2YLKA

Carbohydrate-binding module cbm3b from the cellulosomal cellobiohydrolase 9a from clostridium thermocellum
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
145
structure length
145
Chain Sequence
b'MDVKVQYLCENTQTSQQEIKGKFNIVNTGNRDYSLKDIVLRYYFTKEHNSQLQFICYYTPIGSGNLIPSFGGSGDEHYLQLEFKDVKLPAGGQTGEIQFVIRYADNSFHDQSNDYSFDPTIKAFQDYGKVTLYKNGELVWGTPPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULOSE 1,4-BETA-CELLOBIOSIDASE
publication title A Single Mutation Reforms the Binding Activity of an Adhesion-Deficient Family 3 Carbohydrate-Binding Module
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
total genus 36
structure length 145
sequence length 145
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.91: Cellulose 1,4-beta-cellobiosidase (non-reducing end).
pdb deposition date 2011-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00942 CBM_3 Cellulose binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.710 Mainly Beta Sandwich Immunoglobulin-like Endoglucanase-like 2ylkA00
4B9FA 2XFGB 4TF4A 3TF4A 3ZQXA 3ZU8A 2L8AA 1K72A 1G43A 1KFGA 2WNXA 2WOBA 3ZQWA 4JO5A 1NBCA 4B96A 2XBTA 1TF4A 2WO4A 1G87A 4B97A 2YLKA 4C8XA 4B9PA 4B9CA 3ZUCA 1JS4A 1GA2A
chains in the Genus database with same CATH superfamily
3QAZB 4LP4A 3Q2WA 2PCPA 4TF4A 3BN3B 4G1MA 4O51B 4DN4L 2DLGA 2WMPA 3HG5A 1N6UA 5CHNB 3R18A 3VGGA 4OCXL 1I7TB 4UAHA 2KZBA 2NY1B 3RDTC 2WP3T 1T1XB 4MD0A 4JO1H 1BQHB 1TO4A 2YEVB 5IMOA 1NQBA 2IC2A 2XNAA 2YQ3A 2BCKA 4NI6A 1FZKB 2WIMA 4LEOA 1BAWA 1I1YB 3C5ZD 5I1AB 4OV5B 1W72L 5DRZA 1MG2C 5TDPB 3VXUE 3NMEA 3L3DA 3QCUL 1P7HL 4WK4B 1PAZA 3OJ2C 5ETUA 3ZZSA 3P69A 4XGZA 4FLHA 1HTYA 3UROR 4ANWA 4ZMPA 3NA9H 1JPGB 3HEIB 1AD9A 3ZK0A 4KZDH 5JHDB 1HDMB 4OLUH 4DK5A 3CXHK 2IAMB 4B50A 1KPRA 1MRCL 4JN1L 1MDAA 4OT1L 4KKAC 2VERN 3HRPA 4XNUH 3MMEA 1CLCA 3BQUC 1JZHA 3KWVA 2P5EE 2VN6A 3RVTC 4QR7A 2R4SH 3D34A 2FD6H 5DFWH 1H19A 4HFWB 4BQCA 1A7OH 3QIUD 5BV7L 1A4AA 2GTQA 5LGHL 4PJ5A 3M7OA 3QJXA 4KQ3H 1CVSC 1BOGB 1DANT 1FJ1B 2HJLB 3C08H 1TMQA 1QYGH 2YEZB 5H2BA 5AW9B 2CRZA 1MZZA 3RNQA 1TCRB 5F88B 3E80A 3X1BA 1JYNA 1YYLH 3V4UH 5HHPB 2HN7B 4KJYA 5T1DH 3DOIA 1JRHI 1UADC 4WUKH 5JPMC 2C3XA 3ZE2E 5HYIA 2ADFH 1EHLH 1NEZG 2EO1A 5ICXA 3HS0C 1FO0L 2JELL 3LN9A 1NCUA 4LBEB 4PHZA 5FV1L 3R8QA 8PAZA 4Q89A 1RSYA 5IEKA 4QRTA 3QWQB 3ARTA 5LBSL 1LL1A 3IB4A 3MJGX 3SDAA 2DIJA 4Z7UF 1RAMA 1E4KC 3R7QA 1I9RL 3N85H 2AABL 4C58B 2QSQA 5C0BA 2R2BB 1FL3A 3UYPB 1KCUH 3VXSD 4TL4A 5IB5B 2QADB 3VFPA 4NQQA 4NM8H 2W59A 4XN2A 4MVBD 1RJZA 1W8OA 4JDTL 3VFGL 3ETSA 2E9IA 4MQSB 5LAXB 3KPSB 1AACA 4YPGA 4ZUWB 4EDXA 2NQ3A 3JVGA 1ADQL 3N0AA 5A40E 4ZT1A 2Z91A 3KR3L 3DWTA 5EG6C 5IQ7H 2P7TA 3FQTB 3IMSA 1F11A 3MJ9L 5L6YL 3AROA 4AENA 3UAAA 2YAMA 3MLXH 3F7RA 3MUGA 3R1GH 3QDGA 3QHZL 1WA0X 3APNA 4PBWD 5FKPA 3ARBA 5L7XH 4MJ4A 4N8CH 4Y88A 3AS1A 4LL1A 4N2LA 3UJJL 2CR3A 4M5ZH 3PXLA 3MRIA 5EU5B 3CFJB 5J1TC 3T0ED 1KB5H 1ZJAA 2B59A 2I60H 1E40A 1JHLH 1F58H 4N0UE 2P42B 5E8OB 3NPSC 1L5GA 2DYPB 3HNTL 3LNEA 4BWTA 2G3ZA 3NACH 3GSOB 2E86A 1F18A 1I3RA 3WFBH 2Y22A 4KK5D 1UVQB 3ZL4H 2XWXA 4PJGE 1PD6A 4ZFQA 1X5JA 1HFUA 2PTVA 1KB5A 2WQAA 5J3HD 2H32B 4AV5A 4G6FB 4DP0X 4RRPG 3SPJA 1IFGA 2CO1A 1FVEA 2F54B 5IG7A 1AZZC 5EIIG 2PYFA 5I0YA 3TL5A 2R1XA 3W11D 3FB5A 3QWRA 3VO0A 5C09B 1OAKH 1DSYA 1U41A 3V6BR 1EEZA 1A64A 3G6JF 3U25A 2PO6A 3W9DB 3IFOA 4NS0A 2Y6TE 4NZRH 3ZHLA 1E3XA 4NBYB 5DD5H 5EF2A 1H8OA 4HUXB 4LMQI 3BWUF 3VFTB 1N68A 4LVOB 2JE8A 4QY8B 3SDDC 2W91A 2I69A 1AMYA 2F53D 2Q0ZX 5SX4I 2F5AH 4PRBA 1EA9C 1T4KB 1P5UC 5EMYA 4QXGH 4QO1B 4AOFA 1K85A 1QFPA 4X4ME 3RB5A 3UPRA 3RUGF 4PJEE 1MWAL 3QS2A 4OKVB 4P2OC 3SE3A 1WT5C 4XPBL 4GRWB 2DQJH 4LSPL 4LKCB 2D3JA 1YLBB 4XMKL 2Q3ZA 3ROOB 4WI6A 3SOTA 1T1WA 2ERJB 3QJZA 3BZEB 1T2JA 3UBHA 3VX1A 4UV4H 4G8GE 2AJYH 2FYVA 3QVAA 5MERA 2PUQT 4M1GL 4E2OA 1HSBA 2BVOB 1NIAA 3CSGA 5F7EL 1BZ9A 4Y5VC 5D72L 4HWBH 4XN9A 1J9QA 4DAGH 3TM6A 4EEEA 3B2PA 4U6TA 4Y16B 4CJ0A 4P3CL 2A4CA 1I3GL 4KOCA 1AG6A 1BVLB 3CHSA 4EDWH 4BYHA 4MD5A 2CIKB 1WBZB 3MOBL 3LKOB 1J5OH 3DX3A 2BNUA 4HWBA 4EBQL 4YX2L 3IAPA 3BSZL 1AHWC 1U3NA 1Q1PA 3L5WA 1FNHA 3JXAA 4K8RH 3EYUH 1FYTB 1LE9B 1A3LH 3GYRA 1AQDA 4UCFA 3P4MB 1OY3B 3BCFA 3KGUA 2H47C 1PS3A 3PWLB 2W9DL 1GGIH 2NY5L 3U46A 2VIRA 4PGDA 2C4XA 3E6HA 3W0WE 4EQ2A 1RSFA 3UC0L 4JLRA 1JD9A 4FFYL 5B1BB 5T5FH 4XCNB 1CGXA 1ZE3H 4XMLH 1WK0A 2WUCH 3MR9B 2CNYA 3G04B 3HHMA 2WIIB 5SWSE 2BSBA 3HZMA 2HT3D 5LNEA 3WJJC 5C07A 4DFIA 1DQDH 1FZOB 4JPWL 4BSVB 2ENPA 3GJEB 1EZLA 1RIUH 4LF3B 1RD6A 3DNKA 1CXFA 3BP5B 4YXLH 4DQOH 2CJ3A 2IEPA 5T5FA 2LU7A 1V55B 4HA1A 5DUPH 1KCKA 3ZT7A 4U6XA 2WMPB 3BAIA 4PVNA 1UFGA 2L04A 2PP8A 3NOIA 1AXTH 5BV7B 1TEYA 1U3JA 4M6OH 3ZDZB 4ZMOA 4MD0B 2F8VA 2CDFA 5IMOB 4YZWA 2CO2A 3EFDL 4C56E 1ICTA 3E38A 1OV8A 1QSVA 1TF4A 2V9UA 4LEOB 4YSUA 3FTXA 1BIIA 1Z9PA 3FSOA 5DRZB 3LQAL 4HXAL 1E9PA 2X40A 3I6SA 3L3DB 5ETUB 5GGTH 3AG3B 5IWLC 3M8OH 1RIHL 1EXUA 4AK2A 2HB0A 3UFIA 2G4EA 4PLKD 1AD9B 1WWBX 3L7EA 4JG9A 3F04A 1RUKH 3GM0A 5CNHA 2C1OA 3QXAA 4YVNA 5BMFL 3BEVA 4OD3L 4XVTH 4GEJA 4IBLT 3BMWA 1DBBH 1KPRB 1KN2H 4JE4B 4OZFG 4X5LA 1WO2A 5GGTA 3TBYA 5ECJE 3UPAA 3MMEB 1IGTA 1OPOA 1KPVA 5K9QI 1HH6A 2OTUA 3SSGA 3WIIH 5KVFH 2OJ1A 1QNZL 5LDSA 4NZUL 3DGGA 2HH0L 4MXWH 5H2BB 5ICYA 4D2NA 2AXWA 2JVUA 3KYAA 3RNQB 3T6WA 1JPEA 1XF4A 2DS4A 4GAJH 2EDYA 4G9FD 5LGJA 4I9WE 1RZFL 2O1AA 2ED9A 2I26N 1PZDA 1CI5A 3ZRSA 4CUCA 2F61A 3NJFA 4PP1D 5HI3D 4A7GF 5JOPE 1MQKH 5ICXB 1Q38A 1I8LA 5ADPH 4YUEH 3CDFA 1SFHA 2ZX5A 1BQRA 1DJIA 3RJQB 1USQA 5IEKB 4YDJA 5K69A 1U58B 1HEHC 4QRTB 3SDAB 1PQZB 1UWYA 3TVMD 3Q9QA 4JQVA 1LVEA 1XGZA 3K6DA 2YGQA 2L4OA 4P5RA 1TJHL 3LEYL 3AT8A 4F15B 2UWEF 2W0PA 1MLCA 4MBOA 4NQUA 4PLJD 3P9LA 4BXSV 5A16A 4XP1H 1IGCH 3VFWA 5MHSE 3B9KA 2IOMA 4M7JL 1ZEAH 4K9JA 4W93A 3OSVA 3WO4C 4DP6X 2QVIA 5EULV 1OGPA 1WQVT 3RTLA 2CUHA 3L8QA 1OK0A 1RJZB 3EBAA 4DUXA 5ABAA 4TVPE 5TE4L 3ULSA 1HQRA 3PABA 2XIIA 5AD0A 3DX4A 3AZUA 2B1AL 4EDXB 2C7FA 3MCKA 2Z91B 3X1FA 3EH4B 3TF7C 4OD1H 3O9WD 3VFMA 4HWZB 4Y2DD 4EZJA 2EDHA 4FQ2L 4AENB 4CU6A 3U7YL 1ADWA 3MUGB 3I6KA 3NQIA 1CPUA 3QDGB 5EU6E 2E7BA 4P05A 5CR8A 3WFEL 4KGLA 4W9GC 4CL7A 4DVRH 1HYSC 2ZCHH 4BZ2L 1CD8A 4KHXH 5DCCA 1N5YL 4GIPD 4A39A 4HWEL 5FFGA 5LAPA 1DQMH 4H26A 1AGDA 2EXWC 3ZMNA 4A7GA 3ZTDC 4BFRA 2V0AA 3MRIB 4FNSA 4JFHE 4MJIE 4OBRA 2B59B 2OMWA 3HNVH 4EI5A 3GTVA 4Z7UB 2XVLA 5DFAA 4HKBB 1T4WA 3KWTA 5I1IH 4XX1G 3ENEA 2UY6A 2UZPA 2YD2A 1I3RB 1ZLWH 4LLVB 1S7WB 1X5HA 4GT0A 4KKCC 3SKUD 4H8PA 1SYSA 4O58L 3TWCL 3UTTA 4K94C 4DZ8A 5FYLE 1KB5B 1T0OA 3P11L 3DO3A 1UFUA 5IG7B 1FVEB 1K5NA 4Z7VA 1VGEH 2PYFB 4HK3N 2R1XB 3WJMB 3FB5B 2FK9A 5L9DL 3RGVD 4W81A 3DBXA 4PVMA 5J13C 1KEGL 2MJWA 1QTYT 1GC1C 2PO6B 3IFOB 5BQDA 2WK2A 4M61A 4DFHA 1U8IA 3APMA 1WRFA 1KEML 1RIVH 4W9EC 2JSFA 3ZUNC 4FQLL 4F8QA 2X70B 2F8XC 3BDXA 4ORZC 3UG5A 3AY4A 5I73C 5DS2A 4JHAH 4PRBB 3D39D 4K3JL 5TK4A 1OD9A 2FBOJ 2NY6C 3EJCA 4R90L 3QFJE 2G9HA 4UF7C 2VNCA 4KJPD 2PTTA 5IEHA 1RULH 5CUSL 1FCCA 1IGMH 3CU1A 3V10A 2YKLH 3KYMB 4S1SL 5F7WC 4ADIA 5MERB 3UMTA 1DTUA 1GZHC 2GIMA 3QDMD 3JZYA 1HSBB 2A83A 1BZ9B 1E43A 1AG0A 5C86A 1V3LA 4KX9A 4QWWD 1WUZA 5EBGA 1WH0A 4AMXA 1GJIA 3UBXG 1KELL 1IIIA 4JVUA 4MKTA 1BM3H 2FEEL 2GC7C 3CPUA 3O6FA 3GINA 3OG4B 3PRZA 4I2XE 2DLIA 3GIZH 4QHMA 4URTB 5GGQL 4QXVA 5E4AA 3PWPE 4GEIA 2BHFA 2MH4A 2YSTA 4MD5B 4GI9A 5DJ6A 4ECNA 2O5XH 2BNUB 4KVCL 3UAJC 4DQAA 3PHQA 4G8FA 3TTYA 3S8WA 4L3CA 2ZXEB 3MDJA 3L5WB 4FA7B 4UM8A 3TO4A 5C9JA 5HVGB 3V5DA 1A9EA 2WZPD 2D2OA 3VYOA 2APBA 4N28A 5FYKL 1OANA 3U46B 2OPCA 1J9CT 3HC3L 2VIRB 3LD8C 3QRGH 3E6HB 1BBJA 4NQXB 4PGDB 3MOAH 5CMAB 5E5MA 5CEZL 2XVGA 4CU8A 4AQ8A 3VG9C 1WFMA 4JLRB 4MQXD 3VX0A 4D9QE 2EACA 3EOAA 3WS6A 4MHHG 5ALBH 4QNPE 5HHMD 4W9KC 1OLZA 3T9WA 5EEVA 3PXHA 4WGVB 1A5FL 3C6LB 3TONA 3IWUA 4FOMA 5BVPH 5ITFA 3WFCL 5A2AA 5KVEE 1JZ2A 3C60C 1KGXA 1Y6KR 5F7NC 2HUEA 5DLML 3QJHA 3DRQB 3JTSA 2CLRA 5KYUA 5HVWA 1LO2L 5L8KB 3ULUH 4Z23A 2CO7A 4U6XB 1HHGB 4IIQA 2E59A 5DD6A 5E9AA 1SOXA 2XTJD 1MI5D 5FYJL 4ZW7A 1NL0L 2OYKA 3UCRA 2HTKC 5LJYH 5DDHB 2DWTA 4G72B 2WZ5A 1JZJA 2CDFB 1CU4L 2YRPA 3H1ZA 3ULVD 4WFEE 4F80A 1BYNA 1SEBA 3LJ3A 4Z0XA 5E51A 1BIIB 1FFRA 4I18C 4K5LA 2MQGA 4LNRA 3G08B 1E9PB 3MU3A 4WEUD 3C9NA 2NY4C 4JS7A 2E6JA 3HG1D 4ZX6A 4J28A 1EXUB 1A3ZA 5LQBL 4AK1A 4NO0A 1ZXQA 2JI3A 3JZ7A 1OP5H 4RGND 4N85A 2V3DA 4ACPA 3IEAA 4GO9A 3KPRD 1HL4A 1NOLA 1FBIH 1KJMB 4MJ2A 4X7EC 5IJKC 3ILDA 3EYQC 4U7MA 3TBYB 1U3HC 4WENB 1IGTB 2HT2C 2FX9L 1KPVB 4OM1L 1AFVL 5HY9A 1IE5A 2ZUYA 3GXDA 1HH6B 2OTUB 3QQ9D 5D1ZA 4JM2D 2HA1A 2EP6A 3KCPB 1IMHC 5ANHA 2F15A 2ZG2A 1KBVA 4XPTH 1OP5K 1VFAB 2XKNB 5ICYB 1ID2A 1QSEA 5HYFA 2AEPH 1XF4B 2XQYA 4OZHA 4WVRA 3LB6D 3KWUA 1YECH 5LGJB 3FU9A 4MXVE 3TH2T 5SWQB 3VDCA 3SKJL 3ATDA 2ZXAA 3O2DL 4AXWA 4QHKI 1G43A 1SBSL 4HOXA 3ISYA 4Z7QB 1E8WA 1D5BB 3TA4D 2OCJA 2DZEA 3HBZA 4EN3C 2O6EA 2PN5A 4QCIA 2EIDA 1KCVL 1P69B 4XXCA 3K74B 3MKGA 2HVKA 1UEYA 4YDJB 4Y4FA 4NEHB 2R2HA 3CHRA 43C9A 4FFVD 2YPLA 2VRKA 2E7CA 1L9SA 1QSZA 1U4EA 3B83A 5BO1L 3MA9H 5A16B 1M7IA 5A3IC 3KLHD 3VFWB 3B9KB 3GO1L 2NNCA 5JZ7C 4GMSL 1AGCA 4FQXC 5K9OA 1X5YA 5CJQH 2A9MH 5F9OL 2WLMA 4RMQA 3RPBA 3TZVA 3ARRA 4JE0A 4FXGC 1N2RA 1KMGA 2AXFA 5FPIA 1FH5L 3ULSB 1HQRB 3NABL 4KK9C 5AD0B 1OAZH 2MOVA 4NQVA 1YO4A 1F42A 4Z95H 4L1LA 4PCYA 2NNRA 1XXDC 5HDBF 1UD4A 3MBEA 2APVA 3VI3E 4XCFL 2OMVA 1QBLH 3I6KB 4R0LB 1OM3H 5B1AB 5C0CD 5KEZA 1GOGA 3OB8A 2GSGA 3KYNA 4HWUA 3FN0H 3K2KA 4ZW8A 2DLEA 2X3AA 3WMPA 1KB9K 3P30H 1QO3A 4H26B 3VRJA 1AGDB 1NMCC 4LE8A 2F1EA 2B1HL 4NWTH 4KRNA 3FNKA 2D03L 4I3RH 3V79C 3Q1SH 1NFDF 2OMWB 3FQWA 2ZOKB 3QAZC 3QXTA 4K7PY 2HVBA 4MAYD 4N0RA 4DPAX 3F64A 3GB7A 2UY6B 1KGYE 3MRFA 2NY1C 3X17A 3O6ML 3VXMA 4IGBD 5JMOC 1IGYA 1MW3A 1SYSB 3UTTB 3VSVA 4DZ8B 4MLSA 3S3JA 1CYXA 1KCWA 5EO1A 5E1AA 3CXDH 1NM4A 4NM4H 1K5NB 5IB1A 2ZF8A 4Z7VB 3VI4F 3WNIA 3FZUC 1AQKH 3P2TA 3V4VL 1C5CH 2ZCKH 4XNDA 2A6IA 5C0FA 1WHOA 1TTBA 4JGNA 1ITBB 1VGKA 1XO8A 4XX5A 4XCCH 1G94A 2EEFA 4AQEA 3DBXB 5JHDE 1RCYA 1RFDH 3ARQA 3V6OA 4M48H 4R4ND 1DSFH 2VXSH 1UGKA 2X2IA 2IAMC 4P5TA 4KAQL 1H3XA 2LLNA 4I0PB 4YZFE 4XMTA 2B16A 3S37H 4NSKB 3NH7H 1F4YL 2IANA 3NAAL 3HCVA 5CS7A 1WBXB 4XMUA 2ZOLA 5EBMA 1L0XA 2G9HB 1THCA 4MYWB 1NCNA 2J8UF 2YD0A 5EPMB 5IEHB 3EJSA 3SJVD 3N1GC 4AIZA 2H41A 1OWRM 1T2QH 1Q9KB 3QJTB 3CHPA 2CJSA 3DETC 4JKNA 5D70L 5TE7H 1U8HB 3U82B 3WMQA 1Z7JA 4CSSA 1KTCA 4HIPA 1OO2A 1QRNB 4AYDC 2ZE0A 2FVNA 1MRFH 2Q8AL 3IMVA 1U3YA 2IIJA 4FHBD 3QEQD 5ICZA 4M5YL 4R5TA 3GM8A 1KN4L 2NZ9C 1FN4A 5D1XD 4IBWA 4WFGD 4YDIH 3KW8A 2CLZA 4GBXD 4GXFA 4TLSA 3O6FB 2I5YH 3SPCA 1KTJA 1ZMYA 3W39A 1A22B 3ARGD 3BXNA 1QKZL 2VABA 4PTUB 3QHTC 3KH3A 1MSPA 5DJ6B 1MHCA 2WQVA 1T5XA 4N2EA 1KZYA 1B3IA 2QADC 5DRWA 1Z66A 3IPFA 2Z7YA 1BZOA 2YAEA 4HKZA 4L3CB 3K2MC 4NJAL 2VLME 2GVYA 1B2WL 5C9JB 4B27A 3KPSE 3MUZ1 1A9EB 2WLNA 5CLTA 1HIML 3BAEL 1DUZA 1MH5A 3SGJA 4X8JB 4KKQA 1AO7A 5E5MB 3FO2B 3OQ3B 4FQJL 4UT7L 3VG0L 4ZFOA 4LCYA 3HMWH 2AVFA 3IMRA 3EOAB 3WUWB 3T77A 3S35H 1DO6A 2H5UA 3GMRA 4GY4A 4WW2F 2F0CA 2ROXA 4UAOB 5I30H 1KOAA 2VO8A 4RDBA 4W9IC 1FV1A 3Q8CA 4ZPTB 3OKNA 4UQ9A 1NINA 3FU7A 3QJHB 5DEGA 5KYUB 4R4FL 4CKVX 4FHJA 1MFEL 3D6GA 1LHZA 1SGKA 2CKNA 1MVYA 3LZQA 3BLKA 3QNFA 4CKQA 4IIQB 1Q9WA 2OSYA 4FQ1H 3WN6A 1BLNA 2VCOA 4AYEC 3L13A 5AVSB 3T4YA 4AGLA 4W9JC 2F54E 2IH1A 4X7SL 3CE1A 3N1QC 5H4YA 2Y06H 4JFUA 3LKSA 2BNQA 4HMEA 4QIRA 3L95A 3BYTA 3IRPX 5CXPA 5C09E 4Z0XB 1KCRL 2EH8H 5EUKA 3FN9A 5KYXB 3C9NB 1DVQA 1NC4A 4GB9A 4DNLA 3UABA 2KDGA 4NO0B 3CBJB 1M2VA 2NY2C 2EEDA 3DOSA 5CJ5A 5J1SC 1E2VA 4TN9A 3P3TA 3RZCA 3NFSL 4LVOC 2CG9X 2AQSA 4LLQA 2PPFA 5ICUA 5I1EH 4ZNCD 4ZTPH 4ZRGA 4IYKA 2QZ5A 2QGDA 4H20H 1BQSA 3CDZA 3AS0A 3O3EB 5HY9B 2Z8WC 2IH3B 4N2BA 5D1ZB 1X4YA 4GRWE 3OWEA 1J10A 3INUH 3B3IA 3VFUB 5C8JA 2PYEA 5GRVL 5EEYA 2ERJC 5T1JA 1YEIH 4J6IA 1QSEB 2AXGA 4J2QA 4PRPD 4X5XB 3E8VA 3L17A 4FQIL 3RNKA 2YQBA 4HCRH 4AXWB 1QWNA 1TMCB 2HRGA 4R4BA 5EEZA 2YZ8A 3BKMH 3NZHH 4OSUL 3VXUD 3CC1A 2E75C 4QCIB 4M56A 4YDZA 2HVKB 1K2DA 4LSQH 2ZUTA 4Y4FB 1AHMA 4Y16C 5DTFA 4AEFA 2R2HB 43C9B 2YPLB 5HHNA 1NCAH 2Y7SA 3EGDA 1RK1A 4PBDA 3LQZA 5E1QA 4HCRA 2BFVH 2DLHA 4X6FA 1M7IB 4YDMA 5E6SB 5JHLL 1SQMA 3U0PB 3HS8A 1FYTE 3BQUD 1AGCB 3JSSA 3RL2A 3S36H 5K9OB 3RVTD 3CAFA 2P5ED 3TZVB 2XVBA 1OZTG 2AXFB 5AL8A 1KBPA 3MRMA 4JRWA 4D9RE 4V1DB 5DC9B 4NQVB 1FVDA 3BSHA 2CGYA 1INQA 1X9UA 1ET5A 5IQMA 4XMVA 5B39G 3W2DH 1A9VA 2K6ZA 2Z0UA 3MBEB 3X1NA 3GSWA 4JG5A 2OMVB 1KXTA 3WFHB 4A2HA 3VH8G 4XP6H 1CTOA 5M7QA 1A14L 2GSGB 3FULA 3KYNB 1AOZA 2DKSA 3MPCA 3S5ZA 1BF2A 1S7TA 1B4LA 3U0WH 5JA8B 3RWFA 1KXQE 2DQUL 3ABLB 1KENH 2D31A 5DC2A 1G6RH 3V52L 3DLQR 1QUNA 2J1XA 1UZ6F 1RZIA 1H3PH 3G5XA 5E4OA 4X5PA 3JWOL 2VUKA 1PDKA 2JI1A 3FQWB 4JHWH 4RBPH 2FQGA 1WWWX 1RLBA 3GB7B 2FO1A 2Y2YA 3LXCA 2QVFB 2XJKA 4BEIA 2ZPKH 2ZWSA 3MRFB 3ZDZE 3SE9L 1BMGA 2DV6A 4I9XA 4PH8A 3VSUA 5J7CC 4YSSA 5BV7C 1JV2A 1G6RA 3N0PB 5GS2D 1IGYB 2XXCB 1UOKA 1WC7A 3KJ6L 4YLQT 5CJXC 5EO1B 2FGZA 1TZIA 3NFPA 5IB1B 1MHPH 3GMLB 2BVPA 5C3TA 4YHPA 4POYA 1LGVA 4UM9A 3W81A 1FCGA 5C0FB 3BE1L 4MQ7A 2BOLA 3GMPA 1VGKB 1JNJA 2Z3FA 2EDQA 4OLYL 4AQEB 1MEXL 3EXLA 1D5ZA 3FXIC 3PDGA 4FTDA 3SY6A 4YFLF 3S88H 1DBMH 4P5TB 1EHKB 1XX9C 1IKOP 4ODTH 3S6CA 4CW1A 5I5IA 4G71B 4HIJA 2XWTB 4K2UH 4NYLA 2R4RH 4X0KA 5FLUA 1ORQA 1T6VN 1V7MH 5AKRA 5BUGA 4WHDA 4FNUA 3I9AA 3ILEA 2BWIA 1P4LA 4YHNA 2QKSA 2IANB 5I66A 2HZHA 1MAMH 4GXVL 3HCVB 4OAWA 5EBMB 2ZOLB 3MRBB 3VGEA 4AIZB 1MFAL 2Z35A 4KH2A 2EXTA 2GJJA 4Z3IA 2PWEA 4O5LL 1RUAL 2VLKA 5DZPA 2BVEA 1O7SA 5F7UA 3HRZA 1AGEA 2QSTA 3MA7A 2ADJA 4OFQA 4DP4X 1YNLL 5DEZA 3VJ6A 2I24N 1QFWL 5ICZB 3B9VA 3VFVA 5I2IA 4NNXA 3VYPA 3REWB 2BJMH 5I18L 1AY1H 1DVFD 1OTUD 3IXAB 3UJIH 3FTGA 3EXJA 2CLZB 3BN9C 1EDYA 2BRQA 4J3OG 3MNMA 4F15C 4L8SB 3W39B 2V7HA 2X3CA 5D5MF 1A6VL 1KSRA 2DQIH 2A99A 3O4OB 2XBDA 3MLZH 3SQBA 3SDDD 2ADYA 1MHCB 4P5MA 1T5XB 4KY1H 5DRWB 4YSRA 3T2NH 3RJDA 2CALA 4ZMNA 4HKZB 5AFAA 4I8DA 4P5KB 4DTGH 1JTOA 2VXTL 3FH8A 3ZE1F 3HKFA 3UG3A 3DHMA 4B9ZA 4LCIL 3RWCB 3ELQA 2YWYA 1EMTL 4ZOEA 5FWQA 4P2OD 1DUZB 1MH5B 4HJGA 1N4XL 5HGAA 2OR9L 1JGEA 5AL0A 3IJHA 1EGJL 3MQIA 1NBVL 4PUBL 3VACA 5FM5M 4QDGA 1AO7B 2DB8A 3T6QC 3QDGE 5DVKA 1W8NA 4TULH 5J0BA 4CVXA 4ZFOB 3LV3A 1KCSH 3EYSH 3VQLA 3FB6B 4G8GD 3QS3A 3QT2A 3T77B 3T4AB 3GMRB 2IQAB 3WN5C 3B2XA 4N1HB 2YA0A 3KW7A 5D8JL 3EBHA 5KWYC 5EO0A 3K7UA 3RURA 4QJ3B 1FV1B 4OJAA 2V8MA 4FMVA 2YBRA 4ZYKB 1JHKL 3QC6X 5CBEA 2N7SA 4M7KL 5EF3A 2IAAC 4WKZB 4Z7UE 5D7LA 5DEGB 4XPFH 2W80C 1EFQA 4HXBL 4R7LA 4KDVA 1JPTH 4FP8H 5DJZA 4U6HA 4EQ3A 3ZZLA 5F72S 1Q9WB 4K3DH 4LEEA 4AT6A 1BLNB 2ZT9C 4YEEA 4DGYL 3T4YB 4ALAH 3H42H 5F8QC 1B6DA 3BP6A 2IH1B 4NHUB 3DIFA 3GGWA 3SDYL 3X1EA 4KZCA 3FU3A 3NA4A 2N7BA 3S5LA 3L95B 5EORL 2CLVA 2OKMA 4PV9A 5D1QA 1TCMA 2J5LB 5EUKB 2AJXL 5DHDA 3OQRA 1IGFH 2BINA 1P7QD 2I25N 3TP4A 5IESH 1XB6A 3MFFA 1RVFL 4KXAA 5SWSD 1UA6H 4HC1L 5SV4A 3RZCB 3HC0A 4AEIH 1A66A 3V0GA 4LLQB 5L4JA 1XR9A 4AYMC 5E2UH 4BWUA 1ULVA 2FO4A 3T08A 4E9WA 4WI5A 3U1PA 1FDLH 5K1NA 1CFQA 4LPVA 2XV0A 4GW4A 4RESB 3CDZB 1Q0XH 3D4GA 3SGEH 4YSEA 2R0WL 3B3IB 5C8JB 1V27A 4HAGA 5DJYA 3VD4A 2PYEB 1S5HA 1KXHA 3II2A 3IU4L 4MJJA 4N8UA 1QR1A 2C7UA 1VFMA 2NY5C 3ZQ9A 5INDA 2V3FA 2GJRA 2AGJL 2AXGB 3BKJH 3VGFA 3CX5J 3WNKA 1MPAH 4FG2A 4C56D 2Q7YA 2WBJD 4BZ1H 2HKHH 3QZOA 4R4BB 1I9JH 2IWEA 4ELMA 1E5AA 1H5BC 2FBJH 3AQZA 3BLBA 3FFCA 4J6RH 4QKXB 1VB9A 4S0TD 1K2DB 2J1WA 4NP4L 5IJDC 5DTFB 4WHYH 3H2QA 5K5YA 1DQQB 1JXKA 5HHNB 4K9EH 4LESA 1ZTXH 1RK1B 2P24B 3EGDB 4PAZA 4TPRL 4BZ1A 4X6FB 4WTQA 2MTPA 5JLZA 2JK5A 3BWUC 3EH1A 3NSYA 3PHAA 2C34A 4HMCA 1BJ1H 3RL2B 1FFOA 4JR9L 4UIMA 2BW4A 1ZVSB 2ZYSA 2N3JA 3OHXC 1RUMH 2LE9A 2D2CC 4FABL 2WCSA 3B6SB 3MRMB 1OCWH 3RHWK 3MRLB 1N0XH 3RA7H 1FVDB 4AV0A 4NI3A 1IC7L 1INQB 1QQDB 5DWUL 1VESA 3FRPB 5E5LA 5CZVL 1TJGL 4Z3EA 5JOEA 3GSWB 3ESOA 1KXTB 1DE4B 5HHVL 3U4BL 4BCYA 4I9WD 5GHWH 3VM5A 1NANH 3QQ4A 3VXRB 2AJZA 2JTDA 3C6LC 3KPPA 4M1DH 3CMGA 5JOPD 2CRYA 5ELIA 3RWFB 2DM7A 3GHBL 3SZ6A 2D31B 3FSWA 1RZIB 5IFAL 4LPCA 2M26A 3BVNA 2QQNH 3MREB 3PWJA 1ZE3C 5GIRB 3OKDA 1TYEB 2IOOA 4WF7A 3NEOA 1JGIA 4XWOC 4PI2A 3S3DB 4QYAA 4B7IA 3C5SA 3FCSB 4BJLA 3UC2A 4WJKB 3U7WH 1GOFA 2XJLA 3FSVA 1JV2B 1G6RB 3FO0H 3HFMH 2F08A 4NT6A 3V0WH 2XVKA 1DBKH 4JO1L 1PCXA 1NCDH 4KVNH 1F4XH 2B08A 4LCWB 1GA2A 4TVPD 3VQ1C 1J87A 1TZIB 2X6MA 3B3BA 5TH2B 3NFPB 1SJMA 2BVPB 4GINA 5F97E 3GPEA 3H8NA 2JMRA 4UM9B 4X9BA 4MQ7B 3SYCA 3GMPB 3B7SA 5TFSH 2MQCA 4MX7A 2WXFA 7CGTA 4QJ5B 3VRLF 3RU8L 1D5ZB 1WZLA 4RQQA 1YAIA 3JTTB 3CDGA 5EU6D 1HYSD 1BG9A 5I8CA 1L9NA 3GNML 5IJCC 5DC0A 2GK2A 3R4DA 1X7SA 2HX9A 4HKJA 3DA0A 4CW1B 3OPZH 5FA3A 3GKZA 4HIJB 4NYLB 2DQEH 3G5YB 4X0KB 1IGJA 4XNUL 1G1YA 1ORQB 4JFHD 4MA8H 4MJID 1QZNA 3QZMA 4IOSD 5EOTA 1P4LB 1U8QB 4QOKA 4WCYL 1K4CA 5I66B 2X9YA 2FD6L 2RJMA 3IM1A 4LK4A 2X0VA 4WFFE 3WLBA 4OAWB 1RUPL 5FFLA 2X4UA 4HS8L 1MCIA 2E9BA 4KKCD 4L5FL 5CGMA 2Z35B 3LY6A 3NCYP 4B0MB 5MP6L 2VLKB 4AZ8B 1JMXA 5FYLD 3HRZB 1AGEB 2O6CA 1M3IA 3E1F1 3MA7B 3RVUC 5C6TL 4Z7QE 2ADJB 1OP9A 4XNXL 2W95A 4N0YL 1W6LA 1Z6JT 3VJ6B 4C83A 1PIGA 4JRXA 4KXCA 4V2BA 4UT6L 1U95A 5F0JB 4DUWA 1I8LC 3VFVB 4AGMA 5I2IB 3IDMA 1F2QA 4NWUH 3FTGB 2FB4L 1CLZL 1LMIA 1DHKA 1K5WA 2CNZA 2QL1A 3OJDA 4JQVC 4FX5A 3U6XS 2KZWA 1M7UA 3MLUL 4RMWA 4N2DA 1IAIL 4O4YH 2QQLH 1HINH 4W9ZA 4A67A 2YUWA 3B9KC 2GHZA 3PNWA 5F9AC 3SQBB 2LU3A 4FEMA 5KBKA 2VKXA 2WWMC 3A4EA 2J12B 5TD4A 1G7MA 3A6BL 3GSXA 5E4EC 1C5DA 1H8NA 1YEHH 3KYKH 4A7UA 3FT0A 1JXGA 5E2JA 3EBIA 1HYRC 1OT1A 3SZKC 5JW3L 4HJGB 5HGAB 1JGEB 5A6MA 4L1SA 3IJHB 1O6VA 3EO1A 2WOYA 3UADA 5FYJU 2VDQB 3CD4A 2X5PA 3B2VH 4X2UA 2X4RA 4H7VA 3LV3B 4R0LC 3LMJH 3UEQA 3R1GL 2J56A 1IGIH 1FFTB 1CTNA 4BQ6A 1PD0A 5CINH 5EB9A 2K45A 1OD7A 2ED6A 3IXTB 5EO0B 2V9RA 3F6JA 1C12A 4IIZA 4RA0C 3KHOA 1MAKA 3QIBC 4NZDA 4JGMA 5EA0L 1GSKA 4I48B 5LXVA 2LAAA 2YBRB 3HB3B 5CBEB 3FB7A 3NT0A 2UZXB 2BZ7A 3EOTH 5D7LB 5F1KC 1YRKA 1JHLL 1K4DA 1MCHA 1A6UH 5I82A 2WKOF 1KFGA 4HF5H 3PWPD 2XQBH 3UAJD 5D5MB 3UTTE 4EI6A 1ITCA 3OMNB 2NOYA 2P26A 2BS71 5GGSA 2HTLC 5FGBA 1OHZA 4RAVA 5IIEA 3QJOA 1G1OA 1KIPB 2XT1B 2Y5TB 3V0VA 3BP6B 1KULA 3IBEA 4Z7VE 3DIFB 1NLDH 3TIDA 3GGWB 2AHIA 2SODB 2ESVA 2CLVB 1OKEA 4PV9B 4PW3A 3U30B 1CICA 2AS5M 1XF3A 3L3OA 5ENWB 3CX2A 5K33A 1FNEB 4Q0XH 5FFOA 2WLYA 1UZ8B 4AYBA 1OAKL 5IW3A 2EE9A 1BZEA 1XIWA 5MENA 4OCRH 5GGUA 3DJRA 4NZRL 3MFFB 5DUJA 1YPZF 3D50A 1N8OE 2EE6A 3LHPH 5CD5C 1B3JA 3HC0B 3MV8B 4Y89A 4I0PC 3KL0A 5E94A 5AZEL 3AY4C 3C60D 4W6XB 1SDYA 1HXYA 2D7TH 1JCVA 5F7YC 2FO4B 3SYQA 5JIKA 1OGSA 2HKFH 5DUBA 4B41A 4CSTA 1MFCH 4MAUH 4GW4B 4O9HH 1HXKA 2BDNH 3MJWA 4IDJH 4QXGL 3J7HA 2UX6A 5HPMA 1QEWA 5C3IA 2WLLA 1CWVA 4RVBA 3PP4H 5ACZA 4P8QA 3EBGA 5TJWK 3EFFA 1IQWL 4LLYA 2HTKD 5DJYB 1S5HB 3VCLA 4IKNA 2EDRA 2C7UB 1UYWL 4YIQA 5INDB 1QRNE 5CEZE 4EOWL 4EXKA 5BRZE 5EU7E 2VSMB 5DJXA 3FF8A 2L3BA 4Y8AA 1ZLVK 1T20B 3FTUA 2Q7YB 2H2SC 5EU7C 2RALA 1O6TA 5CKGA 4ELMB 1ZLUK 4M62L 1EAOA 1AMXA 1IQDA 4LRNL 1E9QA 2NY4D 5AVXB 3FFCB 5HI4C 1YDPA 4DAGL 1D6VH 2ZCLL 3O6FC 3UO1L 3RWIA 1N6QH 1JGVL 5H94A 5I1KH 1MVUB 5DT1H 3NIFF 3TGXA 2WB7A 4L9DA 2SEBA 2JK5B 1YYMH 2QVTA 3PU7A 4UDUB 1RPUA 3G6DH 3HC2A 2HT2D 3WEBA 1I9EA 1HZLA 4UIMB 5FYJE 2PCXA 4K0OA 2DWYA 3WS3A 4F58L 2GQHA 3EYUL 2NXZD 3TV3H 2R69H 3WE1A 4U1SB 2F5BH 4AZUA 1S7VA 3NSDA 3AXHA 4AKPA 1UB5A 5I74B 4JO4L 3OM3B 2UVEA 2KZ1B 1GGIL 3EHBD 3VRIA 3T65A 3GHEH 3L3IA 2P48B 4YHIA 2XWJA 1WHPA 2AXHA 4KQ4H 3ME0A 3M1BA 1CT8A 4PM1A 1QI5A 2FQDA 2R69A 3QQ4B 2KQNA 4XMLL 2Y36H 5LN8A 3Q44A 3MNZA 1BCIA 2HPOA 3BFOA 4UAOC 4Y4HA 4WEEA 4ZXBA 3SGEI 3KPPB 4EN3D 1DQDL 3DO4A 2O26U 3RGHA 4ZFGL 2MKLC 5TF1L 4GSUA 4PJ9D 4RWYH 2MCMA 4ZQTA 1L7TL 5HJGA 4UDTA 1WFOA 2AEQL 3BVNB 3PWJB 3SIKA 4YXLL 4F20A 1IM9A 4IKLA 4D8OA 5A3ID 3OKDB 4Y9GA 3OMAB 3EH3B 5A6IA 2W1NA 4IIQC 1E90A 1WS7A 3PGDA 5JZ7D 3S8FB 4JO5A 3FFDA 3C5SB 3ARYA 4LPWA 4FQXD 3R7RA 4JMNA 5T1KD 3NCCB 1EK3A 4OM0H 3MN8A 3B9DA 4PTTB 4BFFA 3D69A 1LO4H 1UM6H 3HC4H 4M6OL 3ULUE 3Q05A 1GS7A 1KCLA 3ZYZA 3ULUC 3FT2A 4KK9D 4BCXA 2IWFA 3PUUA 1NM9A 2FYYA 4QRPA 4LB8A 1OE2A 4TLKA 3F2LA 4JBSA 1X5XA 3ABMB 1R3JA 2DLTA 1J8HE 3ROLA 5B7FA 4MSWB 4Y2DA 1SOSA 5HHOA 4F33A 5DQ9A 1XL4A 3QQXA 2JIXD 4P59H 4I77H 4RQQB 3LKRA 4WIQA 3CDGB 4JM4H 1D6EA 4PJIF 5I8CB 3FTYA 3DX0A 1KDJA 2ZJSL 3O0RL 4RRPA 3ZTEA 2EC8A 1H3UA 4HKJB 4M4PA 4N8PA 4OJDH 5EIIA 1G9MH 1RURH 4PGEA 4HVBA 1KN2L 4OGQC 3S3SA 3FFOA 1IGJB 4FA6A 4Q9CA 4CDHA 2AVGA 3FK3A 5EOTB 4LKXA 4QOKB 1JVKA 1K4CB 5D1ZC 1NANI 1D5XA 4WHTA 3WLBB 2X4UB 2NY1D 1AH1A 3HZKA 4UB0L 3AITA 3P3YA 1UURA 5KJRL 1QSEE 4ZNEA 4HT1H 1OOWA 3Q13A 4PWFA 1TUPA 1QVOA 4POZC 1GRWA 3FZUD 4JX0A 4P2QB 2ZUVA 4GJTB 2FZ3A 1X5MA 3EDDA 4C83B 3TT3L 4JRXB 2HG5B 4CMHB 1U95B 3TBVA 4DP8X 4Q6YA 4X6EA 1X5AA 3X1GA 2YPLE 5JHDD 4JFEA 4BQ9A 5FUOL 4KITB 4LVEA 3OJDB 5IBLC 3DVGA 3L7FB 4G6KH 4DIXA 2IAMD 5E03A 2WQ8A 1XWVA 4FLSA 1FNLA 4JFFA 5FCUH 2W8CA 4PJIA 3PNWB 2APXA 4C55A 4XR8C 3ZL1A 1JPSH 1OTSD 1TVHB 4XNAA 4AG4H 1G7MB 3GSXB 4R7NA 1C5DB 1TYJA 4UV7L 3FHQA 4Q52A 4N2KA 4V1DE 2Y2WA 2D7QA 4FI7A 3AQDA 4ZTOL 4PS7A 1OSZB 1AZRA 3E1ZA 5IMMA 3EO1B 5IROA 3Q3GA 2CH8A 1UA3A 3LCYA 4PW4A 3MBEC 1PZ5A 4U1IA 2X4RB 5AALA 4UOW1 5LCVL 3WSQH 1FPTL 2FX8H 2ETWA 2GBTA 2AK1L 3QDMA 2AW2A 3BVDB 2ZCHL 1D7CA 1HAWA 3DV4B 1C12B 2NZ9D 4WWID 1RKRA 2FLRT 1GYCA 1CK0L 1KZQA 5HYJA 2EUXA 1J0YA 4XVUC 4X50A 1ET7A 2WM0A 3E8UH 3FB7B 4NGHL 1PFCA 1N8ZA 1U8NA 1NCCH 2ZX9A 3D9AH 1K4DB 4OFDA 5AVZB 3KBHE 4Y9CA 2JI2A 1HCZA 3QW9A 2N01B 3UYRL 1XV8A 1E2WA 3IU3B 1BW8A 4JFOA 4ZDHA 1NGQH 4AGOA 4EI6B 5GGSB 4AEHH 1CF8L 2Y1ZA 1I1FB 5JR1L 2BSTB 5CILL 2VLMD 4PJ8A 3QYNA 3PWNA 3HMXH 2Q7AA 3KPSD 2VM3A 3PL6B 1QG3A 5AZ2L 1EO7A 2Y2TA 3TIDB 5TDNA 4A2LA 2WBXA 4L48A 2NLJA 1QA9A 3CV5A 2C3GA 3EJUA 4QHLA 1I4FA 2ESVB 2R56H 4PD4J 4PJXA 4WWKC 1CICB 2X7LB 1YZZA 3FQ2A 3L3OB 3SQOL 4M1CD 4DGIH 3V6OE 4IRSA 4GQZA 5PAZA 3V6OC 4P46A 5MENB 2AI0H 3HMXA 5GGUB 3RX9A 1ETB1 5K39B 3MODL 1L9RA 3H2PA 4P5TC 3GJFH 5E0QA 3BH8A 1R46A 2EE2A 3LH9A 5E94B 2CWRA 3AU1A 4Y9BA 4DH2A 4OZFH 1MHEA 1HXYB 1SM3L 2YRLA 5KW9H 2IANE 1CFVL 4RCAA 5HDQH 3UJTH 1MFVA 1RZQA 4FYQA 4H0IA 2DYPD 5TGBA 4JHAL 3ULVH 3AM8A 5AWNH 2ENQA 5EUOF 5DD1L 3H0TA 5HPMB 1QEWB 5ACZB 3GJFA 3FO1A 3H55A 4X6DF 5FHAH 4ZFZA 3EFFB 3TV8A 4CDGC 4LLYB 5KSAB 3TEWA 4ZS6C 3VCLB 3VQ2C 7FABH 1MI5A 4OZFA 3CN3A 4H8QA 4YIQB 3BIKA 4FNQA 2VM4A 2OYMA 3H85A 4G6FD 3KDPB 5CEXB 3MLSH 4YSPA 2F54D 4NO3A 2CK0L 4UINH 2YRBA 4RGMB 1WV7T 5DJXB 3GK8L 5ITBL 1FH2A 5T33H 4OJFH 3SPIA 2IBZX 4HISA 5C09D 3BESR 4PJCA 1IQDB 4L1BA 4FFWC 1E9QB 3GS7A 1U8KA 4ZMXA 5IHBA 2H9GA 1RU9H 1ETJA 1FLTX 4UTBL 5DFVC 3V7MA 5C71A 1S9WA 2X12A 2WXNA 3JBG7 1BAFL 1NMBL 3P4LA 1SLWA 1GZQA 4KI5E 2ICES 3KJ4B 3HA0A 4L8SC 3NRPA 4LSRL 4OCNC 3CZFA 5H94B 2DW5A 2N7AA 4KI5C 1DQVA 3O4OC 1TNMA 2UYLA 4KTEL 4A2EA 1D9KC 2XA8L 4U05A 4NXSA 1T7YA 1NEZB 2ZXBA 5GRUL 2V2XB 4YE4H 4IMLB 2OSLA 5MEPB 2P46B 5GJTH 2BRRL 2ITEA 3WS3B 4WRLA 1JWUA 1LJMA 3CDCA 5ALCH 2VMCA 3M7FB 4MRBA 3PLYA 1XVSA 2VWEC 3LH8A 3SGJC 1UB5B 4XODA 1A7NH 1AO7E 5D71H 2XY2A 3VRIB 3LNDA 3T65B 3T0BA 3L3IB 3MUJA 5GISH 3C2AL 2XWJB 3QRGL 4OLWH 5AW6B 1CYWA 1NIFA 3M1BB 2ORBH 1CT8B 1F3DH 5DMIH 3IDUA 3NSFA 3T4AC 1IC5L 3EJPA 5ALBL 5CAYB 4MMYA 4Y4HB 4ZXBB 1HI6A 3MLWL 1WZMA 4WI8A 1SOQA 1UB6B 1DZ0A 5KYYA 4UDTB 3ALWA 5A7EA 1XCTA 3PWUA 4PLNC 3RIKA 5JQIB 1IM9B 2X4PB 2GB2A 4JFXA 4YOKA 4YHKL 5LUMA 4PJ7A 1WE5A 2AJVH 2OK0H 3NIFB 3PGDB 4QUOA 3B8SA 3FFDB 3NSCA 3N42B 4AIEA 5T1MB 3OAZK 2E9GA 1FYTD 4YXKL 5FOJA 1E4WH 3GPSA 4MA3A 3D69B 3U1SL 3RWDA 3G5ZA 3K72A 4JFWA 4JZNB 3FT2B 1LK3H 4AQOA 4DO5A 2FYYB 4D9RD 3BDYL 4QRPB 2QVKA 3LNFA 1V5JA 3CK0L 4KUZL 1MFMA 2PR4H 2ZOTA 4MA7L 1B2YA 5DO2D 5A1AA 5L4MA 1NCTA 2CO4A 1R3JB 2VT0A 1J1OL 5HHOB 5DQ9B 1FGVH 3PAZA 3B37A 3LKRB 5E00A 2BSSA 1D6EB 3WO3B 4ZBJA 2H1LM 3RZCC 2XETA 4E41B 4X8CA 4KHTH 5B7EA 5IUSA 5EIIB 1Q90A 4CN6A 4MMZA 1SHMA 3WY2A 5C0RH 3ZIYA 5DC4B 4DO4A 5B22A 4NQDA 1BEYH 3LS5H 4X9HA 3WY3A 2V5YA 4DOHB 3I50H 5IQ9A 5L4IA 4LKXB 3RWJA 5IVOA 3DOHA 2Z8VC 3A6CH 2PYEE 4FNRA 2ARJA 4KTYA 3CIAA 2B4CL 4L23A 3DHUA 4N6QA 3NJGA 2J21A 1OOAA 4J3SA 3W3BA 1XZ0A 2I9TA 2E46A 3FCTB 2WNWA 1U8OA 3MRGB 5I71B 1K8IA 3FQNA 1QVOB 4MMXB 1MFBL 3QFGA 3ZY7A 1GR7A 1RK0B 1A6PA 2J6EL 3N5AA 2CBPA 3SPHA 3ZSSA 1C5BH 2NCEA 1A25A 5D96B 1BVNT 2DBLH 4XBEH 3TBVB 4F5CA 3BJLA 1N19A 4L4JA 5F96L 2UZYA 5KN5B 1C1EL 4XMPL 4JFEB 4N4YB 3DVGB 1EWHA 1E4XL 3QK0A 2YD9A 4PJIB 2EICA 3IJYB 1U92B 3HBPA 5F0LB 2RIKA 1R1CA 1UT1A 4LOEA 4CA4A 1HK6A 3TYGL 4R7NB 4CVUA 4DN3H 4Z77A 3MUUA 1NUGA 3UBXA 2GSMB 1AGFA 4ZMWA 5A2KH 5B38A 2NTSP 1ZV2A 2Y7NA 4ONGL 5DD0H 4PJ5D 3CN0A 1JBJA 4TNFA 5IMMB 2JQMA 4Z95L 3Q3GB 1TQWA 2ZWNA 5DS8A 1NAMH 2J20A 1ZOXA 1PZ5B 1UM5H 2FDBP 4U1IB 4W6YB 3WEMA 5A2IH 2CMRH 3VXRE 1QBLL 5K9KA 4LIQE 1JGLL 2DICA 3FT9A 3FN0L 3LVEA 1J8SA 4FXLA 4NKMA 4EZMA 5HYJB 2N4IA 3LEVH 4MB5A 3SDAD 3WY4A 5ANMA 4X83A 3NCJH 3DPDA 1NAMA 3WFDL 5D1XA 4Y1TA 2X6UA 3BVXA 1N8ZB 1U8NB 1PG7H 3LZPA 3VW3L 2RCSH 1QZ1A 1JN6B 1UD3A 4JFOB 1RZJL 2WXPA 4ZDHB 4Q9QH 3FQRA 1QP1A 2UUDH 3WGUB 1ACCA 2IGTA 3CH8A 4AW7A 2MTAA 1HNGA 1I7ZA 1MCPL 1RZKH 1RMFL 4IMKA 4LCWE 4M8UA 4PJ8B 3PWNB 3TEZA 1DN0B 3HLAA 3QCVH 4M9OA 4N1CA 4HUVA 2CR6A 5B8CA 1ILUA 5TDNB 3CH1A 2DAVA 2NLJB 1QA9B 1I82A 1U8LA 2DQGL 4QHLB 1I4FB 4PJXB 2FLMA 4TNEA 2R0KL 4XVSH 2BM3A 3IDJA 4H0GA 3QDGD 4GQQA 4IRSB 2WINA 2Q76A 3GXFA 4IJ3B 1OLLA 4F8NA 1U91A 4P46B 5I1CH 2EE3A 1BREA 3ARBD 3H4HA 3CXHJ 2YD3A 5IW1A 1BD2A 2X41A 4JG1H 1DSFL 12E8L 3AS3A 4LCUA 3BH8B 1HILB 3F01A 3WENA 5FA4A 3AU1B 5JDJA 1OT2A 3QUXC 3ZTNH 2W81C 1AI1L 1JK9A 1MHEB 1UT2A 3SGDH 3NJNA 2XDHA 1INDH 4GAYA 1JGDA 5TGBB 1XZWA 1GMIA 1XMWA 3BO8A 1TETL 4N5ED 1MF2L 5EHFA 3H0TB 3UTSB 2KMWA 2VQUA 4UTAL 1UH2A 3FO1B 1TSHA 3GJFB 2O6FA 3GRWH 3NJIA 2VLKE 4L8BA 4LL9A 5FOBA 4ZFZB 3P73A 3S4SA 1LD9B 1U8JA 4OZFB 2GEEA 3BIKB 4ODBD 4R26H 3HRZC 1YAZA 3D48R 1E4JA 2XTSA 2DIEA 4QHUA 2R23A 4F37K 3QWRD 5FO8A 2C3VB 4WDIA 3FUDA 4KZ0A 4Q6IA 4KFMA 4A38A 1JPFA 3K2UL 1U8KB 2H9GB 2WVUA 2PO6D 2DKUA 1S9WB 2AQTA 2EYSA 1UCBL 1R3IL 2X6CA 4KK8C 1GZQB 1MXGA 3EFOA 2H8PA 3AC0A 3CBRA 3BAKA 1SLUA 2YD4A 3CZFB 1EUUA 3B8YA 1JGUH 3QPKA 4PS8A 3ZJAA 2UYLB 1YNKH 4UILL 4MB4A 1M6OB 4IOFC 4X7CC 4Z3GA 3DIVA 5JQ6L 1AIZA 3CN1A 4RFOL 4HIXH 5DMJB 4ZUVA 4J5VA 3VGDA 3KEDA 1JWUB 1N0LA 1C08A 1VERA 1ZVYA 3QISA 5DWPA 3CMOH 5D7HA 3U6RB 3BEWA 3EJTA 4FFTA 1KYOK 3N55A 4MZRA 5DQDL 3EIFA 4YEFA 1A6WL 2VZ1A 3SO3B 3UGEA 2BNRB 4ODVL 3RDTA 3U0TA 2EDXA 2YLHA 3QH3A 4XMWA 4QT5B 5E2TL 2ZWLT 3HE6C 3CFCL 2VLRA 4R96A 2XC8A 1I31A 3B9AA 3E2HB 1MCNA 2LLLA 3HB3C 3MYZA 5D7LE 3TJEL 3QWNA 3Q9PA 1PY4A 2WWNA 2XQ0A 5KYYB 2J57A 1VSCA 3IFNH 2IG2L 1XCTB 2AAVA 3PWUB 4LT7A 1V3JA 5MI0B 5HSFA 2FATH 4GSDL 5E6YA 4DGVL 5CCKH 5D5ME 4JFXB 3NG5A 3V5HA 4B3VA 4PJ7B 4BA8A 3MJ8A 2VXQH 1MRDH 4J8QA 1F0LA 3KBFA 2WTOA 3EZ8A 3A67H 4MA3B 2EEBA 1A7QH 4GIOA 3G5ZB 3C5JB 3K72B 4KX8A 4NN6B 2Z34A 1P1VA 1XGTA 4HUUA 4TSAL 2Y07H 3U30C 2UY7A 1NDMA 3QYCA 4LGSB 5IR1B 1E6OH 4LARH 3TIEB 1I8MA 1BBDL 2D7PA 4NAMA 2IFGA 1AE6L 2A9AA 1HKLH 1UENA 1ZA3A 3DVNA 3R0MA 5E00B 3MV8E 2BSSB 3HBQA 5LWYH 4L4VA 3C6LD 1N10A 1CIUA 3RG1C 1GGCH 1T6BX 4FNLH 4X99A 4DKEL 4WI0B 3HS0A 1CLYH 1L7IL 2VLLA 4MMZB 4HUWA 3AREB 3K3QA 3AG2B 3KPMA 3MBWA 4NQDB 5GS2H 3B4NA 1S7RA 4ZTPL 4BIKA 1E4KA 2LLGA 3RY4A 1MREL 5A2LH 2IH8A 1R33A 3ARZA 3BI9X 3G5WA 3HIZA 3IJ8A 4XWOD 3VVWA 3HUJA 4O02H 1CXLA 2ARJB 3ABKB 1SMAA 3OVUB 2J4WH 5B3JF 3OLIA 4NDMA 2I9TB 1L6ZA 1DEEA 1DL7L 4M6ML 1U8OB 2EC9T 2K78A 3FQNB 1Q72L 1OP3K 3EYFB 1UKTA 1G9NH 1T7VA 3D06A 4FZEL 4J3TA 4ELME 1I53A 2ZG3A 1KPUB 5D2LF 5DMKA 3WI9A 2X4QA 2W0FA 2H6UA 3BT2H 3FFCE 4FJ6A 4O02A 4D0CA 1CDGA 4H25A 1MOEA 3FU0A 1YY8A 1EHNA 4C4KT 4K55A 3NQKA 2IFFH 3HBGA 1QBMH 2BW5A 3DX2A 3NEEA 5CR1A 3I2CL 1CFTA 3ZHNA 3QDAA 4YDLC 4OBSA 5MEOA 3SOBL 3IPBA 4LFHD 5JMRA 2JLPA 4JUTA 1SZNA 5F6HI 3VFSB 4G9DB 1QI3A 3OLDA 4OF3A 3S36L 3IMUA 2XWRA 2AJUH 3UBXB 1AGFB 1WEJH 4NKIH 5AYQA 4K9EC 1F41A 4LP5A 4NJ9L 5I74C 4K3EL 2Y6SC 1LO3H 2GBVA 1J86A 4WI9A 1OF2A 2PPDA 1EZVY 5DS8B 3DKHA 3GSUB 4P3DA 5BZWA 4PY7B 2JXMA 2VDOH 3RVUD 1GH7A 4OGAC 4FNPA 1F5WA 5K9KB 4IK6A 1YEJH 2Y5EA 1GS6X 3W57A 4RAHA 5IHUL 3O6LL 3UZQA 1NGYA 4HAFA 4EVNA 5D2LA 5DMGC 2WZAA 1JNNL 1COBA 3ARUA 3O2WL 5CP3H 3QG7H 4E42A 5ANMB 1NAMB 2GYSA 2V5TA 4HZAA 4XN1A 5B3SB 4XT1C 4JHWL 4QLRA 5EU4A 5IVXF 5CCHE 5BJTA 3B9KD 1KJVA 1NSNH 4GG8A 4N2OA 2WTRB 2WWMD 2NNFA 3SDDA 3FQRB 3GSRA 5CP3A 4L5FE 3VXNA 5E8EA 3BKCH 2ZICA 2P8PA 3UBXI 4U31A 4G59C 2O30A 4XP5H 4F7TA 5G4NA 3FB8A 4HUVB 5B8CB 3P02A 3CH1B 4K07A 2GBAA 2JCCA 3QEUA 3T6VA 1U8LB 1MHPL 1WT5A 1YEEL 1GCFA 2YMTA 3Q5TA 3DUUA 5TPWL 2XRAH 3IDJB 4E0RA 2WINB 2Q76B 3BUTA 5F9WB 4PJHA 1U91B 3WMSA 5DJCA 4HLEA 3LKQA 1JP5A 4L4TA 5IW1B 1HU8A 3UTQA 1P6AB 4BE6A 2DWEB 1BD2B 3VTAA 4Y5VA 4JQIL 4DZBB 4ODXA 1X7QA 3FYIB 4OV6F 2XZCL 5I15L 4JREB 1KBGL 3PJSB 4ODTL 5FA4B 2F9BT 4JY5L 1D7BA 2J8OA 1JK9B 1FL5A 4PY8J 4QOKE 4EI5D 4BV1A 2XCMC 3CVHH 4GAYB 4MNQA 3UACA 1JGDB 1N64L 1R4XA 5KOVC 2GFBB 5AYUH 5HBBA 1S9KC 1QLEH 3ORJA 5FOBB 1YEDA 2HTLD 4L8BB 3AMLA 3P73B 3UTTD 3POHA 4OZGF 1U8JB 1I8IB 1AHWA 3WEXA 4G3YH 4P2QE 4FFZL 5C3LD 1QFUL 1LDSA 2WKLA 4JRXE 4Q58C 3GZPA 3KBEA 3BZ4A 1BA9A 4QHUB 2R23B 5FO8B 1ACXA 3F7YA 4CMHC 4WDIB 3ZGIA 1MQ8A 4AUUA 1FFNA 4Q6IB 5GS1B 4AL8H 1JPFB 1TFPA 3L4ZA 1B4JL 4KPHL 3W0WA 2X2YA 2EYSB 2H0FA 3TNMA 3VRLE 1AY1L 3NTCL 2N0MA 1P7QA 3EFOB 5I24A 3WNPA 4NN7B 1PW3A 2CJUH 2H8PB 3DX8A 4XWGH 2NUTA 3WXWL 3ZRFC 5CD5D 4RMRA 3BW9A 4I0PD 4HSQA 5HYSG 3RWGA 4BK5A 4ZD3H 4L3EA 5I76A 1R0AH 2OJZH 4FLOA 4W9LC 4KY1L 3T2NL 1Y18A 3V2AR 4XAWH 1ZIAA 4ZUVB 3T2QA 4XBMA 3HI6L 3ESMA 1K6QL 4F7PA 1LE5A 1N0LB 1C08B 2P80A 2R0ZL 5F1SA 3KVQA 4ELDA 3D0LA 5CJOL 2WW8A 5KJ7E 1ZSDB 1FC2D 1X5FA 4QRRA 3GXTA 3RDTB 3SGDI 2AZAA 1QRND 4UTCA 2EYRA 4UT9A 5CEZD 3QH3B 2AQ3A 4LO9A 4QXUL 1R5WA 3RHWF 2H2SD 3GXIA 1NAKH 4JG0L 3APFA 4KFZC 1PJ9A 1IFHH 2EVGA 2YPVH 4C56A 4NFDA 2VLRB 4R96B 4OLVH 2VQ1A 3D09A 3DVFA 2YRZA 2UVFA 2G2PA 4PRHA 5HI4D 1BFVL 5IWLA 3O6FD 1QHQA 2COQA 3SY0B 2W9LA 4OTXL 5B39A 4GFTB 1RZGA 3COOA 3US0A 1JJUA 1XEUA 4XPFL 3ECUA 4ZW6A 2GJZA 3VH8A 2YPVA 1XF1A 1E4HA 1JPTL 1PLGH 4RGOH 2E76C 1L6XA 3BGAA 3MJ8B 3OR7A 4AQAB 4ODSL 4HETA 3D25A 1JG9A 5FGBC 1GS8A 1ZHKA 2C9PA 1IZKA 4KMTH 4PCTA 3PL6C 2A73A 3K0YA 2OMYA 2ESVE 4L0ZA 2DH3A 5JHAA 1X4ZA 1XGTB 1YVLA 4HUUB 1KIQB 1CICC 2IPTH 1NDMB 4BDVA 3L3OC 5HHXH 5DZAA 2DI7A 3GMMA 3TEXA 1BGXH 3OD3A 1WFIA 3OZ9H 2ZKHL 5MENE 3GHPA 3QQ3A 5H37G 2Y7QB 4FL4C 1IGFL 3LZRA 1ZA3B 3JWNG 4TQIA 2K8QA 3DVNB 4E9RA 4F7CA 3BP7A 2UXVA 2WN3A 5DYFA 4L4VB 5DRNA 4ZO6A 3TO2B 1UA6L 3LRSA 4Q2ZB 3NIDB 4X99B 2CUMA 3QHFL 4UQDA 2KPWA 4A2FA 2ATAA 4QTFA 4HUWB 4RA3A 4XNYH 3IDGA 3MBWB 1YY9C 1S7RB 2WYIA 4J3OF 4NPKA 5AAPA 3CVIH 1ESOA 4H1LG 2O93L 4TVPH 3OZKA 3HUJB 1Q0XL 1PSKH 2K4AA 2O5ZL 1QFOA 5KSAC 4AQ1C 2K3TA 1JI1A 1BWMA 4GFXA 3IVKA 4Q4IA 5JXAH 3FHEA 2OFQA 3OWRA 4NXKA 5BZXA 3L9RB 4NDMB 2OCCB 2YA1A 1DEEB 2FR4A 3MACL 3ULUD 1IT9L 1XSIA 3BKJL 4RISH 4RGMC 3TEUA 1I7RB 2J1ZA 2W9EL 1HE8A 1MPAL 5IOPB 5KVGL 1JVLA 3F58L 5DMKB 3WYRA 4O02B 4D0CB 2BX5A 4B96A 3D0AA 4JNXA 4D0BA 4WAFA 2NRDA 1NUNB 4H25B 5LXGH 2QMKA 4NO0D 1YY8B 3L5HA 4FXKA 4WEMB 2XG4B 3KJ4C 1OSEA 4RNRA 1UTDA 2DJUA 2UXGA 5MEOB 1O0VA 4Z7IA 3DXAA 4JZOA 1S5IL 4YWGL 1BDYA 3VXQA 3O2VL 4Y5XA 2HLFC 4FMKA 5IBTL 4XXDB 3B2DC 2PWFA 4K94H 4DPRA 1Q1JL 2YUXA 2XWEA 4Z3FA 5D1ZD 1RJYA 1D7FA 4MJIA 5AB9A 1VCBC 2Q9OA 2I85A 1JNLL 3NPSB 5G4MA 4EN2A 2X1XR 3U79A 2G9KA 4XPGH 1FNSL 3GIVA 4BFJA 2X4NA 1R24A 2EJ1A 1IEBA 2P44B 2H0JA 3QQDA 4LEXL 4M6NL 1OF2B 5ACLA 1QSED 5I28A 1GIGH 4M00A 3U4AA 4P3DB 5BZWB 3TH4T 1GC1H 5GGRA 2JXMB 3N40F 1RHHA 4UQAA 5F7HA 2GEQA 5ESVA 1M7XA 4OGYH 5GHWL 1R3HA 2Z31A 3P2BA 1FE8H 1NEUA 1JXJA 1UH4A 2BY0A 4P9ML 2J25A 4Y4HC 2Z1KA 4HFUL 3UZQB 1NGYB 2AXJA 5BZZA 5ABDE 4ZK8A 2Q2EB 5D2LB 5F3BB 4OQTH 1U6AL 4Y4FD 1IKFL 1NCOA 3AS2A 3ML8A 3ASWA 4PRNA 2DF3A 4E42B 3W9EA 2YPLD 3KLSA 4GKLA 5IBLD 1F6LL 3ZBMA 1NC2A 1A0QH 2Z1PA 5I1HH 4PV1C 1E28A 5BJTB 3ZTJH 3NIFE 4WU5A 3K8MA 4PRDB 1KJVB 4GG8B 2JH2A 4JO3H 2MNJB 3GKWH 2QHRL 1PNCA 2FECL 2JJUA 3AGVA 2ZUUA 3TZVD 2K6YA 3M45A 4K23H 3MRPA 4X9IA 5E8EB 1GGBL 3FO0L 4I88A 3HFML 4KNUA 2P8PB 3TCLA 1BZDA 1K3IA 4QRPE 4V1DD 3FB8B 1NCDL 2A74B 2JCCB 1IARB 3QEUB 3QFJA 1NTDA 4AYGA 1JXFA 5CWSB 2X4OA 2FWUA 3MBED 3ALPA 4J3VA 5HHOE 1R34A 2HJKA 3I9GL 2NYYC 3DUUB 4XOEA 1J1XL 4E0RB 1SNRA 3CSPA 4FGMA 3T0AA 5I9QC 4PJHB 4HQQL 4N20A 4HZ1A 4F92B 4E41E 3EF7A 3WJLC 3LKQB 1OM9A 3B1UA 4L4TB 5GGSY 3RFZB 1WLHA 2O72A 3UTQB 5SWZA 2OL3H 4WKXA 2YS4A 4PWIA 4ODXB 1X7QB 1F90H 1P0SE 2XFXA 4L1DA 4XVUD 3EO9L 3TBCA 4WLCA 4HLZG 1FL5B 1OAUH 4XC3L 5IFHH 4OFKA 4PN6A 4PJBF 3DPBA 4MNQB 5DF0A 5CZXC 4OVUA 2Z93A 3WE6A 2OL3A 3KPOB 1UM4H 4ZNEE 4NIYE 5E9DA 4TM9A 2LOEA 1G9MC 1ZT7A 3P0YL 2X1OA 1TJIH 4HSCX 5I71C 2O5YH 1MW2A 5AYTA 3WEXB 3WBDA 3IFLL 3C6SA 4MMXC 5AVQB 3I3EA 5TQ0L 2QHLA 1RZPA 2GI0A 3BZ4B 3CLFL 1FGNH 2JJVA 5L8JB 1KLGA 3F7YB 3I9PA 5D96C 1QLEB 5GJSL 3SDCB 1SFDA 1L9MA 4HPYH 1FFNB 4X8XA 4KMQA 4JFEE 5ESQA 5LDUA 4KU1A 5KVEH 3QXDA 4XCYA 3TNMB 2BHZA 1EJ6A 2F19H 3CUPB 2NUTB 3EYVA 4P5TD 2YIHA 3CFEA 4PJIE 4YSQA 3BW9B 4WK2B 3IDYC 3DARA 3OC8A 1EJOH 4L3EB 5I76B 4KZEL 1KTRL 3RL1B 4JM0A 3QO0B 3PV6A 1G7HB 2IAND 3F85A 4K5MA 1UJ3B 1F1AA 1I1AA 1QLRA 4MCYB 5FHBH 2JQAA 1GY1A 3LH2L 5T5NG 1LE5B 4NZTL 4PJBA 3D0LB 3Q8BA 1R3KA 3ULAB 3S2AA 1PMYA 2DTML 4ZS6D 3L3KB 4QRRB 5IROC 1TEFA 4DESA 4S0SD 5M95B 3GI8H 3QXUA 5I17A 3NSJA 2EYRB 5C0EA 4Q14A 1IC1A 1R5WB 4R7XA 5HVHB 1IGIL 1S7SA 5CU5A 1GTNA 1WA2X 1ECYA 1KB9J 5HYJE 2VQ1B 5BOJA 4I18A 4PRHB 1Z1WA 5DJDA 1DQJA 1XXFC 5DSCB 2X53A 5D55A 2WNKA 3TBWB 1MNNA 3FQUA 5B39B 2P28B 1DEDA 4WTZG 1M3JA 4KI5D 4NQEA 1RZGB 5E24E 1CE1H 2HRPL 2KYIA 2GJZB 5CSBA 3VH8B 2JKLA 3TEYA 3DO7A 1M9SA 3MUHL 4UQEA 4DKFH 3GUTA 1P6FA 3LZOA 5DR5L 3T5WA 3OR7B 1EH9A 1OPGL 3D25B 5IJKA 4KTGA 2VR8A 1CXEA 1U3HA 5KYWA 1ZHKB 4WJ5B 3TFBA 2XKSA 2FX7H 4PJ8C 1CR9L 4C4UA 4V33A 3D08A 2OMYB 4PJXE 2J3SA 3TH3T 2ILLA 3SBPA 1AO7D 1KGUA 5BQ7A 5JIPA 3VXOA 2HX8A 4BDVB 3WIHL 3GMMB 4H8WL 3NJHA 2CCVA 4IJ3C 2VLJA 3QQ3B 4P46C 4AVKA 5DRXB 4G8EA 1LLAA 4D9LL 4F7CB 2WWKT 3BP7B 2JKNA 3IPEA 4TUKL 1DBAH 3NK3A 3V7AG 3LRSB 1CFBA 4NCDA 4NRYA 1XL6A 2O6PA 1WSST 1R5IB 2XZZA 1XH3B 5SX5K 3EUUA 1IU1A 3IDGB 2P9RA 4D8PB 1M4KA 3A24A 3EH2A 3UTSE 4P0DA 15C8H 3LEXA 1VACA 5C0GA 1YSOA 5JIIA 2CA4A 2G60H 1UOLA 4KK6C 3H7LA 3MROA 4HJIA 2WGXA 3MRKA 2DQFA 4FQXA 3T1FA 5T1KA 3LPOA 5DJ2A 5IJVA 4KVPA 2FR4B 3NZUA 5J06A 4G1EA 2BNQD 4F27A 4ZOBA 4IM8A 3BUDA 6PCYA 2XV6B 1F4WL 3SBRA 3IKKA 2XWCA 3U4EA 5D93B 4JFZL 4Q9RH 2VC2L 3NBNA 1G7JA 1NC4D 1TZHA 3HHSB 1HJCA 3IRCA 1KBBA 5GS0C 5FIEA 4FXKB 4WNQA 3EW3B 3VI3A 1D6VL 6CGTA 3WNJA 4U1HA 3ARSA 1O9ZA 2JIXA 1SY6L 3LIZH 3TPKA 3MLTA 4RNRB 3RZCD 2EDFA 2NY0B 2OBGA 1ZANH 1JYVA 3DXAB 4JZOB 2LV4A 4L1TA 4TRPL 5E8DL 3WELA 2DPKA 4U3HA 3VXQB 1Q4NX 1Z9OA 4QTIH 4Y5XB 2Z7UA 2NY7H 3OTTA 1Z0NA 3BH9A 3F00A 3OL2A 4P4KA 1JTPA 4BWWA 2W92A 4KJQC 3FMGL 3EYOB 3LIZA 5DVLA 4FQCH 4YHLH 2K3HA 3TV3L 5LG6A 3KLQA 5CHNA 1H15A 5E99H 2PYED 3GIVB 2BNRE 5D7JB 1OAYL 2GJPA 2X4NB 1R24B 3LRMA 1IEBB 4NCC2 3QQDB 1MJ8H 3HPLB 1BQHA 3MZTA 1M57B 5E9NA 5GGRB 2VISA 2J5WA 4Z18A 3D4CA 3O3BB 5ESVB 1P7BA 3FUEA 4G6MH 4PFEA 3DDGA 1NWOA 1R3HB 1Z3GL 1PJWA 2Z31B 1EHXA 1HCFX 3E2HC 3DVIA 3HAEG 4EUPG 2FWOB 5F7BA 5JUEH 1XR8A 2B77A 2J1KA 4PRNB 3K4AA 1MCRA 1QATA 3W9EB 4APXA 4RWYL 5J13B 4OLZH 1P4BH 5JHDA 5MI0C 4NQCB 1NC2B 2WP3O 2LU4A 1RL1A 4PJ7E 1E28B 4WU5B 4K3GA 3FT4B 4MS6A 2D3LA 4OB5H 5C7XL 1B4TA 5KSBF 4PJFF 1K9TA 1Y0LA 3Q48A 4I89A 1ZRUA 4FYSA 1S4IA 3F5WA 3S8GB 2ENJA 3HI1A 2B4CC 3RIFK 4NN6C 1NZRA 1X5ZA 1UACL 5KG9A 2H1PH 1E27A 2HWZH 2NY6B 1WA1X 2DQTH 3CXFA 4XX1E 4HG4K 5K9QG 5IHZB 1BOGA 1FJ1A 3L5XL 4MFHA 2X4OB 1DQLL 1JZEA 2HJKB 1V10A 5FGRA 5IGXH 3BUIA 2OZ4L 5CFHA 3QULB 5D4QA 4GRMA 4N90E 3KLDA 4JEGB 1CGSL 3TBTA 1NCWL 4JKKA 1AS6A 4LLAA 5SWZB 4HV8A 1DO5A 4LBEA 4LSSH 4MMZC 4NQDE 4HEMA 4PQXA 3AREC 4L8DA 1HWHB 2TAAA 4XNZB 4YSTA 1A6AA 2BP3A 4X9GA 2E7LA 2X42A 3FUIA 5D7SH 4ZTEA 3DPBB 5LN4A 2V17L 3QNYB 2ZUWA 1JF1A 4X6BB 1TQSA 2ZP9A 2Z93B 1MJ7L 4K15A 1KJ2H 3C12A 3WE6B 4C47A 5C0NC 4WW1A 5E9DB 3RQ3A 3H53A 5BZDA 5IB5A 4APQA 4LSUL 4A68A 5FUZH 1H6TA 2TSAA 3PPEA 3C6SB 1EO8L 4LASL 1L9TA 1YEGL 3VD9A 3ZDYF 3KPSA 4Y1AA 4UM9D 7TAAA 1AXSB 4ODWB 5A2CA 5GGVL 1KJ2A 3GBDA 4ERSL 2DDQH 3TT1L 3LD8B 3GI9L 2BP0A 4LQFH 3MCLH 1D7DA 3Q06A 1VEMA 3Q2CA 1UEMA 3A3YB 3QA3A 3CSYA 3QXDB 4XCYB 2B9AA 5CP7A 1ZHNB 2KC0A 2WANA 4Z7OF 2WXMA 1QACA 4PJDF 3VU2A 5L2KA 2CCLA 1E2ZA 2DQHH 4OIIH 2BSDA 2OW6A 2NDFA 3MRHA 5I1GH 3SBWC 2APSA 5EU5A 5DQJB 2PWHA 2QQKH 4PCKA 1A9BA 3MOQA 3PV6B 4AYFA 1PAMA 3VGHA 2HAZA 2FJGB 4HOMA 1RZJC 3BAXA 1QLRB 1I1AB 2D0FA 3SQRA 2R29H 4PJBB 4U2YA 3U2SA 1R3KB 3US9A 1Z3RA 1RUQH 3TBSA 1MW1A 2FLBT 4X9FA 3OB0H 4G43A 2AJSH 1L6PA 3STLA 2VLKD 1BHGA 1H3VA 2Q8BL 3M1CA 5KSUA 5C0EB 4XP4L 3TXAA 3WSQL 2F54A 2FX8L 2VL4A 2R29A 3KM1A 3DV6A 4P2RA 4E9XA 2AQPA 4NNPH 4RMBA 5KVDH 3RY5A 4I18B 2EIZA 3FTSA 5ANME 1UASA 5DJDB 1DFBL 1DQJB 4JM2F 1OAQL 4KK8D 1BJ8A 2DJSA 5AW7B 3FQUB 4UOJA 3V8CA 4NQEB 1URIA 1FFPA 4L37A 2WXKA 3GQFA 3DO7B 2C9XA 2HVJA 4Q97A 1FG2A 3GUTB 2WZ6A 4IOFD 4RMVA 4QY8A 2X0WA 3WXVH 2VQ4A 2PWGA 1OCRB 3WD5H 1U3HB 2RQEA 5KYWB 1UWGL 3IGAA 4HLJA 4FADA 3HZ3A 1EBAA 5CIPH 2J88L 5B8CC 3PAVA 2QKIB 1KYAA 5BQ7B 1KGCE 4LKCA 3VXOB 5AKVA 4YSDA 1NFKA 2R8SL 3L9BA 4TOYL 3KNBA 4DGIL 2VLJB 3QPXH 1JPST 3JYBA 1BD2E 4G8EB 2ICWB 2DQMA 5CIPA 1R3LA 2AI0L 4PGCB 3BD4A 4KXDA 4NKOA 5B1CA 1CDUA 2B2XL 2YD5A 4NRYB 2AK4A 4DN4H 2BVTA 4KV5E 1AZBA 4G70B 5D7LD 2P8MA 4OCXH 5KW9L 4Y16A 3RPKA 5HDQL 2HXAA 1CLVA 5F70A 2BOCB 2AC0A 3GMNA 1WBZA 2KL6A 4XC1L 3LEXB 4YHML 1BQUA 3HLKA 4GXUM 4LCVA 5C0GB 4XP9L 1HL8A 2RACA 4TUJB 5IGXL 1S9YA 3FU5A 4JO2L 1TIUA 5LO7A 1W72H 2DQFB 3MRKB 3T1FB 5DJ2B 1H3GA 4M8QB 3B2MA 3GMOA 4MGXA 3JT2A 4ETQA 4WUUA 3WV0A 1CG9A 3P4MA 4X7FC 1CB4A 5EO9A 5T3XE 1JF6A 2NR6C 2HJFB 5D1QD 1REIA 1YEFL 3U4EB 1SXAA 3S98A 1MELA 2TSBA 4Q6IC 5GS1C 1B6UA 2LR4A 1G7JB 1TZHB 2IDUA 3VM7A 2Y72A 1XGPB 1MRCH 1RU9L 1CDYA 1W72A 4JN1H 4OT1H 5LG1A 2ICCA 3WKNA 5JHMA 4WNQB 4JFPA 4NN7C 5I1JL 4JJHA 4U1HB 4YHOH 3G04A 4DP1X 2P8LA 3MLTB 4UBDC 4X6CA 3MV8D 5CGBA 2X3BA 5BRQA 3RBSA 4PMFA 1TPXB 4UUJA 4OI7A 2WGNB 4LF3A 3UGUA 5LHDA 4X5RA 5BV7H 4OLXL 2GJ6A 4PHXA 3BP5A 5LGHH 1KXQA 2HFGL 3RIAF 3BH9B 35C8L 5E6UB 5JOFA 3H56A 2VUOA 4D3CH 2ROYA 4P4KB 3KE0A 1ZPLA 4AJ0A 1KJ3L 1H15B 3CFDA 3IJEB 4BD4A 5FECA 3NUKA 3KPQA 2CRMA 1DDHA 3DSFL 5D7KE 3T3PB 2NXYB 1LEGA 4PI0A 3EH5B 2KLRA 3RI5K 2P43B 2JELH 5DVPA 3CSTA 2VISB 1OK8A 1IAMA 1ZT1A 4R84A 4L1HA 3ZR6A 4Z6AT 1MN4A 2VLRE 2X28A 5CJXA 5AOZA 2G3MA 4M9PA 5LBSH 4NUMA 4QF1A 3K6OA 3GBNL 4XTRC 2KI6A 1I9RH 3FFCD 3LS4H 4XAKE 1EAPB 2AABH 2BIHA 1P1ZA 1XR8B 5I6PA 4HJEA 5C92A 4APXB 1SDDA 2NW2A 4GUOA 1FO0A 4NB7A 4TQPA 2OV0A 4ES9A 5LBSA 1CGUA 1GAFL 2OSXA 3MLYH 4JDTH 3VFGH 3L3GA 4GRLB 4LAQH 4YHYB 3O8XC 5E6IA 2EVIA 2CKBL 5BS0B 1A7PL 1Y0LB 2O61A 2V37A 1ADQH 1P84K 1BPVA 3F5WB 4GAAA 3KR3H 3HI1B 4JRFA 4M3JA 4NOBA 1E0OB 1WIPA 3CDYA 3MJ9H 5FK9B 2E27L 3U36A 4ZMAT 5KG9B 2Y6SD 1E27B 1D2PA 1J05A 3CQPA 2J72A 4ZMQA 3UZEA 2WUBH 3RGVB 2J1YA 5K9JH 2FSEA 3QHZH 4GAGL 4CVWA 3SE8H 1JFQH 1YQ2A 4LSTL 2QMJA 1KFAL 3NJMA 4OGAD 1ADQA 3UJJH 2G5BA 2NNAA 4L4VE 3MJ9A 4GRMB 5F2FA 3NIDE 1ED3B 1FGVL 1T1ZA 3TBTB 1BQKA 3IAQA 2IQ9L 4HV8B 2Z8SA 5DMGD 3GLEA 3KBPA 3HNTH 3TC9A 3MCYA 4ZSOA 1B88A 4B9CA 2WLZA 1N18A 3QGVA 4L8DB 4ZOAA 1U58A 1A6AB 2QLVB 4HBCL 1BEXA 1PQZA 1UJTA 4BH7A 5HHQB 2XPGA 3A4AA 5AVTB 3HUJE 2HKAA 3UAEA 1JF1B 2Z64C 3PAUA 1L3WA 3MTRA 1M1XB 2FE0A 1I8AA 2BVUA 2OZNA 2VDLB 4WW1B 5BZDB 2NY3B 4APQB 2D8KA 2MRYA 2MCAA 3TFKD 2WQSA 1HHJB 3BRFA 2ZKXA 4PVLA 2MNUA 2AF2A 2P49B 3N1MC 3C09B 5DVNA 2VDML 2QT6A 4Y1AB 1PZ2A 5JPNC 2BY1A 2FH8A 4HX1B 2R27A 1CC3A 1G4RA 3WTSA 1KJ2B 2DD8L 1C5BL 3SCMA 4HWZA 3ZE0F 2J73A 1XGQA 2BP0B 2ZKWA 5LLIC 4HS6B 3QA3B 3DX7A 3CSYB 2XYBA 2A7BA 5CP7B 1DLFL 1G9NC 2ARJQ 5L2KB 3WN5A 5FB8B 1CTMA 2MHAA 3MRHB 3MV9A 5DO8A 1D5MA 2DLFL 1MWAH 4KROB 3JTBA 1XDTT 1YJDL 3WKYA 1A9BB 3FT3A 5I8KL 1UXSB 4XPBH 3TA3A 3OMZA 4LSPH 4QOKD 4AYFB 4YMPA 1OGTB 4XMKH 2J2ZA 2ISDA 3FJTA 4Z7UA 4WWOA 2W94A 4EIBA 4HKBA 3U2SB 1ZS8B 3TBSB 2EDEA 1NOAA 4M1GH 3WEOA 4G43B 1S7WA 2PP9A 4LLVA 4PGBB 5F7EH 3Q7JA 3STLB 2QLYA 1WWAX 2H26A 1MWAA 2K70A 4JPKL 3WDJA 5B3JE 4G83A 5D72H 3GZOA 3EDFA 3V4PL 2YZ1A 1JZ3A 3J8F7 5KSUB 1JSYA 1AR1C 4JRXD 4QHNA 5D2LE 3BP4B 4P3CH 3DV6B 3MV7A 4ICWA 4P2RB 1F4HA 4YFDB 2JJWA 3WJMA 1TR7A 1SHSA 2DRUA 2EIZB 3TLRA 2EO7A 2XZQL 4IRJA 1Y1UA 2F74A 1FIEA 3MOBH 5AW8B 4YHZL 3O6KL 3WUZA 2RMNA 2BSEA 4EBQH 4YX2H 4JRLA 2GIXA 3BSZH 2F6AA 2WQRA 2NY2B 1FFPB 2XTJB 3HN8A 4L37B 5LKNA 2Q3AA 1PG7L 4Z7OB 2HVJB 2X70A 1FG2B 4OI9A 3V0JA 5ABZA 2XSKA 3GZQA 1BXVA 3ARDA 2AQ2A 2W9DH 4B5EA 2NY5H 5EZIL 4JDVA 3VVVA 5CU9A 1D5IL 3ECQA 1KBKA 3IGAB 1RZKL 4OFPA 3UC0H 4Z0BL 2JCCE 3BSZA 3OLEA 1XSOA 5FF6A 2EINB 3KPLA 3ZYIA 1AS7A 4FFYH 2A74C 2EXYC 3FSAA 4LRIC 3ZHFA 3VWKA 4TLTA 4Y19A 4KO7A 1IO4C 4KTDL 4BFGA 4JPIA 4JPWH 4HIQA 4LZKA 1OQOA 3KYMA 4Z76A 4PJHE 4RGNB 4A37A 4B9KC 3E3QC 3KNBB 1N3NA 4L4TE 5HXMA 5E5UB 3QUZA 3RFZC 5DUML 5EBLA 4ESKA 5CIPB 3KPRB 1R3LB 3KLAA 4GQ9L 1BVNP 4FFYA 5L88L 4A7TA 4NKOB 1H5BA 5E2VL 1ZTMA 3MXWL 2AK4B 4TQEL 4QRBA 4MNQE 2P8MB 5DU7A 3MNDA 4JM2B 3VMPA 5EDSA 3G6JA 1F97A 2MFNA 3UL4A 3HFFA 3M1OA 4OVVA 2YOAA 3GMNB 1GJWA 2OXHA 1FYHB 2XIBA 5TTRA 3ILPB 32C2B 1S9YB 3GRWL 3ZE2F 5FO9A 4ADGA 3QRBA 4HXAH 4IBVA 5IV2B 1HNFA 4O2FA 3GMOB 5DK3A 2RR3A 2ZX7A 4ETQB 2WXQA 1IJ9A 3OHXA 1CG9B 4WUUB 1RIHH 1TZGL 2A9DA 4MBRA 5EO9B 2ESVD 1DJHA 1CICD 3SDCC 2ZYRA