQNA 1OE1A 4R84A 4KRPD 1ZA3B 3QDJE 3PGDA 4ZFOL 2I60L 3PHQB 3D05A 1XF3B 4OCNC 3MLUH 2Z91A 1CDYA 3FQ2A 4NO2B 5DMIH 2HT4D 4ODHL 3BISA 4UTAH 2BVOA 2IBZY 4JFUA 3WEMA 3B1TA 4WNQB 3T71A 1XGQA 4KXDA 4OZFH 2RACA 2V9UA 4GKSA 1P4IH 2JQAA 3SKMB 1BOGB 4JDVB 4OV5B 3JTSA 3CPUA 3GQFA 2IGFH 2WCPA 4H2CA 4H8WL 1TJGL 4JPKL 4ZRGA 3BQUD 2XZAH 3MRRA 4YDLC 4L3CB 4AQOA 4MRBA 2O5YL 4N8CH 3KYAA 1NCCL 2LVEA 3UTTB 1KYUA 4YSOA 3TA3C 2C9AA 3MLYL 2Z35A 1I8KA 2R69H 4RIRA 5D7IF 3F58L 1F13A 3IMVA 3WJLC 5IBUG 1CURA 4JM2C 5T33H 5DRXA 1L5GB 3VXMB 5G4OA 3Q8BA 2O72A 4WHYG 1BLNA 4KH9A 3RVUC 5B1BB 4AEFA 1FH5L 2P7TB 1EA9C 3QEQE 1I31A 1AE6H 2BY0A 4N0FA 4B96A 2OJ1A 1JTPA 5I0ZA 5EU6E 1BG1A 2P5EB 3IXAA 2WUBL 4HIIB 3ZHFA 5DD3H 3TIDB 1MIEH 4B7IA 5IMLB 3NCEB 4WIQA 2Y06H 4RFOL 4LBEB 4X6EB 4Y8DC 4YR6A 3ZBMA 1TZGH 1A1MA 4K7PX 1E4XI 3KYMA 3ZKNC 1XH1A 5C2BH 4GUQA 1AD0B 4RDQG 4Q9RL 2X1PA 3NRPA 4XBMA 3V4PA 4EUPG 3Q5OA 4FQLL 2H9GA 1BW8A 5B1JA 5AYQA 3LPOA 3TZVB 1TZIB 5J06A 1UGKA 4JFYA 5BVJB 1CYGA 4RETB 5CP3A 3BAWA 2AXWA 5EZLB 4MJIA 5HHOB 3GKWL 4PG2C 4JB9H 3F00A 1XWVA 3RWCB 2ATPA 2R0KL 4WEBH 3V8CA 3BZEA 1HYRC 4JFWA 1U58B 3OKNA 4MWFA 3QORD 1HCYA 1NIBA 4CBZA 5FYJE 3RTQC 4EVNA 3VQ1C 1RZ8B 3IU4L 3MV11 3CDZB 4Y9FA 1ED3A 1SXAA 5FKPB 5B39B 2XBTA 2AXFB 2F1AA 1NZRA 2NY2D 4L4TD 1JHLH 1F8TH 2F5AL 5H2BB 3QWOA 4PREB 3K80A 1UD6A 3ET9F 1CFQB 2Y2YA 4KOBA 4EI6B 5KG9A 3WTWA 1E9OA 1VACB 4N6RB 3C6LD 2EVGA 1RZKL 1ZGLB 1WFJA 3NOIA 2DBLH 4DP6X 2ENJA 1NSNL 1Z3RA 2XN9D 1IVLA 3O3DA 2CBMA 3QJOA 3CFMA 5AYUL 2Y69B 2XVBA 5I1CL 2XRAL 4KVPA 3B7YA 1CICD 4AENA 1AZBA 1E5YA 4MNQB 2D31A 3TWYA 4YMPA 3TVMA 4ANKA 3VGBA 1NDMB 1FVEA 1W0WB 3DROA 4FNUA 1R47A 5J11B 2ZXEB 1KFAL 4PV8B 2B0SL 3QQ3B 2ZYSA 2XWCA 3D48R 4MNGA 2IPUK 3DGGB 3MRLA 2OW6A 3ZKXC 1FORL 2F2HA 3RWJA 4ZZFA 3F7PC 5C0EA 4JRXE 4WJ5A 4G7VL 3CU7A 4ZOAA 2GG1A 1WO2A 4RQQA 4U2ZA 4K3JH 3NTCL 4HMEA 1PLGH 4KXAA 3S4SB 3ZGIA 2R83A 1ZT1B 2F15A 2NTFA 2XUWA 4XN8A 5I6KA 3T8XB 5BW7A 1AKJA 4U6HA 1FGNH 4V2CB 2QMKA 5IT2L 3LB6D 1CGTA 1HAWA 2W91A 4P59L 4K7PL 4BH8B 1KTRL 5EC1B 3NCYP 3ETTA 3P4OB 3PHAA 4WEMB 2N0KA 3LZFH 3W56A 4N4YB 1YEKL 4UT6A 4YK4C 2H6UA 3ASWA 5DMGC 1ZE3C 3HE6D 1S7TB 3MBED 1RJZB 2DQUH 4GO6B 1FNFA 2ZOWA 3FO0L 5BRQA 7CGTA 1HH9A 4QGTA 4F9PA 1S9WB 3PIQB 3WNJA 5J9PA 3A5VA 2Z31C 5CXPA 1UA3A 5EIIA 2BIHA 2YLKA 2XWDA 3D4GA 4KO6A 2J72A 4XCNA 1J9TA 2A9ML 4M6OL 4DW2H 5LCVA 4QXGH 4UIKH 3DUUA 4G9FB 1LQBC 3V0WL 3R19A 5EU4B 5IK3A 5FGCE 1S46A 4JDEB 4J2QA 2R23B 5D71L 1UM5H 3DHPA 3FTSA 3MOAH 4UOW1 4H0IA 4WI8A 5CIPB 5F1NA 3SE6A 4XOAA 1HCFX 1JXGA 2VH5L 2HJKA 4J6RL 4M5SA 4RSVA 3QIBA 2QHLA 2VR7A 4E9LA 1SMDA 3QFGA 3VXUB 4O58L 3C8HA 2EYTB 4FQHA 1KJ2L 1T6BX 2DQGL 1CGWA 2C3XA 3E9UA 4XT1C 1KC5L 1NM9A 3AS2A 4JHAL 3HE7C 1QLFB 4ACPA 1H15B 1FL6A 4I1PA 3NH7H 1KJMB 4JAMB 1BIHA 5J4MA 2WLNA 4TLKA 4APQA 1GGBL 1BQLH 4H13C 5C0GB 3F6IA 4U0QB 1U92A 5EFIA 4AJYV 3LXCA 4YDKL 3MCKB 3TBSA 3RIFF 2FWOB 5INDA 3QUYB 3WLBA 4FEIA 1IJ9A 4NC1E 4AZ8A 5JO5B 1NGZA 5CSGA 5C3TA 1ZS8B 1GVIA 3OAYK 1QRND 5B8CA 5EDSA 3WXVL 3ZDWA 4Y9CA 1IC7L 4R7LA 4FG0A 4OKVB 3WFHA 4XAKE 3ZDYE 3QFJE 4PGZA 1OGAD 4XPBH 1ONQA 1Q0EA 3K72A 4W70A 5CWSB 4MMZC 3BUYA 4OIIL 5I75C 3F85A 3GFUA 3MLTA 2G75B 2JV6A 3OB8A 4LLDA 3EKCA 5JXEA 4PJCE 5FCSH 1E90A 4YHNB 3BCFA 3O3BB 2UWEF 2ZNXA 2DWDB 3U25A 4F80A 4UZGA 2ZKHL 4MAZA 4GSRA 1FFPA 4U3SA 4N87A 4YDVB 1JHKL 1X9LA 2ESVD 2I85A 3PJLA 5K39A 1AO7D 4HMDA 4LQFH 4A39A 3FFDA 3CSFA 3FUJA 2VMFA 4PJBB 4BXVA 1FLRL 2C1PB 4PVBA 5IP4A 2GJ6A 4M61A 4HUVA 4OSUL 3MX0A 6PAZA 5CKGA 3F6JA 4AYSA 4GT0A 3QWQB 1W9XA 3KJ4B 3H42H 1FA4A 4PGDA 1HL8A 3LMJL 4X4XA 5AVRB 1A6WH 4KKCC 3APNA 4HSCX 3NCXA 1MREH 4ZW8A 4RZCA 3TF7C 5FUOH 2IFFL 2FK9A 3OZLA 1DJXA 5ITFA 4G6JL 2DQHL 4P46C 3TFBA 3WIFB 3LZPA 1JWSA 1E2WA 4XVUD 4Z7VB 5A2FA 4ZJ9A 3WY4A 4HWEL 3Q44A 9PCYA 1XIWB 2YGVA 2RQEA 3SE8H 2RJMA 3BC9A 4I8DA 1MCWW 3C5SA 5C0DA 1S9VA 1PY4A 3EO9H 1CYXA 1R0AL 4F91B 1JZDC 3N06B 3GMQA 2QQKL 4FKHA 5I73B 4PR5A 3HLAA 5CEXA 4Y4KB 3BE1H 2A9AA 2I07A 1YCSA 2YAMA 3TNMB 1T4KB 3RUGE 2OA9A 5E6ZA 2DIJA 1FO0H 1AYRA 1IGTA 1VENA 3E2HC 4OUOA 3FSOA 2GTQA 3ULUC 4Y19D 1B0WA 2DDQL 3N85L 4BZ1H 4FZ8H 1OGAE 4ZG1A 4JGJA 4ZPTA 3U9UA 5I1HL 5HBBA 4XBPB 4X2UA 3VFRA 2E6JA 2KH2B 1EAPA 5C0CE 5ILTH 1WTGT 4LKCA 5D7LB 1LE5B 1HYSD 3SDXF 3U7YL 4HK3N 4OZ4B 2YUZA 4KO7A 1EIBA 1AHWA 1YEDA 3RL1B 3ZT7A 1EWHA 2Y1AA 1H5BC 4G7YL 3QORB 3CN0A 3EDFA 3BP6A 5CR8A 5DJAA 3UAAA 5A43C 4W68A 1QTPA 3OL2A 4FFWD 3T6WA 5BXFA 2XTJB 2J1KA 5GGSB 1ZKAA 2WSDA 4P2RA 4TUJB 5FEBA 5J13C 1Z6JT 2W92A 5SV3A 3ZZ1A 1ZTXE 5ICZA 1B3IA 4L3EE 5D2LF 35C8H 5EPMB 4L1TA 5EWIL 3RQ3A 3F7KA 3SYCA 3ZPDA 5JW5A 5DGQA 4WU7A 5KVDL 1UM6H 5KJ4A 1SJHB 2PPCA 4FQ2H 1WHOA 3C6LB 4FJYA 4S0TD 4UTCA 2HX8A 3ZXAC 2DLTA 2X4TA 3DXAA 3GF8A 4FLQA 4LSPL 2VABA 2XN9B 3SQRA 1QFWI 4Z7IA 4N0UA 4CU6A 1X6LA 3T2PA 1U8IB 1JTOA 5DJ8B 4BRVA 5IB1B 4J23A 1Z5HA 2NY5H 3C2SA 3WLWC 1RH8A 5IKCA 3KBPA 3MV9A 4AQZA 3QUMA 4X4ME 1ADQH 1URIA 1UXMA 3L95B 4FXGA 4PIRF 3RIAF 4Z7OF 1X9RA 3QEGH 5D4QA 1HI6A 2FX9H 4N20A 1V5JA 4KQ0A 5FGSA 4L8CA 3REWA 3WS3A 4WWPA 2QTVA 4I4WA 1N8ZB 5J1AB 3L1GA 1K6QL 1SPDA 3HG5A 4CW1A 4H7VA 4KNSA 4LRNL 3RWFB 1T1WB 2AQPA 5TQ0L 3L9YA 4LLVA 3VXPB 1JZEA 3OSVA 4I77H 2KZBA 2R0WL 3IB4A 3RZWA 4BQ8A 2V9RA 4Z7QB 1H9VA 4OZIA 1QZ1A 2YEZA 5HYFA 2A9CA 2CJTA 4AWJC 4A7TA 2HRPL 4NPKA 2EAEA 3BRFA 2YD0A 3H7BA 4MJ4A 2CKBB 4D2NA 4PJIB 3QUKA 1QUNA 3F5WA 1E6JH 2H2PC 4LSVL 5DJ0B 1D9KA 4LFHD 1RU9L 4UDTB 1REIA 1U8PA 4MCYB 1X7QB 1OP5K 3LEXA 4HLZH 2BIIA 1DQIA 3MBEB 3NPSC 4ODBD 2Y7OA 1JDAA 3FPYA 4JFZL 2FX8H 2WZ5A 3FB7B 2G2NA 3L13A 2ZKYA 2A2QT 3QWRD 2WIIA 3ZE2F 2CKBH 4LHUB 4DCQB 5BQ7A 2KL6A 1LLAA 4DFHA 1QBLH 3LXUX 5JLZB 2JVUA 3F6LA 1ETZA 4YHZL 2WXLA 3GMOA 4KI5F 4ODWB 5TE4H 1N4XL 2WM0A 2GAZA 4LDEB 2HVKB 1ACCA 4LLQB 3RB5A 3FO9A 4JFXA 4EEEA 2WXJA 1GC1C 3BSGA 3CCHB 3FRPB 3SYOA 1ZV2A 4OF6A 3ROOB 2Z8WC 3FT3A 3HC0B 5EU5A 1OAXL 2W9EL 1D6VH 4PVNA 3UBXA 4ABVA 1YUHB 4X42A 2GJRA 2V0AA 2WVVB 1FDLL 5D9SB 1KXQA 1WFTA 3SPVA 3V5DA 1XDTT 4WHYH 1KN2H 4HJJL 3V8OA 1G6RA 3RGVD 1IGFH 4JFDB 4KK9D 3GSNH 4XMLH 4TOYL 1P7QD 2FD6L 4O9HH 4LOEA 4YZWA 2ZX5A 1AI1L 5EO1B 3VJ6A 5TPWH 2VAAA 5I18H 4JKNA 1UD5A 4QHMA 4N90E 1I7RB 5IVXA 1KB5L 4IRSD 3TU6A 2W0LA 3QJHB 2FYYB 4QF1B 1R24B 3EFFB 4A68A 1IC0A 3VD0A 4MB5A 4I9XA 1RIVH 3ZR6A 4XMKH 4OLYH 1T0MB 2A83A 2AVFA 3GBMH 1B4TA 5IB4B 1KIRB 5A6MA 4WWKD 4RRPA 5CBAA 3NABL 2Z92A 4FFYH 4KX7A 1ND0A 1WG3A 4I2XA 1I1AC 4QXUH 4NQEB 4E9SA 4A2DA 4XOCA 3HB3D 2AI0L 3M1BA 3S3DB 1H3VA 3ZN6A 3PHSA 4PLJC 5ABDE 3PP3K 1X5HA 3U1PA 3FL7A 4NQSA 3MZGB 1MHPL 4NZRH 3ARBB 2YD4A 4CKQA 1ET5A 2Z93B 3LQAC 1Z2KA 4KQ3H 3GSQB 4JM2A 3WJLA 2XYCA 1DJYA 1J5OL 2X70A 1CXKA 1E8ZA 3IJSA 1GR7A 2YJQA 1OIOA 4OFQA 1JF6A 3RFZC 1HXMB 4GBXA 3DX7A 4JPQA 3U2IA 3F7VB 4K7FB 1QSEB 2YQBA 4JFOB 2V2XB 2X7LA 2PYEE 4GW1A 4Y5VB 3I9PA 3D39D 1YNLL 2XV2A 4XNZB 1UD4A 1TKWA 1OSEA 1T7XA 5IIEB 1AO7B 2XWEA 3UAEA 1MCFA 1F58H 1OGPA 4R90L 3QR1A 2PMZA 4N2HA 4HEPA 2H2SC 2UX6A 4OZHA 5F7LB 1V7NH 3T0EB 4B97A 3E80A 5GHWH 1G94A 1IE4A 3MROB 3LKOA 5CKAA 1ZT4B 4NRZA 5JNYB 4PP1C 2FZ3B 2MCPH 3LJ3A 1IKFL 1MFEH 2DMBA 2OJEB 3S88H 5CGBA 5BOZG 3D1MC 2EYRA 1A6TB 2FYVA 4YHYB 5E1GA 1MFAH 3NVQA 1J86A 2R2HB 2BFVH 4XNUL 1NFIB 4MJHA 2AKRB 4JCMA 4LPCA 3U4KA 2NY4D 5I8KH 2VR4A 5DVKA 3RTQA 4K5LA 4UUJA 2RIKA 1P1ZA 1SN0A 4LLYB 4IOFC 4NKMB 2VQ4A 3ZDXE 1OXYA 4GUPA 5L4JA 2V37A 5T1DL 3GEFA 3RWGB 4AQ8C 5KVEH 3MACL 4DK3A 3L3HB 5K33A 5I0XA 3TT1H 5DJYA 3VB9A 2VDRH 2F7QA 5LVEA 3WMSA 5IHHA 2EDYA 4QR7A 4OI9A 5C7XH 4M4PA 3H56A 5BV7H 3QJQB 2VDNH 4Y19B 5ESAA 4I7ZC 4CGTA 2VLJE 3AXHA 2WY3B 2DICA 1F1GA 4ZMPA 3ZR5A 4IEFA 4DEUA 1T2QL 2H32H 3B83A 2C9SA 4I48B 1QKZH 4WFGE 1KTDA 2QGDA 2EJ1A 1FCGA 1MJJA 4GRLC 4Q56A 4RAHA 3MV7A 4XX1G 3EYVA 4JY4B 4H40A 1GGTA 1MCBA 5I1KL 2F54D 4FP8L 3S36H 3VD7A 2X4UB 3VFOB 2VDQL 3T04D 1JP5A 5EIIG 3MNMA 3NIFF 5L4MA 1ANUA 4TN9A 1BZDA 3V0VA 3FFCE 5JW3L 2BW5A 3UFIA 1OAUH 3O41A 3H4FA 2XV3A 3DPBA 1QATA 3FO1B 3T4AB 3VXTA 5KZCD 1YC7A 3N1QC 3GM0A 1CGSL 3RWEA 1NPUA 1JV2A 2VKXA 2IBBA 4AQ1A 5IHWA 3GZPA 4XHQA 2FJGA 2LABA 4NUGH 4P04A 2BCKB 5BUPA 4BV1A 5IMMB 4PRIE 2WZAA 1SHWA 3CZFB 3PU7A 5E8OB 2V2TB 4Y2LA 1BAGA 1G1KA 3EJPA 2XCMC 4ZOCA 5KN5B 3D4CA 1KDJA 4AXWA 5B1CA 1U8MA 3TYGH 2AZAA 2C26A 3A4EA 3ARRA 2YD9A 1D3CA 3IMRA 3G6AB 4PJGA 3DVNA 3EUUA 5EU3B 2EIEA 1KZQA 1I7UA 5E8PB 2WKGA 1DEDA 4L2YA 4Z77B 1HN1A 1KENL 2DN7A 1I1YA 2FECL 2R2BA 3QUXC 1U0QA 4NKDB 1YN7A 2E6PA 2FJSA 3G6JB 6TAAA 1IB5A 1ULVA 2YPLA 1RZJC 2F53D 3VE0B 3BEVB 5FYKH 4AV5A 1CD1B 1CDHA 4H1LA 3G6DH 1S7VB 3BKYH 2YEVB 3HZYB 5K69A 4WAFA 1CLYL 1XGZA 4HGWB 4ELME 1HEZB 1E65A 3U7WL 5E7FA 2XXGA 4YHPA 1IAKA 1BWWA 1TJHH 5KVFH 1JPSL 3C6SA 1RHHB 2ADJB 4FQQA 2BOBA 3SKNA 1KG0B 2GJZA 5J6HA 5DVNA 2JE8A 2WP3T 5KYWB 1H3TA 2DH2A 2WBJB 1ZLVK 4G8GE 2JCCA 5CCGE 3TFKC 2RD0A 3QC5X 2CR0A 4ZSOE 3GUTB 3MJ9H 5HVHB 5AWNL 4JX0A 1L4IA 5DA0B 4YXKL 2D7NA 5AW6B 3KS0H 1XR8A 3UACA 3HE7A 3NIDF 2C3GA 1NBYA 5GZOA 3D25B 1DBAL 5C0BA 5FHBL 2V5MA 3LIZL 1KYAA 4KRPC 3ARDD 2CHDA 3MUZ1 5I8CB 5K5YA 5BS0D 2XV0A 3QNZA 4KAQL 2PETA 3HI6L 4TQPA 4ONGL 3GK8L 2HT4C 3HR5A 3OX8A 5CINH 5IWLA 4UF7C 5IESH 3H0TB 2EIKB 1S7XA 1L9RA 2YUVA 3FUNA 4QIRA 3SGDH 1NQBA 1HC1A 3UCQA 1CFBA 3S8WA 5K9QG 5JA9A 4LCIH 4X80L 1GYUA 5BZZA 1A9EB 3MRQA 2Q0ZX 2I9TA 5HVFB 3V4VB 4OUUA 2IADB 3BQUC 4QI3A 1KPVB 2OMYB 1CLZH 1IZJA 2NQ3A 4GXFA 2WO3B 5HGDB 3V0HA 2BHUA 4JY5L 2OMTB 1P7QB 1F4YL 1CO1A 1J8HE 5EUKA 1MY5A 5HDBF 1QACA 3ESUF 5LG1A 1G9MC 4DETA 4NYLB 1NEZB 4APXA 4ZNEA 1JGLH 2WHVA 4IMLB 4IKIA 2VSKB 4PJEF 3VI4A 1K5WA 3V4VH 1ZGLM 4LRIC 4TSCL 2VRKA 3ELAT 1EV2E 5JHDA 4O02H 2B3IA 1IKNC 1YMHB 3C60C 3FCBA 4D0DA 1T2JA 5GS3A 4X6BA 4R5XA 2KDYA 1PNCA 1DQJA 1YEFH 3GBEA 1IE5A 2DQCL 1I8MB 1LD9B 3QDME 5CO1A 1NKGA 4ONHA 2O4EA 4IIQB 1XSKA 2UV3A 4PV9B 2XI9A 4YBQD 1SN2A 1JUFB 3ILPA 2LAGB 3NQKA 2X10A 4LPUA 4YHOH 4JR9H 2MRYA 3KPSE 3U48A 3VTMA 2C3VB 3IF1B 4WUUE 4FI8A 3HZVB 4ZUVA 1XCWA 1EVUA 1QFWM 2BIQA 4HBCL 1HVXA 3UDWC 2O6PA 3WEAA 1NCIA 1N6UA 1I75A 3N44F 3NPZB 2WLZA 2PP8A 3QR2A 4PJXF 4FZEL 4QXWA 1CFVL 3T0BA 3WENA 2UYLB 5JQIB 3ARFC 4D0BB 5CHNA 4B9KC 1V3JA 3D39B 1BEXA 3JTTB 4HBQA 2AJZB 3PNRB 5IQ9B 5DXWA 1X44A 1QNZH 1FZMB 3WDIA 4F33B 4JFEB 3GMPA 4HFWB 4FFTA 1DQQA 4UQCA 1LP9B 2E9WA 2NY2C 3ZHKA 3L3GB 4JG9A 3GIZH 1F4AA 3K4AA 1C7TA 4IRJD 5F3HA 4J8RA 1SOKA 5C07D 5ADPL 4PI2A 2OULB 4UT9L 2C3WA 1MCEA 4BRJA 3VH8B 2WVUA 5E2JA 3WTSA 2H1PL 2VC2B 1UADC 3AUVA 5CCKH 2OMNA 3THML 1ITBB 4JZOA 2BJML 4U4BA 4J5VA 5MERA 3ES6A 3VFGL 1QBML 4OI7A 1WQVT 1MIMH 3QNFA 1CICC 4KJYA 5EV7A 5DUML 3D09A 3IAGC 5F88B 2JCWA 4UZSA 4FXKA 4GRWH 4KUZL 5C0RH 4FLSA 5F9JA 2AQ2A 3QZLA 3VFWA 4NOBA 4LCWA 2OXGB 4XPAL 4JZJB 5C0IA 5T3XH 2VJ0A 3ISWA 4DPCX 2YEQA 3P4MB 5KUKA 3WSQH 5C09D 5DQJA 1OM9A 4XRCA 3VGAC 3DX6B 3GLAA 4IYKA 4LCVA 5IM7B 5EEVA 2GHWB 4L8BB 4MZIA 2E56A 4YH6A 3J8F7 1CBVH 4Z7NE 4JFFB 2KQNA 4MA7H 4B53A 5KAQF 5HHNA 1DHKA 3MRPA 3QQDB 2BHZA 3WXWH 1PSKL 5C97A 1SDAB 1T1YB 5DYFA 1NAKL 5JHAA 1LEKA 5C3IA 3I6GB 1PS3A 3WY2A