2YLKA

Carbohydrate-binding module cbm3b from the cellulosomal cellobiohydrolase 9a from clostridium thermocellum
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
145
structure length
145
Chain Sequence
MDVKVQYLCENTQTSQQEIKGKFNIVNTGNRDYSLKDIVLRYYFTKEHNSQLQFICYYTPIGSGNLIPSFGGSGDEHYLQLEFKDVKLPAGGQTGEIQFVIRYADNSFHDQSNDYSFDPTIKAFQDYGKVTLYKNGELVWGTPPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Single Mutation Reforms the Binding Activity of an Adhesion-Deficient Family 3 Carbohydrate-Binding Module
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
molecule keywords CELLULOSE 1,4-BETA-CELLOBIOSIDASE
total genus 36
structure length 145
sequence length 145
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.91: Cellulose 1,4-beta-cellobiosidase (non-reducing end).
pdb deposition date 2011-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00942 CBM_3 Cellulose binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.710 Mainly Beta Sandwich Immunoglobulin-like Endoglucanase-like 2ylkA00
4B97A 3ZQXA 1K72A 1NBCA 1GA2A 4B9FA 4B9CA 3ZUCA 4B96A 1TF4A 2WOBA 2WO4A 4JO5A 2YLKA 2XFGB 4TF4A 2XBTA 4B9PA 1G87A 1G43A 1KFGA 2WNXA 3ZU8A 3TF4A 3ZQWA 1JS4A 2L8AA 4C8XA
chains in the Genus database with same CATH superfamily
3H85A 3VI4F 4XZUB 2WPGA 4DP9X 2AANA 4FQHB 4DKEL 4U1SB 1WA1X 3DURA 1CF8H 4N5EC 3H9YA 1J0YA 43CAA 2C9SA 3P9MA 2CNZA 1LE9A 5IBLC 4OKVA 3QO1B 1TSRA 2FBJL 5SWSE 1J1PH 1T89A 1CLVA 1NCDH 1EAPA 5JIDA 5AAMA 1AZVA 3BW9B 2FQDA 4HV8A 1P7QB 2V5MA 4LPWA 5J1SC 3H9SB 3T0WA 5FC9A 4DUVA 1AOHA 4PR5A 2HKFH 1B4RA 2D03L 1K4DB 2IDFA 3ECWA 3L7EA 4QY8A 5LB1A 3OAWA 2DBLL 1GGTA 2EIZB 1WK0A 5ACZA 2YXMA 4Y5VB 4CC1A 2AJXL 2NW2B 4X4MA 2AEPH 2E3VA 1XF3B 3IXTB 3VXOA 1EDYA 5C0EB 1TTUA 2HTLC 35C8H 3H3KA 1AZBA 2UX6A 4GO8A 2CIIB 2PABA 1MJUH 2BW4A 5DLLA 2DQTH 3H9SE 1BBJB 5TPWH 3MROB 4NJ9H 2R23A 3F7QA 4ELMF 2EAEA 4LL9A 1DQDL 2J8UB 4NZJA 3QJTB 4OCYH 3S8GB 4RSYA 2DF3A 4PV9B 3T3ME 4YX2H 2KPWA 4AUYA 2HVKA 3GJFH 3KXFE 3FUFA 4A7UA 3CFKA 4UT6A 4BWWA 1N64H 1XF5A 3MLPA 1N19A 3PL6A 3TPUB 1RERA 2P5EB 5MERA 4FXKB 1ZS2A 4YSUA 2IQAA 1V3MA 1C8PA 3KPQB 1XB3A 3L95A 3WS3A 3VXRE 4Z78B 4ONHA 2WZPD 1EHXA 3D51A 3TEUA 1OAYH 3RA7H 1VHPA 3GI9H 5HI4C 2VE6B 4GIPD 2A74C 2F53D 5IHLB 3WJLA 2N7AA 1JE6A 3US0A 1V7ML 3HVDA 4TULL 4YEFA 2YKKA 2GYSA 2XN9B 2Z93B 3PAYA 1UC6A 2Z6FA 4N2BA 4XXCA 2CO6A 1OXYA 1ZSDB 4OF5A 2NT1A 1N8ZB 3FFCB 1YNLL 3BJLA 1FA4A 5A2KH 2EDBA 2FX9L 4TLUA 3T0DA 1UUNA 1YSOA 3SBRA 1FNSL 1JXGA 2LFEA 3N55A 4Y4HD 4XMKL 1QOKA 4HKBB 1KIQA 3CFJA 5DQJA 3NGBC 5JPNC 1Y1UA 2UV3A 4K0OA 3RY6C 1B2WL 2WYTA 3AU1A 5E08H 1RUKH 2H6UA 4ADIA 1NC2B 3BKJH 2WNXA 2ZWSA 1LJMA 3GUFA 5KTEL 4QRPD 2YS4A 2EC8A 1XZWA 4NC1E 4JCWA 4Z76B 2NXZD 4NGHL 3U9WA 2ZCHH 1TTAA 2X9XA 1C12B 1YAIA 2PWGA 3LD8C 3DBXB 4X5XA 2E7LA 4F8PA 3LS5H 3ISWA 4F2MB 2DAVA 1GHFL 1YQ2A 4HWZB 3BPNC 1BF2A 4AVHA 2DICA 1DJSA 1LEKA 3VI3B 1SXAA 5AB1A 2KQNA 1EEZB 3OMZA 5TDOA 3S97C 5FO8B 3ZE2F 3FOMB 3BH9B 4BH8A 2BWQA 3V4PL 3IGLA 3FW6A 1GH7A 1AGDA 3VFPA 2WBJB 1FO0L 3EH4B 3MJ9A 1XAUA 4PH8A 3ME0A 3G6DL 1OAZL 1QSFA 1FC2D 5GZNC 1KCVH 4OSUL 1R3HA 2F08A 3QG7L 4PCYA 4NKIL 3STZA 3RDTB 1GOGA 3L5JA 3OAYK 4N68A 4IBVA 5C0BE 1MW0A 3QQ3B 1UYWH 4PLKC 5JIQA 3PDGA 2GJJA 2ORBL 4JFZH 4MAYB 3V6OA 3NA4A 3VXSA 3L3KA 4OIIL 2D4DA 1JDDA 2W9LA 1WZMA 3UZEA 5DD5L 3QWRA 5F7EL 2EEFA 4X5WA 2RFXA 3H3PH 3QHZH 5CCKH 3GI8L 3N85L 3S37L 4OJCA 4XMWA 3FO9A 5DDHB 1DJGA 5AEAA 4ZUVA 3OZLA 1IX2A 4PW9A 2E47A 4D0CA 3O11A 4U4IA 4HH8A 2J5LB 4P23D 2VIRB 5IQLA 1G87A 3M1BB 5BO0D 4QOKE 5IW6B 4P3CL 3HZ3A 1LO0H 4TM9A 2BZDA 1KXVC 3RNKB 2ZUUA 5JUEL 1E2ZA 3E6FA 3MLXH 3MREA 1I9RL 5CMAB 4R5VA 2ZICA 1A7NL 4OIBA 3A23A 5FYLH 4E5XB 2WZAA 3O6LH 2RAMA 4AVJA 4OZGE 1AFVL 3CN2A 5E2WH 3NZUA 1A3RL 1OCCB 2AJSH 3L3HB 4RGND 2QPDB 4IOFD 4BK4A 4FLOA 1N2RA 4K71C 1BPVA 5TQ0H 1HDMA 3ARZA 3D39B 3QAZC 4NZTL 2WXLA 1QTYT 5F7MC 1JNNL 1ORSA 1BD2A 5MI0C 4XRCA 4YE4L 1MELA 2EQDA 3OKLB 3S98A 3GLZA 3EFFA 4L29B 1RP9A 3KW7A 4POUB 5DMKA 4N86A 4V11A 1HL9A 1N8ZA 3FFCA 2VWEC 4A68A 1MNUH 2VDLL 1WTGT 3EDDA 4Z3HA 3ZTNL 4OZIE 3GIVA 3WTYA 3SQBB 3CJJA 3AGVA 5DUPL 5GSRA 1I7RB 2BSDA 4NAQA 5CBEA 3FC8A 4ZS6D 1NCTA 3DHPA 4S1RH 3BT2L 4YHLH 3O0RH 3UCRA 1ID5I 1SRDA 3CIAA 4L9DA 2IFFH 2FD6L 3C5SB 4JJOA 5EN2B 5B38G 2CR0A 5C0FB 2EKSB 3D85D 5FM4A 2NQ3A 2C5DC 4Q9BA 3HI5L 4PJ7E 1KDJA 2G9HB 2XZZA 1FNEA 1BQLL 3DOHA 4P4KB 3P4OB 1R19A 2PP7A 4U6TA 3A6BH 3FTYA 1KLUB 5T1LB 5AW9B 3WOVA 2EDYA 3VXPA 2DWEA 4ONFH 5EOQH 1VCBC 2HXAA 2OJEB 3W9DA 1G5GA 3PQYA 4QNPF 4ZDHA 4OCRH 1IZJA 1A7PL 4FA8A 2IXQB 1ILSA 1RD6A 3HN8A 5DJZB 1WHOA 1FSKC 43C9B 2H2SD 4MB4A 1E4XI 4PS4L 2F8OA 5D8JL 3ETBJ 5AYUH 4Y9GA 3MUY1 4I18A 5KJRH 4WHDA 2Y2TA 3UPCA 4EI5B 1HHIA 3CFCL 2XWEA 4EEEA 2BPBA 5GJSH 4P2AA 5LAXA 1MJ7H 5C0DB 2QADD 4XMXA 2LU5A 3MGOA 3IPBA 4NKOA 3PWJB 1SJVA 4PREB 2QV2A 3ARDA 1U3HA 4JPKL 3QFJD 4NUMA 1BAWA 3RVUC 3UAAA 4N1EA 3V0DA 4HZLB 1TITA 3HVNA 4AGLA 4G8GE 4QTHA 1NEUA 3OZ9L 5EO0B 2LU3A 3SZ6A 4I3GA 4TL4A 4ZMXA 3FQNA 3ZVVA 3CFMA 3D52A 1D6EA 3MRPA 3TT3L 5ADPL 2NY3B 5E9DE 5CINH 3LH2L 3RGVC 1L9TA 1KYAA 4X7SH 2O6EA 3EYVB 3EYSL 1BCIA 2YBRA 2WZPA 2HB0A 1ML0A 2JI2A 1BX2A 4X5LA 4OLYL 2WWKO 2DMKA 2EE3A 3WFZA 2EH8L 3MLRL 3BAEL 4PJBE 4AUJA 1NGWB 3V0WL 1MCOH 3QW9A 1IVTA 3NEXA 4UIMB 3N04A 1XCWA 1CFVH 1BVKB 4MQXC 2EXTA 1UXSA 3DV4B 1TSHA 4E5XA 4CU7A 3L5IA 1N6VA 5AOJA 2BSSA 4U7SA 1E9QA 2WLZA 4IKKA 4JPQA 5ALBH 4OGXH 2RA1A 3BZFA 1WFUA 2X41A 1V7NH 1Z9SA 2VRAA 3HAEG 4U6XB 5D55A 3ERXA 3NQIA 3RAJL 2PW1A 2DH3A 4YC2C 3DX9B 1THAA 4GSXA 4OUUB 1S9YA 1G7HB 5D7SH 2AHIA 1Y6NR 4XWOC 4CNIA 4Z7NB 5KVGH 2YAEA 3BVWA 4JM0A 1F11A 3QJHA 1FHGA 3OG4B 4ZW5A 5I6XB 5GXBB 1S7SB 1BOYA 5J6SA 2LV4A 5D9SB 3VSTA 5F2FA 4XMUA 2J20A 5GS2H 4LDCA 4N0CD 4FULA 4K5OA 3O45A 3BUIA 3BPOC 3WXVL 3GEWB 1A47A 2X3CA 3BEVB 2EUZA 1YPZA 3LKPB 2FJSA 1S7TB 2BOCA 1EZVX 1KYDA 4CN4A 1A1MB 1ZVSA 2BXZA 1G6RA 4W4OC 1H9VA 4XPGH 2HT2C 1YUHA 3DURB 5E7BA 5F93C 2O6FA 2V9RA 2XPGA 3SPVB 3TIDB 5F7FA 3LJ3A 1QTSA 4D0DA 1USQA 2XRAH 2XBDA 3MRKB 2Y3NA 3B34A 4WI2A 3D4GA 5A2FA 2J6EA 3QH3B 2ARJB 2BHFA 3FCGA 4NXKA 2Z7ZA 5C09E 4XAKD 3SO3C 4J2XA 2ZXBA 4IIQB 4OGYH 4C4UA 3S3CB 4W4NA 1RK7A 1Q94B 2W65A 4FKHA 4G6FB 3NACL 3KLAB 4PIRF 5INDB 2AQNA 3MRJA 4PG2A 3C9NA 2E4TA 3NN8A 1NC4A 3BH8B 4X8JB 5IB3B 3W5NA 4U4BA 3WS6A 3QIBA 4GI6A 1TF4A 4PM1A 3IU4L 1O0VA 4MCZB 4MJID 4TS6A 1ZXKA 1F6FB 2XG5A 5CWSA 4X2UA 5TE4H 4EN2A 3BN9D 1J0ZA 4RGOL 4WJG3 4FAAB 4R4FL 3NIDF 2PTTA 2IH8A 1HEHC 1MWOA 3NQKA 1M53A 5C0IB 4W9IC 3NCFB 2DQDL 1BM3L 1YJDH 3E7JA 1P6FA 2KERA 4L0PB 1UXMA 2JXMA 1E0OB 3VFNB 4NBYB 2AXJA 4YSAA 2XTJB 2H1PL 5KEZA 5E2TL 5M94B 1DBAH 5D1XB 3U7WH 5JHDD 3MNZB 2MOQA 5E6YA 4PB9H 5KVGE 4HUVA 1DYZA 3RJDA 2ISDA 3HS0A 5E7FA 3TZVD 1MRFL 2OSLA 3HLAA 4TNWK 4A63A 4R5XA 3RYMA 5I1KH 4BSJA 2HKFL 3UYOD 4J4PC 5D6DA 4HJ1A 4J3OD 1YN6B 4PGDB 3I50L 3CVCA 1I9JL 2CMRH 4L3EA 4N1CA 4P57A 5D2LA 2VGLM 4J3WA 2G60L 1BEYL 2Q7YA 1NL0H 1AIFB 4KZEL 1FIGH 1M1SA 1X7QA 3D2UA 3KCWA 4Y2DB 5E8OB 5SWSB 2NZIA 3SKOA 5KVDL 5D7JA 5F7DB 1AO7B 1BXUA 4KKQA 4LF3A 3ZSTA 3S88L 2NPLX 3B2MA 4UQBA 2FWSA 3RGHA 4LSSL 3KEDA 3NIFF 4DPAX 4CKVX 3IDYC 1RMFH 4IEFA 2VUYA 4KTEL 1HH6A 4XGZB 3SJVA 2CALA 1KIQB 5DQJB 1CFNB 1BYPA 1KGYE 1K8DA 4Z7WE 1E27B 4JY6B 4Q97A 4KKBD 5CD5D 5HHXH 5KYXA 2UWEA 4TPRH 1J86A 1H3GA 2Q8AH 3FO0H 4FTVD 5DHVB 5AD0B 2OW6A 1H3WM 2AAAA 1CLYL 4RFOH 1RIVH 2DLEA 2AQ2A 3LHPH 3SE3A 1LILA 4LHUG 5AZUA 4LLDA 3P3SA 4JNXA 4XMKH 1ES0B 2Q1EA 2XYCA 4LLYB 3DXAB 3WHE0 3JWOC 5TE6L 2TAAA 2VUOA 5BXFB 5K1JA 5TE7H 1C7SA 3WG7B 1UJ3C 3IDNA 2PR9A 2YAFA 1BDYA 3GJFK 5ESQA 1I1FA 3IYLW 2CIIA 4B7LA 4XCEA 5JW3H 35C8L 4HIQA 4NKQB 3QS3A 5FB8B 1QFWH 5FIEA 2NNCA 1PY0A 3CLFL 1P9MC 4QHNB 4XPTH 1BQUA 3K80A 1HS6A 1LWHA 2F5AH 4XP1L 1BZ7A 2YA2A 4BFJA 2B2XL 1IL1A 1YEDB 3BUYA 4XN8A 3SD5A 1A0QL 3EOBB 3W81A 2Z92B 3VYNA 5CGTA 3ARDB 1WBXB 2JJUA 4ZXBA 1RURH 3VWKA 4C55A 3O6FB 4P46C 4BGLA 1E3XA 3VB8A 3WNMA 5I8CB 4LRNL 4AM0B 1R34A 4BK8A 2RACA 4AENB 1J12A 1E65A 1Z2KA 3ULVE 3IKCB 1NFDB 3HZKB 3HJ0A 3HC3L 3NSXA 5FA3A 4QJ4B 2XG5B 2VDRL 4AGOA 4H1LA 5DUMH 1FGVH 3QPXL 1N4XH 1F4XH 3O2WL 4YDLB 1LK2B 2R56L 2E74C 3QWNA 2EC9U 1QKZH 3TNNB 5I8EA 4ZFOA 4GO6B 4ZUVB 4D0CB 3CTTA 4WSKA 1ZT7B 4MFHA 3BD3A 2WUCL 3DPBB 3I6LD 2OSXA 2AXFB 4LSDA 4Z7VE 1A66A 2AK4B 5JW4Q 2HUHA 2WQ8A 3HC4H 2CO4A 4M1CD 4S1SL 2A73B 2NY2D 5DUPH 5DJAA 3GI8H 4LCWB 4LKXA 3F5WB 4ZFQA 1HAUA 5FLUA 5CJXA 4OBSA 3F83A 4ZFFA 1QRND 1MHEB 1IAIL 2E9GA 4RGMC 4X4ME 1OLLA 3ARGD 3QEQD 2FH8A 4U1JB 1AYRA 4XOAA 4N2LA 4E0RB 4K7PH 1TVHB 3GTNA 3EOYG 4P57B 5IBUG 3GXPA 3GHEH 4CUCA 1ZLVH 1WIUA 3IF1B 2BIIA 2WXIA 4J8RB 1TNMA 2W0LA 2LHAA 4KHXL 4TN9A 3N9GH 5E2WL 1G7JB 3LS5L 2EXWC 3QJHB 1MFBL 4TQ8A 4YOKA 2ZONA 4UT9A 1OCWL 3BSZH 4Z7WF 2DQMA 4KY2A 2YLKA 4J1UA 2ZOLB 5L4JA 1OW0A 3WFBH 3LSOA 5ICZA 2CLRA 1LYQA 5CIPA 3ZT6A 3DX7A 3BKJL 1L9MA 4MCMA 2UWEB 3T0BA 4GG6F 1OOAA 1B2YA 3AG3B 1YA5A 1ZVSB 2YXFA 5JA9A 1G9NC 4FYSA 2CZNA 4K9EH 4Y19A 2MIZA 1I1AC 4NFCA 3TBTA 3V4UH 4MA7L 5E5RB 2VO5A 2Q86A 2V7HB 4X0KB 2VLRB 3EO0A 2GJ6D 5GHWH 5F8QC 5DWPA 4AT6B 4Z3EA 2HLFC 3S3DB 4OQTL 1JWUA 5AYQA 1X5XA 1XF2B 4KKLD 2ZUWA 1F41A 3U0PB 1W6WA 4ATWA 1INEL 3MODL 1JDCA 5DFVD 6PCYA 4F58H 1KN4L 3NJXA 1ODUA 3MRJB 1RSYA 5BQ7B 3GMMB 4UZUA 4PRNA 4D9LH 2VABB 3DO4A 1Q38A 1LMIA 5EBLA 3ZKXB 2F8XC 4WWKC 5F3FA 5KYUB 4X4KA 2DYSB 3QIBD 2VE6A 1XR8B 4U1HB 1AXTH 4BJLA 2NT0A 3KPRA 4J4PD 2IC2A 3HNTH 1U8MA 4EI6B 4OF7A 4FG0A 2O5YH 2J7LA 1DVFC 3L4WA 3ARBA 4KH2A 4HU2A 4OAWA 4YPGB 1A3ZA 3EJCA 2PO6B 2BVUA 4KMTL 3MREB 2YPLA 4IKIA 3RFZC 3WKNA 4AM0A 4IJTA 1PY9A 4FHJA 3IKCA 1RK0B 2XCMC 3X3FH 3FUEA 4H7VA 4B9FA 2QPEB 4A7GF 4KV5F 1FDLL 1BQHG 4NS0A 4H1LB 2C9XA 2QFRA 1SYVB 4NQXB 3LXUX 3S2CA 3MKGA 3VFMB 3WY3A 2C7UA 4A7GA 3SDYH 4NCDA 2WOBA 1UZGA 3CVHH 3AM8A 4HFUL 1QUNA 1XBRA 3BP5B 4DN3L 4JN1L 4HIJA 3SYQA 4CSTA 1KT2A 2AJZA 5I66B 3CZNA 1IBBA 3SBWA 1HE8A 1XCQA 4I0PB 5DYOB 4FMVA 1QFHA 4WV1B 4BUHA 4HWZA 2FUQA 1E3FA 2J21A 4ZUWB 3WY4A 4A2FA 2ODIA 3ROOA 4TVPH 3QZWA 4W6YB 4CVZA 4PRID 3S36H 2GCYB 3FJTA 4HC1L 3VXUB 3CFIC 3ULUE 1A1OA 5AUMB 2J8OA 3ARFA 4PWKA 5JPMC 5GGUB 3DIDA 4JFQA 4E0RA 2IVFC 3P9MB 5HYEA 1SJEB 2WLKA 3GTTA 4HEMA 4PMFA 4U0RC 3APMA 5B3SB 8FABA 1CDHA 1QUPA 1SDDA 2A6DB 2YXVA 5I73B 1S9YB 2IWEA 4PJ5B 2JE8A 2XYBA 1IQWL 4IGBB 3LPWA 1FLTX 3M8OL 2R4RH 4DKFL 2AEWA 5I18H 1IKNA 1MVUB 2VR8A 3ML8A 4FKEA 5GRVL 2AAVA 4PW3A 3P9LB 2D0FA 3U46A 1GXEA 1RJZA 2EECA 3ARGB 3O6KH 3QDJD 3IMSA 3CUPB 3B9EA 1C7TA 2WTRA 3BAIA 1V8HA 1EZVY 1JNLL 4FQIH 5C0AE 5I23A 3D0VB 1GTNA 3ABZA 3WJMA 5E5LA 2X5PA 4RETB 2NUTB 3O41A 1PBYA 2J73A 4C57C 5CZVL 2IIJA 5GGTA 3BHBA 2YSTA 1T4WA 2KZBA 1VPOL 3MROA 3CXHJ 4O2CA 5KSAA 3WFEH 3AY2A 2PPDA 1F4WL 5H8DA 4YZWA 3CD4A 1LNUB 3V0JA 2E9JA 3S5LB 1EFXB 2OP4L 2ZPKH 4N0UB 1KWGA 4KI5C 3QQDA 1CGSH 1E4XL 3ZZ1A 2CXGA 3ULUD 1NSNL 4P5MA 2FBRA 5JOFB 4I77L 3V7AG 4HG4K 3GIZL 1KTJA 1WIOA 3NBNA 3TEXA 2CBOA 2X4OA 1M7IA 4RESB 1ZIAA 3SBQA 3T2NH 5T5FH 5G5DB 4XBGA 2NXYD 2AS5M 1NGQH 2P5EA 5MERB 3TO2B 3MA7A 4XNBA 4JFED 2ZKHH 5F6IB 3MACH 1K6QH 4QMEA 1CTMA 1L9NA 4C4BA 5E8DL 1R24A 2ZXGA 4JFHE 4S2SB 3IDXH 2OTUB 2QGCA 3HG1E 1LQSR 3F7YA 3OMIB 4KGLA 3KH3A 4GQQA 5GS0C 2BP0A 4ADGA 2MNWA 2OMXA 4Y1TA 1CN4A 3TEZA 1RURL 4HIIA 4C47A 2CMRL 4BQCA 4K3GA 3DMMC 3QG7H 4U3XA 3KL3A 5GGRY 4QRSA 2YHGA 3WTXA 2YPLE 4QRPA 1SGKA 1DFBL 2F15A 2I07A 3ILEA 4DESA 3SIKA 1GGCL 4PGZA 5DGRA 3SZKC 3CNKA 1V10A 4PJIE 1IBFA 4LVOC 2IWFA 4LEOA 4LLUB 4MD0A 1L9SA 2HJFB 4PI2A 2IFFL 1S9WA 5T5NG 4G8EA 4H4NA 5IM7B 3F12A 3HRZA 2XN0A 4UZSA 4DGIL 4QXTA 1I8MB 3MZTA 2YSSB 4LKCB 1ZHKB 1AQKH 3V9EA 2Z34A 1IT9H 1KTKE 2PYFB 2VQ1B 4U1IA 4F37F 1TENA 3QORD 2FNWA 4PJXB 2NR6C 4U1SA 4PGJA 1R46A 3A6OA 1G4RA 3S4SG 3TN0D 1ACYL 2EKSA 3C87A 3ZHLA 1PU0A 1MRFH 2B08A 3CE1A 3CZJA 1BQHB 3GMRB 4G1EA 4CVXB 5KYWA 5BS0E 5JOPE 1U21A 2VB5A 3VXRB 2WLYA 1IAII 5G55A 3V6OC 5F7DA 3BEWA 4JDTL 5B8CC 1IC7L 4NUGH 4RBPH 5TDOB 4DEWA 4ADJA 4K7PX 4LDLB 1XSIA 4HEME 4IOSA 1A6TB 2EEDA 5DR5L 3ZMEA 5JPMA 3PL6D 5BRPA 4HISA 4PLNC 2DKUA 5AOLA 1XBDA 4RWHA 1TQBC 4OGXL 4A2EA 4AG4L 2ED7A 4JPKH 2JKJA 1D5IL 2PPFA 4HFWB 4JGUA 4XBMA 1YUHB 3POCA 4XI5D 1ADQH 4L8DB 4WLCA 2V2TB 4R8WH 4FF9A 1X3DA 1A6VH 2ZSWB 3EADA 3PXJA 4HOZA 1LQBC 3QHFH 4GW4B 5EIIA 1PIFA 1AD0B 3GSNA 3T4AC 1BMWA 4QRRA 1PAMA 4UOQA 3EJZC 2HRHA 5A2IH 2B4CC 3FXIC 3RY4A 3SKMB 3I84A 2Y5TA 3DX8A 1HOCA 3L3GA 4HJ0D 5HHXL 1IFHH 3GRWH 3ZL2A 2Y7OA 1HZHL 1TR7A 2OSWA 4NPYB 5HP5A 4KJPD 3EYSH 5ECGA 1ZD6A 2K78A 4ONGL 2CWRA 3WKQA 4F7TA 2DLFH 3ZYIA 5E0FA 2F7RA 1UXWA 1HI6A 4HT1L 4NRYB 2B77A 3I3DA 1VFBB 3QWRD 4F7CB 3P40A 5KUKA 2ZKYA 3KMDA 2A6KB 1SHWA 3CFTA 5I75C 1G6VK 3VRIB 4QJ3B 4RMVA 3A67L 5J13C 1HTYA 2FEEL 2C3XA 4FNSA 4Y2OB 2WIMA 3E8UL 2VDQL 3VG9B 4C56B 1UA6L 4RGNC 2VH5H 2DTMH 3P3YA 5T1DL 3VM5A 4F3FB 3WN5C 1W16A 3HTLX 3M1BA 1KNOA 5E99L 2HP4A 2ILLA 4QHKI 3ORJA 2GB2A 1B9KA 2DQHH 3MNZA 1N5YL 4M61B 3VSVA 2AZUA 2X10A 3RGVB 3SPCA 1ED3A 3QT2A 5F6HJ 1ZGLB 2WSKA 3BP7A 5JOPD 5I28A 1QSFD 4GOSA 2ZYRA 2E7CA 4X80L 4DW2L 3QUXC 3N0AA 1Q9WB 5B7EA 3DVGB 1S78C 1P5UC 3GK8H 3B5GA 4JY5H 5JQ6H 1DBBL 2QT6A 2JKTM 1NUNB 2EEAA 3LH8A 3MBWB 4GAYA 2I26N 3OX8B 3QEHB 4LHUD 5K9QG 3HC3H 3DTUB 4XVSL 4LCWE 4HPOL 4F91B 1AY1H 3D9AL 3H9HB 5DA0B 1S9XB 4M3JA 1UADC 1SUHA 2EDOA 5F7AA 3LRHA 2BO0A 4EJ1C 2WGNB 2MSPA 4U1MA 4WJ5B 4KZDH 5IBLD 1QKZL 3QZWB 5IEKA 2AQPA 3A4DA 3PWPE 4YLBA 5HD8C 1KGCE 3IT8D 1NCWH 2R0KH 1KZQA 3P0VH 3NABH 3VGGA 3QJRB 3RWGB 2NY4B 1EZSA 1F3JB 3UGXA 4DZBA 4PJ9D 3BLKA 5AOIA 4NERA 4BFOA 1AANA 2UYLA 4KKCC 4WTQA 4XBPB 2X9ZA 4KUCF 5IK3A 2JJSA 1N5AA 2BM3A 1CDBA 3FQWA 3QEUB 5AVYB 1RUQH 4OLVH 1MUJB 1OTUC 5TE7L 4L0YA 2QELA 3C2AH 5E2UH 2IQAB 4YFEA 1GVIA 3BOVA 3PRZA 5AB9A 4OZGA 2V9UA 1PEWA 3O81A 1NBVL 5EZPA 4P2OD 1BVNP 3HCVA 4YBLC 1LDPH 3BX7C 3WNLA 4LPTA 4KJWD 1F0LA 1GC1L 4G6AD 1EXHA 1SOKA 1TDQA 2Y22A 1AXSB 2VQUA 1GJWA 1GA2A 3NCYS 4FXGB 3EDKA 5DVMA 2PCFB 2JELH 1MSPA 3KVQA 4AYFB 5IVZA 3TVMD 1OGPA 2F1EA 2YGVA 4X6FB 2WXNA 5FYKL 1MF2L 3MGOB 2M1KA 4ZAKC 1FH5H 3FMGH 3LZOA 2Y5TB 5DVPA 1TJGH 2J1KA 3B56A 2NQCA 4P4RB 3IPFA 3P11L 5DD1H 1VGKB 4HPYH 1NGXA 1WSST 4I0PC 4DK3A 3CXFA 5HGAA 1MLBB 3I75B 3GSVB 4GKZB 1XH3B 5SV4A 5EN3A 4YDKL 3BKYH 5D2NB 3AM8C 4RBPK 4MVBC 1BLNA 1J0JA 1NL0L 3PUUA 4QLWA 1YEIH 4F7CA 5DD0H 2Y2WA 1IEHA 1EVUA 1YN6A 4PGDA 1A9EA 1HCZA 3TH3T 3UZQB 3FSAA 2O6PA 5CGBA 5MEND 4AEEA 5DD3H 4PG2C 5TTRA 4LCYA 5K9OA 3SYAA 1TFPA 4PJ8B 3MRFA 5T3XH 3RL2A 1KTDB 3TLRA 3RFZB 4BFIB 3HZMB 5I5RA 2XWTA 3JV6A 4MXQC 1JZ8A 4KRPB 1MW1A 2EVFA 2DIJA 3TBVB 4EVNA 4JR9L 1MQKL 3HB3B 1R3LA 2RCSH 2VMFA 1DUZA 1CXKA 1MG2C 2J8UE 3TT1H 3S8WA 2BC4B 1RZ8A 2DMHA 3T9WA 2OMYA 2PW1B 2D2CC 3ZQ9A 3LKNA 5IQNA 3VWJA 1TJHL 3GSNL 5JHMA 4M1CC 3OKOB 3KPMA 2ZJSH 2WWOA 3RDTA 1VB9A 4YN3A 1LHZA 4Z1PA 4LLDB 5I74B 4GAJH 5IFJA 5BVPL 4Q14A 2AJUH 4JQIH 4XMPH 4PP2A 4KRMB 3GMRA 1F6LL 4RAHA 3X14B 1XMEB 3X3GH 3ES6B 4M7ZC 2HJKB 4Z5RA 4DETA 1CK0L 3ZIYA 4UDTA 2FATL 3HE6A 5DEGA 3WFBL 5HGGS 2SODB 1U8KB 3G5YB 3T0EA 4F9LC 2IDSA 4PD4J 4DN3H 4B5EA 1HOEA 1I1CA 4YQXL 1DQMH 2R69A 5INCB 1UWEL 3TCTA 1VZIA 1JHKL 1RZJL 1NQBA 4JUSA 3WKML 1FG2A 3F05A 1FYHB 1BWMA 3MV9D 3E2HC 5DC9B 3D12B 5ID1A 4WFGE 1U33A 1L9RA 3WE1A 2K6YA 1F58L 3PJSA 3SGEI 1KB9K 4ZFOL 1PKQE 1WZKA 4MJ2A 4KK5D 5IW1B 4QJ5B 4KJYA 4QR7A 2E59A 4L4JA 1CMOA 3ECQA 4L48A 2BOBA 4KHTH 4GSQA 4OCNC 1MWAB 3U1PA 1RZJC 5DS8B 1I9IL 1KDIA 1I8IB 2QMKA 1X6LA 5EBMA 1AHWB 4CJ1A 1D6EB 2YLHA 5LO7A 1UM6H 4XOCA 4XWGL 3SDAB 1HZHH 4PJ8D 5L8LB 1MHCA 1WT5C 2VLKE 3BLBA 2WQAA 4HD5A 4MSWB 1H6UA 3C12A 3GXIA 3LDBC 1H3PH 1VCAA 1WA0X 3VGBA 4PWEA 5BV7B 3V2AR 3LS4H 3L3OC 2E5EA 3QUML 4IOIA 4KQ0A 2VQ4A 2ZYHA 3LZNA 3BZEA 2WIIB 3MV7A 4UDUA 3SDCB 3RX7A 4N26A 1OT1A 4JFDE 3UL4A 5DJ6B 5DK0B 3F00A 3ARWA 3FQTA 4S0HA 5HYSG 3IDMA 1VF5C 3S5ZA 4OV5A 3WO4C 1BLNB 3JZYA 4IHBA 5TDPA 1KIPB 1U8PA 4GRLB 2VW7A 1XGYL 5EA0L 3CN1A 5LBSL 5IFAL 1ZHNA 3GUTB 1AQMA 3RUGF 2UY6A 3QXVA 1Q0EA 3KM2A 1B4TA 5AZEL 4OLXH 1SEQL 2PMZA 3INUH 3ZMNA 3BKCH 4QAWA 4X9BA 4POZD 3GYRA 3W1ZA 1T7XA 1P5UB 1WZLA 2NTSP 4LP5A 5CZVH 1WGOA 4IRJB 4QD2E 5EWIH 2G9HA 1WAEA 3WHXA 3DIFB 3OGOE 1A65A 4HIHB 1T89C 1LEIA 4NZFA 3VI3A 4AQ8C 5C9KA 3OAZH 4UUJA 1GZHC 4PJBB 4QGYA 4Y5VA 5IM7A 3LKQB 2W9DL 3GSXB 5D7LB 5AW5B 1HH6B 4XGZA 3SJVB 2CR3A 2RD0A 5IFHL 3HHMA 5AOMA 1TPXC 5C97A 2QLVB 3HUJF 4R3SA 4MA1C 1MCRA 5EZIL 2CLRB 1AGBA 2WZ5A 3TIDA 4NO0A 2HTKC 4OCYL 3NCXA 4LSUL 1OSEA 1S7RA 4Z95H 1WBYA 5EBWA 4BA8A 3WIAA 3H3BC 2JK5A 3PABA 3FB7B 1G43A 2DTSA 3C08H 3IRZA 2AEIT 2VDRB 1M7XA 1QPPA 4MS8C 2X7LB 3LRKA 4APXA 4ELKA 3BVUA 3NJMA 1LO2L 2X53A 1OY3B 5HI4D 1EO7A 4JQXA 4Z7QF 2B1HH 2PW2B 4BGDA 4X6EA 1TFHA 4GRMA 3RI5F 3RIKA 1JHLH 2IJ0C 4LCUA 4M4RA 4UANA 2BZ7A 3HG1B 3PGFL 1KXTB 3CSGA 4FFWD 3IDIB 5E6IC 4YXKH 3EH3B 2BSBA 3JV5A 1BAFL 3ZBMA 3PAVA 2IMNA 1B0WA 3LQAL 4YK4C 5D6CA 1ZXQA 3EO9H 4K94H 4X9GA 3R7QA 4WHTB 3QSKB 1QABA 1YNKH 3SDCD 3T4AB 1CC3A 5AAWA 5EEZA 3C2AL 5E2UL 2YD5A 4HKXB 4GUPA 2ZSWA 3QQ9C 3Q5YA 2WTOA 4R7DA 2I32A 5C70A 4OJAA 5BO1L 2DQJL 3CH1B 5D7JC 1NBCA 5I0YA 1CQKA 5HGBB 1N5YH 3RWIB 1TIUA 2IF7A 5GSVB 2VZTA 2PCXA 2YJLA 5IBUB 4P2RB 3T2LA 1W8OA 4ALAC 3TBBA 2GI0A 5I15H 1HDMB 2E7BA 5TQ2H 1R6VA 2YRZA 4PPTA 5C0ND 1V3JA 3EH2A 5IUCA 3K6OA 3MLVH 4OFYA 4PHXA 1A02N 3KXFB 3GZOA 3ARGC 1CXHA 1JK8A 1NAMB 4NQUA 4HZAA 4PWFA 1UM4L 3RIFK 3FQRB 1D7FA 2QLYA 2IGLA 4HWNA 3MRFB 1T1XA 3AREB 5E70A 3SE8H 1OF2B 1R3JA 3Q1SL 2JB6B 5IHWA 1T04A 3BUDA 3GMLB 3X1EA 4ZUWA 3D25A 1KJ2B 3QFJA 3U2SB 3D0LB 2BOCB 4HJJH 1J48A 1R3LB 5F72S 3VD0A 2KKQA 4JGMA 1URLA 2R39A 3FTGA 1RI8A 3VXUA 2ZE0A 7TAAA 2OMWB 3VXTA 1BZOA 2C1OA 4KU1A 4RAVB 2Z8RA 4K5PA 2UVFA 1OARH 3QNFA 1FFPA 5EO1A 1KJ2L 2C3VB 5CEZL 1XSJA 4CSPA 3NCMA 3HAEB 1KGXA 3T6QC 2R7EB 5HYFA 4CN6A 2FT8A 3MV9A 4YSOA 4Q58C 2R1YB 5AVTB 3DXAA 3G5VB 1I7TA 4PEEA 4JRYD 2FLBT 4QWWD 1I1FB 4TULH 1G7PB 4ODVH 2AJXH 1IARB 2LABA 1CGSL 1E4XH 2WCPA 2WXHA 4OZFA 4WJ5A 1QLEH 1E90A 1DO6A 2WKOF 1BF8A 1M56B 3WL9B 4XCNB 5BOJA 2VDMH 4FG4A 1G5AA 4NNXA 4JN2A 3AUVA 3QHZL 5CCKL 1T1WB 1GJIA 3FPXA 3HMWH 2V5SA 1BOGB 2RMNA 5FEBA 2BERA 4XN2A 1WGVA 2QQNL 2JV6A 4Y8AA 2Z92A 4H0GA 4JX0A 4OJEH 3RDTD 1A7OL 1DLHB 4JB9H 3ZYJA 2OLDA 2ADJA 5BNXD 4MAUH 5J12C 2DLGA 2V3DA 4S1DC 4X50A 4L3AA 3VWJD 2EDEA 3BQVA 1IM9A 4ZZFA 5L2JA 4ZNEE 2YFNA 4WI3A 1ZVYA 4BRVA 4DAGH 4DJMA 4Z7OF 1QBLL 2ED9A 4M4RB 3ZN6A 3P77A 4UQAA 2P80A 1L6ZA 2DYPB 3CVIH 3ECVA 1OQXA 2H26B 5HHOD 4WGKA 1HI6B 1E8WA 4YWGH 2PTUA 1DFBH 1R24B 3GXUB 2VDNL 5EBLB 5ESAA 2KS0A 5MEPB 1PW3A 3VRIA 2OX5A 1E4WH 5DVKA 4APQB 2QJDA 3MRNB 2UZYA 2A83A 5CJQH 5CFHA 4JKPL 2Z4QA 3EGSA 4QRQB 1FO0H 3VRJA 2PN5A 3RVTC 5E1IA 1JFHA 3C8DA 5E99H 1SVCP 2MCPL 2WC7A 4P4RA 3N44B 1M6UA 5IEHB 3TX4A 3QPQD 5BW7C 1EJOH 1RY7B 5TGBA 2V33A 3RRQA 2XU9A 4B7IA 1CFTB 1CO1A 2LAAA 3CVDA 4OGAD 2BH0A 1ZLEA 2NOYA 4OLVL 2N7SA 4MB1A 3QJXA 1RQ5A 1WFJA 4XHQA 5C0FA 3MBWA 3OX8A 1HSBB 3QEHA 4S11A 3RTQD 1H15B 1XIWC 5ESVA 4H20H 3TVMA 1VLXA 1JPFB 5F0JB 2GFBB 4IBWA 4GI8A 5HDRA 4PD4K 4MX7B 3IJYB 4UV7L 4MDJA 4J23A 3SD2A 4Y1AA 3U36A 5IV2B 2GABA 5I26A 3UC2A 1FPTH 2I27N 2IO5A 2P24B 4FQXD 2A7BA 1BSIA 3P30H 1ZV9A 5FK9B 4I87A 3HZYA 1S9VB 5I1LA 1NAKH 4HEPG 4YDKH 3QPKA 2VW6A 2A3TA 2Y7MA 1KB9J 4RMBA 3MR9B 4PBDA 4HZLA 3SDCC 2XN1A 3PQYE 1GYWA 1TTCA 3MNVB 1U3HB 4FZ8H 5E9DD 2AP2A 4OM1H 1A1NB 4FLHA 2XFGB 4NT6B 4LEBA 1RHFA 1BGXH 1OEZW 1H6EA 1ZE3C 2AABL 2F68X 3GGWA 3MCYA 4ODSL 5EO0A 3TFKC 3WENA 1JI1A 5EOCJ 3ARED 3G08B 3HCVB 3NK3A 4IRSB 2LFGA 4WFFE 3NP3A 4R96B 5FKPA 4X7SL 2CJUH 1UFGA 3A4FA 4JRYB 5C0IA 2J25A 1LE5B 2GK0A 4JRXA 4P46D 3JV0A 1H8LA 5IESH 3W0WE 4ZPVA 3V8CA 3FB8A 1L7IL 4CMMA 2V17L 4I2XB 5LKNA 2PXYD 1E4KC 2P5ED 2WGXA 4IU3B 4ORGB 5D1ZI 4E9WA 5E1HB 1NEZG 4WUUD 4ONOA 4PTUB 4N25A 2EUVA 2KLRA 2QQLL 3AG2B 3WEBA 4UT9H 1AHWC 3RWIA 2XKNB 4PJAB 4PY7B 5B3NA 3OSVA 4WDIA 2OTUA 3EHBC 1T0MB 3RPBA 2C8NA 1JWMB 2AK4E 4MAZA 5FHAH 3VMPA 1QI3A 2EIDA 5ESAB 4J2QA 3K2UL 3FHQA 3R06A 4FNTA 1IUZA 2GEQA 3DXAE 2DQCH 1QHQA 4MSWA 3QHFL 3IDGB 1P1ZA 2WNKA 3DUHA 4NENB 3IMBA 1S7SA 1TZGL 2XX0A 3FFCD 1A7PH 3IU3B 4UQ3B 3CFNA 1J18A 1K8IA 3SB3A 3AUWB 3T0XA 1KXQE 1COBA 1YEJL 4GRWF 3QXDB 4E42A 5I66A 4BH8B 3LRSA 4H8QA 4HXAH 2LLNA 3EJRA 4CADA 3K5SA 3MLVL 4M5YH 4WTZA 4DN4L 2X70A 5FF6A 3HMXL 4ZX6A 3BIBX 2FECI 2DIAA 2OCCB 4F9PC 1A4CA 2UY7B 5SV3A 4NKMA 5LAXB 2AITA 3US1A 3GHBH 4LOUD 4HKJB 2C1OB 3L9BA 1TU2B 2JIXB 5F89A 2W81C 2O26U 1NWOA 4FZEL 4JY4A 1LO2H 2AJ3A 4TNVF 3O9WC 4ZFGH 5MEOB 3ZTNH 1G6RL 1LLAA 2MTPA 4JM2C 2B14A 3KPSD 3NJJA 1AHKA 1FIEA 2ZWLT 4NNYA 1YQVL 3V5KA 2XUWA 4Z5RB 4LLMB 1B0RA 5AZ2L 2ZT9C 1VEMA 5I2IA 4IS6A 1KY6A 1QNIA 3FU8A 2O93L 1INQA 3QA3B 4MYWB 2OTWB 5DYFA 3QJZA 1PX8A 5BRZB 1JIBA 1RIUL 5ALCL 2VUKA 3ZE0F 4DTGH 1CLOL 4JO3H 5T33H 3AG1B 3B9KC 4HUWB 4WI7A 5L9DL 4A7VA 3GXTA 3CK0L 4L8DA 1EO5A 2OL3H 3VAEA 1UWEH 1CFQB 1LVEA 4PRPA 4XOEA 4ZD3L 5LNGA 4QO1A 1IL1B 5D7IA 3MXWH 2HN7A 5EZJA 1QFWM 5HI3D 2IOMA 4IMLA 2J6EH 1PJWA 4CU8A 4PJDE 1NKOA 1NCIA 5AOZA 4B6ZA 2AV7B 2G0KA 3INUL 2YRBA 4KH9A 4MB3A 2VDKH 3RWFA 4E9VA 1CGVA 4ODBD 4PVNA 1CK0H 1MCEA 3QIWD 4Z7QB 3Q05A 1FFRA 3VXMA 5JW4N 3LKRB 3ISRA 1HHHB 2X4UA 4N2IA 2YQ2A 3NZ8B 2JLPA 5J89A 2AERT 1YEEL 1VFBA 5IBTH 1LD9B 2Q3ZA 1FCGA 1NCUA 1QFUL 2VXUH 2PXYA 2UXVA 4GINA 3V52H 2H4EA 1JVKA 1GOHA 5CEXA 3CVIL 1XCXA 5ADOL 5L6YH 1GZQA 1OTTD 1U2YA 2G2PA 4PJDF 4FA6A 3F8UB 4X5XB 5DHVH 1M7DB 4R2GC 4NI6A 2YD2A 3RZCC 3T8VA 4NQED 2NRDA 1XCQB 2FD6H 4I0PA 3L4YA 5CBAA 4MA8H 3A4EA 5FO8A 2NY4C 4XVUD 3PREA 2HKHH 1Z9OA 4B9YA 3DOIA 4NOFA 1HHJA 4RGNB 4ES8A 5IVOA 3RVWC 4GBXD 4KVCL 5GPRA 1MNUL 4AC4A 4BFRA 1OP5H 2HWZL 4XXWA 3GEFA 3WS6C 3V7MA 3ZGIA 5AZEH 5I75B 1CI3M 4DO4A 5IT2L 2CE6A 5LJYH 1JYXA 1ETJA 2B59A 3TCLA 3JT2A 4QRRE 3RQ3A 1WD8A 1HKFA 4PGBA 5EOQL 3KEHA 3SGKC 2CUMA 2QL1A 3D50A 3B7SA 4M1DL 3TM6A 4C83B 3VGAB 1T03H 3OLEA 1I53A 4I8DA 3N3EA 3POHA 1QPKA 1UWXK 2H3XC 1HQ4A 3QQ4B 3EBHA 3QXDA 4E42B 3PQYB 3QDMD 2JH2A 4N28A 4JVPA 2BHUA 3H7LA 4ERSL 1MW2A 2EEXA 3MV01 3FTWA 3UO8B 3RKDD 4TSCL 3RX5A 2X4PB 3AS0A 1EA9C 5K9JL 5CLZA 3AS2A 3OXRA 5LQBL 1FL6B 2FVNA 3ILQD 3IN0A 5EF0A 3SKJH 4CN1A 5JW5B 4L4TE 2QSVA 2BMKB 3LKSB 2BNRB 3L5WA 3UBGA 3D3VD 1TU2A 2XTLA 5F89B 5DD6A 5EEYA 2ZX6A 5JOFA 2XVLA 1TNNA 5IK3B 4K9JA 3O6FA 4ACTA 5DHMC 1D6VL 4NN7C 5E6IA 3TBCA 1QR1B 3H53A 1FCCA 3HR5B 4Y5YC 3ZDZB 3UTZA 4PJCF 2FO4B 4PS3A 5F0LB 2UZPA 1HL8A 3GMMA 4NO2A 4PRHD 3VQLA 2ATAA 4ELME 5D1XE 4PWHA 3GGWB 3I9AA 3N43F 2VAJA 4OCLC 3RFRA 4NRYA 5EU7E 4LASL 1KJ3L 3FN0H 5CN1A 2ADIA 2K8QA 2EDMA 3G6JE 2Y6TE 3O3BB 3ULVC 3GRGA 2G3NA 4R96A 2ZCLL 4UM9A 3QK0A 4IDLA 2BRRH 4FXTA 2IH1B 1OK0A 2QEJA 3ESVF 1NPJA 3PNWB 4I89A 3FBQA 5JW4M 1Q1JL 4FOMA 5C07A 3K6IA 3EH5B 1NBYB 4LLQB 4NNPH 4WO4C 4F93B 1ED3B 1J1OH 4GKZA 4HS8L 1X5ZA 3X12B 2BCMA 2GY5A 2O5NA 3ARSA 4MMZA 5DVNA 3WN6A 4QXVA 1M3IA 4Z7OB 3ZE1B 4BSWB 1ACXA 1JG9A 4G6KL 4A1RA 2P5WE 1AZUA 1TVHA 1W6LA 1YLBB 4MBRA 4PLOB 4EUPB 3MTRA 4CC4A 1L9QA 2C7UB 5AG9A 2DMCA 3D48R 4XMTA 1OD7A 4KNUA 1M6OB 2FIRT 4LSVL 4PGCB 4PJXA 5DRWA 5MEQA 1KPVA 4Z0BH 4E68A 5F3BB 4LQFL 1I7ZA 4J8RA 2Y7QB 1X4YA 3CDZB 5C7XL 5ICXA 5IB4B 1BVLB 2EDNA 3INOA 5FX3A 5CJBA 1AE6H 3L3JB 4P05A 4JKMA 2RALA 2ZAGA 1EO8H 3QXUA 4XNZB 1PQZA 1ASPA 3GMQB 2QVFB 3KHQA 4QI3A 5CJQL 5EC1A 25C8H 2UZXB 2BVEA 2G2NA 3BT0A 5AUMA 1A0QH 4ELMB 3TN0C 1DJWA 4ZMZA 1SJEA 1YEHL 8FABB 3DXAD 4KVNH 3ZDZE 1QBLH 2Q76A 3OF6D 1WFTA 5A2AA 1ET8A 2VXVH 4LCCB 3FAWA 4WK0B 4X99B 1O75A 2WQRA 3Q2WA 1HHKA 2EE6A 1QR4A 1XH1A 3ZLQC 3UTTA 2W65B 4MKMA 3DX8B 1QACA 3GDCA 2KMWA 3VWKB 3ZE2E 1INEH 4CSZA 4TUUA 5MI0B 5T3ZH 4OZGB 2VLME 2SEBB 2J57A 4PJXF 5BV7L 3FRPB 1TCRB 4B9GA 1FRGH 2ED6A 5E51A 5IMOB 1GZPA 2NNRA 4H25B 2X2YA 4KK5C 1AXSA 4RDQF 3FSWA 3GSQB 3MRIB 4GRWH 4JPIB 2OMTB 2MCMA 3UPRB 1JCVA 1AR1C 1T6VN 4BD4A 1JAEA 3MFGB 1MLCA 4I1RA 4IHOB 3VYOA 3QQDB 1HKLH 1JZJA 3B3IA 4JO1H 1C1EL 3QDMB 2UWEE 4A2LA 2X44D 4WSGA 1U3ZA 4JLRA 1U8QB 3OHXC 1NUGA 4QRBA 3ZDXF 1HIMH 4AQ1C 2BHZA 2JTYA 5CHNA 4BWTA 4R4BA 3CFKB 1OAXH 2YPLB 4TRPL 4BZ1L 5JHDA 2JWYA 5FYKE 3V5HA 4XPHL 4K7PY 5D1ZD 1P84K 2ZG3A 2JCCE 1T3FB 3WNJA 3TYFB 3SY0A 3DUUB 2EH7H 1X5IA 1VESA 3D3VB 4KJQD 5FGBA 2JCWA 3OJMB 3MRGB 3VXMB 1NGPH 4P23C 2GVYA 1NGZA 1QO3A 3WD5H 1OM3H 1KMGA 3BP6A 1CFMA 2H47C 3HZVA 4YXHH 3MRRB 3HE6D 3OR7B 4TQPA 3U25A 4G8IA 2B2XH 2OYLA 1JSYA 3DVIA 4OT1H 4QRQA 5BRQA 4RQQB 5I82A 1SJMA 4RNRA 3QNYA 3ZMRA 3IEAA 3FNKA 3V79C 1OAQL 1JV5B 1U41A 3OB0H 1CLZL 4K8RH 3G9VA 2C34A 4G5AA 4POZC 5D9SA 4DAGL 2DY2A 3FQYA 3B9KB 3CPLB 3MGAA 4HIEB 4FABL 3QUXD 5GGTH 1EZUA 1E27A 2J71A 3F6LA 4DVBB 4NQDE 5GGUA 1UWXH 1FZMB 4DQOH 2OMYB 1AH1A 2A6JB 1IAIH 2WN3A 1S7WB 2HH0L 4QHUB 2Z1PA 2HA1A 4RGOH 1A64A 1FGVL 1KYFA 2IPUK 3BMWA 3QPXH 5I9QB 4F2FA 4E9QA 2A9BA 3E1F1 3PV6A 3IETB 2UZIL 1HC1A 1M6OA 4PGCA 2VN4A 3OSKA 3IPEA 4WV1C 4ZW7A 3LV3B 1UH4A 1RZIA 4BXSV 5BO1H 3ZO9A 3F3HA 3FO0L 3DBXA 3SBWC 3UTPD 5JHLH 2E9BA 3R4RA 2X4QA 4BIKA 1K3IA 1WZ1L 5I8OH 4DHLA 5JPMB 1T1YB 3G04B 4Q2ZA 3I6LE 1WC7B 2FGWL 1D5ZB 4XPBL 2CO7B 2YD6A 4OGZA 5EU6B 1CU4L 5BRZE 4OZ4A 5LG1A 5I30L 1QFPA 3AAZA 3ZOAA 3S36X 2CKBA 3WNNA 4DTGL 4NM4H 3RLSA 3B2UD 4PRHA 2OL3L 2EUXA 3Q7JA 5C0BB 4K5LA 1IGJB 4K9EL 5K1VA 4AYFA 5KSAC 2V2WA 2NZ1A 4JGJA 1IE5A 3V4UL 1FF5A 4DP8X 4E9LA 3AWGA 3IJEB 3ULVD 2OJZH 2VLRE 3FCTB 1A21A 5EUKB 2IALB 2CJ3A 3EO1B 2X4OB 1PJ9A 4EZMA 1NGQL 4RWYL 2J2ZA 2P46B 3V0IA 5LBVA 1UD6A 4PJBF 2H5UA 3VFVA 1H3VA 1M05A 1T22A 2DJSA 3KGRA 2XTJE 3P4NB 2OMVA 1NAML 5JZ7C 1A8JH 3E80A 5AWNL 3LZFH 3PDDA 2AZAA 1P4LA 1NDMA 3FAXA 5KBPA 2GC4C 2GBTA 3QWQB 3L3DB 4PJ5D 1MJJA 3MOAH 2YD7A 4YHML 5DT1H 2ZP8A 4OCWL 2RHEA 3MV7D 4HQQL 4QRPB 2F6AA 4RFOL 2DJ4A 2V5TA 4H26B 5CLTA 5BPPA 2PO6C 4Y2OA 3CMOL 5ADOH 3ARFC 3QDMA 3VQ1C 4QO1B 3QCUL 4PV1C 1PZBA 3MLUL 3D07A 3ARRA 1KNOB 1YECL 3T8XA 3KLKA 3U6RB 3ECBB 3PNWA 3UG4A 1MZZA 4LP8A 4G72B 4PTUA 4AVIA 4LF3B 3OPUA 2QQKL 1BZEA 4QRUA 4G42B 4XP6H 2Y0SA 4M6OH 5HYJE 4GQRA 1D5XA 1M7UA 4JW3A 3CDFA 3OKMB 1IB5A 4ATTA 1V3KA 3KWWB 5D4JA 5D70H 1KELL 3ARFB 3R1GH 3TV3L 3EOAA 3L3HA 2H6PA 3APCA 3QJSB 4BZ1A 4XHJC 2ALAA 5IGXH 1YY8B 1ZE3H 4PLJD 3K2UH 2ZXQA 2XQYA 4KXZI 1XX9C 1OCWH 2FGZA 3LXCA 2EUWA 1W91A 1XZ0B 2CBPA 3WHXB 3OF6A 5EU6E 1XGRA 1AHMA 2DI8A 3FO2B 4MJ6B 4G6KH 2MCAA 5ICYA 4QRAA 2VDLB 4A6YL 1WE5A 5BUGA 4M02A 5D1QC 2XNAA 2BP8A 2DS4A 4WWPA 3QZOA 4P46B 1EXUB 3CK0H 3DGDA 3DVFA 4RISL 1NPUA 2VDMB 5FGBC 1OB1B 3CSFA 2V7NA 4UNIA 4GSRA 3V6ZB 5DJXA 5DJCA 2HRGA 4F15B 4NJAH 4S0TD 1OAJA 5KWYC 5IIEB 3AXIA 3KPSE 4KKAD 1I7RA 4TUJA 3FTZA 3MSPA 6FABH 5J6GA 1KSRA 1AKPA 4XO5A 4O2CB 4YIQB 3THML 3A22A 4P5KB 5KSAB 1QD0A 1ADQA 4RMRA 4UQ2B 3TBTB 4MLSA 3ECUA 1NIFA 5E2JA 4UQEA 5IR1A 2EXWD 2KC0A 2C3VA 4L18A 1NOFA 2Q76B 3AWFA 4X83A 5SWZB 3MJGX 2HPTA 1WBYB 2F74B 2AJ3B 1DQQA 1F00I 3LTVA 3W37A 2PETA 3IBOA 5I18L 5LXVA 4GRMB 1IQDA 3ZE1F 3CC1A 2Y7LA 1JF5A 2HT2D 1TEFA 3Q01A 4NZUH 5JYLA 3ELQA 3SEPA 5B38A 5ERWA 3FUKA 2K3HA 4KKNA 1J8HB 1Z5LA 3HNTL 1GPOH 3FT3A 5DS8A 5DJYB 2SEBA 5D4IA 2ZXEB 2B9BA 3P73B 2XBTA 3M86A 3QPQC 3L5XH 4MCNA 4HWEH 4FI8A 3FKUS 4GP5B 5D7IB 2GQHA 2GG1A 3F85A 4DEPC 3RBSA 2P8LB 3IFPB 3BCFA 3NVQA 2L7EA 4MJIE 4U6YB 4D9LL 3DKHA 5D5MB 5G4MA 3IDUA 4BV1A 1L0PA 3KZ8A 2YUXA 4K15A 5J6HB 4I18C 3VFRA 4LLWA 2YZ8A 4P23A 4PJ8C 4Z7UB 2FO4A 1QYGL 5BOZG 2VQTA 4XMVA 4WHYG 4YHPB 3KG5A 1Z32X 5GSVA 1H3XA 1WTLA 1T0MA 1I31A 5DS2A 4ZTPL 3RNQB 8PAZA 5L9DH 3C5SA 4JS7A 4WGVB 1YMMA 2A4CA 1EV2E 2B5IB 3DO7A 3KLHD 2BIOA 4GG8B 1JNHB 4QF1A 4UT7H 2X4RB 3O3AA 2ITDA 3KHOA 2GTZB 1K5WA 4UM9B 1JK8B 1NAMA 1FNEB 2EYTB 2JJTC 4CJ0A 3RVVD 5DEZA 1T20A 4XC1H 2YD0A 3FQUB 2N59A 4UQ3A 3REWB 1T1XB 3GBNL 2FECL 4X6CB 4EIGB 4MCYB 4BCZA 3MRBB 4HK3J 1MFAH 2EEBA 3N5AA 4E41E 2FIKB 1YYML 3OVUB 2WQSA 4XTRC 1IM3B 1MFVA 5IJCC 4KZDL 3HC0B 5DURD 1PSKL 4O2EA 4PJIB 3ZY7A 2I60L 2OL3A 3T6WA 4YXLL 1BQRA 3MC0A 4NFBA 2X0WA 1QW9A 2WQVA 5HHNA 1CD0A 1Z0MA 1DSFL 2VLJB 4PGBB 3S36L 1GY1A 4APQC 4KDWA 4ZRGA 3PWJA 3FB7A 1DZ0A 1IBHA 3B2UC 4OFVA 2R1WB 3DYMA 4DQOL 1MPAL 5HJBA 4GAGH 1TXKA 1W2KT 3FRUB 1E42A 1K2DA 2WW8A 5DRNA 3UJTH 5JPNA 4P3DA 4XBEL 4ORZC 3FQWB 4ZX4A 1G9ML 4MQSB 3G5VA 5K39A 1PEZA 2J8UF 4NNYB 3V5KB 1FRGL 2BS8A 4LLMA 4WU7B 4EMZA 2A9NH 2ZKWA 3NA9L 5CJOH 1MWAL 1MREH 1LDPL 4JJ5A 5DZOA 3ULVF 3OGCA 4P4KD 3LQZA 1KBBA 2DQHL 4NXSA 3HI1B 4UU9B 3S9DB 4M6ML 4RVBA 4XP4L 4JO4H 3L4UA 1VIWA 3PWUB 4U6HA 4WUKL 2H32H 5DD6B 5F88B 3U0TB 1IGMH 1JZ3A 3B2VL 1K85A 1KCUH 2HTLD 1N7MH 3LEYH 3LNFA 4I3RH 1F4WH 1AOZA 3RKDC 3GSVA 3Q5TA 1DUYA 5J11B 3WKYA 3GB7A 1ZVNA 3GBLA 2IALA 3ABMB 3JTBA 2NQDA 4HDIB 5L6YL 2A6IB 1BZ8A 1N67A 3RWEA 2Z0BA 1N0XL 3V6BR 1CJYA 4IDJH 2PXYC 2AJYH 1GMIA 4WHCA 1JMZA 1T22B 1U8NB 2BNQD 3JWNC 1JERA 1T7VA 4X7TB 4R83A 4WW1A 1JP5A 3WD5L 2F53A 5T1MB 2NY6D 5KZCB 3L3IB 3T77A 4N5UA 3GS7A 1MJJB 1PZ3A 2EDKA 4RMUA 5CEXB 2NXYC 1PDKA 3SN6N 3C8KB 5DURB 2BY3A 1S5HB 5J6HA 1DEDA 3D87B 5IHZB 3UAJC 4RMTA 4LGSB 4HP5A 4WHYH 5DTFB 5CJ8A 4C56E 3QAQA 1J5OL 3ALWA 4M1DH 1KIRB 1DUZB 2ZWKA 1G6RB 4L4TB 4NO5B 4J27A 4ALAL 4KDVA 2AQ3A 3TBSA 4B9ZA 4XZUA 3DV6A 3DYOA 4MRCA 4V1DB 3ARYA 3W2DH 1CFBA 3NYKA 2IAAC 1MFDL 1MIEH 3FYEB 5C1MB 5CSZB 5EH1A 4ETYA 2O5XL 3RUGA 1LO5B 5LUMA 1Q1JH 2J72A 4D0BB 1IT9L 3ZE2B 5KVMC 4M7LL 4HETA 4WJKB 3U0WL 1D5MA 1A4JB 5SWSA 1AE6L 2ZOUA 4H5SB 3VX0A 2XA8L 4UTAH 1BG1A 3KR3L 1BMZA 1YEFH 4JHBA 3W39A 3NUKA 5IHUH 1AJ7H 3I74A 5D4QA 4MA1B 1OPGL 1WFNA 3V4VL 2EXYD 4P8QA 1ZLVK 4G9FD 1OP9A 3D09A 2P24A 2WLJA 2YWZA 4A6YH 2MMXA 1IILE 4Y9CA 3A21A 3CFQA 3UX9B 3QZMA 3U36B 2H45A 2YD1A 5JMRA 4XPHH 3TJHD 1TMQA 4BDVA 1NJ9B 3MX0B 3WKMH 3BGFB 5E8EA 3BKYL 2ZP9A 3BZDA 3JV4A 1TQBB 4NIYE 4A6YA 3O6LL 1EEQA 5IKCA 2X2HA 5IVXA 4HC1H 4KDTC 5HSFA 1E9PA 3JT0A 2F54A 4GRWB 1KGUA 2BSRA 3FQXB 4O02B 4PWIA 4J39A 4YC2B 4DKAA 1NGXB 2P1YA 2P49B 5EUOB 2Y9RT 3HPJA 5GZND 1JF1A 3MCKA 4AMKH 1KULA 2MWCA 1ZPUA 4P59L 1AMXA 4WUUA 3UBXI 1ZEAL 4C4KT 4TUKH 4Z78A 3DRTB 4M4PA 5DHDA 2JKNA 2ZG1A 4IRSA 3B37A 4L8SB 4ZW6A 3UGUA 3EJZD 4DFIA 4NZUL 5HVHB 4PB0H 1E3ZA 5D2LB 4GUPB 1SBSH 1C1EH 2OMZB 5I0XA 4JRYA 1T21A 1UT9A 5A6MA 2FAUA 3QUMH 1WT5A 4IU3A 3SKOB 1VPOH 1DFXA 1AR2A 4Z7QE 1G7MA 1M42A 1QG3A 4ZUUA 1C08B 1U30A 3FB8B 3MO1B 3AY4A 5L8JB 1O7SA 4JAMB 4LSPH 4YPJA 2XKNA 4PJAA 4PY7A 4R2GB 4BKTC 2X2UA 5IEHA 3FUDA 3PGDB 4HC1A 4QHMA 5EB9A 5C08B 3IMWA 3W56A 2NY3C 4DKTA 3TIEA 4RX4D 5I16B 4JFEA 1XH2A 3LMJH 2KH2B 3OLGA 4M6AA 3DVGA 1S2EA 1Y6KR 1D5RA 1QA9B 4Z7VA 4URTB 3GBDA 4HSQA 4F20A 4E5XG 1CPUA 1KEGL 1KGCD 2NSQA 4LL1A 5D1ZC 4KO5A 1MEXH 4GBXC 5TFSL 2QDWA 4G7YL 1UD2A 2OR8A 4Z7VF 3FCBA 3JWDL 4EO5A 1C16A 4ZT1A 1XHHA 1JVLA 3IU3A 5DD1L 4OFYD 1KLGB 3J7HA 1ACZA 5KJRL 5KSUB 3CXDL 5C86A 2H0JA 4X7EC 3OMNB 3MLXL 2L8AA 3D39E 4W9DC 2YIHA 1T5WA 1S7VB 1ETZB 3U7YH 2YAMA 2MOVA 2PWHA 5C0CE 2ZUQC 3ZJAA 1ASOA 2X4TB 2YGPA 4K5MA 4DGYL 2BP3A 3WIIL 1U8OB 2XPYA 3PNRB 2DKSA 1JZ4A 3QNXA 2CO1A 1SDAB 2OQJA 3BDYL 1RZPA 5C0RL 4WO0A 3JTSA 4MD4B 1ILUA 4KHTL 3BFOA 4P4KC 4D8PB 4W6XB 2UY7A 3DBSA 1MCSA 2CA3A 2FEJA 2VAAA 5CINL 5DEFB 3DTDA 5EC2B 1HHKB 2BY2A 5BS0A 2HRPH 2EIMB 2Y5EA 4ILDA 1HQ4B 4W1TA 1N10A 1W0VB 3KBFA 4UF7C 4LPYA 3KL5A 5KS9A 3ULUL 3CDGB 3QCUH 4G8GA 2BP5M 2QKSA 3QHTC 2IAMD 3F6JA 4OZ4B 2CGYA 2PP9A 4WHTA 1JRHI 2WO2B 4OZFH 5H35A 5IB2B 3I9PA 4XB3A 5GZOA 2W91A 5I73C 5JHBA 5EU3A 4KY1H 5EG6C 4KRPC 4XNQB 4GQPH 1O9ZA 4Q8BA 4BFFA 3TF4A 5C9JB 3D6GA 1CVSC 1RZKC 1PG7L 5H4YA 4CSSA 4D9RD 2OCFD 3CN4A 1U4FA 3VVWA 3RVXD 2WVUA 1U8QA 3D8MA 1DBKL 4GIAA 4M48H 3IMUA 1CL7I 1XSKA 3AS1A 4GMSH 4PUBH 1CWVA 3TU6A 3ILPA 4MNHB 3TNMA 4AIEA 3GS0A 3GZPA 4FQCH 1W15A 1A6VL 5KSBE 1Y7VA 1UZ6E 1K5NB 4BSVA 5I30H 2ATPA 4K7FA 1QSEB 4LLVA 4TTDD 3VJ6B 1EJ8A 4IU2B 4BE5A 2GUYA 4X7FC 5I74C 4MLIA 3UP6A 4NHUB 2KL6A 3QE5A 4GYBA 2D7QA 2ADIB 1BEXA 2ZSVB 4KXCA 1A14H 3BWAB 2Z4QB 1GKEA 1KG0A 1Z5YD 2PF6A 3GLEA 3UJIL 3I6SA 4NYLB 3ZQXA 4ZNEA 2YFOA 5D96C 3B6SA 3WCYA 1P1ZB 3UROR 4KNQA 3TT1L 5GGSA 1UYWL 2CG9X 2IBBA 1GGBH 5IOPB 1U92B 1SFDA 3HG4A 1GS6X 4PJFF 2PP8A 5FYKD 3S5YA 4LXFA 3M07A 5EFIB 1YVLA 2XZQH 2Z64C 2BVOB 1UA6H 1DVSA 3GMPB 1RLBA 3ILDA 4YDVA 5IB1B 4LBAA 1NPNA 4WKZA 2P9RA 2VDLH 2ZOWA 4G3YL 5DVLA 2LQRA 1OGAE 5D2NE 4BFEA 5EF3A 1RUPL 2FX9H 4XCFL 1WLHA 4LB8A 4GJTB 4ZUTA 1NMBL 1HQRA 3BIAX 3O4OC 2E7HA 2JI3A 1IU1A 1J5OH 2JIXA 3BQUB 3IM1A 5AW3B 1GY2A 4PR5B 3TJHC 5H94A 4HXBL 2XNAB 1CQYA 2APSA 5DJDB 4FRWA 2X89D 4YQXH 1FL5B 4BZ1H 4DSYA 1F56A 2VR9A 4RZCB 1P2CB 3D69B 4PS4H 4HPYL 3RZWA 4K8RD 4HOWA 1UCBL 1N8OE 4NC1C 4Y8DC 5B7FA 1I9RH 1M2VB 1EJFA 1G7PA 1XQ4A 2ZCHL 4X98A 2XY2A 2EABA 2Q5BA 1MWAH 3QI9B 1E9OB 4X0NA 4S1QH 2K70A 3SSGA 1RHHB 4XMPL 1FFNA 1ZWIB 3AW5A 5FK9A 2UXFA 1MAMH 4L8BA 4UYPA 1JGUH 3QRFM 2O61A 2W0PA 5TQ0L 2X89A 4YHIB 2VSKB 4ZTOL 1DQVA 1MFNA 2D8KA 2HUEA 3OHXA 5LNEA 1BM7A 1OKEA 4QXWA 4PJ5A 5BZWB 3BFWA 1JPSL 5EEXA 4L4VA 4Q6KA 2GBUA 4WWKD 5E4OA 4M43L 4GNKB 4IOFC 3LH2H 2M26A 3ZKNC 3IFOA 3RB7A 3N91A 4HJSA 1MCDA 5DT1L 3IBEA 3ARGA 4GAAA 1W0VA 3QWOB 4Q0XH 5FXCH 1ZANL 3ML9A 1NBQA 5AKRA 1BFTA 5KSVB 1MQKH 3T04D 4Y4KC 4YH6A 1KUMA 1IEAB 3KYNA 3LKRA 1OP3K 2LLGA 2OX5B 3IAQA 4M7LT 3X2QB 4F8QA 4S1RL 5I6XC 3WJJC 1XMWA 2R29H 2R9HD 4ABVA 3K6SB 1PAZA 3R8QA 3AT9A 2Q2LA 1S8DA 2A77H 4IRZH 4KQ4L 3VUAA 1WEJL 2UZIH 4O4YL 1INDH 4Z77A 3DDGA 5KN5A 2CLZB 3FOLA 5MHSD 3M7OA 1NZRA 3VU1A 5TK2A 1ZJBA 3MV7B 4NZRL 3SCMC 1BMGA 4RMWA 1R3KB 4X6CE 3SDCA 2R29A 3CMGA 5F9AC 3OB8A 4LCYB 4NM8L 1HX0A 5K9OB 3F2LA 5J13B 3L08A 3C75A 5HDBF 4GG6A 4P5TC 1U8HA 4MYPA 4YHZL 1HZLA 4X4ZA 3RU8H 1KJ2A 5GRUH 3RTQC 2CDEA 4MMZB 3WUWG 1TMCB 3RNQA 4JFOA 4EXKA 3RHWF 1PX4A 3OKMA 1ZVHA 3P11H 1KPRA 2A9CA 2ZSVA 3SYCA 2BWDA 3EDEA 4GP4B 3R7RA 5IMMB 5DHEA 3T0VA 3JVGC 4Y5VC 2B1AL 4JREB 4Z7UE 5I1GH 3DX9A 1BPLB 2WVVB 4FFYL 3MYJA 2CCLA 3CZUB 4LZKA 2ZOKA 4XVUC 3PGCB 1R9FA 3KDPB 5E2VL 4KK6C 1HJBC 3GC3A 1T4KB 3S37X 3BSHA 4NQEB 1FBIH 5EORL 5MENA 3GBNH 2C3HA 4OCMC 2HJFA 3LKQA 3X13A 1UENA 3CPLA 4GKNB 1MCLA 3OWEA 5DUBB 2WXMA 3GKZA 4Z95L 4F5CE 2KPNA 1Z0NA 1D5BB 3DJRA 4XXDA 2R1XB 4NKDB 5E8NB 1S7VA 4NO0B 3DROB 1KYOK 5J6GB 3CC5B 4NNXB 2HT4D 2X2JA 1EFXD 4W93A 3TFKD 1XIWB 4XH2B 3LKOB 5E6SB 5JO5B 1UACL 4HUMB 3PWPD 3MR9A 4YBQC 5I5MA 4BEIA 2G2RB 4YHYC 1K2DB 5DRNB 4Z23A 3WTVA 1DQQB 4KKBC 3TO2A 1WPCA 2XXFA 4MNGA 1XF4B 2AKRB 3C60D 1SJHB 4YDNA 3QDHA 3VXSB 4L4VD 4WWKA 3KVDD 3H0TB 2WUBH 1G9EA 4OFQA 1SEBA 3HBPA 2CKBB 2DQJH 3WTTA 4HUCA 1P7KB 2RQEA 4GUQA 3H54A 1RV6X 2JB5H 4JLRB 3QDJB 1EHNA 4L3CA 3UAJA 1IGJA 2AEOA 1OGAD 2HX8A 1KJ2H 1YUKB 1BAFH 4I1PA 1MRCH 1IGTB 5C6TH 1AC0A 3KYKL 2PR4L 4YGAB 5CHNB 2VLJD 1ADWA 2AV1B 4ZXBB 1OIOA 1S9WB 1U3HD 2QHRH 2WKOA 3K91A 3QWOA 1ZLWH 4C54A 3QO0A 5TDNA 5FO7A 5FUCC 3TVMC 2LTQC 4BE6A 3ETSA 1R5WB 4F7PA 2A0LD 5B8CB 3AGWA 2ADGB 2CR6A 4GBXA 4WCYH 1F97A 1MFEL 3T4YB 5DZAA 4WDIB 4GP8B 1DBKH 2AJYL 3LMJL 4JANA 3U9UA 5I0DA 2H9GA 2XFXB 3ZL4H 1IAKB 3HMWL 3PDOA 3QXWA 4I0PD 4ABWA 2F7QA 1E43A 7PCYA 3PWVA 4NCC2 3K71A 2OSYA 2YC1A 4G7YH 4U1KA 4MQ7B 3IMVA 5FR3A 1PLBA 4FQQA 1AKJA 3NJHA 1OF0A 4RMSA 1PZUB 4OJYA 2B1HL 3NH7L 3VXRD 4IRSD 3ULVH 3MO1A 4LFHG 3WXVH 1ETA1 1IEBB 5IQOA 2OR9L 1K72A 1YC7A 4RA0C 2X28A 4R0LC 5F9OL 3D85A 5I19H 4GT0A 2ZNWA 2DDQL 2CDEB 2DQUL 3WNIA 4CADB 5EFIA 1CBVH 4LU5L 2D7TH 2OR7A 2NYZA 1OP4A 2E8ZA 2XI9A 4R3SB 2H8PA 3VXMD 3HE7B 1JWSA 4O2EB 5FYJL 1F86A 5KYYB 4GXVH 5J1AA 3ESNA 3QEQE 5AL8A 4DOHB 1SDYA 4GXFA 4BKLA 2C9PA 2FBOJ 2ZWYA 3JUZA 3NMEA 2ZOKB 2WUCH 4JKWA 2I25N 5EA0H 5DMGC 3OB0K 3NACH 1O6SB 2H1PH 4PS7A 2XWJB 4YDJB 1I4FA 2EACA 2A1WH 2GSIB 4O00A 3ULUH 2CO7A 5LLIC 4F7TB 2HT3C 5F6IC 3L4CA 4MASA 1P2CA 3D69A 5AVVB 5C07D 4XVOA 1QMUA 4OFIA 3G5WA 4QPEA 2CDGB 3GLDA 2R23B 2J5LC 2X1XR 3GSQA 3UPRA 3OKKA 1WYJA 2OK0H 1TETL 5SWSD 1HNFA 3CVHB 4J6IA 1F3JA 1TPXB 3AQDA 4YEEA 4I18B 4M8VA 3SGJA 5IMLA 4B60A 4H40A 3KAAA 5DGQA 2OW7A 3MMEB 3EFDH 5IF0B 2CIKA 1XF5B 3LX9A 1XB8A 5FO9B 1MFBH 1UZ8B 3CX5K 1E40A 1M05B 2B5IC 3P4NA 1QWNA 3S35X 5AVRB 4QLRA 4WI6A 5DQ9A 4YR6B 2DLIA 2P48B 1RZFH 2ALWA 4OI9A 3HNVL 1O5PA 2A6IA 5CGYC 3WSQL 1MXGA 2XZAL 3ZKXC 4MAUL 1FC1A 1S3RA 3MRGA 9CGTA 3WFDL 3MA9L 5CR1A 1PZAA 2GJZA 3MRNA 2OAAA 3W5MA 1I9JH 5DF0A 3IE4A 1WUNT 2NNFA 3LIZA 3Q2CA 4XP5L 4WAFA 4JKNA 4PB0L 2EVJA 1IGCL 3E1ZA 3OR7A 5ETUA 5K93A 4H26A 2XSKA 1H3UA 4WTXA 3WEXA 3VXSD 3KNBA 3KXFA 1LK2A 1Q9KB 4UBDD 4FG6C 3U6RA 2VDRH 2J44A 3IXAB 3MOBH 4EZJA 1N0LB 3ZHKA 1M57B 1MCOL 3UGEA 2I9LB 4J3XA 3APNA 3GF8A 1BGXL 3RPIA 4KO7A 5AVUB 2VDOL 2DQIL 2G30A 1HNGA 1BF5A 1YPZF 1XH3A 3RVVC 3R0MA 4M93C 1CBJA 1Z3RA 2APBA 1P9MA 2YEZB 3DC0A 3QIWB 4FD0A 4TSBH 3NCBB 4X9YA 4HG4J 4FI6A 3F5WA 3IN2A 4TPRL 2ZD0A 3VU2A 2JI1A 2BOLA 3DETD 3EFOA 3O2VL 4JG1L 1CDGA 1Z3GH 1IC5H 2BXYA 2OMWA 1CDJA 3B8YA 4Z0XA 5ITFB 2A2QT 2EINB 4J12A 4ODUA 3QJVB 5FS5A 2F5AL 2GTZA 5IROC 4HWBA 3RU8L 4HCRA 1IAOB 3C8HA 1KBPA 3B2VH 4NP9A 2FSEB 1EQWA 2P5WD 4P46A 1N5AB 5B1AB 1JZ7A 5A2CA 2R0WH 1OB1A 3DO3A 4JRXD 2D7OA 4Y1AE 2BP8B 3DJZA 1L7TH 5SX4I 3ROOB 2XVKA 5A7BA 1I85A 3K81A 1M71A 2FT7A 3PQYD 1D7DA 3L1EA 4HUNB 4TLTA 1G9MC 2H32B 4B53A 3Q0HA 2CM5A 4AITA 4HIPA 2BC4A 4TNWF 5B1JC 1ZGLP 3LNHA 3PHQB 1J9QA 1NLDL 3BSZL 4XP1H 4X99A 1NWPA 4ZUTB 3EZ8A 4OU3A 4PCTA 2AABH 4ODSH 3FQ1A 4HS3A 4KITB 5FECA 3OAZK 4G9FE 2VTFA 1UJ3A 4KFMA 4M43H 2HRPL 4OI7A 1D6VH 2ZUVA 3N06B 5I76A 3O2DA 4IM8A 3CXDH 1RZ7H 3RJQB 2BSRB 2YUZA 1IQDB 1J8HA 4JCLA 4ZSOB 2NSXA 4FQ1H 3NSDA 1JXDA 3VFVB 3I2CH 4FQXA 5G4OA 2W59A 4HLZH 4XN7A 4XR8C 5H35B 4AV5A 2VERA 1I7UA 4QCIB 4TVSa 2P52A 4Q6YA 2JJSC 2C1PB 2MNUA 4M8QA 5TE4L 5JTWA 1FORL 1NCBH 3D3VE 4I48A 3QJFB 2GKIA 2ID5A 2VM4A 4LIQL 5GIRB 1HXMB 3NJIA 1MVYA 4QTIH 3G5XA 3FF7A 1AC6A 3QDJA 1T2JA 4YFLF 1JPGB 2K6ZA 5C07B 5J7CC 4LFHD 3RTQA 2CBTA 4PV8A 1WBZA 3HKFA 3NCYP 4LLWB 2WY3B 3GM0A 1WFIA 1UATA 5E9AA 1X5FA 2C26A 3U2IA 2CU9A 2W07B 4KRPD 3BKML 3QDME 4FQCL 1NMAL 1VFOA 3MRLB 4L1SA 4QHPA 2OZNA 1OPGH 4YHZH 4B5ZA 1TZOA 4UOZA 3KJ6L 4B95C 4XAKE 1BVKA 3VE0A 2P8PA 3ZT7A 2DI9A 1NGZB 1QO3B 2CAKA 4X8CA 1FPTL 4KUCD 3QAZB 4MMXB 4GG6E 2MRYA 4QRRD 3QO1A 2JQAA 3QDGD 3KS0J 1XD1A 3V4PB 3PDOB 4CMHB 4CNIB 3IJ9A 1V27A 4TTDC 3BC9A 1XFPA 2DYRB 1MAML 4JQVA 1F3DJ 4O58H 1N18A 1VFMA 1GGBL 4H1LG 5ITBH 1QQDA 3G9AB 1PFCA 3PAUA 1KYOJ 2WWNA 3HC0A 1HH9A 1VADB 2FYYA 2X38A 1GSMA 4ZAKB 2CBQA 2KYIA 2VZUA 3QYNA 3T6VA 3MAWA 3M46A 3RI5K 3PU7A 2X09A 1GC1C 4HHAA 3EFOB 4LCVA 2X4TA 3VFWA 2VXUL 3HW7A 1XCTA 3FQ4A 2OL3B 1T1ZB 1C8QA 2J3SA 1EJOL 2XWZA 4Z7WA 2CO3A 2VXTL 4D0DB 5JXEA 4Q9QH 3PS6A 3QORA 1REIA 4L0ZA 2NLJB 1EMTH 3EXJA 2AXHA 2QGDA 4ZS7L 4Z3GA 1U8LA 3BO8A 5DFAA 3FQ2A 5FYJH 3KYOB 3SPHA 3MU3A 3PL6B 4M62L 3JXAA 3TPUA 1L0XA 2X6CA 3B83A 3NZHH 1A6TA 3U79A 5ABDE 3CDGA 1PG7H 4AYBA 4YAQB 4C4KO 3OHMB 4MMYB 4ERSH 4UT6H 3S48A 4I77H 2J6EL 5FHAL 1VACA 3DROA 3UTQA 2ICWI 3H2PA 4LOUC 4F33A 3TJEH 3ARQA 2WXGA 3C5JB 4P5TA 2DM4A 1MCWM 1QEWA 1Y0LB 1ZCRA 2V2WB 3PHSA 4PJDA 4HS6A 1KN2H 5DZNA 4KAQL 2WCSA 5TFSH 2P8LA 5FECB 3T0EC 1HXKA 4U3HA 1ZK9A 3BN3B 1R5VA 1SNRA 2FQGA 1MFCH 3PWUA 5F88A 4G8FA 4AW7A 1DO5A 1O6TA 3CCHB 3O2DL 5DJ6A 2PW2A 1T66C 5A40E 1EPFA 1OSPH 2CUIA 3V6FA 4AENA 4BCXA 4JPVL 4MXWL 2A9ML 3KYMA 1NA8A 4G1MA 3Q2NA 1EDQA 5K9JH 1IKOP 1IBZA 5DZPA 3ULUF 3CDCA 3P2DA 4DK5A 4S0SD 4ZFZA 4HJ0C 5DUJA 4NN6C 4PWGA 4X8XA 1YG9A 3OBAA 1HCYA 1T2QH 3V0AC 5E8DH 3DETC 5DLMH 3UXFA 4H8VA 2Z65C 1RULH 3VG0L 32C2A 4CC4C 1EEUA 1OALA 3L4TA 4FYTA 3DPBA 1YMHA 5C09B 2J4WL 1IGTA 3L1FA 3HFML 2Y69B 4ZFGL 1U93B 4KXBA 5HGBA 2K3TA 2Q2EB 4S1SH 4XN9A 1LTXA 2FDBP 2QPSA 5FYKU 2AK4A 3C60A 1J8HE 2XN9E 1G1OA 3QEQA 2Y6SC 1P6WA 1L7IH 4K2UH 3TN0B 3L9EA 2EDDA 3AXLB 4JM2A 4BZ2H 5AW6B 1CL7L 4MKTA 1X6NA 4G71B 5T3ZL 2G5UA 2ZCLH 2IAMC 3TBSB 1FNFA 3K8LA 4DOHE 4IK7A 1H8NA 3FONB 3FO2A 1QRNB 3P3TA 2YA0A 4YSTA 1Y1DA 4P5RA 3MV8B 5T1DH 2XN9D 1Y07A 2ZQKA 5JOEA 1AKJB 3T65A 4OGAC 4TUOA 1BQHA 2GEEA 3F04A 3R18A 2Q6WA 5KYWB 1QQDB 3P69A 5T1KA 5A3IC 2BFGA 3LH9A 3UMNA 3VD7A 2NXZB 4R6UA 1U0QA 1E4KA 4TUJB 1FUNA 3QZPA 4WU7A 2OJEA 2VXQH 4N2MA 1JTOA 3X1BA 4AOFA 4I9XA 5E6UB 5ANMB 2C9VA 3CGTA 3OD3A 2KHAA 1IFHL 3GRWL 4WK2B 4X5WB 5ICZB 2XPGB 4OLEA 3VXTB 2VC2H 2YA1A 4TNVK 4WI4A 3L2MA 4NBZB 2GBAA 1MCPL 4H0IA 2OFQA 1JYNA 3VWKD 4BDVB 2V2XA 1MFEH 2R2HA 2GIXA 3KBPA 3CSYB 4YK4B 5GGVH 1ET5A 3B1UA 4HPOH 2OM5A 5H2BA 2EYRA 5LQBH 4AYID 5KJ7E 2IV8A 4AW4A 3KYOA 4PJIF 4UAHA 3MODH 4NO2B 4AEIH 1OANA 4PJFE 4RFEA 5I8CA 2NYKA 3GS4A 3V5DA 3SY0B 4KK9D 3O41B 1PZ5B 5DJYA 5EV7A 2FJGA 2VXSH 5LWYL 3WYRA 1MHPL 1U8NA 1UD8A 2IH3B 3VGFA 2IDTA 4Y4HC 1Q0YH 3QISA 3V10A 5C3IA 3EOTH 3G5ZB 4R90H 3L5HA 3RHWK 2WLLA 5CZXD 3B9DA 4H8UA 3T8XB 4BK5C 4ZUSA 3V0GA 5IMLB 3QBTB 4PG9B 1GMEA 4HKZB 2PO6A 2WINA 3VXQA 2ORBH 3FZUD 3LY6A 1UB5B 1R3KA 3LEXA 3PP4H 4PJCB 3MBEB 4Y4FB 5L88L 3LNIA 3C6LA 1J5DA 1ZA6A 1KFGA 3N41F 5E9NA 1Y18B 5IG7B 4RZKA 4ZD3H 3PWPB 3N43B 1UOVA 2A73A 4YHPA 3K8MA 1NSNH 4FTVA 5C0BD 3RY5A 5ILTH 3OL2A 2BVPA 1MKFA 2GIMA 4NRXB 1VKXB 2ZYIA 3FB5B 4MZ2A 4EBQH 4XT1C 2APWA 5F3BA 2HFEB 3O6ML 4JQXC 3WEOA 1H0DB 4W70A 4MQ7A 4OT1L 25C8L 4WI9A 1XGRB 1VJSA 2F54E 3D2UD 3OKYA 4LVNB 4ZOEA 4Z8FL 4NO3A 3BAXA 3BQUC 1LO0L 3L1OL 5A6IA 5A6LA 3GJEA 3BI9X 4HAFA 4UTBL 1X7SA 3K2KA 1P7QD 2AQ1A 3AZUA 1KCRH 5SWZE 1YPZB 3LKPA 4LU5H 4OGQC 1AXIB 3UPAA 4AQAB 3MOBL 2WXQA 2K4AA 3DPDA 1ZLUH 1JGVL 2ZCZA 1OAUH 2EC9T 2IBZY 1S5IH 2JIXD 4N90E 2FX7H 5HJDA 1H9DA 4MXQD 2EYSA 1RK1B 3T0AA 4HULB 2W60A 4Y19B 1MCIA 4ANWA 4QT5B 1OVZA 4G8AC 2HZHA 2IPUG 3MTXA 1GR7A 4Y0GA 1L0YA 5CFAA 3LCYA 3QH3A 5SWZD 3LN5A 2WTRB 2VAAB 1YNTB 2GITB 5DEJA 2X6VA 3OKDB 5T1KB 1JNJA 5IT2H 3H2QA 4L1LA 4WI0A 4B3EA 4M6NL 4U05A 5ESQB 3IJYA 5JR1H 3QGVA 1F4HA 1DLFH 3QRBA 4ONHB 2Y4SA 4S1DD 3GHPA 3M1CA 4H2CA 3BZ4A 3NFPB 3FCUB 5EU3B 5FGRA 2HVJB 2VABA 3NJVA 2UX7A 1LP9B 4MMYA 4LHUB 3UDWA 2WP3T 5FCUH 4XNMB 3K72B 1BREA 2AFNA 4JZOB 1NC4D 4F33B 3DOSB 1I1AA 5GGVY