2YLHA

Structure of n-terminal domain of candida albicans als9-2 g299w mutant
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
311
structure length
311
Chain Sequence
KTITGVFNSFDSLTWTRSVEYAYKGPETPTWNAVLGWSLNSTTADPGDTFTLILPCVFKFITTQTSVDLTADGVSYATCDFNAGEEFTTFSSLSCTVNSVSVSYARVSGTVKLPITFNVGGTGSSVDLADSKCFTAGKNTVTFMDGDTKISTTVDFDASPVSPSGYITSSRIIPSLNKLSSLFVVPQCENGYTSGIMGFVASNGATIDCSNVNIGISKGLNDWNFPVSSESFSYTKTCTSTSITVEFQNVPAGYRPFVDAYISAENIDKYTLTYANEYTCENGNTVVDPFTLTWWWYKNSEADSDGDVIVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Broad Specificity to Host- Cell Ligands by the Pathogenic Fungus Candida Albicans.
pubmed doi rcsb
source organism Candida albicans
molecule tags Cell adhesion
molecule keywords AGGLUTININ-LIKE PROTEIN
total genus 69
structure length 311
sequence length 311
ec nomenclature
pdb deposition date 2011-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11766 Candida_ALS_N Cell-wall agglutinin N-terminal ligand-sugar binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ylhA01
2.60.40.2430 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ylhA02
4MBOA 5CF3A 3ASWA 3AU0A 3IS1X 3AT0A 2RALA 1R19A 3IS0X 4LE8A 2F68X 1N67A 4F20A 4F24A 4LEEA 3V10A 2Z1PA 4JDZA 3IRPX 4MBRA 5IHWA 2F6AA 2Y7OA 2Y7NA 4B60A 1R17A 4JE0A 4B5ZA 4F1ZA 4F27A 4LEBA 4JDZB 2Y7LA 2YLHA 5CFAA 3IRZA 2Y7MA 2VR3A
chains in the Genus database with same CATH superfamily
2DQCH 3ROLB 2JF1A 3QUYA 4HKXB 3GTTA 3CPLA 3DX8A 3MRBB 4ZDHA 4CAGA 3FU8A 4FFVD 3OKLB 2EVFA 1OSEA 1TPXB 3QWOA 4P04A 2D7TH 5BRZB 1OGAB 1E8ZA 1IBGL 5DJYB 1MREL 4ENED 2NLJB 4HV8A 1QFWL 1KFAL 2QMJA 3TEZA 2Y06L 4YO0A 5FGCE 1WGOA 5CZXC 5TDOA 4LBEB 1NCAL 2R2BA 5G2NA 5D4IA 2Z91A 4AENA 3CN1A 2CLVB 1NOAA 3A5VA 4L8BB 2VMJA 3RTQB 2GY7B 4CMHC 5HYQA 1FAIH 3QDJB 1E5AA 1K8DB 3GJFB 4BE6A 3S34H 3AWFA 2WOBA 3KVPA 4FQIL 4DGUA 3AB0B 5HGHB 2ZP0T 4L0PB 2AQ2A 3S35H 3AQYA 2DQMA 1AR2A 3QXAB 1T5WB 5IT2L 3DO7B 2C9QA 2YPVL 4H5SB 1CUOA 5D1XB 1I53A 5GJSL 4EI6A 3D50A 3V5DA 3O0RL 2HT4D 1T0PB 1NC4D 4OW6A 3DURA 4CKQA 1XMWA 1CGWA 3QULB 5IHZA 1KV7A 4AGQA 5HYQB 4RBPK 2IPKA 5T5FA 1Q9KA 1HJBC 2OMUA 1JZJA 5GZOC 1MY5A 4MKMA 1CFTA 3BE1L 5HDRA 3E2HB 3NJNA 2ZAIA 2EINB 3KCWA 3AM8C 3X1EA 4UV4H 3BPOB 2B5IB 4F2MA 1N64L 3HS0A 2NLJA 3WSQH 1PNDA 1DQML 1NGYA 1I1YB 1NGPL 2FTAA 4FXKB 1S78C 3M1CA 3QA3A 1ZA6A 2OL3H 1D5IH 1UKSA 5FGBC 5CJBA 2XWXA 4HF5L 5I71C 2Q3AA 4KUZH 1HKFA 3GSWA 4P4KC 4P5TC 4X6EB 2E0PA 1DLHB 5JIQA 3H9HB 2OQJA 1NGZA 4HJIA 2J1KA 3BP6A 3GKZA 2A1WH 5DJDB 2DYPD 3V4VB 2JIXD 3KG5A 5C3IA 3KYAA 1EAPA 3D4YA 3MLTB 4N0YL 4LFHG 3WS6A 1KC5L 4G6FB 4FXKC 2PNDA 3VGDA 3TNMA 2FH6A 3F00A 2CNYA 4GKZA 4L18A 2JJTA 3IU3B 3QIUB 2BSTB 3GO1L 4XPAH 4Y5VA 5I26A 5FF6A 5DMYA 4IU3A 1KB3A 4GW5A 3PWUB 4GUCA 4OZ4A 4UT9A 5CJOL 5EMYA 5FM5O 4KI5E 1FDLL 4IRJC 2Q8AH 4XNQA 4X6CF 2OJZL 1KY7A 2YD4A 1FSKC 4P4KD 3HI5H 5HDBE 1RU9H 2PO6D 5D2LE 3MX0A 4XR8C 5JPNC 4ERSH 1M6OB 4K7PL 5JW3H 5T3XE 3CMGA 4HIJB 1PF3A 2FQGA 1I9RH 1F13A 1NWOA 3TBTB 1DEDA 3HBGA 4P2OB 3LH8A 5IB3A 2PO6B 4QYOA 1C7TA 4OCYH 1A5FL 3V52L 3OJDA 4UILH 2DLHA 4G9FB 1P84J 1QSFD 1CE1H 3FHAA 2D03H 4HMDA 4KX7A 2KS0A 4OJYA 5DA4A 5CLYA 5KSBF 5B7EA 3VW3L 1V8HA 2YPLE 3UROR 2EVGA 3DX7A 1TENA 1DCEA 3TT3H 3O2VH 1RUQL 1S7QB 2YKKA 5IVXB 2GBUA 5EIIG 1KEML 4Z7VE 3QZLA 2P7TA 3SKJH 1F02I 4JO3H 5E51A 5FM8A 2N3JA 1NKRA 1NCHA 1PLGH 1C8QA 4ODUA 2BVOA 5ISZE 4JFEE 4EXKA 2Q0ZX 3H9SB 3AGWA 2QSCH 1CGVA 4BSWA 5KVEL 5KSAD 3BWUC 2RIKA 3VD4A 4GPVA 1QO3B 1TU2B 2J7LA 2XWJA 4PRHD 5DFAA 4EI5D 4DN3L 3L3JA 5E1GA 4HH8A 4RESB 3OR6A 4XP6H 4ZMZA 5A6MA 3T2LA 3US0A 2P80A 1YPZE 4TTDC 3QHZL 2WCPA 2VYRE 4MMXA 1SOKA 5D7EA 4K3JH 4LQ1A 4H8WC 4G43A 4OFIA 2ZXEB 4L05A 5JORA 3Q8CA 4FFZA 2CDEB 3ZK0A 5E6IA 3VD3A 4JO3L 5EZOH 3TBWA 4OGYH 3CFJB 4BZ2L 1CDHA 3WIFB 1D5RA 3O6LH 4IU2B 1DDTA 3P3SA 3UZVB 4MA8H 4GQ9L 5DJ0A 4Z8FL 1HNYA 3GZQA 3U6XA 1KTRL 3LSOA 2OMTA 1HH9A 2O5YL 1XDTT 2VXQA 4UV7L 5BUGA 4HJEA 2M26A 2X2JA 3TO4D 2R9HC 1XZ0B 4ZZKA 4YZFF 2O61B 3MJWA 2J20A 1PKQE 2PXYC 1ZANH 3GIZH 2VZTA 3EJCA 3IDXL 5LBVA 2KZ1B 3L5XH 5IJVA 2VLRB 1ZMYA 1TVDA 5MEOB 4FP8L 2UZIL 3BKJL 3L7EB 1JV5B 1YNLL 4JFEB 4UDUA 5CSGA 4X4YA 3D87B 3N41B 1HN1A 3MTXA 3UL4A 3D2UB 2BFVL 1LGVA 5JORB 3SOBH 3ESUF 1FE8H 1KCSH 5DK0B 3W2DL 3GUTB 4X4XA 4NM4L 3K71A 3P4LA 1IFHL 3UBHA 2MOQA 1BVNT 1UEMA 4LDOB 1UACL 4HJGB 5MERB 2V5YA 1X9QA 5IB2A 1AKJA 2UYLA 1E42A 3DMMB 5EF3A 3T4YB 2VSCA 1HH6A 3WEXA 1BM7A 1HOCA 4ODTL 4K9EL 1R3HA 4S1SH 5DQ9A 4MVBC 1DBJL 4LEOB 5I6PA 2V7NA 5L7XL 5CS7A 3ZJAA 4BBWA 3VM7A 2CAKA 4F3FB 4BINA 1N5AB 4Z7UA 4X7CC 4K73A 2OMVA 5JIPA 4Y16C 2OA9A 1QQDB 5HHPA 3ZTNL 1A6AA 3BGAA 1O6SA 4AQZA 4B7LA 1INEH 1MZYA 3WD5L 3BOVA 1AQHA 4FNQA 4RQQA 4G42A 3IE4A 1W0WA 2XIBA 2I60L 5D4QA 4B0MB 1FPTL 2X09A 3MOAH 3ZMNA 2IAMD 4PJBF 3HS0C 3H56A 4WU7A 2EE0A 2AXJA 4XTRD 2A74B 2R2EB 4G6FD 2XLLA 2CXGA 4RAVB 2IH8A 1A9EA 5DMGD 1GGIL 1A3RH 2LVEA 3L7FA 1HHGA 2V5TA 3VU1A 3KPTA 3V8CA 5L8JB 1S8DB 3LTVA 5GGRY 4IJ3C 1XTMA 2R23A 5BO0D 1OARL 3S8WA 1EDYA 4IOIB 1MFCL 5HHXH 1F8TL 3LCYA 1HILA 1M6OA 2X6MA 3QC6X 3OJVC 3L8QA 1M7DB 3FHEA 2WTPA 1BMWA 5EOQH 2DN7A 5JOPE 4NUJB 2Y7QA 4JE0A 4XAKE 3GGWA 1TUPA 2MNUA 1CFVL 3U36B 5AOIA 8PAZA 1I3GH 2MHAB 5EB9A 5AVYB 1SYSB 1TZGL 4J3OF 2M1KA 4EO5A 4Q9RL 2ARJA 4JR9L 3LN5B 2IALB 3QIWC 1A7QH 2H1PL 3IFLH 3LS5L 3C5ZC 1BLNB 3FYEB 1B9KA 3P73A 1XIWB 4DESA 1XBRA 1MCEA 3GK8H 1WFUA 3APDA 5TF0A 1NC4B 3NEOA 3GLAA 3ZDZE 1ONQA 1J87A 4MLSA 4AJVA 1XSJA 1MFVA 3I84A 4EIGB 3MRIB 3I50H 1XL6A 1DVFC 4JRXB 5KYUB 1CDUA 2WNWA 4JPKL 3MRHB 1D5MA 1HKLH 2DQDH 1XX9C 5I82A 3WKQA 5LGKA 4M5TA 4APQD 2H2SD 3TBBA 2BRRL 3U9UB 4LLVB 3ILPB 1MEXH 3BZ4B 4MSWB 2RTTA 3BFOA 1YDPA 2EIEA 3WHXA 4KUZL 1N7MH 4YX2L 3DGGB 1AD9B 3V4PA 1CFSB 1H9VA 4WEBL 5EHFA 3NFPA 4LDLB 5I8OH 2NQ3A 3LEVH 4OM0H 3OQRA 3C9NA 5D1QE 1Q72L 1DTUA 1O0VA 2MKLC 4F7EB 3P4OA 3C08H 2X4PA 5GGVH 2JLPA 5AYTA 1R4XA 3HC4L 3IJHA 1BZ9B 2WBJD 3L1OL 1LE5A 1JGUH 4BQBA 1BFOB 1HU8A 3HI5L 3EXLA 4PLKD 2ROXA 2OXGB 2VRAA 2CO7B 4JM2C 1L9SA 3JUYA 3OPUA 2VZ1A 4MDJA 4PB9H 5CEZE 1B9ZA 4ACPA 5CM1A 4G8IA 5K59E 2GI7A 2OL3A 2FSEB 2YSTA 4MMZB 4L0YA 1RFDL 1I1AD 1NGXA 4MCNA 2Y6TE 1UEYA 2XVGA 2B20A 3K4DA 4HUXA 3UBGA 2ZNXA 5C0AD 4MMYA 1VERA 1SJEB 4IRZH 3VFSB 1L0YA 1KNOB 4A2MA 1JG9A 1EVTC 3RJQB 1MFAH 4QDGA 3U0PA 3RFZC 1J5CA 2IWGA 5F9WB 4KV5F 1LNUB 4QJ3B 3D52A 5C6WH 3IMTA 2EO9A 4Z3IA 2RCSL 3KYNB 2JVUA 1UA3A 1C12B 4Z77B 4JG9A 4KV5E 4QHPA 4HS6A 5GGSB 4F93B 5I1HL 1AZVA 1T4KB 2DQFA 4RGOH 1XCQB 4LPUA 5LCVA 3OZKA 3T9WA 1DJGA 2GHWB 1D5BB 3DKHA 5FGRA 5T1KB 2ATPB 2XKUA 4HUVA 2DAVA 2L7QA 1KPUA 1KJ2L 1X7TA 2J2ZA 1CLCA 1QEXA 3T8XB 5F0LB 1QBML 1DBAH 2ZUQC 2L8AA 3HE7D 3OKMA 4OF7A 1EGJH 1R3KB 4FE9A 1EEQA 1NTDA 4ADJA 1EHLH 1HSAB 3AACA 4C4BA 2J8OA 3IJ9A 3HZ3A 1ZHNB 3QHZH 4NQEE 4NO2B 5PAZA 4LL4A 3TO4B 2IF7A 3MV9E 3VFOB 4NERA 1JPTH 3OAWA 5JW4Q 2JKIS 4GI8A 2PLTA 4NS0A 3ZPDA 1MI5B 2BIPA 3UZEC 5ITFB 4E9RA 2ZG2A 2VC2H 4MQ7A 4Y19D 4W9ZA 1FFNA 4R26L 3ALWA 5E6SB 1W91A 5E2UH 1TZOA 1NSNL 5ID0B 2Z7WA 1QI5A 4G7VL 5I1IL 1NPJA 2AEPH 4GW1A 2FATL 1SEQL 3POHA 3SDXF 1EHNA 3GMQB 3FTUA 4GO9A 4OJDH 3PREA 4C83B 1SOXA 3VU2A 1WZMA 5EU6A 5EUKB 2C34A 3MCLH 3PGCA 3BVXA 1DQJB 1IJ9A 2DPKA 4TUJB 2AK1H 3VFNA 5E6UB 3WY3A 3QJHB 2FEDD 4I9WD 3GSVB 4U0QB 1BZDA 5FO8A 3D30A 1DBML 4X6DB 4I9WE 1NC2B 4BK4A 5EC1B 4OCXL 5BO1L 4JFFD 3N1MC 3TO4A 3GNML 5LGJB 1GHFL 4UIKH 4P2OC 2EH7H 5I1CH 5KBNC 1XGPB 2GITA 3SQOL 3ZT5A 5F3BA 3C6SA 1PLGL 4V2BA 1FNAA 3FN0H 3OKMB 5G4OA 4TMPA 1SXNA 3Q8FA 4CNIB 1WWAX 1CD1B 4J3OD 1J9RA 1F42A 2IJ0C 4YLBA 5F8QC 4X5WA 5B38G 2DJMA 4KK5C 3UG3A 2XUWA 4P2QE 4EKJA 2DWDB 4DK5A 3ISYA 3SKNB 4YHOH 2OTUB 4JO5A 4R0LA 2H6PB 5CD5D 5B1BB 5EO1B 4X83A 1D6VH 3AUVA 3L1FA 1IM9D 2FEEI 4QWWD 4Y5YA 5JHMA 5JIKA 4QHUA 1G7PB 4FERA 4XN4A 2DQUL 1J05A 4LHQB 3P77A 2G9HA 1RIVH 5BJTA 1YEHL 3GBML 1MWAL 3B34A 4WWPA 2QT6A 4ZFOA 2YGPA 1Q94B 4FULA 2YRPA 5DFVD 3QRGL 2CG9X 3QDME 4QF1A 3VQLA 3TC9A 3U4EA 3F5WB 3VXUD 1NKOA 5B8CB 1BWMA 4MJIE 1AD0B 4P4KB 4WTWA 2Y36L 3IDNA 4G6AD 3LS4H 3MRNB 4B96A 3NJFA 4EVNA 3KVDD 2PW1A 4KMLB 4QOKE 4RMWA 5AWNH 3L4CA 5KZCD 1KGWA 3H4FA 3ULVE 4LQFL 1NLDL 1YEDA 2F0CA 2KUTA 4BFIA 3QIUD 4OTXL 1I82A 4R7NA 1N6QL 1GAFL 3WEBA 1T04A 5F89B 1EUUA 1UC6A 4Z0BH 1BFOA 1JPGA 5IB2B 2J71A 1FH2A 3CZJA 1K85A 2JIXB 4DKTA 4FA7B 1KFGA 5DUPH 1U8JB 2VXTL 1JMXA 2ZAHA 1OAJA 3G08B 4YH6A 3O6ML 2FNBA 3HR5A 4P46D 3TIEA 4Z7OB 4B5EA 3VM5A 4M7KL 1YEFL 2A9AA 5D1XC 4OLZH 1N6UA 1N59A 3RWGA 1HAUA 5ITBL 2FO8A 2AEQH 3L7EA 2VNCA 2R0WH 2CO2A 5I76B 3D3VE 3QEQA 2UV3A 2FYYB 2WZ0A 3HHSB 5CIPA 1AGDB 3NFSH 4GP4B 1U8OA 4PV1C 1KYAA 3V6ZA 3ZR5A 1A6WL 4UUJB 4QI3A 4F2FA 4PBXA 1A1NB 2HN7A 4JO4H 2JJWA 4MNGA 1IAOA 4WHDA 3JVFC 1WE5A 4EZLA 3HB3C 1IKOP 2JKWA 1CU4H 3MREB 3GBDA 2R39A 5GSRB 3MRHA 1GIGH 3T2NH 2W9LA 2ICCA 4HUUA 5D1XD 4A7GF 1MPAL 1ZJBA 35C8L 3CVIH 4R5XA 4AKPA 1BA9A 3F84A 1A6UH 2GJRA 5KS9F 5F6IC 3VACA 3MJ7B 2EIZA 4FNLL 2GB2A 4MNGB 1R5IA 2IFFL 3VFTB 5CJXC 3KLQA 5TE7L 5E5UB 2YMXH 1WEJL 4NZRL 3S5LA 3WN5B 4DSYA 4XC1H 3ZYZA 2EVIA 1TEGA 3I2CL 1BX2A 2EUXA 1PZAA 3Q2LA 4LHUA 3FK3A 1MZZA 2B4CC 2FBRA 3AG2B 3C2SA 4L29A 4TSBH 2B1AL 4FTDA 2ZOKB 3TF7C 2XWZA 1OAKH 2ED6A 4HXBL 3HEIB 3HG3A 5LO7A 2BIQA 2ADGA 2PMZA 3WMQA 3IMVA 2YD8A 3TPUB 1OARH 1XO8A 2NW3A 1IAII 1TKWB 4NYLA 1RK0A 5F71A 5FWRA 3CH1A 5DYFA 3VXTA 4FFWD 4RWYH 5FM5M 5DEFB 2HFGL 2BINA 2Q86A 4YHZH 3B3IA 1T0NB 3WEMA 2ITDB 1AJ7L 2WBJA 5CF3A 2VIRA 1J10A 1QACA 2N7BA 4LZKA 4PWJA 3PAVA 1Q1JL 4TVPH 5D7LE 2Q8BH 3ARBB 4TV3A 3I2CH 5AW9B 3O2DH 1P7QD 1FO0H 1OXYA 1PZBA 4A6YB 4U2YA 3RE0A 3DROB 1TIUA 2KKQA 1JE6A 3KJ6H 3F01A 3RWJA 5GS2H 3ULUE 3MO1A 4NCDA 3O9WB 4EZJA 1A9VA 4FQQB 4IBQA 4N2LA 2NUTB 4G8GB 5ISZB 5J1AB 4QEGA 1XH3A 5SWQA 2SEBB 1I9RL 1OEZW 3LZPA 3BZEB 4PJ5B 3MJ8A 4HFUH 1A14L 3CXHK 1MJUH 3GZPA 4JFDA 4KXAA 4NM8L 4A2GA 4AE1A 5IOPB 3FQ4A 1CFBA 2PXYB 1QUNA 2UZYA 4L4VB 1KEGH 5A2CA 4JK0D 4FNUA 2OSXA 3VFVA 1EQWA 3WI9A 1E4JA 3GIVA 2C3VB 3MV8A 2WZPA 3BZEA 2CJTA 3ESVF 3HFMH 3UBXB 2P48B 4JX0A 2YIHA 4KO6A 1W6LA 4C55A 2JJSC 2UUDH 1QPPA 2HH0H 2WC7A 4KGJA 4L37A 3BWAB 4XCYA 5IHHA 5KSBB 4XVSH 4PJDE 4WUKL 4B9GA 4H88H 3PE9A 3EFOA 4JFEA 3U7AA 4JQIL 2HSIA 1A3LL 2C4XA 3UDWA 2P5WE 4CKVX 3FRUA 2VXVH 4YXHL 3ARDB 3MRMA 3KPLB 3NDYE 3M8OH 2X2UA 1KELH 1OSZA 3GTNA 4ODVL 5SWZD 4PJGE 5JOFA 4OZGA 4X6DA 2CXKA 2H1XA 1YNTA 2ZG1A 3K5RA 5DRXA 3REVB 5A6LA 5JNYA 1QD0A 3DGGA 1OTSD 1SBSH 4KROB 4MQTB 3TX4A 3CN2A 3OR7B 3QJUB 4GQPH 4M8RA 1IE5A 4FYQA 4NYLB 4N68A 4KK6D 3I02A 3EF7A 2WMPB 4LSTL 3PGCB 3LRKA 2VQTA 3QIBB 2Z4QA 1B2YA 4N3TA 4TSAH 3MMEA 4XPGL 5ETUB 7PCYA 4P9HH 1L4IA 1JUFB 3WJLC 4UQBA 2CE6A 5HYEA 1MCCA 4HHAA 1P1ZB 1KCBA 1N70A 3FUJA 4ZOBA 5E9DD 1GZQB 3CAFA 2R29L 3O4LE 3WLBA 4FGMA 2BDNH 3A6BL 4LLQA 1P7KB 2XA8L 4KRPB 3GSRB 1AXTH 5HJ3B 4ORGB 4PY7B 3OR6B 1EWHA 3VFVB 1KF9B 1AYRA 3DGDA 1GC1L 1N2RA 3CSGA 3R4RA 1EHKB 3WXWL 1QR1A 3TEWA 1N4XL 4JFFA 3QJHA 4PBWD 2F1AA 5SWZE 2AK4B 1HCFX 3OC5A 3ULSB 4B9PA 5H37A 1E9PA 3ZGIA 3LY6A 5D1ZA 5IJKA 3FTGB 5GGUB 1U0QA 3AUWB 1RY7B 5BS0A 1YNLH 2N7SA 1LO5B 1X9LA 3WY2A 5D1QB 1EHLL 4Y8DC 1FO0L 4Y88A 4ODSH 3SBWC 1TQUA 1QVOA 1V3KA 4O02H 4NPYA 2W38A 4IRSD 2IXQA 1LWRA 3N0AA 2VSMB 1XGTB 4GP8B 5I5MA 5GRVL 4MZ2A 1G9ML 5ACZA 4JKWA 2MKWA 3KDMB 4Z77A 1NANI 5BMFL 4OLWH 5J13B 1X5LA 3CSPA 1Z0MA 3BAJA 5LXGH 1CTMA 4K5NA 3UX9B 1TITA 3QFDB 3KLHD 5E4OA 3VWKC 2XIDA 4U1LA 5A43C 2OZ4L 2JCCA 1GGBL 3DYPA 4R0LB 1INQA 3UAJD 4WI9A 4LNRB 2CU9A 3X11A 3HR5B 4JAMB 3TIEB 1GTFA 1G7QA 3QI9C 2ZWZA 4K5MA 1ULVA 4OZGF 3T0EB 1EDQA 2B2XL 1FNLA 3NQIA 4IOFD 5D1ZB 1DUZA 1OAUH 4R7NB 5F6HI 4BCYA 3RZCD 5FF6B 3PWUA 4L3EE 4MA1C 3UGXA 1JCKA 2FT7A 2NSMA 4GG8B 3MU3A 4HX1B 4AKQA 5F44A 3M86A 5FUOH 3S7GA 3VG0H 4GAYB 5D70H 2W9EH 3DXAB 1OALA 1ZTXH 4ZK8A 3QUYD 4W93A 1IZKA 4OI9A 4OV5A 3DPBB 5DMIL 3B7YA 1DVZA 4LVNB 4U1LB 5J11B 3GS7A 2IGLA 4HWUA 3LQAC 4JDEA 5EUKA 4IOFC 2C9UA 2ZX9A 5HD8D 4NCC2 4U7KA 3ZKND 2R1WB 4X4MA 4DUWA 2J57A 4BZ1A 2UZIH 3BKJH 3MNVA 4X0KB 2LOEA 3PWPA 2QQKL 4W6XB 5AYUL 3OGCB 3SKNA 1BBJB 1P4UA 4TQEH 3PF2A 4CN1A 4UB0H 3HE6D 3MR9A 2ZCKH 4TOYL 3LKOA 5CJ8A 4L3ED 2AKRB 5I1LB 2CNZA 2VN7A 2KI6A 1WAAE 2XYCA 3IJSA 4XPHL 3QE5A 4AYEC 3QUGA 2QADB 4B0MM 5HYSG 2DW5A 2VDMH 3DURB 4U49A 3WGVB 2VT0A 2E47A 2YPVA 2YRBA 3QWNA 4F7EA 4HUKB 1TPXC 3C60C 3PGDA 1YEEH 4G6MH 5MHSD 4YDLC 2L7JA 1HZKA 3TXAA 3AZUA 4HOXA 2KL6A 1A1OB 1JGDA 3H85A 4DUVA 5L7XH 3B3BA 4GG8A 2B08A 3HNVL 4OD1H 2IEPA 3A47A 3BGFB 2E4TA 3R1GL 4QRRE 1N5YL 1IAIM 3ZHNA 2AVFA 5AALA 5CINL 5L4IA 3WLBB 5IEHA 4Z0BL 1AO7B 3BH9B 1H19A 3KLDA 3LNIA 4PMEA 2NXYB 1WRFA 4AX3A 5CD3B 3BVVA 4AXWA 4JQXC 2Z31D 3LKRA 4MB5A 3NA9L 5C09A 3T3PF 3BX7C 4F57L 1UOVA 1H3TA 1ET5A 1JZEA 1KB5H 2BVUA 1RVFL 1E4KA 3BGMB 2NYKA 3F5WA 4F8TA 4QF1B 2HFFA 4E41A 5B7MA 1HHGB 5SWQB 3NCJH 1EEYA 3ZZLA 3MNMA 1VGEL 4JN2A 1MFEL 3U46B 1MCJA 2YUZA 4JM0A 1ZGLP 4MASA 3W39B 4GAYA 1NBCA 3PDDA 1Y07A 3DYMA 4KAQH 5DD5H 5F9DC 1CDJA 3ULUH 1LQBC 1S7XA 3HPJB 4B9IA 1QZNA 1PX3A 4N5UA 3QJXA 1NUFA 1WJ3A 1MJUL 4R83A 2YD3A 3FT4B 1GKEA 1KPVA 1N26A 1ZGLB 3U48A 4QNPE 1MCOL 2NY1B 4HGKC 3U7WH 5BPPA 2GY5A 5I9QB 1FGNH 1S5HA 4U1MA 3ECUA 5E6IC 3EJPA 3F7QA 5C8JB 3LZQA 5KVGL 3OG6B 4IS6B 4C54A 5CBEA 3Q1EA 3LN4A 3C87A 1MSPA 3DMMA 2IANA 2EE6A 2CIIA 3NG5A 4EUPA 2IAMC 5B1KA 1QFWM 1G7JB 4WSKA 3MRCA 2G3MA 3JTBA 1DHKA 1SQMA 3DHPA 5CJOH 3F04A 5T1MA 3CFBA 4AYDC 4Q74A 3S5LB 3WN5A 1N19A 4NZDA 4P59H 4F1ZA 3O4LB 3BD4A 3VQ2C 4UT6H 3OM3B 3DX4A 1QQDA 3CSFA 3MRDA 5HHPB 1BQHG 3U1SH 5K5YA 1HWWA 3MO1B 2YR3A 3HMWH 5E6ID 1YEJL 5F93C 5E0FA 1QLEL 3WKMH 4PUBH 2CM5A 4XOAA 2TRYA 5TQ2L 4OQTA 2DEWX 2WUBL 4TSCL 4HG4K 4LSUH 2AK4D 3T1WA 3K6SB 2KPWA 2WZ6A 2CRZA 1Q9WA 3B3IB 4KMQA 4WVRA 2F58L 2R8SL 1P4BH 5IFAL 5E2UL 3ZZSA 1HHKA 1DQMH 4C4KT 2X0WA 3MRRB 4LCIL 2FBJL 2WXFA 3BAEH 2FYYA 3HHSA 3EOAB 2DQTH 5DJAB 3PYCA 4NDMB 4ZXBD 1WGVA 3E9UA 3BFWA 2VN6A 3QRLA 4XAWH 3TBWB 3LZRA 2IMMA 3KH4A 5F97E 5I1KH 3ZL1A 2CDEA 3N40P 4DP2X 3JXAA 1ZLWH 2MFNA 2FJHB 4JG0H 3O2WH 2HVBA 4PGBA 1OTUC 3DHMA 1D5BA 2DD8L 4A37A 1WAAA 3H6JA 1XIWC 5GSVA 5C0BE 4ZMTA 3GJFA 2X4RA 5I0YA 4S10A 3AY4C 3TONA 5CCGE 3PXLA 4MJ2A 3SO3C 3ZVVA 5BO1H 2PYED 3LD8C 5MI0C 1IM3A 3E3QC 2IGFL 4UINH 3TASA 3US1A 2A73A 5GRYA 3T3PB 3UZVA 1W80A 2QPEB 4GG6A 3FFCE 3NCYS 5BW7C 3MRNA 4OGYL 3STBA 1P9MA 5HI3D 4GUPA 1BGXH 2NTSP 4L2LA 3WTUA 3QJFB 4K9JA 5TQ0L 5GQBA 1T0MB 2P3YA 3I3EA 5H35B 4F27A 4ZFGL 3MRBA 3LIUA 4JVUA 1NZRA 1C8PA 1OGPA 3CPLB 2BSED 1DFXA 3DX2A 3EAKA 2CGZA 1DFBH 1PQZA 2YPLA 4GH7B 3QEQB 3U2SB 2DQUH 2L04A 4JM2D 4DO6A 1THCA 5D7LB 5IQ7H 1DN0A 4LKXA 1QTSA 5IM7A 2NQDA 2OMBA 2XZAH 2IQAB 2XN9E 2EJ1A 1B0RB 2P8LB 3L5IA 1NFAA 3GMLA 1JPTL 5HY9B 3QZNA 4GUOA 1MCBA 3GSOB 5EDSA 4PJ5D 1Z2KA 3G08A 4KKQA 4AUJA 2EC8A 1U8CA 1V3LA 4HK0A 4M62L 3EUDA 1GOHA 2P5WB 1I7UB 4HD9A 4RETB 5H2BA 1D6EB 4IHOB 4JLRB 2HCZX 2Q87A 4Z7QB 3NSCA 2APVA 1JV2B 1PS3A 1Z9MA 1XTLA 3DX7B 4K7PX 2IXQB 3OF6A 4OTXH 3VD2A 3WHXB 4FFYH 3WNJA 1G6RL 1FFPB 5IQ7L 4JKNA 3PWLB 2VO8A 1IZJA 2OMVB 3KPRE 4Y89A 3IRPX 5BZZA 4HOWA 3D4GA 5K33A 5B8CA 3F7VA 3TCTA 3MPCA 4JKMA 4J39A 2EIMB 3GMOA 4C58B 4R8WL 1JNNH 3QJRB 1FC1A 1FZKA 5BV7B 3V6OE 5EULV 3FTVA 2HMID 3QUHA 1OF0A 2MTPA 3TCLB 1MJ7L 3E9TA 1NINA 1ZEAL 4RMUA 3C2AL 1LP9A 4G71B 4PJ5E 2RACA 2Z8SA 4APQA 3K1DA 1Y7VA 1J9QA 4WW1B 4HC1L 3RWHA 2ZOLA 2BW5A 3QO1B 3DUSA 4XO8A 4Y9EA 4ONFH 2HG5A 3SPVA 2OTUA 5IJCC 4J27A 2GAZB 5GGVL 1FZMA 1BQLL 2OTPA 3L54A 3BEWA 4HBQA 3RWFA 4AL8C 4MZIA 3WIIH 3DX6A 3BN9D 1NUGA 2YO3A 3FB8A 4P5KA 1NCDL 3CLEL 3TA3C 4FP8H 1IKFL 1PLAA 2IBZY 2QDWA 2HUEA 3LB6D 3OKNB 4I4WA 4TL5A 1PY9A 4Y2NA 1NH6A 2XNAB 2YGVA 4EQ2A 2NXZB 2K78A 2D3LA 4FMFA 2V9QA 2DRUA 3PL6D 1TETH 1CLZH 5LKNA 2F53B 1OM3L 1BAFL 3FQ2A 1O9ZA 2P5EB 4V1DE 1RZ7L 2LFGA 3INUH 5FWQA 4AVKA 2DI9A 2YXFA 1LE9A 4MCMA 1JHLH 1LWHA 4OZHB 4TULH 3DC0A 4OAWA 4R4FL 2PYEE 3DSNB 4YUEL 4UQ9A 3E6FA 4HYTB 1I9IL 1SDAB 3WFCL 2QFRA 4P07A 4C83A 4YGAB 4ZFGH 5L88L 1KJ3H 1G7MB 1GYVA 5I30L 2BP0B 2CO3A 1EGJA 3APCA 5DD5L 5LVEA 4UT6A 2ICWJ 1KTLA 1KXVC 4IGBB 4ETQB 2ESVE 5TFSL 3DX8B 4OCNC 4AG4H 1O75A 1K9TA 2COQA 2N1TE 4FQXD 3D5OF 2EDBA 3FT9A 3VTTA 3M1OA 1A7OL 2BW4A 1VHPA 3QDJA 2J8UE 3WE6B 1S3KH 3EJZD 5E8PB 3BKCH 2I69A 5CFAA 3SO3B 3BKYH 2OL3B 3BDYL 4JCMA 3SSGA 4GW5B 3UC2A 3VD9A 5HHNA 3BPLC 4AEIH 2P24A 2VLJA 1HDMB 1BVLB 1RULL 2AJXH 4QR7A 4QCIA 7PAZA 2YK1H 4D0BA 1DBKH 3D2UA 1MHHA 3HLAA 3QORC 3FPYA 2HG0A 4QO1B 2QVMA 3VTAA 1ECZA 2G0LA 2VB5A 3ZMEA 1SVZA 4TNVF 4M6AA 4OT1H 4JUSA 1IEAB 2CKBL 2Q3ZA 4LO9A 4JO2L 3BP7A 3MBWA 2PPCA 1HXKA 3N41F 2HRGA 4K55A 2G9HB 3U9PH 2XXCB 3WNNA 2HVKB 3BQUD 1NGYB 4HJJL 4KHXL 3GJFH 1GGCL 1WFJA 4X6DE 5LGYA 3SE8H 2ALWA 4GKSB 2CUHA 1FG9C 3LPFA 4NGHL 5CBEB 2J1XA 2NNRA 4ZW3A 3GK8L 1KY6A 4LLVA 5IB4A 2Q9OA 4X7FC 1IKNA 3HC2A 3WO4B 3O4OB 5IMLB 4PJEE 4L8DB 2GKIA 1YEWA 1SQ2N 1BQLH 3ZKXC 5EORH 2NX5B 5I71B 3BO8A 5IBLD 3FTGA 1MDTA 2FBOJ 1BEYH 6PCYA 2ITCA 5JHDD 2F1EA 4I2XA 4R3SB 1A1OA 1JGDB 5LNEA 4LCVA 9CGTA 4YFEA 4LEXH 2DDQL 4KNTA 5BOPA 2DWXA 4LGPB 1IGYA 2AAAA 3EFDH 5CHNA 3O8XC 1I75A 3PGFL 4LBEA 4QYAA 4X7TA 3E1ZA 4NC1C 2AEWA 4HZLB 3QEGL 3UYPA 4A04A 1U8KB 1OV8A 2C9RA 3L17A 3RLSA 5EN2B 5BV7C 4O02B 3GBNL 4MA3A 3SBQA 3I9IA 5CFHA 2PP7A 3L6FB 3IF1B 4GINA 1UWFA 2AFNA 5K9OB 1OQOA 4E9VA 1RIVL 1RZQA 1YNKL 2VR6A 2WYTA 1RUQH 1REIA 4WNQA 3R06B 3DO3A 1Z7JA 1WBXB 2AQ3A 2JI2A 2NUPA 4APXB 1R5WB 4JMXA 1FFNB 2FLMA 4POYA 4XMZA 5IY5B 2JTYA 5L4JA 3OR7A 1U3HB 2KERA 4AV4A 5FYJU 5DFWH 4H20L 2P46B 2OYLA 5ICZA 2WQUA 1MUJB 1MOEA 3OJDB 1XGYL 3MLSL 1LNUA 2DJ4A 1AHKA 3VGEA 5IB3B 3GZOA 3QFGA 1FJ1A 4DH2A 3GMRA 1HL9A 2AXWA 3MCKB 2ENJA 3E6HB 3O6KL 2F7QA 3WJJC 4X7TB 5BOZG 4GRLA 3TO2B 5D8JL 2XZAL 1AANA 1TNNA 4XVUC 3ASNB 3DBSA 4UQ3B 1QRKA 2ADIB 1J5IA 5DUPL 4B60A 3S4SG 3NA4A 2ZQKA 1ZK5A 2I26N 3B2PA 2J72A 1I7ZB 4HPYH 4XNAA 5CP3A 1L9RA 5JA8B 2YPLD 4J3UA 1FQ9C 5IBUG 3GC3A 3PWPB 3P2BA 4JM2A 4GUQA 4YHKL 1Y18A 1SY6L 5DZAA 1U41A 4Q56A 4KJPD 4KHTH 4XCEA 3U4EB 2CHWA 4YDLB 5TE4H 3CCHB 3SCMD 5EFIB 3MLUL 2EE2A 5LHDA 2OQJB 3GWJA 3FO0L 2D0GA 2EECA 3HRZC 1D7DA 4JFPA 3FMGL 4PCKA 1G6RH 4Q8BA 3RWIB 1CFMA 4OM0L 3RBSA 1MRCL 3J07A 3LRGA 5IFJA 4HLZG 3LNEA 4HUMB 2C7UB 4KVCL 5HYJE 1EDHA 2L3BA 4NHUA 3ARRA 3PFUA 1ECYA 3C09B 3F7PC 3QEQD 4U7SA 3Q06A 4MWFB 3WU1A 4J6RH 3FQRA 3E80A 3FQXB 3O2VL 4LLUB 4U05A 3OF6D 5ABDE 1E4XL 2MPVA 2VMDA 4HIIB 3AMKA 4X8GA 2CCVA 5E5MB 2CRIA 2WBXA 1HL4A 5FKPB 2OMUB 3P1VA 3FUIA 1AQKL 4RGMB 3SOBL 1DLFL 1QYGH 2YN5A 2VXUL 3RY5A 3MFGB 4GI9A 1S7UB 5ES4B 3WNLA 2ITDA 2WBJB 4ANXA 1NQBA 2EXSA 3KLSA 4AH2A 4AIZA 3E6HA 3GTVA 3WE1A 1BOYA 1U3ZA 1MLBB 1WFNA 5AKSA 3FJTA 2B1AH 5D6CA 3LKSA 5FYKH 2Q7AA 2X42A 5A2BA 2JCCB 5D7JD 1EEZA 1XZWA 1SRDA 3L2NA 4QRQB 2JMRA 2ATKA 4YQXL 2XQYG 2J5LC 2CIKA 1N6QH 2HFEA 2ICWB 1ORQB 3B1TA 5AYUH 1EH9A 1LDSA 4YDIL 3SEPA 5JXEA 3BZ5A 4J6IA 3OKKB 2XDHA 1E4XH 4WW2F 5L2JB 1MHEA 3QO0A 5ALBH 2ZOLB 2EDHA 2G4GA 4DQOL 2W65A 4KMTH 1N8OE 3MXVL 5TDNB 1FL3B 3UO1H 1DANU 3QZOA 1ZS2A 4ANVA 2ZPKL 5E1AB 3ARTA 3BWZA 4FFZH 2VDML 4GRLC 3VFWB 1ET8A 1QFUL 5TGBA 3TV3L 4LRIC 3ZKSD 1FVCB 5F96L 2CPUA 2FSDA 3HG0A 3NUKA 1LK3L 3D08A 3FF7A 4KJQD 4LMQE 4OF3A 4XCNA 3IDYC 3RA7L 3WFCH 5E4IA 3TV8A 2J5WA 2ED8A 2JI1A 1JGVL 2BVQB 1XF3B 2DIAA 3OXRA 4BWWA 1AOZA 2XHNA 2LU5A 1A66A 3PUUA 3VFRB 1JZ2A 2BOBB 1UZGA 3CDZB 3GXPA 5KJ7E 2G5UA 4FFYL 3U79A 4YDIH 4MXWL 4NZ8A 2F53A 5IG7B 1CURA 1NA8A 4DPCX 3RIAF 2ITCB 4UNUA 2DL9A 1OL0A 1OAUL 3TFBA 1PKOA 1EUTA 3FO9B 1M7DA 2RGSA 4F80A 3DRTA 1ZPUA 3AW5A 3LX9A 3QDJE 5DO8A 1V7NL 5C0DA 4IOIA 4A2FA 5FA4B 3TWCL 3O4LD 3Q8EA 5DLML 5C0EA 4H8WL 4W9FC 2YA2A 2IH3A 3DTUB 1M3IA 2EEFA 3KXFB 3ME0A 1BXUA 3O81A 2ADJA 2K0RA 3IDIB 4N0FB 3L1GA 4PVBA 2AXGA 2PP8A 2NY4D 4LRNL 1G7IB 4DP5X 1NAKH 3HHMA 3M7FB 3MACL 3CFQA 1R3IH 4U1IA 5CWSB 2PN5A 3DVFA 4M7LT 1PMYA 3HTLX 5B3JE 5E7BA 3RWCA 4OF5A 1A0QH 5IVZB 3S4SB 3SDAA 4Z7WA 2FIKB 2ZUTA 1FORL 2BC4B 4NWTL 4N8CH 5DVMA 3QFJD 4HIEA 1IRAY 3VFSA 5ISZD 1UD4A 1FZOA 4PAZA 3U4BH 3GMOB 5IEKB 1JV5A 3NH7L 3UJTL 4RA0C 1MRFL 3NZSA 1JNHB 4PJ6A 5T3XD 1Y6MR 4HSCX 1JK9A 2PCFA 4BSJA 2VE6B 3AC0A 4O00A 2XA3A 4Z7WB 2I9TB 4PH8A 4UTBL 3UZQA 3Q2CA 4KROC 1G5AA 3BGFC 4G9FA 4R4FH 3VG9C 2C3VA 4UV4L 5G4NA 2X6VA 4E0RB 3B2DC 2IH9A 3VXMD 3QZWB 3DJTA 4PRBB 2P5WA 4ZUWB 3ARED 1PZDA 3ZDZF 2D4FA 2X4PB 2UY6B 2P42B 3MZTA 5GRWA 2M2DA 2XA8H 5I23A 5KYNA 1WZ1L 2XI9A 2JI3A 3C6EA 3VYPA 4PJCE 3UBXI 3DX0A 4TRPL 3T77B 3S3CB 3LPPA 3RKDC 3FPXA 1N68A 2BWQA 3IETB 1JL8A 2EDOA 3EH2A 5KSAC 4E2OA 4JFED 1Z3RA 2NXYD 3QUML 5E9DA 1ADWA 4ELME 1QKZH 4J4PD 3UTSA 1DDHA 2HVJB 1W72H 4LSUL 3LVTA 3VFPB 3RVWC 4LOEA 1MW1A 4WK2B 2M8XA 1GGTA 4GIPD 3GDBA 4QLWA 1E9OA 1M9WA 1YYLL 2YHGA 1R5IB 1QI4A 2BP5M 1JS4A 3L4ZA 4JFHE 3VFTA 1U3HA 3I74A 3WKYA 1SY6A 4FHKA 3K72A 1BOGB 4BZ2A 3RA7H 4O02L 1AFVH 1BJMA 4AQ1A 1ZT7A 2Y06H 2DH3A 2BY3A 1MW0A 2DQEL 3DXAE 3GZKA 5J11C 3VI4F 4YDVB 5DZJA 1R9FA 2HFFB 4CSZA 4IMLB 5CEYA 2H41A 5IBTH 5BQDA 3V9FA 4L3EB 1L3WA 3MA7B 3DECA 2QGDA 4G43B 4BE5A 3V0FA 4G8FB 3G04A 2X9ZA 1A64A 4R90L 5DRZB 2AERT 5T3XL 5L2JA 5IIEB 2VO5A 1TO4A 3LZLA 4NKOA 4AGPA 2HJKA 7FABL 2I27N 2XN9A 4JQIA 4LHUB 1DQKA 5ANHA 1ROWA 2A77L 2PCYA 1UXSA 4FNRA 1XMEB 1YC7A 3WNOA 4EUPB 5DK2A 2D2CC 3ZDXB 4KZEL 3NRPA 3OBAA 2FX8L 5AW4B 5KSAB 1ASQA 3OJ2C 4P9HL 4RX4A 4DO4A 3ULVL 1BMZA 1UJ3C 3SKMB 5KYXA 5J12B 3CVHL 5F89A 5C08B 1FO0B 1XSOA 2QLYA 3G5YA 4PB0H 5EUOE 3TZVC 3BVNB 3T8XA 5EZPA 4IRSA 2YUVA 5T1KD 2GTWA 2NR6C 4XRCB 4E5XG 3DVGB 4NQDE 5DUJA 4TN9A 1NMCC 1CE6A 3PPSA 2COVD 4KTYA 5GGRB 2FECL 3WGUB 2Y6SC 4WI0A 4XWOC 2WUBH 4TSCH 2UZXB 3I6SA 4WJKB 2DMKA 4QRTA 1MJ8H 2C3GA 4LF3A 4JDVB 4ONGL 5I76A 3UAJA 3NAAH 3CFDA 1JVKA 1Y0LB 5AW5B 3VTMA 3L9RA 4NFDA 2QVTA 2AJZB 1R75A 4DETA 4EMZA 3W5MA 4Z7UE 1IL1A 3SDAB 4ODSL 4XMXA 3X1NA 3UPRB 2OI9C 4XWGH 2A5UA 2FBJH 2QGEA 4XCEB 3RWCB 5HPMB 1MHHB 2EC9U 1U9KA 3HLAB 3HB3B 3QIWB 4H40A 4HCIA 3D0LA 1DQLH 4FQJH 5E8OA 5IM7B 1IM9B 2OSLB 2AANA 1I1FA 5D7JC 4JEGB 2DMGA 1BPVA 1WH0A 2GCYA 5TH2A 3FH8A 2CHDA 1UD5A 2X3CA 2EEXA 4G8IB 1WUZA 3BVNA 3QB7C 4IRSB 4ODHH 1T4WA 1CD1A 3ULUF 3HE6A 2Y22A 1T0MA 2QPDB 3IDXH 4D94A 1QW8A 1VZGA 4YSTA 2EZ0C 1J0HA 1F45A 3PRZA 3BCFA 3W0WA 1K2DA 1QZ1A 3F6JA 2DQJL 3A24A 4AYMC 2EILB 2GIXA 4UTBA 4JDZA 4XMTA 3CHSA 3PIQA 1E7UA 4FMVA 1IC7L 2IOOA 3V0VB 1RURL 1FJ1B 3ARFD 4MFHA 3KJ6L 5GRZA 4L3AA 1X7QB 4QXUH 4W4OC 3PQYA 4PRIA 1ITCA 4KJQC 2G5BB 3N44F 5F9OL 2D7PA 3V0GA 4QTIH 4BDVB 4WKZB 5FYLH 3UGUA 4JJOA 3U1PA 2FX7H 1NEZB 3DI2B 4JPQA 4RFEA 2QKIB 4FYSA 4XAKD 5DZNA 2YD5A 2YXWA 3SDYH 2H6PA 4BFOA 1GYUA 1ODUA 1UWEL 2IANE 3IDYB 4KKPA 4NT6A 4PRHE 3T08A 1VFOA 1AP2A 4WI5A 2HPOA 2B1HH 4ZXBC 1FN4A 1TJIL 3O3AA 2OV0A 1QRNE 1RQ5A 4FQ1L 3MI6A 2ZX6A 4OU3A 2DQJH 4LNVA 1TVHB 5H4ZA 5JQHC 4WHYG 4KXZH 3WNKA 2CJ3A 1NCCL 3OAYH 5JYMA 4C59B 5HYSB 4TTGA 1Q0XL 1TQSA 1ZT1A 3HFML 3KL3A 3NEEA 4JRXA 1KXQE 2VW4A 3FB5B 1JXGA 4QAMB 2GJPA 3JWDH 4YL9A 5HJBA 5LN4A 3UTQA 2X88A 1JYVA 1XIWD 3NEXA 5K9KA 2DLIA 4L1LA 3EGSB 2B5IC 1N2RB 4NN5C 1ED3B 2GCYB 2VH5H 2WJ7A 5LBGA 1A4JA 1MI5E 5TH2B 3FOMA 3MYJA 4GQQA 5HPOA 1DDHB 3MBXL 3QAZB 2B39A 5F3HA 5FO8B 1WBZA 4HIHA 1I1AA 3VWJD 4DVBB 1ZSDA 4R7DA 4X6CB 2YUXA 3SN6N 3BT0A 4IOSD 3QH3B 1LO2H 1TJIH 5BRZA 4DOHE 5GIRB 2GQHA 4LFHD 4GMSL 5DQJA 3O9WC 1SBSL 3HAEH 3WSQL 4ZMOA 4IYKA 3W5NA 4Z7NB 3V0DA 3IMSA 3L3KA 1MCIA 4TSAL 2ZKXA 3NQKA 2Q10A 1IGML 3QRFM 2GUYA 2HVKA 4JKLA 3BKML 4K3EH 1NMAH 4P2OA 4UOW1 3Q1SH 3ARWA 3V5HA 5K59F 3ARVA 1J11A 3S37X 4CMMB 1F6AB 3AS3A 2BOCA 3K8LA 4N0UE 2Y5QA 2XV0A 4BUQA 4O2CA 4ZUTB 2XKNB 3EZ8A 4PJDB 1I85C 1A6ZB 4U1MB 1ACYH 1T20B 2WXMA 1NGXB 5DC2A 1QFUH 1U91A 4GMSH 4NI3A 2FIKA 4MHHG 5J7CC 2DF3A 3KJ4C 1QMUA 1T2XA 2G75A 2OJZH 3KPRD 2VXSH 1OAYH 4N86A 5ICUA 2PYFA 3EGSA 3B9KB 1RP8A 3DSFL 2QQKH 5IVNA 3VD5A 2F8IA 1RKRA 5KVGE 3ENEA 3B9KC 5I18L 3HN8A 2ZXCA 2G3ZA 4BHUI 4P5MA 2DQIH 4P2QA 2YJLA 3GM8A 2B77A 3GUFA 4QHKI 1NKGA 3BH8B 4PI2A 1JJUA 3KJ4B 5FDYA 2CLRB 4AV5A 3IBOA 3R0MA 4PJ7A 4RWHA 1MF2L 5AW1B 4OI7A 5LAXB 5D7SH 3RNQA 3WFHA 1ANUA 4M1DL 1YUHA 1M7UA 4FNTA 3MV01 5FYKD 3UP1A 2VLMD 1VFBB 1ACYL 2IDQA 4HWNA 1ZAGA 2HMIC 4Y4FC 3SYAA 1PFOA 2NNAB 3OHXA 3D3VB 2WOYA 1GGBH 4S0HA 3VB8A 4RRPG 4LOVA 3S37H 2BHUA 4RMVA 4S2SB 4DW2L 1WCBA 2QJDA 4OQTL 3S88L 1AS8A 4I3SL 2FQEA 2RAMA 1DO5A 1N64H 4HW6A 4NQCD 5AUMB 1SDDA 4PV9A 1GS6X 4M5ZL 4B9ZA 4Z7OE 1XH2A 3IGAB 4DKFL 4ZOEA 4UQIM 1F3DH 3RX9A 1AHWC 1IGTB 3VFPA 1SHWA 1WPCA 2Q20A 4M9PA 4U6HB 4QAWA 3FONA 4UT9H 5C2BL 2V5SA 2D9CA 1MHCA 1A7QL 2H1PH 3PP4H 3C12A 1RULH 4IBSA 2AJXL 1Z9SB 5SV3A 3V0EA 1G9NH 3EUUA 4MNQB 2XN9B 3TJHC 4HKZA 3VI3B 1WHOA 4NZRH 3MRRA 4CSPA 4YHYC 3CFKB 4PHZA 4YO0B 5J8OA 2FWSA 5J57B 1BQRA 1R3LA 2WLHA 1JERA 2DLFH 1N67A 4TSBL 5D7IF 2KH2B 3CU7A 3H0TB 5B4MD 1FNSL 1JWMA 3LHPL 2L4OA 3L4UA 3D1MC 4H2AA 4IIQC 4OJEH 5D1ZC 3UIYA 2WPGA 1T2QH 3KWWB 3H42H 4LU5H 3OKYA 1NAMB 2NY3C 3LIZA 4JZOB 1DQDH 3RPIB 3VXUA 1M1XA 2ICEC 3D07A 4RVBA 1ORSB 3X13B 1EHAA 1U6AL 4XI5C 2OSYA 5L4MA 2VDKH 1VGKA 3QHFL 2FECI 4XB8A 4DP7X 2R4SL 1CDYA 3HW7A 1N0LB 5JNYB 5L0QC 4LLWA 1D2OA 2F54B 4MD5A 1U8MB 3N6YA 3QG6B 5IVXA 5KZCB 4GFXA 2IANB 2BDNL 1G7IA 2N0KA 4R96A 1UWGH 1CI3M 3KGUA 1ZLVH 1UKQA 3QS2A 5A7EA 1JZDC 1H6EA 3RIFK 2A4EA 3T0EA 3GSOA 1R3JA 1NBQA 3FTSA 1BHGA 3AVEA 2ZP9A 4NRXB 4PTTA 1OP9A 2Z92B 1AC0A 2EXYD 3Q8BA 4DZ8A 3L7FB 4XNBA 3PU7A 4R6UA 4I48A 4EAEA 5C7ZA 2X10A 4BUHA 4UTCA 1HJCA 4HDIB 2QKSA 4ONHB 1T1XB 5DLLA 3CDZA 3VXSB 2DIEA 1KLFA 2VLKD 2VR3A 3OXRB 3HG1D 2WLYA 1HIML 4LLYA 4Y4FB 1HZLA 4K71C 1E40A 4PD4J 1EANA 3HOGA 4O2FA 1TJHH 5AFAA 4IM8A 1OB1B 4XVSL 4XODA 4YDVA 4LDCA 2W9DL 3QBTB 2JKXA 1DVUA 1WDAA 4BQCA 5ID1A 2FX9H 3ZZ1A 4YUEH 1HZHH 4R5TA 1ZXKA 5D7IA 4JB9H 2OM5A 4WTZG 3VFGL 3G5ZA 2GFBB 1UWEH 4YWGL 3MBEC 1A3ZA 2BNQE 4AXWB 1EK3A 1LO3L 3PQYD 4KJYA 5AB1A 3T4AA 2VL5B 3T4YA 2JK5B 1URZA 2NW2A 4R2GB 2FUTA 1BMGA 3SGKA 5INCB 1HFUA 1YEHH 3GBMH 4OUUB 4YDZA 4UUJA 4ABWA 1PZ5B 3IAGC 4P23D 5EOQL 3W1ZA 3TA3D 3IFPB 1RD6A 1ZT4A 3OX8A 4UAOB 4WV1A 1A2YB 2BZDA 2EYRA 4HU8A 4OLXH 3DRTB 3WV0A 2HKFH 3FB8B 4P5KB 5A6IA 2IPKB 1IUZA 4LLDB 4XOEA 1J7VR 2LAAA 5I1AB 3ZDYF 1K3IA 3OLEA 1BVOA 3BH8A 2ENQA 5H37H 1E6OH 3HRZA 3Q48A 3CFCH 3I3DA 3LRSB 3GS0A 4F92B 4PV8A 3PABA 5T8IA 2JKNA 3H3PL 4LOUD 3SPHA 3GLEA 3MV7E 4R2GD 3O45B 4JUTA 1HHKB 5E7FA 1BWWA 2ID5A 4WTZA 1FIEA 1TU2A 4XNYH 3VVVA 2GEEA 3G5ZB 5D1ZI 1GAFH 3ZE1B 2DY2A 2AK1L 4M1CC 5FO7A 4N0YH 2RH0A 1MRCH 4Y1TA 3DTXA 2HT3D 1JZ8A 2H0EA 5DHDA 3CGTA 4MCZB 2F7PA 5FGBA 3QS3A 3RVVD 3QUXC 2FL5B 1M1SA 4WTQA 1FZOB 1TLKA 4YC2C 1OGAD 3QR2A 2A9BA 5DJYA 5ABZA 4GKLA 3VSTA 4GBXC 2AP2A 1P5VB 3TH2T 3LH2L 4LPTA 1Z5YD 4NO5A 4XP9H 3CFBB 3GHEL 4ODBD 1XR8A 1NAKL 4GKNA 1TZAA 5BVJA 2K3TA 2L0DA 3IEAA 4ZAKB 2JXMB 5F9OH 2ADFH 1L9PA 4BGLA 2NZ1A 2YARA 4E9QA 2GSGA 3M1BA 1A6WH 3ARBC 3MRJB 2EO7A 3X14A 5IB1B 4FNPA 2F74B 2PWEA 2D31B 4X99A 2Y3NA 3T0EC 4PRNA 1DSFH 1U58A 2VXSL 4GW4A 4FFVC 3S0PA 3EYVA 2FEJA 5G5DA 1MPAH 4HXAH 2A4ZA 1AIFA 2XWBB 3PWNA 1CVRA 1M71B 2HTLD 1GY2A 1JDDA 5J0BA 2BZCA 1ZY9A 2FUQA 3ISWA 4F2EA 1D2PA 3X11B 5FCUL 4JJHA 4JPWH 4YAQB 5DZVA 5HVGB 2ODHA 4O2CB 4ZUTA 2WKLA 1MIML 3LH9A 1JXDA 2PF6A 3MKGA 3Q44A 2J6EL 4TLSA 1ZCRA 2ZOUA 1YEDB 3CNKA 2XTJD 3NTCL 4P05A 5IQ9A 2OK0L 2HLFC 3P4NB 1KCRH 4ZFOL 2C9VA 1L0XA 4IK6A 1HHIA 2J8HA 5KYYB 1PU0A 5CXPA 4PRDB 1C5CL 5F9AC 4BFRA 1OZUA 4P2QD 1TQVA 3EXJA 2LT9A 2H2PD 3ZUCA 3I50L 1UM5L 1DO6A 4K2UH 5E1AA 4DKDC 4G6KL 2A6DA 1BV8A 1OO2A 2PTTA 5E00A 4PJ8A 3ILEA 3MX0B 4H1LB 3WS3B 3BRGC 4BJLA 2DWEB 4I5BB 4W9LC 1S4IA 4K3JL 3WDHA 3GXUB 3VWJB 2H3XC 2O6EA 3JWNG 1HXYB 3GSNL 3WBDA 3WDJA 4JGJA 1PFCA 4JPVH 1FC2D 5JHDA 1LVEA 4UWQB 2ADIA 4IU3B 2MTAA 1YMMD 3MUZ1 4U1NA 4NP9A 4D9LL 1FVDB 3IDGA 2OCCB 1A4BA 2R0WL 5HHOE 4X2UA 5ELIA 4LRNH 2ILLA 4CNIA 4ZPVA 2Y4SA 2X4NA 3NZUA 1IARB 9PCYA 5E4EB 3T0EE 1G94A 1ZS8B 4Y2DC 3PXHA 5DEGA 3GYRA 2H9GA 5F0PB 2P1YA 3W9DA 1V54B 3F65A 4FLHA 1KIRA 2QV2A 2AKRA 2VDOB 5ETUA 4B5ZA 3PHAA 3IJSB 4E9TA 4M7JL 3MMEB 4O2EB 2B14A 3QIBA 1MJJB 2EDMA 2A74C 4J1UA 1S7SA 1A02N 1ZTXE 3QA3B 5DZ9A 4RZKA 5DYOA 1LDPL 3K4AA 5M7QA 4OBSA 5F1OB 5F72S 1AR1D 5GS0D 1RIHL 4W9EC 4GP5B 4NHUB 3Q9PA 4NQDA 1ACXA 1YNTB 2GJZB 4FLRA 1T4KA 2JK5A 3D3VD 2E5EA 3STLB 3RGBA 5HYJB 3RX5A 1XCXA 4P4RB 3ZMRA 1NJ9A 2R7EA 1VACA 3EOTL 3AXIA 3GBNH 1GZHA 4ZRGA 4AYFA 2A9MH 3D48R 1S9KC 1HINH 3JYBA 4Z0XB 1JF6A 1J1PL 2V8MA 4OZFA 1ZWIB 2NY3B 2Y7MA 3AAZA 3QWRA 4ODTH 5CBAA 1MFEH 4HEME 4AMXA 1S3RA 1W72A 1FDLH 3GSQA 3TFKC 4KH2A 4NQTA 4P57B 3B7TA 3IRCA 4M3KB 4TNWK 2KQNA 5GZOA 3GI8L 2ZCZA 2X2IA 4UBDD 4Y9FA 4WFGE 4XPTL 1E8YA 2HTKD 1UWXK 2JJSA 1PX4A 3FDWA 1IC4L 4YLCA 3OGOE 5I73C 5E08H 1OM3H 1VEPA 1NL0H 3KDPB 5GZND 4AQ1C 3MTRA 3QDGB 3SGEH 3SKMA 3NAAL 5E23A 3WJLA 4CW1B 3ZL2A 4XHQA 3NIFB 5C71A 2I9LA 3ILQC 4MQXC 3RIKA 3DIFB 2YOAA 1KGJA 1YJDH 4LP5A 4ZD3L 3EG9A 5HSFA 3CFNA 2JCCE 3RKPA 2QVIA 4GFTB 3VGGA 5KG9B 4KTDL 4FQQA 3UIZA 5DVNA 1B2WH 5IB1A 3DOIA 5F21B 3WNMA 1HX0A 4R5VA 5D7JA 1QABA 2A74A 2DH2A 4QGTA 4R4BB 2F61A 4FMKA 4PJGB 5ACZB 2ED9A 5CLXA 5IIEA 3KDMA 2GJZA 4GLRI 3P30H 1CFSA 3NIGE 3OXSB 4NIKB 2NUPB 1BYNA 3VAEA 1KGUA 2VSDA 2CJUL 2Z31C 1U95A 2P9RA 4RZCB 3EYQC 5KSBE 5DJ2A 2Z35B 2OR7A 4F37K 4JR9H 1QLEH 2A2QT 3UYPB 3GI9H 3KWVA 3KPSD 1DEEA 1JGEB 1M56B 2FWOA 4YSEA 2W1NA 4A7UA 1RHFA 3WUWG 4U6TA 3IXAA 2OXGA 2VDNB 3O6MH 1S9VB 2OMNA 1P4IH 4ZS6D 4XPAL 5LQBL 2F58H 1C5BL 4BSVA 4PJDF 2WLNA 3IWVA 4QRSB 3BD3A 4YDMA 3HZMA 4OZFB 4MDRA 1AQMA 4JNXA 3ARGC 1GMEA 25C8H 3FN0L 1U8LA 3HZYA 3DO4A 2Z4QB 1D9KB 1F56A 4MBRA 4WO4C 3SE8L 2P47B 3QUXD 4U1JA 1EHXA 4KI5D 4P23B 3NJIA 1P4LA 2F1BA 2J6EA 2V7HB 2APXA 4ONOA 4PRBA 4MXVF 2F5BL 5DD6A 4EIUA 4ODXA 4ELKB 3M45A 4IHBA 3ML8A 4LARL 3V4PB 5MENB 4YBHA 5J6GA 5FO7B 2A9ML 1XZ0A 3ASWA 3US9A 1U3HC 3TIDB 3E1F1 3K72B 3OMAB 3UZQB 2D7QA 4JDTL 3QPXH 3K1KC 4RMRA 4AM0Q 1CWVA 4M9OA 2A4CA 1KYDA 5EU5A 25C8L 2D4DA 2HVJA 3L3HB 1NBVH 4W9DC 5J06A 5DSCA 1NC4A 3WJMA 4UQAA 1H5BC 3HG1B 4ZW5A 1IC4H 2ZWKA 3VXSD 5LAXA 4MBOA 1LEIA 3LRMA 1OAKL 4HXBH 1NLDH 4I0PD 4KTEL 3GIVB 4ORZC 5E8OB 4DN3H 5CWSA 4NAQA 3QAZC 1TDQA 4RMBA 3VQMA 4JZJA 1MCRA 1N0XL 2F74A 1BAWA 5A2FA 2F19H 4G9FD 4PFEA 1E28A 5LCVH 3T0BA 4AT6A 4MA1B 1VPOH 1R33A 2WINA 2Y3AA 3ZL4L 1HCVA 1EFXB 1TZ8A 2X4UB 3SDAD 3KXFA 3ME0B 3BUPA 3ORJA 4F33A 4YNYB 4FFTA 1UH3A 1XEDA 3HR6A 1DEEB 1JGEA 1NCNA 2CWRA 3VXRD 1R24A 2UZPA 1T83C 2AZUA 5ANMB 5AOZA 2MCG1 4CILA 4YLQT 3TURA 4LNRA 4P2RE 2H4EA 1RJZA 1CIUA 4OB5L 4LP4A 2C9AA 2AQRA 4PJBE 4G8GA 2NUTA 2K45A 3TYFA 2EAEA 3D25B 5EOTB 2J4WL 4X4ZA 4EJ1C 3HCVA 3CD4A 5EBMA 5SV4A 5AB2A 2TSAA 3DSNA 1O6VA 2JCCF 3QT2A 1HEZA 5I75C 3CFUA 5I30H 1IM3B 2BC4A 2OMYB 1UM5H 3BUYA 5HHOA 2WIIB 3NGBB 3Q3GB 2MQCA 5DHVA 1GR7A 1T03H 2A6JB 1DQQB 2PWGA 2BVYA 2R0LL 2VAJA 1A0QL 3CE1A 3WKNA 4QHNA 4WFEE 3UAFA 5EIVA 3V0WH 3NZ8A 1TVBB 3JV6B 2GTQA 2Y25A 2YKLH 1AVAA 1VFAB 3SGEI 5CEXB 1IIKA 1DE4B 3EGXA 3VE0B 3L48A 1MF2H 2NW3B 2V7HA 4HUWB 5DHXB 3UO1L 4OFPA 4K8RH 4L48A 3W0WE 4D0DA 2FWLB 1KACB 3P9WB 4JN1L 1GKOA 4H44C 4LLDA 2YWZA 5E4EC 3SYQA 5GIRA 4Y9BA 3ULUD 4J2XA 5AVXB 1U3JA 5D5MB 1UGKA 2YK1L 3SDDA 2LLGA 5LB1A 3MBEA 4R7VA 3GB7B 2CIKB 1R3LB 2ADFL 4XXDB 4UNVA 4QKXB 3JWNE 1QWNA 4W9KC 5I1GL 2MMXA 4EF3A 3KYKL 4JQXA 2WXKA 1Q9WB 1RIUH 2VW6A 3W57A 4P9MH 1G5GA 3K6SA 3VFRA 5JZ7C 3CSYB 3S3JA 1TZIB 1M2VB 1IO4C 1VF5C 3L3OB 3LQAH 2A3TA 3N1PC 1ORSA 3X13A 2W8CA 3FCGA 3TBSB 4RMSA 3N91A 3I6KA 4CBZA 5TGBB 2J8UB 4MYWB 2EDRA 5EZJA 3F6LA 2Z4TA 2BIIA 2BPBA 3E8UL 1T6BX 5C0AE 3HC0A 5E8EB 3H6AA 3EOTH 4XHJC 2B9BA 4ELMF 4ZOAA 3ARSA 4PRIE 1MHEB 1PZCA 5DHVB 2NPLX 3HNSH 3TFKD 2BSCA 1IGIH 1HE7A 2YAOA 2WQVA 5AAMA 4HDIA 4ONHA 5H2BB 3IN0A 1S7SB 2XTSA 1JFQH 1JGIA 1X5AA 5EORL 3D3VA 2VN4A 1KYFA 4LLMB 2WV3A 1JMZA 3UG4A 4MJ5B 1N59B 1NLBH 3QNFA 4K4KA 1EZSA 5C09E 4D0DB 3KPOA 3GRWH 4Z7QF 5GZNC 3KR3L 4FQ2L 4JM4L 3OVUB 1CB4A 3CN3A 2H32A 3CHRA 2VMEA 2C4FT 5BQ7B 5J56B 4JDZB 1MCPL 2XV3A 5EEXA 4PM1A 1IGFL 1KPVB 2K3HA 3LDBC 4IBYA 4UM9D 1IGTA 5D72L 5DD0L 4YSUA 5CEZL 1TQCB 2ZZUT 1T89C 4GJTB 5IUCA 2YC1A 2HX8A 4XB3A 1XHHA 4LASL 2RHEA 1F41A 3MXWH 4KRLB 2YBRA 1MWAB 2DB8A 4ZX5A 3MUUA 1HHHA 2X1OA 3P9LA 5HDBF 2WANA 1WFIA 1TTBA 3CBRA 4FI8A 4P57A 1A7PH 4QOKA 3MV7A 5ILTL 3T2QA 3BN9C 3A4DA 5IQNA 3U2IA 4ATWA 1WQVT 5GZNA 2YSSA 3G5VA 5E2VH 1YUKB 2A6DB 2EDLA 4Q6KA 1FBIL 4FYRA 1Q8MA 3T71A 2DQDL 2VDPB 4J3TA 4QJ5B 2UXTA 2HUHA 3L4TA 5ECGA 1IEBB 2BNUA 4YNYA 3CZGA 5K9JH 5ICZB 2X1PA 1Q94A 1MQ8A 5DUML 4DVRH 2WO4A 1L6ZA 2B1HL 1EXUA 2OZNA 4FNSA 2WLIB 4ZSOB 4XZUA 2O5XH 3KLLA 1YN6A 1FHNA 5C8JA 4GSUA 1UCBH 2YZ1A 5FX3A 4DPRA 3W11C 3BCDA 4K8RD 5DJCA 3N55A 1TQCC 4Y2OB 4LCUA 4YHMH 2R56L 4WNQB 2ORBL 3QORA 1JFHA 2HT2D 3BSGA 5F7EH 1ZHBA 4W6WB 4CJ0A 1DVFD 1R3JB 4ZNCD 4OFVA 5FA3B 1S7WA 3K8KA 1NCOA 3KNBB 4AM0B 3F58H 4KTGA 4NAMA 1XFPA 4LPXA 1RAMA 2ESVA 1U8HB 5D7HA 2ZIDA 2WQSA 5A2LH 3ARFA 3DX1A 4TUKL 5JO5B 5I1LA 4HEPA 3OPZL 1JTTA 1WYJA 3Q5YA 4HAGA 1PBYA 4J8RB 1LO3H 3NZHL 3SE6A 3FQWA 3NFPB 1H6UA 3FT0A 4LEBA 3IKCA 3WKML 1L7TH 3ZDZB 3NFNB 2A6IB 1U8PA 4YFLF 2VZOA 3G5WA 3QHFH 2Q6WA 4WFHE 4Y8AA 3D39B 5ESQA 4KVCH 1DQIA 1F2QA 5D71H 5EU6B 1PAMA 3FAXA 1LO0L 1ETA1 3ATDA 4V11A 3V8OA 4IOSA 4NSKB 1MFAL 3RI5F 4AL8L 4BFBD 3MA7A 2Q76B 1YNKH 5JPMA 1AO7A 4NJAH 3ES6A 4TQ8A 5GRUH 4GT7A 2HN7B 1ZV5A 1U8PB 4Y4HD 4HPHA 1ZLEA 5ID0A 2GTZB 3IMWA 3BPLB 2JJTC 4YSRA 5EZLA 5F7AA 1AGCB 5IW1B 5K39B 5MI0B 2AJVH 3H7BB 4BDVA 3IJYA 5L6YH 4QRPB 4W9JC 4ZNEE 4I0PC 5GS2D 3KPLA 4XCCH 5D93C 3PAZA 4YBQD 4Z3HA 4PLOB 4WJ5A 2VDQL 5HVHB 1VA9A 4I0KA 3TJPA 4G6ML 4ZFZB 3NCCB 4M43L 1SXBA 1BG9A 5CEZH 4YE0A 3SDCC 4RFNC 4L8SB 4NQEA 5FYKL 1YRKA 4QHMB 4OLYH 2BX5A 4KTEH 3ECVA 1CIDA 1KN2L 4AM0A 3SO5A 1ZT1B 3BWAA 4O9HL 1MCNA 4XCYB 5IQMA 1NCCH 1WS7A 3AITA 3OHXC 5FKPA 3RUGF 2XWBA 1HHJB 1K8DA 5EWIL 43CAB 2GW5A 3IGAA 4ALAH 5FDWB 4Z5RB 2UWEB 2X4SA 3IPBA 2AMUA 5FFGA 1DZBA 5IB4B 2GK2A 5DJCB 3N1QC 4NZTH 1OLLA 2R1WA 3KPRA 2DQFB 1SHSA 1ZHLB 4R4BA 3CH8A 4OB5H 1RZIB 3BQUB 3E38A 4FL4C 3WTWA 2WVUA 1TTFA 3T0WA 2JKSA 3QQDA 3TVMA 2EIJB 4XBMA 4XTRC 1QFWH 2Z1PA 2YAMA 5J12C 1M53A 5E1IA 2BSRA 4KAQL 1A4CA 4L3FA 5DMIH 1WZLA 2ED7A 2J1YA 3CLEH 4JFVA 3SCMB 5DZPA 3ZE2F 4GAAA 5KVDH 1ILSA 4HKJB 3PUCA 4JS7A 2DYSB 5AW7B 3SE3A 4RAUB 1EFXA 3P9LB 2WINB 2CDFB 5L2KA 4QOKB 3DROA 4R4NC 5I5RA 3DJ9A 1HHHB 4LAQH 3S34L 1JHTA 3LZOA 4X9GA 2Z7UA 2C7FA 2R0ZH 2CMRL 2HKHH 3MRGA 3FN3A 4JFWA 3U0WL 1KYOJ 3KH3A 4QRRB 3EDJA 3ZTDC 1QR1B 3T2PA 3NTCH 2OK0H 1W2KT 3MC0A 4I9XA 4JFQB 1F3RB 1O9VA 4NQCA 3TPKA 4YHYB 4J1UB 1MCQA 4EDXB 1ZOXA 2BNQD 1U91B 4X80L 5CZVH 4FI7A 1LE5B 4WU5B 5G55A 3IU4L 4NNPH 2YN3A 4PIRF 3NZHH 1FVEB 2H26A 2WNGA 1V27A 4IGBD 1ZS8A 2OKMA 3IS1X 5DEGB 3U6XS 3MOBH 3V4VL 3IS0X 4R4ND 5C07D 3X14B 4E9WA 4M61B 1AE6L 5IB5B 3V9CA 1KBVA 4FHBD 4TYUA 5FIEA 1CU4L 3ZSSA 1KJVA 1NC2A 1U8IB 2WWKT 2GI0A 1CMOA 2BS8A 3G6DH 1J1OH 4NQDB 5J6GB 5MENA 4PW9A 1VZHA 4OZHE 5AKTA 8FABA 5CN2A 2Z9TA 5F88A 3EH4B 1I7RA 3MLWH 2WXRA 5JMRA 2ETWA 4PHXA 4OFYA 5DVKA 2X05A 1ES0A 4H2CA 3GHEH 3M07A 3E8UH 5F7DB 3EIFA 3JVGC 3QUZA 3AS1A 4RCAA 4Y7MA 4ABUA 3QRGH 1DBKL 4OZIF 2AJVL 3GXFA 5D7SL 3G5XA 1O7VA 4N2EA 4HZLA 1LO2L 3TEUA 3MJ9A 3SJVB 3RFZA 2K7QA 4JHAH 1NIFA 2AABL 3F05A 4U1SB 2Q6WB 3V6OC 1IAMA 5F96H 2DIJA 3BSZA 3FYIB 3BISA 1N8ZB 2H0FA 2KMWA 1PY4A 4QTFA 1NFIA 1BBDL 1JAEA 5EIIB 4MRBA 3NVQA 1PIFA 4TXVB 1LDPH 4JKPH 2R4RH 5IV2B 3RDJA 3FSZA 3S8FB 1NUDA 3SDDB 4N85A 2IV8A 3BQVA 2O26U 3EJJX 1SJXA 2WGNB 1GW6A 3MBEB 4RBPH 5ACLA 5GXBB 1K4DB 4KFMA 2QEJA 4PP1C 5CN1A 4KO9A 5FHBL 3V7AE 5F6IB 1B4LA 1XB6A 4U2ZA 4XE5B 1Z9SA 5LXVA 1CGTA 1Q72H 4I18B 3I02B 3ZW3A 1FCCA 4HUVB 3PP4L 1TEYA 4K71B 5LXGL 2QADC 1E3FA 1VFAA 4PLNC 1AH1A 2FQFA 3HC4H 3ETBF 1G4RA 5HJDA 1Q9OB 1Y0LA 4JPIA 4JG1L 4N1CA 4G72B 1S7UA 3FQ1A 2NR6A 4N8VA 3SB3A 3SZKC 5E03A 1C12A 1BZOA 1UH2A 3JWOH 4RLDA 3K6OA 4LPYA 3Q3GA 5GGRA 3DVNA 4XMVA 4CC1A 4OCMC 5DJ6A 3S5ZA 1TTAA 1Q9LB 3FQUA 3GJEA 2LFEA 4TNGA 1T0NA 4FYTA 2P5PA 3D4CA 2A38A 2M83A 3P9MA 4P5TD 4IBUA 5JPNB 4JRXE 4MNHB 4Y2DA 4ZX3A 1L3NA 4ZD3H 2R1YA 4PJ7B 1KULA 5F8RC 1W15A 3EO1A 3EO9H 5C0CA 4UNIA 5CZVL 3P3UA 2ICWI 3CCHA 4Z3JA 3BJLA 3HBQA 2UXFA 1UOLA 1NAML 1IM9A 3ULVF 1YN7B 5IBUB 2JE8A 4ABQA 2HZHA 3QEQE 1HVXA 4NBZB 2WKOF 3ULUL 2YRZA 2BCMA 3DTDA 4G11A 2AI0H 1Q4NX 3TCXA 4NHCH 1CICB 3GPSA 3MLVL 5E1HB 4A2HA 3NSXA 1OTSC 4C8XA 2DWDA 3CFCL 1SM3L 3ZTEA 2YMOA 4X4XB 1QFWI 4C4KO 4NO5B 4AK1A 3OPZH 3PQYE 5E4AA 2Y24A 2J88L 3KBHE 2V3EA 1MCOH 3U7WL 4FG6C 3C5XA 1VACB 1HNGA 2CKBA 2QLVB 2WWKO 4LHUG 2WQRA 5D8JH 3C5JB 1PKQA 4FHJA 4JY5H 5DRXB 1Q1JH 3REVA 2B0SL 1KTJA 3MUY1 2VRQA 3UJJL 2GT9B 2J5LB 3TT3L 1SFDA 1BFTA 1JIBA 3B2VL 4FJ6A 1J1XL 2F53D 1M2OA 1PLCA 1A1MA 3PDOA 4KO7A 3PL6B 3G3LA 3O3DB 1CFTB 2IDFA 5B1JA 3RPBA 4TUJA 3C5ZA 3G6JF 3K74B 2JB5L 5AYQA 5DRWB 4IEFB 5I8EB 1HQRA 1CXLA 1RUAL 3EGDB 4DEUA 3U1SL 3QG7H 2RALA 3T0VA 1DCLA 3QYCA 1CD8A 5HBBA 4L9DA 2CALA 3FMGH 3L6FA 4C47A 4WLCA 1ZXQA 3CU1A 3PGFH 4ODHL 1YPZA 4U3SB 3JV4B 4X98B 2ARJB 5LAPA 3SDCB 2XN2A 1GS7A 4W4OA 2V2WB 2O6CA 2W07A 3OD3A 1TJXA 3FB6B 4E42A 3OHMB 1OT4A 2ZYIA 1FL6B 4Z76B 3P0GB 2NNFA 1ED3A 2IADB 43C9B 2G30A 1IBGH 1U92A 2C1PA 5CGBA 2H47C 3BLPX 3A67H 2XWEA 2FH8A 5SWZB 5C9KA 4P3DA 4GRWF 4ALAL 4ZZFA 2ZG3A 4X4ME 3EYSH 2VN5A 4WO4B 3K8MA 1QLFB 2OP4H 2QFPA 1VCBC 5ISZA 2X6UA 3UFIA 4OSUL 4FN0A 2MEJB 5KBLA 4A2EA 1GY1A 2F7RA 4UZGA 3RGHA 3QIBC 5F3FA 2QDVA 4OKVB 4HFWB 2VC2B 3RTLA 4RFEB 3KBPA 4F7CB 2YLHA 3AM8A 4PD4K 3HG4A 4N2OA 2DQGH 4MD5B 4LESA 4NC0B 4RQQB 4FAAB 5DXWA 3BUIA 5DMJB 3DETC 1OF2A 1ZANL 2WTOA 3GIZL 4MAUL 1DL7L 2IQ9H 3CFIC 1U2YA 2PXYD 4DF9A 3QUYC 1USZA 2FB4H 3WOVA 1FNEB 1O9WA 1RK1B 4LVHC 3ABLB 5ERWB 4KKBC 5G5DB 4CGUB 3V6FA 4OCRL 5EEYA 1JXJA 4PJ9C 1MVUB 5FLUA 4PRNB 2ZUQB 3ZQWA 5E1QA 3BFQG 1C16A 2FHFA 4OSUH 4TUOA 3HVDA 1RZJL 4KK9D 4WTXA 5F7NC 1UKTA 2R2HB 4FZ8L 3EYFB 5JUEL 4O4YL 4TUUA 1SUHA 2OSWA 1JF1A 3CHQA 3UTSD 5C6TL 4AVJA 2PYFB 3IU4H 2X2HA 3PWVA 4DVBA 2FCBA 5AZUA 1GC1H 2RA1A 3DMMC 5F3HB 4BZ1L 2X53A 3VH8B 3KS0H 4KK6C 4KXBA 3QZBA 3GKWL 3OAUL 3S36X 1KMGA 3AAZB 5CBAB 3QPQD 1MCFA 1PIGA 1PNCA 3CX5J 2XICA 1W0VB 1YPZF 4MVBD 4WQOA 3QUMA 2WTRB 4IQHA 4M48H 3SPGA 3FB5A 1J8HA 1TJGL 4N2FA 1WC7A 4PS4H 4X8JB 2O93L 4ENEC 2X70B 4JRYB 4L9LA 5I8KL 3AT8A 3FUMA 1KTDB 4WWNA 1EEYB 3BAIA 3FC8A 4AYFB 4HPOH 2VDOH 4U6HA 1QEWB 4EZMA 1QASA 4JE4B 5EO9B 5EF1A 1GC1C 4KDTC 5EH1A 2I60H 3EFFA 3SYCA 3GSNB 4HLZH 1R3IL 4XPFH 5KYWB 4XO3A 4PGDB 4Q0XL 1KDJA 5GS0H 3ILPA 5DJ0B 4J12A 2VJXA 5IK3B 1ORQA 5IB5A 4OCYL 3VI3A 5IESH 4G9FE 2XBZA 3L5WA 5A1AA 1GZPB 1WITA 1SOQA 1RUMH 3C5SA 1D6VL 4GAGL 4XXCA 1G0DA 3HG5A 3QISA 3W9DB 5EA0H 3C60A 1T1ZA 1LEKA 3LPGA 5HI4C 4MXVE 5JR1L 4KI5C 3MGTA 4GMTL 4WW2A 2EH8L 4M93C 4ZMAT 1FVDA 1IB5A 5INCA 2YD9A 3OC8A 5AB9A 5D4JA 3ATEA 4GOSA 3HE6B 1TCRA 1PGRB 2BVQA 5FOJA 1AG6A 3HNSL 3SKOA 2X38A 3TS8A 2DM3A 3QJOA 3T6WA 4NQDD 4AEIL 2IV9A 4KI5F 2NX5D 5KVEH 3HUJF 2G75B 3BPNC 3VI4B 3GSNA 4QT5A 1MCWW 2VISB 3VX1A 3BRDA 1QWUA 4XN7A 3B7SA 3OHXB 1OE1A 3KEHA 4GI6A 3LEYL 3MNZB 3NIFE 3UYRL 5KWYC 4R84A 4XVJL 4J3OG 4RNRA 4P46B 2E9IA 4PRDA 4PN6A 3LPOA 2NY7L 1OCRB 2EYSB 1W72L 3KGRA 1JZ4A 1G7HB 4HWBL 4KOBA 4ZW8A 2YPKA 5GZOD 1QPXA 1CYXA 5I6XC 5A3IC 3OWEA 4BCXA 4N28A 3RL1B 1Z3GH 3IJEB 3WHE1 3H3PH 4C56E 1QBAA 2I9LB 1S7TA 2Z93B 4F3FA 4Y0GA 1BZ9A 4JFDE 1G84A 3LKNB 2ATPA 3TTYA 4Z78B 1NUNB 3D51A 1CT8B 1VFUA 3KM2A 4HUCA 1XSIA 2EKSA 2JLLA 4ODWA 2I7SA 4PG2C 5DJZA 3NACH 1TZHB 3MRJA 4PJAE 4DN4L 4EI0A 1BSIA 4HQQH 5HY9A 3UDWC 3VGFA 4OGAD 5ADPL 5HI5C 5I6LA 3T65B 3IU3A 1W8OA 3S48A 1UOKA 2J3SA 3HZKA 2DDQH 5IW1A 1MUJA 5HJ3A 5HPMA 4NC2B 4TNFA 5L0QB 2EYSA 3G9AB 3MFFB 4M93B 2JELL 2N56A 1K4CB 4G70B 2F5BH 4TF4A 4Y1SA 4BRJA 5AG9A 4N9GA 3RPIA 1U33A 3DX3A 2B16A 3BYTA 4HCRL 1QBLH 2ALAA 2DYRB 3R06A 2V4LA 2LW3A 3GJFK 4M6ML 2XY1A 2QELA 3KPSA 4A68A 4CDHA 4DGYH 3FU9A 4HU2A 1ONQB 1OTUD 1ZSDB 4IKLA 4R7DB 4X6CA 1TXKA 2E9GA 3QW9A 1J0ZA 5FKAA 3RAJH 3RZWA 4WDIA 1KCWA 1JI2A 3T4AC 1L6PA 4RAHA 5K1JA 2NDFA 3H3BC 3O2DA 1MI5A 4OIIL 3FU5A 3LN5A 4ZAKC 4MB3A 1E2VA 2G5BA 3C8KB 2MHAA 2BMKA 3ZGHA 1NIBA 4JG0L 4UDTA 1I9JH 1ZK9A 4OCWL 4XN8A 2G0KA 1HSAA 1KXQA 1RZ7H 5B39B 2ESVB 4WF7A 1WA1X 4RA3A 3FCBA 2APWA 5HTSA 1QRNA 3QUXB 2YGNA 1Z0NA 4ALAC 3GMNB 2EABA 5SX5K 3RU8H 4QLRA 3HRPA 4N0UB 3ZHKA 3L5WB 4EXPX 4Y2OA 4XVTH 3BEWB 4V33A 1OAXH 1HQRB 5L88H 3QQ3B 4Z1PA 4FOMA 5AVWB 4Z3GA 1NCBH 4AENB 5CGTA 4I0PA 2VDRH 3V4PL 1MY7A 3Q6GH 3FUHA 4XCCL 3WIAA 2XG4B 3G04B 4E0RA 1PJ9A 2ZKYA 4HFUL 4JDEB 1TEFA 2J4WH 3ARDD 3VCLA 4JB9L 1VFBA 4GXUN 3FRUB 1CF1A 3V6BR 3UO8B 5T3ZD 6FABL 4JFOB 5IKCB 1ETJA 3FU7B 2VLLB 2VZ3A 3EBGA 5E94A 5MHSE 1YJDL 4XE0A 1I4FA 5A16A 4FXTA 3HE7B 3FULA 3GBLA 4ADIA 4Y4FA 3WN5C 4PYHA 1W8NA 3MVSA 3N42B 5HVFB 3V5KA 3ZR6A 4K94L 1TMQA 4BELD 1BVLA 4H8HA 1CBVL 1YHPA 2FJGB 2ZT9C 4L4VE 5T1MB 3MRLB 5IR1B 5CIPH 4L4VD 1E6OL 1E8WA 4U1IB 2OMXB 4AQEA 4GS7C 4GQ9H 5JUEH 5DD3H 4LCCB 4Z18A 4HWZA 4M5SA 5KOVC 2YAFA 3CVHA 4BQ8A 2FIRT 3I6LE 4E41D 4G8GE 5I16A 1T6VN 5I8OL 1YA5A 2QR0B 1Q0XH 1XF5A 4U4IA 5J9PB 1T7VA 1FNEA 1JVOA 2ODIA 3MOQA 4A7SA 3P0YH 5E8NA 1S7TB 2Z93A 2E9BA 3NJGA 3T3ME 3HA0A 2PABA 2CDGA 3ZE1E 1SVCP 5DVPA 2K1MA 5SWSE 1SPDA 2F54A 3APMA 5IG7A 4G1MB 2YPKB 5FV1L 5F7MC 1F4YH 2E76C 1MELA 3TN0B 4F8PA 5C0FA 1G7HA 2KT6A 4KMTL 4NLAA 3CDYA 1DJWA 4PPTA 3RRQA 2BVPA 4DK3A 2QQNH 3FU7A 1UM4H 5C7XL 2NY3D 3PXJA 3B6SB 5JHLL 1DN2A 4AW7A 1G1OA 4XXWC 2K7PA 4M43H 5DK3A 4OVVA 4AQ1B 3BGMA 2NY6C 1NL0L 2E74C 3FTWA 5F70A 1QWHA 3LAFA 1CLYL 3IYLW 2VABB 1M4KA 1U8OB 3NABL 2E27H 3V6ZB 3VNZA 3QIUC 5FGSA 1E27A 1T89A 4Z76A 3FU3A 4ZTEA 3KR3H 1DJXA 4HSQA 1G0XA 2UXVA 4NKDB 2NQCA 1HT6A 4NUGH 1D5ZA 1AR1B 2BS9A 3HN3A 4MS8C 5L2KE 1RZGB 2XJLA 4A38A 4LKCB 4MS6A 3RWGB 1MIMH 3IFNH 3HE7A 3PY9A 4NIYE 4XNZB 5T1LA 2Y6SD 4APQB 1SXAA 5B8CC 4PJBA 3WMPA 1UJTA 5I6NA 1UM4L 5C7XH 1X3DA 4Q6IA 4YZFE 5FYLL 1PEZA 4JN1H 3O2DL 4ODUB 1RPKA 3NCWA 4AH2B 2NY6D