2YLKA

Carbohydrate-binding module cbm3b from the cellulosomal cellobiohydrolase 9a from clostridium thermocellum
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
145
structure length
145
Chain Sequence
MDVKVQYLCENTQTSQQEIKGKFNIVNTGNRDYSLKDIVLRYYFTKEHNSQLQFICYYTPIGSGNLIPSFGGSGDEHYLQLEFKDVKLPAGGQTGEIQFVIRYADNSFHDQSNDYSFDPTIKAFQDYGKVTLYKNGELVWGTPPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULOSE 1,4-BETA-CELLOBIOSIDASE
publication title A Single Mutation Reforms the Binding Activity of an Adhesion-Deficient Family 3 Carbohydrate-Binding Module
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
total genus 36
structure length 145
sequence length 145
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.91: Cellulose 1,4-beta-cellobiosidase (non-reducing end).
pdb deposition date 2011-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00942 CBM_3 Cellulose binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.710 Mainly Beta Sandwich Immunoglobulin-like Endoglucanase-like 2ylkA00
3ZU8A 3ZQXA 1GA2A 4B9PA 2XFGB 1JS4A 4JO5A 3ZQWA 1G87A 4B97A 4C8XA 2WNXA 1NBCA 1G43A 4B9FA 2XBTA 2L8AA 2YLKA 2WO4A 4TF4A 1K72A 3TF4A 1TF4A 2WOBA 3ZUCA 1KFGA 4B9CA 4B96A
chains in the Genus database with same CATH superfamily
1BX2A 2XN2A 2J1KA 2Y3AA 1LEIB 1O6VA 2DM3A 1IT9H 1F4AA 3EH3B 1BJMA 2HX9A 5KYYB 1NSNL 2MJWA 2ZX9A 5AB1A 1EQWA 4FQHA 5DVKA 1RIHL 1USZA 4ODXA 2HFTA 5IROD 1WBXB 1A6WL 1X5GA 2CKBH 4OIBA 5DEGB 5HDWA 1BZ7B 1RULL 3I6KA 3IMRA 5GISH 5KBKA 4MJ6B 2JQZA 2EDXA 5DD0H 5A6MA 2R7EA 4ZFGL 2GBVA 4RMVA 1KTCA 1A9BB 3DYOA 2YZ1A 5GGTA 3S5ZA 3SDAD 3S98A 1QA9B 3SO5A 5IMOA 2VT0A 2PO6B 4K3EH 4OT1H 4Y9BA 1II4E 4ZXBB 3FT2A 4HKBB 1NEZA 4JRYA 4GJTB 3PJSA 3LYRA 4NT6B 2BZ7A 5KSVA 3UFIA 1BIHA 1RZ8A 1U8IA 2KH2B 1UKQA 4LCIL 4QHLA 5TQ0L 1AQKH 1ND0A 2WVVA 5DJYA 1Q4NX 3WV0A 4AW4A 5IF0A 1FO0L 2Z35A 3AT8A 4RWYH 4W4OC 4M5TA 5F71A 3MAWA 5GGVY 4Q9QH 1NFIB 1SLVA 5G55A 3JV6B 5DQDH 4JY5L 1QR1A 4JG9A 3LEVH 4BGDA 2VC2B 4AJ0A 5E03A 1JNNL 2P8PA 4K9EC 4KUZH 4O51A 4B41A 3APFA 4XO4A 4CGTA 3HRZB 1Z3GL 1E6JH 5C0IB 3B2VL 3DURA 4HLEA 1M57B 2VUKA 5JR1H 3CZNA 3T8MA 2BNQD 2HUHA 2C3VB 3CVHB 3FB6A 4OQTA 3KWUA 4DKFH 4Z7NF 2MFNA 1SJHB 5I1KH 2GI0A 1WRFA 2VAAA 1FSKC 2ZNXA 3ARPA 1NBCA 1QFUL 4U3XA 4K7PY 4LPUA 4UDUB 5GRYA 1UB6B 1VFMA 5BRZD 4ODSL 2BDNH 1I7UB 2QL1A 1BG9A 1FH5H 4QF1B 2XYCA 4H88L 2PPFA 5AVXB 1ZT1A 1IIKA 3UTOA 2L7QA 2VN6A 5E0QA 3PG2A 1NCWL 3U83A 2H2PC 3RVUD 4EF3A 1EEZA 3PDOB 1TVHB 4KTDL 1EJ8A 5FUCC 4JN1H 4M61B 4BFFA 3DO3A 3W38A 1G1OA 1IQWH 1ASQA 3VA6A 1A7OH 1KXTA 2X42A 5JW4R 4FG6C 2VQ4A 4PG9A 2C8NA 3E3QC 2EUVA 4LCYA 5I1DA 4PY7B 4UI2A 1DVXA 3L3GA 2F18A 2BP5M 1QLEL 4WVRA 5C2BL 3PGFL 3D34A 4KGJA 2VITA 1UWEH 5IBTL 1H5BB 3GMMA 1IEAB 4IGBA 2YQ3A 3OPZH 3D69B 2DYPA 4EI6B 5FGCE 3PIQB 5ID0B 4XOBA 2J73A 4PRIB 2A9ML 4WTZA 3HMXL 4FN0A 2JIXD 4L05A 1KJVA 3MXVH 3QO1B 3C60C 4IBZA 5A1AA 1AKJA 1D5MB 2XZCL 4Z7UB 1SOKA 5TD4A 3O8XC 4XAKD 2CLVA 1AC6A 3QULA 2Y3NA 3RVWC 1MCFA 1PX3A 1TCMA 3KYKH 5TE4H 4P4RA 1VPOL 1OP3H 2CPCA 3FONA 4QWWD 4DVBA 1DJWA 5C07B 2QPFA 5FC9A 4N8UA 3EHBB 2ZE0A 2VABB 1U8CA 5D1QB 4JKWA 1WDAA 1AVAA 1KLUA 4MS6A 4YR6A 3M1CA 3K4ZA 5J9PB 1DJIA 2FWSA 2VN7A 1T5WB 4AM0Q 5KSUA 1X4YA 5C0GA 3VM5A 2WQXA 5L8JB 4NDMA 2HN7A 1TU2A 2YAOA 2YPLE 4BFOA 4OJDH 1V7NH 5HHNA 3HFMH 3X1NA 3O11A 3UAJC 4QOKD 3VXSA 4L3CA 2DTMH 3JVFC 4BK4A 2ROYA 2J56A 2CK2A 4U1HA 1CLZL 3L8QA 1EHNA 3S4SA 3EJQA 1AQDB 5JPMA 3NJVA 1TYRA 3GLZA 2CHNA 2GKIA 1CFNA 3SBRA 4MQXC 5ABZA 4FI6A 1C5DA 1BVKB 2X4PB 4PRPA 3NRPA 3RZWA 3KPOA 1G9MH 5I5JA 4JDZA 2XFXA 4JKPL 1OP5K 3RKPA 4FYSA 2IH3B 3LXCA 4YGAB 5IHUH 3VACA 3EGXA 3ARQA 3PXLA 3SPCA 4OLXL 2MCMA 1OD9A 4UU9B 5GS3A 1CDCA 5C3LD 5IBUB 1U6AH 4LPYA 3BVDB 2J57A 5FYKL 3IFNL 1TUPA 1KB5L 1N64H 5I17A 2XG5A 2WQRA 1QRNA 4H40A 3VTAA 4UZUA 2OYLA 4IU3A 3NACH 3BEWA 5CO1A 5F88A 3IK2A 4RGOL 1TJGH 1Z1WA 5ADPH 2HTKC 4OTXH 1I1AB 1XO8A 2CU9A 3RU8H 1Z3RA 5GRVK 5FM8A 1SY6L 1T5XA 5F7EH 1G6RL 5L6YL 1SYVA 2DQCL 2PWGA 1GYCA 5DD3H 1DDHA 1EHLL 4ONHA 3MRLA 2DY2A 3DSNA 4CSTA 3HS8A 2IDTA 2WQUA 4G43B 4L4VD 3NMEA 4MA8H 3RX5A 2OR9L 2DWYA 3D2UB 5D7IE 4UQIM 3GMQA 1BEYL 3N1MC 2IBZX 3QWQB 3GGWA 4FXLA 1XR9B 1OB1A 4N22A 4B3VA 3IGKA 4NQCA 3IMBA 4IJ3C 3L7FA 1A6UL 3OHXA 3X1BA 1GGBH 4O58L 3GSOB 1QYGL 1JPGB 3MGOB 1NMBH 4E41D 4PHXA 3QXVA 3KE0A 4JFOA 2WCPA 4JFEB 2OW6A 2DMKA 4K3DH 5IT2L 1AYRA 4RGNE 3AT0A 3QDME 1INQA 4NNYB 3ZHKA 1M7UA 3KPLB 3MLSH 5I18H 5IB3B 1T7XA 1DVFD 4O02A 2DQHH 1FFOA 2VISA 2VDPB 5E1AB 1F5WA 1ZLVH 4NHCL 4XCCL 3FH7A 5IEKB 5J56B 2R1WB 4Z7NB 4BDVA 2ED6A 4L5FH 3OQ3B 2X2UA 1IM3D 5JORB 2FATH 3OR7A 4YJZL 4NQDD 3Q6FA 3JXAA 3WKYA 4PJ8C 2EO1A 2YXWA 1YEIH 1UADC 3QISA 4AQZA 1OP3K 5CJXA 5DQJB 2K45A 4PPTA 2IADB 2AJZA 1BYOA 1GS6X 3HZMB 3L3OB 1SHXA 5K1JA 3B7SA 3FQWB 4TTGA 5DDHA 2DMGA 3EGSB 1F90H 3W9DA 3ZXAC 3OLDA 8FABB 5TDPB 4OZIA 3WHE1 2QKIB 2ARJA 3GKWH 3QG7H 1JXGA 2YMTA 5K1NA 4QHNB 3IFOB 1Z5YD 4YGVA 1SVCP 2O5ZL 4JCMA 3PGCA 4JFVA 4G11A 4FLSA 1BX2B 4NZTL 3PJNA 2HT2D 2I25N 5IFAL 2B59A 1XXFC 3RKDD 4GKLA 4R4NC 5CHNA 4H8HA 2W5PA 4BWUA 1DE4A 3FT3B 3OMZA 4FQHB 3FT1A 3D18A 4ODXB 2RQ8A 3CC1A 1IBYA 1FL3A 2FB4L 4Y4FB 2YZ8A 5T1JA 2OCFD 4XP4L 3I6KB 3UEZA 1QI3A 2CCWA 1CFSA 3SGDH 1UXSA 2ZUQB 3WFHA 4D9LH 5K9QG 2MEJB 3QJHA 5CINL 3LIZL 4N0FA 4GO8A 2ATAA 4HUXA 4BELD 4G80A 3CZJA 3CFJA 4NX0A 1TZAA 2D7MA 3FT2B 4JJOA 1NEZB 3ZR6A 1F6FB 1R1CA 4X8XA 4JRYB 1U8KA 1ILUA 1EV2E 3PJSB 5D70L 2RBLA 4DP0X 5JXEC 5KSVB 3HG5A 2BNRA 4FHBD 3N1QC 2MCPL 1RZ8B 1U8IB 3NIGE 3VXNA 5KSAA 4PUBL 4QHLB 4R9HA 1ND0B 2J8OA 5DJYB 5IF0B 2Z35B 1KIUA 1X5XA 3QNFA 4K94C 2KZ1B 3IPFA 3DOHA 1QR1B 4G3YL 3V5KA 4H1LA 1RP9A 3VFGL 4JMXA 5I76A 3KS0J 1DVTA 2P49B 2P8PB 5FLUA 3BZDA 4LBEB 4UDTA 4APQA 4JHWH 3DURB 1O75A 3KYMA 2W80C 4AW7A 3FDWA 4NO5A 4XXCC 3FB6B 2CDGA 2Y6SD 3W5MA 2VXTH 3PHAA 5CSBA 2VAAB 1J5DA 2FWUA 1A3LH 3H9SE 1FFPA 3OC5A 1QBML 2EO9A 2IEPA 3KEHA 4B0MM 4UCFA 1W0YT 1ZT1B 5HXMA 3I9IA 3DPBA 3ZE0E 5EU7E 2QQLH 5EA0H 4WHYG 1ZS8A 1EEZB 2PCYA 2FUQA 4JO8A 4N2KA 4X4ZA 4OZIF 4OF8A 4Y0GA 3B9KC 4ETQA 3P3RA 2P8LA 2AABH 5CBAA 1HT6A 3INOA 4Q2ZA 2E56A 1KXTB 4LRNL 1DQMH 4G6FD 1ID5I 1WWCA 3EF4A 1ZA6B 3RPKA 4LCYB 5I1DB 1FIEA 3L3GB 5F7FA 1OM9A 4YE4H 5E2TL 5AKSA 1ETZA 3QORA 1NCDH 2O6PA 2VITB 2QPDB 2QKSA 4ZTEA 1D6VH 3HE6A 4PJBA 1JZ3A 2AQPA 4FHKA 3AREC 3TA3D 4XMUA 4IGBB 3EUDA 4NUGL 2G30A 1Q38A 2DYPB 5ECJE 1FNHA 1OXYA 3NOIA 1B4JH 1EEYB 4R2GB 3AITA 3F2LA 5KJ7E 5E56A 1KJVB 2X88A 1AKJB 5DMJB 3AGWA 3QB7C 3Q8FA 1KY6A 4KXZI 4HC1L 4LASH 3I9AA 4GW5A 3LS5H 5DFAA 2YPLD 2CLVB 4J4PA 4KTYA 5DD1H 1HXMB 1EVUA 8CGTA 3QULB 4LNRA 1T7YA 2OP4L 3CG8A 4X6CA 4P4RB 4GUQA 5HGBA 3FONB 3BT0A 4DVBB 2I26N 4U3CA 2ICWI 5MI0C 2IQ9L 1I8LC 2XC8A 5T1KA 1GC1C 2Q7NA 1U8CB 1DVYA 2YBRA 1A7PH 5DI8B 1OAXH 1KLUB 4YR6B 2UX7A 1R46A 5AVZB 2OI9B 5EOQL 1XDTT 1TEYA 3JUZA 4JO1H 2J2ZA 2Q10A 5KSUB 5C0GB 1CXIA 2O1AA 1HN1A 2A74B 5T3XH 2QT6A 4N6QA 1QEXA 4U1IA 4IHOB 1TU2B 3HVNA 4KJQC 4R4FL 5CJQL 4NZRL 2F58L 3MRFA 1RZ7H 1SLWA 2Z0BA 3CUPA 4FQIH 2GBUA 3FOLA 3O11B 3OAUH 2BSSA 4L3CB 3VXSB 3WAKA 3ECQA 1BQKA 2ISDA 4NBXB 1A65A 1BD2B 4U1HB 1JWUA 4A04A 1EZLA 1JGUL 3S4SB 3T6ZA 2XN9A 4D0BA 5JPMB 1NKOA 4B9ZA 1CFNB 1RVFL 2DWSA 3MJ8A 2QQNL 4FG6D 4X42A 4FQQB 2EDMA 2JCCE 1AY1H 1PIGA 3L7EA 2ZXDA 3MA9H 3RGBA 4PRPB 3U4EA 3KPOB 1HCVA 4JDZB 2XFXB 4BZ2H 2F1EA 4WNSA 2MOGA 1UCBL 2C4FU 5BZXA 4PM1A 5I1AB 1CE1H 1NL0H 3S37X 2NY0B 1KELH 5AL8A 2AEIT 5AVTB 5BS0E 3BIKA 3IXAA 3EGXB 3NJXA 3SY0A 4DQOL 2OL3B 3PHSA 1YJDC 2ZCKH 3PGDA 2D2OA 4N20A 3WEBA 2FBJH 4FX5A 4JPIA 1W0WA 9PCYA 4I3SH 4FQ1L 3JWOC 4YO0A 5I17B 5CM1A 3K6IA 2XG5B 4WO4B 1I7RA 1QRNB 3SDXA 4WV1A 1FQ9C 2BHFA 5LAPA 4IU3B 2WOYA 3BEWB 5F88B 3RVWD 2QADB 4GXFA 5D7JA 3VGAC 3LPPA 4CU6A 4ZT1A 5FDWB 2Z31A 1F6AA 1SYVB 4PJBF 3TH4T 2O4EA 1ZE3C 1E4WL 4LGSB 4RGND 3SDDB 4K8RH 4KROD 1UD8A 1UKSA 4JJHA 3MRLB 3DSNB 3QDMD 4KUCD 3QFJA 5K59E 3IXTA 4OFVA 1IM9A 3ALXA 2Z8RA 4ZS7L 2FGWH 3WFCH 5F7YC 4A2DA 1F3DJ 2ENYA 4M4RA 4TNWF 3GMQB 3PP4H 3TWCH 4GIAA 4XE0A 3GGWB 3HAEG 1P4IH 5C0ND 1OB1B 1XCXA 2IG2H 1L7IL 3S36H 4NQCB 2D7TL 4CC0A 3L7FB 3OHXB 4HHAA 2BSTA 3QYCA 3T3MF 4X6CF 4K4KA 2AFNA 4UQ9A 4NCDA 1D5ZB 1DLHB 4PP1C 3BKYH 1IBBA 4M02A 3C08H 2NY3C 3SGEI 1E9PA 4H2CA 5C09E 2ZUSA 3CH1A 1PTZA 4G6ML 5AZEH 5ABDE 1INQB 3M07A 2WXOA 4PJHA 1LO0L 4UQAA 4O02B 1FFOB 2VISB 2CJUH 3DMMD 4Z0BH 3T6VA 1L9TA 4ZSOE 4TN9A 1JF6A 3RWGA 1X44A 3CXHJ 1RMFH 4JFZH 5F6HI 1HU8A 1SOXA 5E2UL 4YXHL 4JVPA 1JS4A 4AEIH 1J1PL 3OR7B 5FOJA 5LWYL 4JZNA 1IVTA 3AFLA 4R8WH 5JTWA 1RERA 1CFVH 1U4FA 4TULH 2AJZB 1KCKA 1SM3L 1I8IA 2WLIB 5DDHB 3U9PH 1FG2A 3BP7B 3W9DB 1UUSA 4UT7H 3SOTA 2X6MA 4AMWA 4OZIB 3FU6A 1E5ZA 3H6AA 1W15A 2ARJB 1OO2A 5JQHC 1C8PA 4Z3EA 1VJSA 2QMJA 2VJXA 3T2QA 1IL1A 4MJ4A 4YGVB 3ISYA 2R0LH 2HPTA 3HLKA 5HDLA 3TP4A 1O0VA 1OAQH 3PGCB 5D6DC 1CICC 2ZXCA 4BBWA 2AJVH 3W39A 5CHNB 2DRUA 2Y23A 1DE4B 2DMHA 4AL8H 3SDXF 3RI5F 3QDGA 3D18B 2Z93A 4D9RE 1XAKA 5FPIA 3EYUH 5LBVA 4FF9A 1FL3B 4LFHG 4YEEA 1FVEA 1ZIAA 2GJJA 4HSCX 1ETB1 1QWUA 2HKAA 3IDGA 5I1GL 3WFHB 3ZJAA 4F37K 3A5VA 3ALWA 4K5PA 1G1KA 3CVIL 1QI5A 3WOVA 1NAKH 5IROA 4GBXC 4MMYA 4HUXB 4G80B 2DQMA 5CIPH 2D4FA 5EC2A 2WKLA 3QQ9D 4XN4A 1H3PH 4NN5B 4HUKB 3FJTA 2XJLA 3HE7C 1U8KB 1DQDL 5EU6B 3D87B 3NABH 2ZKWA 1AG6A 2BNRB 3ARGC 3DX0A 3ZUCA 3VXNB 5KSAB 3UO1L 3GM8A 4AWJC 3IBOA 1RFDH 1KIUB 3R18A 1JZ2A 2NQCA 3UZEC 3G5YA 3CK0L 3MMEA 3EOTH 3GI8L 1RJLA 5DLMH 4LVEA 1UT1A 4H1LB 4PJFA 1EXGA 1BW8A 1EHKB 1MFBH 2F53E 5I76B 4JJ5B 4PJHF 4NRYA 3K8LA 5IB1B 1S5HA 3FFDB 3MBXL 1PS3A 4UDTB 1NC4D 5CLTA 2XVBA 2YPVL 3LD8C 4APQB 1PG7X 4PJAE 1KBKA 2SEBA 5J06A 2DQDL 2VXQH 4NO5B 2XA8L 4CVZA 1N6QL 1MWAH 2EKJA 3HOGA 2ZJSH 5I0XA 1GGCH 43C9A 4OJEH 4MYPA 3CCHA 4PYHA 3SE9L 1FFPB 1I9EA 1KGCE 2YAQA 3TEZA 2XKNA 3QEQE 4ALAH 3WDIA 3KL0A 2BNQA 2DAVA 4XMTA 5F9WC 2VKXA 2X9WA 2LW3A 2IWKA 4Z7WE 3DPBB 1NMCC 3II1A 5AENA 2JELH 1ZS8B 4PLJD 3HRPA 3D3VE 5T1MA 4B7LA 4HGWA 4ETQB 4ZFOA 1VENA 2P8LB 4PRAB 5BRZA 5CBAB 3JV0A 4P4KD 4Q2ZB 1WWBX 4ATTA 3EOAA 2Z4QA 3FU3A 2NLJA 1R0AL 4F2ME 3GZKA 1B0IA 4QYOA 5D71H 2Q87A 1TKWA 2EDNA 2K0RA 3S8GB 5CLWA 1ETZB 4HCGA 4FABL 2DJ4A 1GXEA 3HE6B 1KTKE 4M5ZL 4PJBB 5TDOB 3S3PA 3WELA 3WIAA 1DBAL 4XRCA 1YC8A 1OGAE 5DWUH 5JXED 3RB7A 1VIWA 1H6UA 1RH8A 5D7SH 1DL7L 1ZD6A 3PWNB 3ABMB 3EYVA 4GW5B 2QLVB 3VWKD 4FI8A 5IGXL 3ETBJ 5CUSL 3QI9C 1Q0XH 4X6CB 2JIXA 1DJXA 5HGBB 3VD4A 3T4AA 1CDJA 5HYFA 3D06A 2X4OA 5T1KB 3QZPA 5KS9E 2YBRB 3B5TA 2PP8A 1WH0A 3M1BA 5F6IC 4LVOB 3NAAL 1XBRA 3MHZA 1I1CA 3MRBA 1DSFL 4ZUUA 4FFWD 2J2ZB 1O9VA 3MJ9A 4FFZL 1E65A 3BVVA 1UENA 4LRIC 3T3PE 3V0WL 5D6CA 2IO5A 4Z7QF 1I31A 3MRFB 4LQFH 4X9IA 5BS0D 1UACL 3CUPB 3OAYH 1BVNT 4N86A 3FOLB 4PJFF 4WNJA 5ITBL 1JZGA 3A24A 2BSSB 4RA3A 5IK3A 3MGAA 4XZUA 2HTLD 1JWUB 3LKSA 4DTGH 3AUWB 4CDGC 4D0BB 2XN9B 1TZGH 2H8PB 5I1JL 5A6LA 3EBAA 5B7MA 5I15H 4QOKA 5I71C 3MI6A 4M1CD 3VXOA 4BQ9A 4TPRH 1AXTH 1RPKA 4OM0L 3P3SA 4P07A 4RFNB 4RSVA 3EZ8A 3SGJA 3D0VA 4TNFA 3OG4B 3V0JA 4PCYA 2YD3A 2FQGA 2ITEA 3BIKB 3IXAB 3SY0B 5D7EA 4TS6A 2BPBA 5KAQG 5DR5L 3PGDB 1KGIA 3Q0HA 1RURL 3FCTA 4JPIB 2PWEA 4RDQF 3RUGA 1M4KA 2V37A 3PL6D 4YO0B 5E6ID 2YK1L 3MRIA 3OJMB 1PGRB 1I7RB 3SDXB 4WV1B 2B1AL 4J23A 4KDWA 2JQAA 3QNYA 3CDGA 2WYTA 3LDBB 3WJLA 5DJAA 4J2QA 4AYMC 3REVA 3GK8H 4KQ4L 5D7JB 4N8VG 1JOIA 4IYKA 1JBJA 2WV3A 2EP6A 2XQYG 2Z31B 1F6AB 3QWNA 4S1QL 2APFA 3D8MA 3VI4A 4GXVH 2Q8BL 5C09D 1YDPA 3IXTB 1IM9B 4HKXB 3UADA 5TE7L 1EAOA 5ICYB 4HSAC 5E0FA 4M4RB 1HFUA 2H7WA 4XC1L 2FWLB 3C6EA 1DFXA 2ADFL 3EO9H 4FDWA 4AE1A 1V10A 1ZDSA 3EJJX 4KJQD 5DHDA 5EOTB 4LCCC 4AVIA 2APWA 4Z5RA 1NAMH 4HHAB 3VE0A 4L4VA 4X5XA 1S9XA 4I1NB 4NZUL 3NCJH 5JZ7C 3RNKA 1LILA 1ZV5A 1QABA 4WTQA 3CH1B 1L3NA 1T66C 4L8SC 1OTTC 1CUOA 1O7VA 4DGVL 4HHWA 4E41A 3P2BA 4QI3A 3AAZA 3LEYL 4JPWH 3GHEL 4MTMA 4A2FA 4BWWA 3RWGB 5I66A 1O7SA 5BCAA 4OD3L 1MWOA 1NGPL 1GZHC 2V9RA 1KCLA 2E6PA 5KTEL 1M56B 4JFQB 4K23H 5GS0L 1DVFA 1RSFA 4ZS6D 1P5VB 4JZNB 2Y4SA 5SWSE 4IRJC 4NENA 2J43A 1C08A 4X5PA 4Z23A 1E2VA 4ACTA 2MPAH 1RD6A 3BQUC 1I8IB 3WUWA 2OK0H 1IM3A 5IFJA 3MACH 5I26A 1FG2B 2IFGA 4NQDA 5DZJA 4D9RD 2ZX7A 3NGBB 5FO9A 1TR7A 3SQOL 3TO4C 2XTJC 1CJYA 1NKGA 4K5MA 3EOYG 3DIFA 2PXYD 2PW2A 1IL1B 1WCBB 2IDUA 4Z7VE 1TPXC 5CWSA 5BOJA 2BFVH 1WT5A 2VXUL 2ZUUA 1DLFL 4HZ1A 1J0ZA 2XPZA 3K74B 3RUGF 3W39B 2H26A 4Q0XL 5B1CA 2A77L 1OCOB 3F8UB 3DIDA 5B39G 5GGRA 2X9XA 1NPNA 3NIFE 3S3DB 2PYFA 4X8GA 2Z93B 5I8EA 1QFWM 3JYCA 1YMHA 3HMXA 1FVEB 3RBSA 3HEIB 3HI6L 3ZE1E 3IDGB 1MLCA 3WFBL 4I2XE 2VDOH 2Z0UA 1W9XA 3ENEA 1K3IA 4FLOA 4OGAC 3VI4F 1RZFL 1U8OB 4BK5C 1HHGA 4J28A 2LV4A 2X44D 2F53D 3FHQA 1KXVC 1E30A 3PDDA 4MMYB 5T1LD 1LE9B 1XGYL 3DLQR 2E4TA 2HKFL 4M1DL 5EC2B 5I75C 4A67A 4QRSA 2XDHA 2EICA 1PX8A 4ADJA 5EN3A 3TJEH 4GXUM 3SDAB 3DSFH 4KKAC 2YGPA 3BH8A 3Q43A 4K7FA 4D94A 4L37A 3QUXD 1JNLL 3RVVD 1KGCD 4Z7QB 3GIZL 1TQBC 3G5YB 3QEQD 4ZRGA 4KVCL 3MMEB 4QO1A 1RJLB 1NDGA 2TRHA 2FO8A 3V52L 4PJFB 3CVCA 3QVAA 5F7UA 4Z3JA 4OGQC 2ADJA 2ZAGA 4PJGE 1S5HB 3NRFA 3BFOA 4DN3L 2YS4A 2AJYL 3D3VD 3DETC 4MRBA 4OLEA 4ISVB 2SEBB 1BGXH 2WXJA 1U8MA 2NNFA 2B2XH 1JFQH 2F7QA 3ULAB 4CVZB 2WGXA 4PLKC 1CLVA 5CEZH 2ZOLA 4XPHH 43C9B 2RALA 3CCHB 5B21A 2AC0A 5GIRA 1IC7H 3FT0A 2XKNB 4I0PC 1NM9A 3IGLA 2BNQB 2ZUVA 1IAMA 1V3KA 3NCMA 1JPFA 2QZ5A 4JCWA 1D9KD 4BUHA 1OGAD 2QBWA 4KAQL 1WZLA 4F8OA 1IBHA 4Q89A 2J5WA 1X5AA 5F3HA 5T1MB 5CLYA 4JFYB 4HGWB 4ZFOB 5F97E 5J7CC 5BRZB 2GBAA 1NBZA 4HQQL 2X4RA 2Z4QB 4EI5D 2G3MA 2NLJB 3THMH 4QYOB 3RNQA 1JI2A 2HFFB 5FW8A 1RLBA 1PD6A 1TKWB 2W07B 3HS0C 3VGEA 3ULUL 3MBEC 3AG4B 3CLFH 1AOHA 1IGTA 2BW4A 4OCRL 5FKPA 2JKXA 5F96H 3PHOA 3UZVA 4XRCB 1R3IL 1NCBH 4HF5H 3VGHA 3FT4A 4K2UH 4TM9A 4PU2A 1BPVA 4U49A 5EIIG 1YQVH 3GTTA 4A7TA 1S5IL 5TFSH 3TA3A 2G2PA 2J88L 3ZT5A 2XQBL 3ULVE 2R2HA 4K5OA 3PP3H 4HG4K 3CXFA 2H9GB 3BZ5A 4HWZA 4K73A 1EO7A 5H4YA 2JIXB 4M7ZC 1WA1X 2WTPA 3T4AB 4MAUL 4UIMA 2X4OB 4YHNA 2ZYRA 4NC0B 2YPLA 4QJ5B 2AXHA 3ARTA 3P0VL 4FXGA 3M1BB 1LO4H 3ME0A 3L45A 4BV1A 5KN5B 2OCCB 1FORH 3MRBB 5IVOA 1THCA 1EAPA 4ZUUB 1WFJA 1J0YA 3LZQA 3WMPA 5TF1H 4N0YL 1UA6H 5DHXB 3V95A 4JX0A 3WENA 5D6CB 3IFLL 4HK3J 3ELAT 1A47A 3ECUA 1QVOA 2CR6A 2ETWA 1UATA 3HMWL 3V9FA 4KX7A 1EAQA 5J3HC 3WTYA 4KJWC 5IK3B 3WSQL 1RL1A 2J3SA 5CS7A 1NLDH 4XZUB 3LKSB 1MJ7L 1GHFH 4MQTB 5ICUA 1M05A 2SODB 1M3JA 2ENPA 1A7RH 4DESA 5CBEA 3A0OA 3QEHA 2H6PB 3LQAL 1INDL 1UJ3B 1OARH 2ZT9C 4QOKB 3TIEA 5DYFA 4ENEC 2E9JA 3VXOB 1BBDH 5HHVL 3FQXA 1E4KC 4KXBA 4F15B 4LLQA 2ZP0T 3D0VB 3WDHA 4AX3A 1SHSA 1BF2A 2I5YH 4QNPE 2EYSA 3LKQA 1DBBH 3DGGA 4M1GH 2RH0A 3FCGA 1PD1A 2PYEE 4TNVF 3MUGA 1BWWA 3TBVA 3FRPG 4R90L 4F2EA 3WXWH 2XFGB 4DFIA 3EO1A 3FCTB 5D1ZI 3RUGB 5BUAA 1CXHA 2R9HD 3MRIB 4PRDA 5GGTH 1GS8A 3BFQG 2DLIA 3QNYB 3CDGB 2O61A 2I60L 3QI9D 5DJAB 1MQ8A 3REVB 5IQOA 5D7IA 2JKTM 3HUJE 2I24N 2R83A 1L5GB 3WNPA 4JHAL 1CC3A 5HYQA 4NFCA 3C5ZD 4FOMA 3VI4B 4UTBA 4DFHA 1CWVA 4JO2H 4HIXH 5IM7A 2H2SD 4V1DE 3EAKA 2IPTL 4U6YA 4EQ3A 2ENSA 1M6UA 5JUEH 3VTMA 4JDTL 4KY2A 1OE1A 3QE5A 1R5VA 1YNKL 3QDMA 3BW9A 4FQ2H 1LGVA 3O2DA 1F58L 5BJTA 4L4VB 4X5XB 5DUML 1ZLDA 2RR3A 1S9XB 4XZ4A 2AEPH 4O9HL 5DD5L 5SWSD 3RWEA 2B1OA 3RNKB 2ZSWA 3MZGB 3TV3H 1KCSH 1T7ZA 2WO3B 1ADQA 1R9FA 3TFBA 2DJMA 2Z34A 5F0PB 4WK2B 4UYQA 4KKNA 4BXSV 1PW3A 3SJVE 4E41B 2JJTC 3EGDA 3RAJH 4KMTL 4X0KB 3AAZB 4R96B 3TEYA 3KPQB 3TH2T 2ZP9A 1QSFE 5I66B 3WS6C 3PV7A 2C9SA 2VR3A 1DVFB 2Y2TA 3DMMA 3PP3K 1SJXA 1V05A 4NENB 4HJIA 1C08B 2UWEB 1SQMA 3BUYA 4GIPD 3Q8EA 4Z78A 3FB7A 3FO1A 5DTFB 3WUWB 1IM3B 5IFJB 2ZXWB 4K94H 5DQ9A 1KIPA 3RRQA 3X13B 4NQDB 4L2YA 4TVUA 2HH0H 5FO9B 1ZLSL 4KKBD 2IALA 4KKPA 1ZWIA 1FN4B 1NBVL 3CFCH 3I2CL 5F8RC 1MJ8L 3DIFB 3TM6A 3V6FB 2Y24A 1IILE 5CWSB 3BDYL 1U42A 4PGCA 4Q97A 2J1ZA 4ZNEE 3QIBA 1O7DC 4G7SB 1KEML 2H26B 3IAPA 4RFEA 1WC7A 1MPAH 3AWGA 2ZIDA 4KDTA 5DZPA 2ZYHA 1FAIH 3FSOA 4MASA 4ERSL 4UILL 4O2FA 5I8EB 3SE8H 1YMHB 2N4IA 1F4YL 5D7IF 2BY0A 5GJTL 4Y7MA 3VJ6A 5J11B 5DCCA 1BBJB 1MLCB 1V5JA 5JZ7D 1MELA 5DJ8A 5CZXD 3VU1A 1P84K 1HHGB 4GRWH 4XE5B 4LDEB 1P6AB 6PAZA 4RRPG 5IJDC 4NM8H 3TURA 1ASPA 5AKRA 4IKNA 2E59A 5LN4A 1A9EA 1MAMH 4QRSB 5IMKA 2VW6A 1Q8MA 2Y72A 2ED9A 4OIIH 5E4OA 4Y4HC 3ZRFC 1VKXA 3CZLA 5BO1H 4AIXA 4KUCF 4ABUA 2E8ZA 5EU3A 3BH8B 1P1ZA 4F1SA 4K7FB 4P5RA 4JHZA 1F4XL 1HEZA 4L37B 1ZXQA 4ZAKC 1E2ZA 1MRCL 4MCZA 4EN3C 1NDGB 4XVJH 1XBDA 2BWDA 2ADJB 3WIFA 4B9YA 3BUPA 3WIHH 3TO4D 3U1SH 5T5NG 1IBFA 1U8MB 2D3NA 1SHMA 3OGOE 4DZ8A 2Z64C 2CHWA 3OXSA 4HAGA 3G9AB 1GC1H 5GRJH 4HAFA 1DEDA 4HLZH 4LLYA 1AHWC 1F3RB 4AG4H 1SJEA 2ZOLB 1NC4A 2F61A 2XXCB 3MLPA 5GIRB 2VDKH 2EUWA 3H53A 3CFEA 4IRZH 1JERA 3T2NH 5AOIA 1X7TA 2DLFL 5AB9A 3HC3H 3MFGB 3T0EE 3P11L 5CZVH 2HAZA 1BM3H 1GR7A 3SCMC 1JPFB 2Q5BA 2VDNH 1NGQL 4WY7H 1MRFL 5MENE 1OE3A 1JVKA 3WLBA 5F3HB 5D4IA 4K3EL 1XCWA 4IBLT 3T2OA 4O5LL 2X4RB 3ZX1A 3V8CA 5FGCB 4OGAD 3ULVD 3R0MA 2CXKA 4N0RA 3RNQB 2GBTA 4KITB 5KANI 4S1RL 4S1DC 1L9SA 4HOZA 1UOWA 2GY7B 1CF8H 1A7QL 1WAAA 4OI9A 5FKPB 4P4KA 3KVQA 3PHOB 4G6FB 3UZVB 1FCCA 4XP9L 1P7QD 3ZTEA 4WI9A 4EUPG 4F7CA 4KKAD 1UG9A 1KGXA 2VLRE 4J3OD 4L3AA 1EWHA 1X5JA 2C1OA 3AXLB 5I8KH 2FJGA 3FT4B 3FB8B 1EFXD 3NG5A 1DBJL 3ZDXE 1YJDH 4A6YB 3TA3B 3DARA 5E7BA 4MZIA 4Q74A 1TSHA 3ZHDA 2R2HB 4G7QB 3PU7A 3X3GH 1YEDB 1DO5A 3HC4H 4LOVA 5ISZE 2AF2A 5AW3B 1IQDA 2IOIA 2FHCA 2P5EE 4OJFL 4UIMB 1DQQA 2YA2A 4YHNB 4R26H 1R24A 2YPLB 2ZCHL 4G7RB 5LAXA 4NAQA 3VWKA 4AXWB 2A2QT 4FXGB 4NQQA 3ME0B 1T7VA 1FFQA 4MAYC 1NCGA 4K3JH 4DK5A 2N1KA 1EAPB 4G72B 5EWIL 1MHEA 1JPSH 3Q05A 1RKRA 1CR9H 4LSUL 1IQWL 3ZQ9A 1ZHBA 2EXWC 2CBOA 4HWBL 4XXCA 4PG2C 3PE9A 1A0QL 3LZNA 1PFOA 2DJSA 2JCCA 1ZSDB 2PYED 1FSKB 3IKCB 1NCJA 3LN9A 4AUUA 3PQYE 1RIUH 5D1XE 4CC4A 1L3WA 1OQOA 1M05B 3KD4A 4KQ3H 3RWHA 3VSQA 3L3KA 2OBGA 3ARUA 5BS0A 1J12A 4J8RA 3VQ1C 4KK8D 2WSPA 4POZD 4QRTA 5LUMA 2WIMA 4LQ1A 1CFTA 4NKIH 3STZA 3ZE0F 3VRJA 3OMIB 3FQXB 3S35L 3H0TA 4A39A 3MN8A 3KWWA 1W2KT 4LLQB 4LB8A 3UBXI 3SDYL 2MPVA 4JFFE 2R2EA 4UT9L 2QLYA 4W68A 1SFDA 1QSZA 2EYSB 3V0FA 3DGGB 4UZGA 2V9QA 1QD0A 2ZCLH 4HFUH 3TBVB 1EJOH 4V1DD 3EO1B 3FTYA 4KK9C 4RMTA 4TLUA 1MFMA 1TDQA 1V7MH 4UQ3A 3AXIA 5KBPA 3VD5A 4PRDB 3V4VB 3VDCA 5CJOH 3EO0A 2D0GA 4XMLH 2O61B 4NQEA 4WWNA 2DQJH 3HI5L 3P9LA 3EH2A 5D7IB 4B5ZA 3PL6A 5E6IA 1WAAF 4MHHI 2RD0A 1OK0A 3WJJC 2AQ1A 2RAMA 1KLFA 2XX0A 4FP8H 1V7NL 2NY2D 5FA4A 2XICA 5IY5B 2EDTA 5IM7B 2O5YH 4AQ8A 3OKOA 1UWGH 3KG5A 4Q9RH 2W38A 3RPIA 4U6YB 3SJVD 4OFPA 4AV4A 1Q9OA 3ML9A 3S88H 3U1QA 5IW1A 2XETA 4PBDA 3AW5A 1QSFD 3VGBA 3ARDD 4RGNB 3ZL4L 1CF1A 2IBGA 3EH4B 4KROB 3TN0C 5L8LB 5C09A 1R5VB 3QDMB 3BW9B 3ILQD 2R8SH 2BVOA 1IKNC 2CNZA 3MUJA 5ICXA 2P7TA 4XXWA 3U7YL 2BX5A 1Y18A 5D1ZC 3SN6N 4J27A 2WCSA 4ZSOA 4YDLB 3F58H 1BZDA 4TQEH 2H1LM 2KBGA 3Q2NA 4JR9L 3RWEB 3VW3H 2ZSWB 3Q44A 2FBOJ 3G3LA 3B2PA 4ZMAT 5KYXB 5C0DA 2Y2WA 3QHZL 1RUPH 3ESNA 3Q6GH 1T6BX 2B1HL 3RGVC 3EGDB 1MCNA 2EINB 4YXKH 5C2UB 5FX3A 3PREA 2WQAA 2GK2A 2PUQT 2Z7ZA 1S6NA 2JCCF 2EDHA 4X6EA 1DFBL 2JKSA 4ECNA 2CGRH 2ZKYA 3B34A 1HL8A 3DMMB 2WXRA 2X12A 3P1VA 1BZQK 1YQ2A 4XN2A 4HZLA 4EXKA 3BUYB 3QCVH 1YPZE 1PSKH 4GAGL 4Z78B 3FB7B 3FO1B 3I75A 1ZAGA 3D0LA 3A4FA 1KIPB 4I3RL 4Z18A 4GSDL 1GW6A 3HAEA 2Q3ZA 4M5YL 2IALB 3B6SA 4AQ1A 4FNTA 4F93B 4YDIH 3QIWC 1KTDA 3QRLA 2UZYA 4PJ9C 3V6OE 4PGCB 1U58A 2DWXA 4NIYE 5HBBA 2J5LB 3CHQA 4RFEB 3Q2CA 4H0HB 1WC7B 2PXYA 5BW7C 2UVFA 4LEBA 5DVLA 4UWQB 2RHEA 4FQCL 3N44F 1PYWB 2PPEA 4O2FB 3SKOA 3BRFA 1HAWA 5DMIL 3VG0L 3MC0A 3G5ZA 2R69L 3VJ6B 5T33L 3DOSA 2GI7A 1DBKL 5T1DH 4YQXH 1ZSHA 4IJ3B 1KCVH 4W9DC 3L2MA 1ZKAA 3NIGB 2HLAA 1CK0L 2MOQA 2NTFA 4NNPH 4L1LA 3NSXA 2VDRL 1BQ5A 3EJYD 4N5ED 4W6YB 2VN5A 5IMKB 3Q1EA 2EDLA 3C6LC 3UBFA 4E9LA 1VKXB 2J4WH 5C6TH 5I6PA 5CJ5A 3GLAA 2F53A 4PB0H 5EU3B 2FH6A 4I77L 5T1LA 1F90L 1N8ZA 3A23A 3PNWA 4A7VA 4OFQA 2WIIA 4D3CL 1HEZB 1JWSB 2K6WA 4JQXC 2X89D 2E75C 4X7TA 5IQLA 1KSRA 4MCZB 2WD0A 1J5OL 3T0ED 4FGMA 4ABQA 3A22A 4S1SL 3WIFB 2GY5A 3BGAA 3QUXA 3FUHA 3H9SB 5MEND 4NN6B 3QEQA 5EEXA 1YUHA 5KWYC 3F7KA 4WKZA 4FC3E 1AMXA 4WI4A 3OXSB 4DZ8B 1P2CB 4LT7A 2ZSVA 4Z7WA 2WQ8A 4HT1L 4LLYB 4MVBD 4WJKB 2NMSA 1SJEB 3S9DB 1NC4B 1TSRA 3D3VA 2I32A 1IGJA 2KDYA 4XMXA 3CFEB 2NNAA 4ZO6A 3LB6C 5GXBB 1CI5A 1BQRA 3RFRA 1XMWA 3MRCA 4F2MA 3E1ZA 4HPYL 2VLRD 4ZYKA 1P4UA 1UWYA 3Q5OA 4JG1L 4J6IA 3CFNA 3WLBB 3IJ8A 4JM0A 5J6GB 4XMPL 4AKQA 4JPQA 2WK2A 4P3CL 5DC2A 5KBNC 1BQLL 2E5EA 5I16A 1D9KA 4KXZH 1OGAA 4GI6A 5EZPA 5ISZD 5CP3H 3FAXA 1J9TA 4P2AA 5DFVC 4DKEL 2R23A 1ZK9A 1XHHA 1BVLA 3VWJC 1HKLL 2P5ED 1A7NL 2MQCA 5D7KE 2F8VA 4P4KB 3MLZL 3GPEA 1NGWA 3SE4A 3AADB 4YSPA 4EI5A 1HWWA 2MSPA 3BUQA 4F7CB 4X0NA 3B8SA 1J48A 3MXWH 3UJJL 2C1OB 2FJGB 3KBPA 3OWEA 3V0EA 1IFGA 2N01B 4KKZA 3LXBA 5CCGE 4TLTA 5KS9A 1R17A 5AVSB 4HFWA 3AVEA 2Z1PA 1YMME 3T0DA 1CGTA 1NOFA 2JTYA 1NPJA 1IQDB 3QJFA 3X3FH 4GNKB 3WJMA 4TNWK 4YHYC 2FLRT 5D1XD 1DQQB 4UUJA 3WMSA 1R24B 1N59A 5LAXB 3VWKB 2YD5A 5KVDE 4H13C 1XGPA 1DVQA 5HPOA 3NUKA 4W1TA 3H9HA 1H0DA 1OW0C 5H2BB 3JWNH 1XWVA 3Q9PA 4MWFB 3BPLC 1TZOA 2X41A 1THAA 5ALCL 3WMQA 3LZOA 1A6AA 2HPOA 1ZHBB 4JFFD 2HKHH 3MU3A 2W60A 4DAGL 2JCCB 2FHBA 3KL5A 1FFNA 1OAUL 3SDCC 4Q58C 12E8L 1Z9NA 4RZCA 3SE3C 3QJTB 5DS1A 1T83A 3N85L 3RWHB 4HEPA 3L3KB 1VGKA 4V2CB 1R75A 5BS0B 4NKDB 1ZHLB 4J8RB 4WW2C 4W9GC 5F8QC 3Q5TA 4WLCA 4Z7WF 1OALA 2AEQL 1CFTB 3STZB 3BAYA 3FU7A 4UV4H 3VRJB 1B4JL 2XZAH 3H0TB 1VERA 3NDZE 3QUZD 5B38G 4FXKA 2R2EB 1CZ8H 4YPJA 2Z9TA 3FZUD 4MA3A 3ASNB 4ZK8A 4JPVH 2VSDA 1FNAA 1AD9A 4B6ZA 2J44A 4HS8H 1KFAH 3CU7A 1HEJC 1HYRC 4F7MA 1I9JH 1VAHA 4PD4K 4UQ3B 5E1QA 1XGUA 5L9DL 4KMQA 5JPNA 2VLJE 5J1AA 5IJKC 4FD0A 4UM9D 3KHOA 3AM8A 4FNQA 3RA7H 2VSCA 3PF2A 4ODHH 3IWVA 1MQKH 3PL6B 2DEWX 5E6IB 1MRDL 4X4YA 1U2YA 2MQGA 1NQBA 1VZHA 3FN0L 5I24A 1XT5A 2YGQA 4J3TA 4XNBA 1TTBA 3P3UA 4I87A 4X6FA 5FA4B 3GXFA 5DFWH 2AI0H 1WK0A 4MAYD 4NC1C 3OKOB 3SGEH 5D2NC 1Q9OB 4K15A 5EZIL 1R4XA 1L9MA 3C5ZA 5KS9F 5D9SA 3IDJA 3MDJA 4HIQA 5C09B 3ZE2E 5MHSE 3T4YA 4PR5A 2EXYC 3D52A 1JF5A 4JRLA 3OKNA 1KYOK 3ESMA 4OGYL 5ICXB 5A40E 3MA9L 2ADYA 1Y18B 3T3PF 2EE3A 4ZSOB 1BJ1H 3B4NA 1AXSA 1MCLA 3D08A 1E2WA 3CZFA 3P4NA 2W0LA 3RY6A 3NZHH 4A63A 1YHPA 5C0DB 5KW9H 2AJXH 2ATPB 3QG6A 2CDEA 1LJMA 1Z0NA 5GGQH 1RZGA 1JUFA 2G3XA 1OF0A 5SWSA 2XTSA 2ZUWA 4FQXD 3UBXG 1T4KA 4KBPA 3UL4A 4ANVA 4X6EB 5JHMA 5C97A 1K5NA 2G4EA 4N8VA 2LLGA 3H4FA 5EV7A 4BQ8A 4MJIE 2ZOTA 5E8DH 3ZTDC 4WDIA 2O6EA 5FW7A 2VZ1A 3VFPA 4HZLB 3I75B 4WFEE 4Z7VA 1E28A 2DIJA 1WIPA 5EFIA 5KBMA 3TZVC 4V33A 1RZIA 2PWDA 3HAEB 2CBQA 2LAAA 4HH9A 2NCMA 4UNIA 3B6SB 3ZU8A 1A9VA 1PJWA 4AQ1B 1YEHH 3BUDA 4MHHG 2Z8SA 4YHOL 4B0MB 2V6HA 1KTDB 2EVIA 2R51A 2UZYB 4GYBA 5HYEA 3N5AA 3S36L 4FEIA 1JHKL 1U58B 3CZEA 3BD3A 3CAFA 5D4JA 4CSZA 3JQOB 1NUDA 3REWA 5ADOH 1JCVA 5GZOC 2PXYB 3U82B 1WZMA 2XSKA 4YHLH 1T03H 2P5PA 5EEWA 1J8HE 5A16A 1KENL 1KN4L 1JPTL 2F1BA 2VDML 3CHSA 5FXCH 3SKOB 1AO7E 2Y2YA 1U3YA 5TPWL 4HMDA 3DOSB 4DGYH 4DT2A 2V5TA 1HNFA 1FYHB 3L9BA 4LSVL 2BRRH 5DK0A 2VB5A 4NC1E 2HLAB 1G87A 2NTFB 4WSGA 1I3RA 4B97A 2CWRA 1T3FA 3B3IA 5EEUA 4HWNA 2XVGA 1XF2A 4HIJA 2MKWA 1SUJA 1Y1UA 3C9NA 2F53B 4PJGA 4E9YA 4GUPA 5T1LB 1N8ZB 5F9DC 2WIIB 3KMDA 3QNZB 4PJAB 1E8XA 1P5UC 4MXWL 3TVMC 5D72H 2CKNA 4X7TB 3ESUF 5HHXH 5KAQF 3OGCA 1CDHA 3BZ4A 2EEBA 4GQPH 1ES0A 4I48B 4NKMA 4AEFA 1VESA 3AS0A 2PWHA 5CGYD 1MNUH 3ZKXB 3GMLA 4G9DA 3IN0A 5FYJE 3WXVL 5B39A 2VMDA 2VR7A 3QEQB 5F1KC 1YUHB 1JHLL 2CG9X 2QGBA 3CLEL 4OLVH 4WKZB 4X5QA 1WEJL 4JAMA 2WNGA 1QASA 2ZSVB 3QAZB 4AGQA 4Z7WB 3O9WC 3P0YH 1OGTA 3BPNC 3PWLA 1NSNH 1MCOL 3D3VB 3KL3A 4XGZA 2AXFA 3RIFF 1IGJB 5D7KD 2NNAB 1RIHH 2FEJA 4PWGA 5T5FA 1LP9E 3MRCB 1A6WH 4Z7VF 4JE0A 4F2MB 4ZYKB 3CX5K 4ADGA 1C5CL 3H2WA 3G04A 1RULH 4JQIL 1CGSL 2PCXA 1ONQA 4ZFGH 2VMEA 3COOA 2JQMA 5I16B 1D9KB 1YMMD 4HJTA 1OGAB 3NIFF 4JG0L 4XMWA 1BMWA 4YVNA 1D5BA 2W91A 2F1AA 2R23B 3RLSA 5GS0C 4GXUN 1BVLB 4QJ4B 1EHXA 3ZE1F 5LBSL 4OD2A 1NGWB 4PBWD 3V0HA 1ORQA 4EI5B 3C6LD 5ACMA 1B88A 4LCIH 1S7SA 4OB5L 2Z7UA 3EADA 1FO0H 3M7OA 3NH7L 3QXDA 1Z32X 2BP0B 3AACA 3MV7E 3QJSB 5K9OA 4JY5H 1L9QA 1G4RA 4X5WA 3GMNA 5CP7B 5KS9B 1P7QA 4NQSA 4YMPA 1S78C 4F7TA 2VNCA 1JNNH 5TF0A 1KYAA 5DUBA 1Z3GH 1EFXA 3QJFB 3RL2A 1Z0MA 3T3PB 3WJMB 4GAYA 4P8QA 4O4YL 4UUJB 4Y5XC 1N59B 4NPJA 2Z8WC 1EMTL 4ALAL 4P2QE 3NPSB 1XGPB 5B8CC 1BEXA 2DBJA 2XWEA 3C87A 2TAAA 3FUFA 1PIFA 5DZAA 1H0DB 4RH4A 1QFUH 4PJGF 4KVPA 2VMJA 5FYJL 4ODSH 4LMQI 4I89A 1U3HC 1A6AB 2OMTA 4H88H 1MI5E 2C3GA 4H20L 2W60B 1NCWH 2WLLA 4KTDH 4P5KA 3N50A 1FFNB 2UX6A 3UIZA 4RZCB 2WJ7A 3II3A 1GCYA 1VGKB 4MFHA 3HB3C 4PVMA 2VLJD 2I69A 4HA1A 5G2NA 1QLEH 2BSCA 2PYEA 1NMCB 5C2BH 2NW2A 3PGFH 3TYGH 4TQIA 1JGDA 3FU7B 4LGRB 4XWGL 3SYOA 5D7SL 5IBTH 5B7FA 3QWRD 3ARFC 4FXKB 2COVD 4O00A 4A2HA 1UT2A 4LP5A 3U4AA 4PN6A 4MA3B 2G75B 4KRPC 3L9RA 2DV6A 3SBWC 2A9MH 1C5BL 2LVCA 4XCFL 3HMXH 1AD9B 4AZ8A 3HBZA 1PLBA 1X6NA 2XZCH 1RHHA 5SV4A 4F7MB 1CN4A 2XPGA 5EOCJ 4MD4A 4UQEA 3HUJA 2EDBA 1XGUB 4DPRA 1CQYA 1SMOA 5JPNB 3VXRE 5J1AB 5JW3L 1YN7A 1VPOH 5MHSD 2IV9A 1QI4A 3AGVA 1WZKA 2H41A 4V1DA 3SBQA 1TMQA 1ZRUA 4ODVL 3FOMA 3GXUB 3R7QA 4KXCA 2EDEA 3VI3E 3MNMA 2J8UE 5E51A 4GQ9L 5I19H 3ULVF 5JIMA 3QI9B 3ETTA 4CNIA 5IHZB 1S7XA 3RX9A 3BFWA 2NY4C 2EEXA 4X7FC 3BH9A 1HYSD 1GZQA 4U7MA 3C5ZB 3UC0L 5D9SB 5F6IB 2JCWA 3QC5X 3IDJB 3L5IA 4U0RC 2VZTA 3B8YA 4WFGE 3WKNA 3T4YB 4PR5B 4J3OF 2WW8A 2YQBA 4PV8A 2A1WH 3SJVA 1ZPUA 3GFUA 3IRZA 3MOAL 4MJID 1NFDE 5J1SC 3ULUC 1QBAA 3ARDA 3ZO9A 1LO5A 1AXSB 4NAJA 1JNHB 3CZFB 2VDQL 2GC4C 3P4NB 4K0OA 2Y5QA 4XB7A 2EDFA 1KGWA 4WFED 2HSIA 4JKPH 2DLEA 1UM5L 3KWVA 3QG6B 3QRBA 2CDEB 5DC4B 3KLLA 2VOTA 4WI5A 1RZGB 1JUFB 5SWSB 2MMXA 3O2WL 4JVUA 4NB7A 3ZKND 2GK0A 2MQ0A 3GSQA 1T4KB 3VYOA 3WLWD 1XX9C 1MCPL 3OAWA 1KUMA 4B50A 1K5NB 4N8VB 5FYKH 2WKGA 3IFNH 2AQRA 2NR6D 1KB5H 4MX7A 1R3HA 4QYAA 4WDIB 1G5GA 3DTDA 2H3KA 4PFEA 3K91A 3QFDA 3VFPB 4RGOH 2UY7A 5BQ7B 1N6UA 1J8HD 5HDBE 3HI1A 1E28B 4Z7VB 5EFIB 3F04A 3O4OC 4LIQL 3K46A 4N1HB 1RZIB 1SY6H 4DP9X 4ZNEA 5AB0A 1G6RH 5L6YH 2Q7YA 1F6LL 4FMFA 1I1RA 4U1NA 4HH9B 2CM6A 2DQCH 1FBIL 1HHHA 1I3GL 4AKPA 4KNQA 1EHLH 4PGDA 2LTQC 5AAPA 3O6FD 2VC2L 5AW5B 1KJ2B 2DQEL 2OR9H 3CFQA 5H4ZA 1IBDA 1BEYH 3TFKD 3EYSL 3E6FA 4TVPE 4JMNA 1HHIA 5EOCL 3ZE1B 2QSCL 3HUJF 5EZOL 3REWB 1GJIA 3NCJL 1M6OA 3R19A 4I2XB 3CVHL 3A6OA 1A6UH 3QRFM 5A16B 4O58H 1QYGH 1I85C 3D07A 4CAGA 4GKZA 3LQAC 1FGVH 2B77A 1WFTA 3CFUA 2ZWYA 3ZKSD 5DO2D 2F68X 2XHNA 3NSCA 3U0WL 4MMZC 2WHVA 4LCCB 1U93B 4DZBA 2O93L 5T3ZE 3GINA 1L9OA 4YHKL 5AOMA 1MNNA 4XVTL 2FJHA 1I3RB 2ZPKL 3B3IB 1T3FB 4NHCH 4XCCH 4XO3A 2R56L 2NXYD 5F3FA 4WKXA 5FYJD 5BV7B 1UA3A 1XF2B 1AR1D 2HMID 2Y36H 4JO4L 3C9NB 4L8SB 4PJGB 1RZQA 4GUPB 4W9LC 1NUFA 5KVGE 3VD9A 3FQ2A 1HOEA 5FW6A 4C54A 3U30B 3SQBA 2KC0A 3TJHC 5LDUA 2P3YA 3BZ4B 5CSZA 3SD5A 1ES0B 4NKMB 1P53A 5DK3A 3QCTL 2IMMA 4N2BA 2EUZA 3GMLB 4G9DB 4TF4A 2X89A 5B39B 3V79C 4IRJB 1JN6A 4UMSA 1ZS2A 1BAFL 3T0EA 4Z76B 1B6DA 2O5ZH 3UPAA 1YYLL 2YUVA 4NZTH 1U8HA 1RLWA 3UAFA 5IFAH 2EVGA 2GITB 1XIWD 1OGTB 2VWEC 3LEXA 3TO4B 3V0AC 5MENA 4XGZB 4KZDL 2AXFB 3WNKA 1BFOA 3AZUA 4BGLA 3RTQC 1NIFA 3U2IA 3IEAA 2NW3A 3BESR 4P23D 2LT9A 1TPXB 2EEAA 1U8NA 1J87A 3MX0B 3G04B 2PTTA 4XP4H 5EPMA 2BZDA 5K93A 3MV7D 1ONQB 3BAJA 3LKPA 4LEEA 2IANE 4LLDA 5CINH 4FAAB 2YPKA 4XP6L 4OCYL 4NOFA 4W9FC 1FNFA 5CSGA 1OE2A 3TJEL 2VLRA 4XCEA 2FWOB 1D5BB 4GY4A 1WFOA 4YK4B 4PSPA 3RURA 2OMXA 3F5WA 5D70H 3QRGL 3NSJA 5DHVA 1E50A 5MERA 2XXGA 1DVUA 4OD2B 4YH6A 5K9KA 3CFMA 4P2QD 2MCPH 3HR6A 3LHAA 1DSYA 5ISZA 4PUBH 1S7SB 1RI8A 1G9NC 2QFPA 4NZ8A 1A25A 2A73A 2D03L 1JYNA 5AW6B 2P5EA 2W9DL 5I75B 1F4WL 3I84A 4Z1PA 4G3YH 3GMNB 1E9OB 3TVMD 3IJHA 3B56A 3VFGH 1P7QB 1PLGL 2W65B 4NQSB 2G5UA 1GGUA 1J1OL 1MI5D 4F7TB 3GSWA 1OQXA 1EFXB 1JXDA 3RL2B 3KLQA 5KVGL 4GAYB 5TE6H 5CD3A 3BT2L 3MRMB 2QJDA 2IAMD 5LN8A 1BAWA 4P46C 3L81A 2WMPA 4XNMA 1CGUA 3N2JA 3BN9D 4GEJA 4TUJA 2Q1EA 1DHKA 4AGMA 2PF6A 2LAGB 1QBMH 4PREB 1LD9A 5D1XA 4ZXBD 4P49A 3DI3B 2TRYA 1JVLA 3LZFH 2OMTB 2BH0A 2BS8A 5G4OA 3S37L 4HJ0D 3BSZA 2AS5M 2WLLB 3JVGC 4FLHA 4P5KB 4CBZA 3N1FC 3P3YA 1ROCA 3BUTA 2HRGA 3KPMA 1YYML 4LRNH 2KHAA 4JFFA 3DYPA 1MCCA 3ABGA 2DQTL 4C8XA 1G1YA 3IDYB 3SPHA 3VXRD 2BIHA 2AVFA 2IPUG 3EDEA 3TLRA 4TXVB 2F19L 2PYEB 5E2TH 2NW2B 1NTDA 1JGDB 1PD0A 1MFDL 1J5IA 5EBLA 3D12B 1YQVL 1BIIA 3TBYA 4FTVE 3L9RB 1MLBA 4ODWB 4L1TA 2EE9A 4UZSA 2D7QA 4E36A 3QUZA 2VDPL 4U2ZA 4HC1H 2ZX8A 4XB3A 1OANA 1RHHB 4D0DB 4F7KA 4XH2A 4MD4B 3B2DC 3E8UL 1BREA 3HUJB 2X0VA 4KKRA 2RIKA 4UQDA 3VGDA 3WFDL 5JXAH 2OP4H 1YN7B 2J1YA 5J8OA 4WFGD 4QRFA 3QA3B 1ZEAL 4V1DB 2IQ9H 1YSOA 2OR7A 5GRXG 5TF1L 1OY3B 3FOMB 3ZDXF 2Q0ZX 4XOEA 4H25A 4Y5VC 5EOQH 3FNKA 5J13B 1T20B 4UM9A 2QVMA 3BIBX 2Z6FA 5JHLA 1QP1A 4U1LB 4CNIB 4ZUVA 4AUYA 4I0CC 1S7XB 2DQFA 2DLTA 4Y2DC 3GWJA 4YSUA 5CEXA 2XXMB 5CJQH 4OFYD 2LVEA 4NZRH 2F58H 4HUUA 3VFNA 4J3SA 3LNIA 5JHAA 1SXAA 2GB2A 3BH9B 1GZQB 3BKML 4FMVA 4LEOA 3MLYL 1EHAA 2NY2B 3KS0H 4W9CC 1H3GA 2K3TA 1EZVY 4O2CA 4PV8B 1JGUH 3SJVB 4ESKA 1HILA 5FOBA 1OT2A 1RVFH 1T1XA 1QSFB 2QQNH 3ARDB 1LO5B 2IIJA 1T5KA 1CDUA 2D7PA 2ZWSA 4UV7L 1HEHC 4YDNA 5HI5D 4M1GL 5C7XL 2IOOA 2F8XC 2XPYA 2VGLM 1UCBH 3TU6A 3KBHE 5FCSH 3H9YA 5ALBL 1AE6L 1AS8A 1CYXA 1OV8A 1TYEB 2G2RA 3QS3A 5I9QB 5D1QD 4DERA 1E3FA 2ZAHA 1YPZA 3GSQB 1QNIA 3MBWA 4DQOH 1A4BA 2NX5A 3NJHA 3K7UA 1MREL 5C92A 5AUMA 4GRLD 1G6VK 2Y7MA 4FQ1H 1R3HB 2HJLA 4TVPD 1UVQA 3BYYA 4FQXA 4HMEA 4BCYA 4I1PA 5DJDA 4M9PA 1LEGA 1RK7A 1QFHA 3ARBD 1HE8A 3QFDB 2R2CA 4LNVA 5FYKU 4AYDC 1KC5L 2UY7B 2IVFC 3HI1B 1T0NA 2UZIL 3V6OA 3AROA 3RG1C 2X4TA 2Q7YB 3OSKA 4U1NB 1T4WA 5LHDA 1S9VA 2WWMC 4BE5A 1HHHB 1E4WH 4UBDC 2O72A 2WB7A 5J5EA 4PGDB 3C8KA 4U1GB 4ZS7H 5T3ZD 4NUPA 4DF9A 1N10A 3DHPA 5ID1A 4MSWA 2EIEA 2ZF9A 3OKYA 4JG5A 4WENB 1FRGL 2KPWA 4GUCA 4KI5C 1HHIB 3NCYS 3V2AR 5FS5A 4L8BA 3WY4A 5J4MA 2D7TH 3II2A 1Q9WA 4HUCA 3CWGA 4OQTL 3KW7A 2QFRA 2CRIA 1KCSL 1MIML 2AXGA 4GKZB 1PBYA 3CH8A 4DWHA 4A66A 4ZX5A 5CJ8A 2BVPA 2YOCA 2GHZA 4G6MH 4OM1L 4AZUA 4BM7A 2DB8A 1LO0H 3V55A 5ITFA 3E2HC 4B9KC 2FJHB 3WY3A 5IVXE 5TJWK 3U9WA 4LK4A 4HDIA 1PG7L 5E2UH 4YXHH 2ZCZA 4HCFA 4H8VA 1Q0EA 1J1PH 5LWYH 1XB3A 5L4JA 4N25A 5CLZA 4XPGL 4PGBA 4YL4A 3VXTA 2IC2A 4IIQA 4ZPTA 4JGNA 4F8QA 2F7IA 4GI8A 1LDSA 2CO6A 3GRGA 4TMPA 2HH0L 4F2FA 1SM3H 3CFCL 3SQBB 5GS1C 2YGNA 1YVLA 2XTLA 3S97C 4CMHB 1CTNA 4W6XB 4HUMB 1GGYA 1IAOA 5KOMC 3WI9A 4IBWA 1JN6B 3KDMA 2IAND 2V17L 5C0JA 1ZY9A 2AAVA 5E8PA 1HC1A 1YPZF 3A21A 2L4OA 3T0EB 3VFTA 3C6SA 1U8HB 3KPSE 1YEGH 4NN7C 4OLUL 3LEXB 5MENB 1MFCL 2J12B 5F96L 1QATA 4QXUL 4L1HA 1KLGA 2NW3B 2H47C 1MFVA 5IW6A 1GW0A 4CU8A 2LFEA 1X9RA 4AGNA 1U8NB 4POYA 4ONGL 3BWUF 2N1TE 5EPMB 5I1GH 4PEEA 2AXJA 3LKPB 4LLDB 4LAQL 4WFHE 5FHBL 1IKFL 2NQ3A 4HWEL 3CVIH 3KXFE 4KHTL 3CN1A 3QYMA 4MB3A 1WA2X 3EDFA 2VLRB 4Y16D 1F3DH 1NEUA 4RISL 4XCNA 1F00I 1X5MA 4YWGL 3CHPA 4M9OA 3F5WB 3ZDXB 2FT7A 1DQDH 4AQEA 5I1CL 1PZBA 2PWFA 5A2KH 1SHWA 4UQCA 5DHVB 5E5UB 5MERB 4UQBA 4AT6A 1RK1A 3KLHD 1YMMA 4F9LC 3UO1H 5ISZB 3DX4A 5H37A 4OF7A 3Q8AA 2A73B 2P48B 2P5EB 2C4XA 1F1DA 1S7UA 2FK9A 3GI8H 1H8NA 2XI9A 4RMBA 4RDBA 4LARL 3RILA 3IRPX 3UTZA 3IJHB 1MCSA 4KXAA 2OL3L 3AXHA 3TJHD 4CILA 2XKSA 3WFEL 3GSWB 3MBXH 4IRSC 1ITCA 1OAZL 4WU7A 5HJGA 4DIXA 4Y4FD 4P5SA 2G5BA 2ZXAA 3QWOA 1ZHNA 3GHBL 4JFPA 3GXTA 2DQDH 3MODL 2XA8H 5CD3B 3MV9B 3GJFB 4N87A 3KH3A 5I5MA 2YEQA 5DO8A 2YMXL 1N6QH 2KQNA 2B4CL 3HC3L 4XNMB 2BSBA 2Y1YA 1WAPA 2NSMA 5IHLB 3S8WA 1BM3L 4J1UA 4TUJB 4NBZB 3SE9H 3C5XA 4KTEL 3ET9F 3D51A 2NNCA 4LO9A 2PMZA 2BVQA 3PQYB 1AG0A 4LF3B 5D1XB 1LD9B 1UJTA 1OTUC 3PAUA 3RTQD 3GIVA 1TQSA 4FTVD 4GB9A 1Z66A 2FE0A 1J0HA 3PV6A 5E9NA 5B22A 2P28B 4YSAA 1AHWB 5F7BA 1DQKA 1T21B 5FECA 3RJOA 3AQYA 3GDCA 4FE9A 2VZVA 4JFFB 2R29A 4EUPB 2EYTA 4C4KT 1R0AH 1MAKA 3EJUA 4AC2A 1J5CA 2QVFB 1PZCA 3QS2A 3QIUC 4FABH 2A0LC 5GGRY 3FHEA 4M5ZH 3EDDA 5EBLB 5F3BA 1DBAH 5G5DA 5JQ6L 4OZ4A 1BIIB 5DJ0A 2VLJA 1TVDA 1U91A 1N0LB 4OCXL 4YS4A 4OJYA 4PRHE 2YAFA 1MLBB 2DTSA 4XX1G 1YAIA 1DL7H 1QPKA 2VRAA 3WNLA 4O02L 3QPXL 3QBTB 1OCWL 3QUZB 4PJCE 5A2IH 1WZAA 3QWRA 1JGVH 2OKMA 4XH2B 3VYPA 3LRHA 1XV8A 5FUZL 2W92A 5CUSH 4IDJL 4R26L 3VGGA 3W9EA 3E0GA 4G8FB 5HI3C 4R7VA 3RKDC 3NJFA 1U8QA 2IPKA 1PKQE 1W91A 4R7NA 1DANT 3OKMA 4G82A 1QBLL 1T0OA 5DWPA 3NAAH 5I0VA 1SN2A 2FT8A 1DSFH 1TYJA 4N6RA 4UM9B 4PWIA 3DKHA 4QTFA 1QACA 3GBNL 3VRIA 4FFZH 4IOFC 1VFOA 4ZUVB 2YN5A 2DQFB 3LKOA 2AXWA 5CEXB 4PTTA 4U6HA 5GGSB 4HUUB 2C9PA 4I7ZC 2P24A 4LEOB 1EUUA 3PHQA 5ITBH 4WRLA 2GW5A 3UJTL 1MY7A 4MAYB 1N5YL 1BG1A 2WN2A 2CJ3A 3MJ6A 4O2CB 4QGYA 1I9RL 2YEZB 1ZK5A 1WSST 5F7LB 2BJML 1HILB 5FOBB 5B3JE 5I1JH 3R4RA 4EXPX 2XZQL 2M2DA 3VMOA 1G7PA 4YBQC 4HXAL 4U6VL 2WWOA 4ZPVB 5ERWA 4OM0H 2AK1L 3I74A 5AALA 4J3VA 4YDKL 1FZJA 1PY0A 4MJIA 2KLSA 2OQJB 1SBSL 4PI0A 2CPUA 5LNDA 2OCJA 4HS6A 2G2RB 3IN2A 4XX1E 1H9VA 1YPZB 2HT3C 3MBWB 4WW2A 5DR5H 3FO9B 3WY1A 1S9YA 1RURH 4XMLL 5AUMB 4NP4L 5IB5A 2AMGA 1GGIL 1MVUA 2YK1H 2HJLB 4W9KC 4L5FE 3ZRSA 4FQXB 1IAIL 2B1AH 4NP9A 1LEGB 1P69B 3CXHK 4WCYL 1F18A 2J21A 4XWOC 2E74C 1JG9A 1T0NB 4KQ4H 4ZX4A 2NR6A 2A9DA 4GW1A 3KR3L 5FYLL 3WKML 2X4TB 1NMAL 1CCZA 4JQIA 1AGDA 4S1QH 1S9VB 2IOMA 1YO4A 1UA7A 2Q8BH 3H8NA 1K8IA 2X1OA 1TFPA 1ECYA 5DURD 1CO1A 5TE7H 5ID1B 3ARWA 1DUZA 4MSWB 1N4XL 2B20A 4XC1H 1TQCB 4Y2DD 2NY6C 5DVMA 4KPHL 5L4IA 4X6DE 5LBSA 4IQHA 2KLTA 1IZKA 3CTTA 4L8BB 1WWWX 1Q9WB 2DI7A 3O6FA 4F58L 1CI3M 4JO3L 5FGBC 1HINL 3F83A 4C4KO 3T08A 1WA0X 5JOPE 4KO6A 4NZUH 1MW0A 5F0LB 3OSVA 5DHYA 4TUKL 2BVPB 1I8AA 3F7PC 4N24A 3M88A 5FB8A 1OSZA 1N6VA 2FSDA 2YUZA 4ACPA 2P43B 5DC9B 3RVTC 2XWTA 4I9WE 2CLZA 3ZE2F 4DGVH 4CADA 4L1SA 1HH9A 1YLBB 1X5HA 5ITFB 3LEYH 3M6DA 3A3YB 1FNGA 4RGMB 1DZ0A 3CSYA 4HDIB 4NJ9L 3KGTA 3H7LA 4JREB 4OD3H 5IJCC 5IOKA 4QY8A 5KTEH 1YEJL 3AG3B 5GS0H 1W72A 3LXAA 4FFYL 5FUOH 1WFIA 3VXTB 3QJZA 1FIGL 3KPSD 4IIQB 4ZPTB 4GMSL 1LM8V 1RPUA 2YXFA 1WP6A 4S0HA 2GHWB 2CO6B 1IGCL 1JI1A 5KVEL 4QXVA 2EECA 2YAMA 4URKA 3L17A 3OL2A 5IREA 3D09A 3SZKC 4DGIL 5F0JB 4G1MA 2D73A 2BCKA 8PAZA 4NUMA 3RWJA 3KDMB 4UBDD 4MXQC 4R5TA 5C0JB 4A2EA 5E8PB 4WFHD 3UDWC 4X9BA 2ZTBA 3KXFD 4WW2F 3GYRA 2VXUH 5L88L 3C6SB 5LG6A 4TSBL 1FG9C 2CD0A 1Y0LA 4Q0XH 3UMNA 2F5BL 2A77H 4ZUSB 5AYTA 5HYSG 3QO0A 3FTZA 1JIBA 3JWDL 2AEWA 4FHJA 2BVYA 4DETA 1KLGB 2UXGA 5IW6B 4N2NA 1FWXA 5EUOE 1OT4A 4YQXL 4XNZC 4L3FA 1XIWA 2JKLA 2OZNA 5ACZA 3HI6H 3FYIB 1WUNT 4BFBD 5DMGC 2CIIA 1ESOA 1RZFH 4P23A 2CH8A 1E40A 1HK6A 4TTDD 1I3UA 5DJ2A 2ED7A 1DQTA 1XGYH 2GC7C 2HKFH 2ODHA 4M1DH 4NZDA 5HD8C 3HHSA 2MTAA 4G5AA 4MS8D 3MV7A 1ZTXE 1W0VA 2ERJB 5I5IA 3MFFA 2ZKMX 3CIQA 3EJZC 4GRMA 3NTCL 4AT6B 4D0CA 1E4XL 1RK1B 1YMMB 2OMWA 2E7MA 5EZLA 3FSZA 1JNLH 3GIZH 4K8RC 3RWDA 2W8CA 4KVCH 4L9LC 1S7UB 3H1ZA 3LIUA 3UTZB 1F2QA 1R5WA 1T80A 4P2QA 2A6KA 3C6LB 3K1DA 2RTTA 5HYIA 1JZFA 2RA1A 4DN3H 2AJYH 2YHGA 1X5IA 2G5BB 3QWOB 1GSKA 5KYYA 4JLRA 4PS4L 3QYNA 1VFBB 3ZHLA 2NUTA 1CIDA 4KK5C 2CUIA 4J1UB 5AAWA 3ZYJA 1CLYL 2FX7L 1CL7H 2BVQB 3L4UA 4IHBA 4P2OD 2X4QA 3MV01 2EC8A 1AQ8A 1JK8A 3FQ1A 4FULA 2DWTA 3BO8A 2IAMA 2K4AA 2WJ5A 3WIIL 2FGZA 2MOVA 3OLEA 4KAQH 5T3XE 2A4CA 4PRHD 1GS7A 2N3JA 3PV6B 4YBLC 3LNEA 4LCUA 3X12A 4ZXBA 2ARWA 1M7DA 5FECB 1NH6A 15C8L 4HQQH 3A6CH 3BAXA 1NCAL 3RZCC 1PNCA 4HH8A 4JM2D 2O26U 2EYTB 5FFGA 5JHDE 1PG7W 1AZNA 3BD4A 3CC5A 3KBEA 4NT6A 1HX0A 2HXAA 5FWQA 3P9MA 1PLCA 2G0LA 2KZWA 1UHVA 1FA4A 4P2RE 4LLMB 5F3BB 5G5DB 4OZ4B 1QUNA 1R3IH 4IKLA 4PWJA 5F93C 4MD0A 2VLJB 5DJ0B 3VXRA 1XGQA 3WN5A 3N9GL 4APXA 1M1SA 5DUJA 4P59L 1S5IH 1ZTXL 2H32H 1KJ3L 1BXXA 3MRNB 2J88H 2FBRA 2XXFA 5T8IA 4GG6E 4FTDA 2XQBH 1WWAX 4XI5D 3MCG1 1JHTA 3VI3A 3W9EB 3ZTNL 1FYTE 2J8UA 3O2VL 3ZUNC 3L4ZA 5IOPB 2OX5A 5CMAB 4E9VA 1CVRA 5ESQA 3X2QB 3DX1A 1U8QB 2IPKB 4QTIH 1E67A 1NCCL 2DICA 3OM3B 4R7NB 4AL8C 4MAUH 3V5HA 3OKMB 2Z8VC 1UOLA 3G6DL 4A7QA 3P0VH 4XO9A 3ROLA 2C3XA 2HKHL 2Y1AA 2FT6A 4N6RB 3VRIB 3W11C 1E3XA 3ZE2B 2JE8A 1E42A 4N0YH 1D2PA 5CFAA 3PDOA 3LKOB 2CNYA 4PTTB 2Y5EA 1XB8A 4ABWA 3M8OH 4MD5A 4N85A 4QAWA 2JMRA 2P24B 4K71C 3PHQB 3AY4A 2HCZX 4XTRC 2CCVA 2HG5A 3WSQH 4CN1A 3ZZ1A 5L4MA 3GS7A 1MJ7H 4Q6IC 4EOWH 4OFYA 5B3SB 5I28A 4WSJA 2ZWLT 3WO3B 1KYUA 4IBUA 4TNGA 4GP4B 2AEOA 4O2EA 3WG7B 3CIAA 1G7PB 3D69A 3VH8A 2P42B 5ID0A 2X10A 5HHVH 5ERWB 2K7PA 1CXFA 2AVGA 1FZJB 4MJIB 4FNRA 1KCWA 1S7TA 3V6ZA 2NYYD 1KG0A 1A3ZA 4HS6B 4XPBL 5AAMA 5I23A 1RZKL 3VXPA 4WW2B 3F00A 3IDUA 4R90H 3U2SA 3BAEH 2CBMA 1S9YB 2GUYA 5IB5B 4ZMTA 3WDJA 3KLKA 3U0PA 3Q8CA 2A6IA 3OTTA 1QW9A 5IG7A 3ISWA 5D1QA 3FYEB 1BSIA 1ZANL 2VKWA 1NUGA 2DKUA 2I60H 1XEUA 2YD4A 2F54E 4WWKC 4ALAC 4GRLA 4QCIA 1KNOA 5EN2A 3UMTA 5JOPD 3ASWA 1CGVA 3QEGL 4P5TD 4DW2L 1AGDB 3F65A 2H6OA 3CHOA 3ARBA 3K6DA 1XF4A 1MW2A 5B1JC 1K8IB 1J8HB 2C1PB 1D7FA 1EJ6A 2QVTA 3NEEA 4I9WD 5DUPL 2IPTH 1DUZB 1SNRA 4IOFD 4LPVA 3VUAA 1AO7B 2WVUA 4JDTH 5JDSA 3DJTA 3NA4A 2V5YA 1YNKH 1YUKB 4J3OH 5EU5A 5F89A 3VI3F 3O6FB 5I6KA 1F58H 2J8UF 2BHYA 5DUMH 3HZYA 4Q4IA 2J6EL 1MKFA 3NZHL 4O9HH 3OQRA 5EEYA 1QMUA 2Y6TE 4G7YL 5DD5H 5DHYB 3RDTC 2BXZA 3UBXB 1N5AA 1OWRM 1HJCA 1RUKL 2PW1A 3DV6A 4JUTA 5FB8B 4OF5A 1OSZB 1U8LA 3BX7C 3VXQA 4YBQD 2XWTB 2CO2A 4CADB 3V7AE 1A6PA 1KN2L 3C5JA 1HH9B 3TV8A 4KMTH 1N68A 2ICEC 1MCBA 1FNGB 4L8CA 4ZFOL 3CSYB 4WI6A 4XNXL 2YFOA 2NY1C 3VNYA 4QY8B 1H3VA 3B43A 4N9GA 3VQ2C 1NIEA 1Q90A 4AYBA 1W72B 2FVNA 4LLWB 5A2AA 4A68A 2EE2A 4MAZA 2A83A 4XVUD 3QUYD 2NXYB 1O5DT 2VZSA 3KPRB 3L16A 4OF0A 1HL9A 4YSDA 1AR1B 4Y2NA 1P6WA 4N0CC 3IJSA 4XWOD 4G43A 4C83B 1TO4A 3AMLA 1ZLSH 4PJXE 4G1MB 3D2UA 5DU7A 1NBVH 2HRPL 3I2CH 3T5WA 3FTXA 1MJ8H 2BCKB 1A1MA 3AU0A 2YEVB 1JSYA 3RWJB 2OFQA 1LP9B 3BDYH 3DX2A 4FL4C 4D8OA 2CO4A 5HDBF 5GS2H 1QZ1A 3FKUS 4PVLA 1JPGA 3MGOA 1Y0LB 3RVXD 1KEMH 2FEDD 2M1KA 1ORSA 1P9MC 2OPCA 2NY6D 5AG9A 5C6WH 2IANA 2X9ZA 3QO0B 3KLAA 3V4LA 4NQVA 4ERSH 3AS3A 2ZXGA 4UILH 1E43A 3QDAA 2FD6L 4XNQA 1RXLA 1F4YH 1UURA 3MJ9L 1XIWB 5ACZB 4BH8A 5GJTH 3PAZA 5BQDA 1YNLL 1MJJA 5IEKA 3WNMA 2F7OA 2CIIB 4P23B 4XHJD 2X05A 1H8SA 2JJUA 5DJ2B 4AYSA 2ZKHH 4DVRL 2AQNA 3HHSB 3MV7B 4EN2A 1W0VB 3IS0X 2PO6C 4FA7B 1EK3A 1RQ5A 3MFFB 2JSFA 5LCVA 5E08L 4GRMB 2ALWA 4D0CB 1BMZA 4ZW5A 5HHXL 4FA6A 2OMWB 4Y16A 5EZLB 4F9PC 1F4XH 5TDPA 4GT0A 2N7BA 2A5UA 1MRCH 3PFUA 3RWDB 1C12A 3VVWA 4AMXA 2TSAA 2FX8L 1X9QA 4P2QB 1M2VA 2OAAA 2A6KB 4AKOA 3UTTE 5EIVA 5T3XD 2WWKT 2CUMA 1Q0YL 4I13B 4NM4L 5HSFA 3JTTA 1KV3A 2FIKA 3P0YL 4JLRB 4JW3A 3FT3A 3HRZC 2V2WA 3TVMB 3LMJL 3TBTA 1MI5B 5JHDD 4BA8A 1JDCA 3VG9B 2NUTB 1ZVSA 2VDQB 2R0ZL 4Y4FA 2MHAA 1OAJA 2CBPA 4P05A 2DLFH 2X4QB 2UUDK 3QUGA 1TEFA 4P2RD 4Z3HA 1JK8B 5TQ2L 1MCWM 4PAZA 3BO8B 3P11H 1SVBA 2IAMB 4KFMA 4R7XA 2MCG1 4BEIA 3L1OL 1J05A 2D31A 1VCBC 4H0GA 3MLVH 1NGQH 4CJ0A 5LDSA 4OI7A 1MRFH 3QUKA 4HLJA 2DH2A 5DRWA 3HW7A 2QV2A 4LCUB 1R34A 3X12B 3BPNB 4KZEL 1Q1JL 1LTXA 5F70A 1M7DB 4O5LH 1TOXA 3FU5A 2HLFC 3NDYE 3VFVA 3RTQA 5IVZB 3EIFA 4FTVA 5IV2A 1FZKA 4E68A 2PN5A 3CC5B 1FYTD 3MPCA 4S1RH 4ANXA 2LLLA 3SGKA 4AJYV 4UOJA 3P9MB 1A7QH 3B5HA 4WWID 1K2DB 3E9TA 1GYAA 3DHMA 1DJZA 4XP9H 5BPPA 1QUNB 1LLAA 4N2CA 1IJNA 4MD0B 3N06B 5CLXA 3VXRB 5I73B 1H5BC 1XGQB 3WN5B 4HKZB 2ZWKA 4APXB 1DBJH 1GYUA 4LBEA 5EC1A 3FL7A 1PY4A 4YC2B 2C9VA 1N70A 4IKJA 4LHUD 4LL4A 3RHWK 3FUKA 2JI1A 4X7EC 5FFLA 1JHTB 2X7LA 4R4BA 2XY1A 3VI3B 2J8UB 3A4AA 1K4CA 4DEUA 2OX5B 1HL5A 2ILLA 4JRWA 5ESQB 4BHUA 4OJFH 5L2KE 1F13A 2YOAA 1XF1A 3MUHL 3V5HB 2VZUA 1HZKA 3FQYA 2ZCHH 2K70A 2IPUK 3K2MC 1MUJA 4FNLL 1K3ZA 1AHMA 1HQ4A 2HT4C 3EW3B 3EHBC 3NYKA 3ROLB 3TF4A 3ZRCC 5E2JA 5EWIH 2VLKE 1CE6A 3RY5A 2PR9A 2QSTA 4LSUH 4YDVA 4FYTA 1NFDB 4HWBH 1Q94A 4TNEA 5B4MD 5JIDA 4MD5B 1A0QH 1EXHA 3UPRB 1QRKA 1ZA6A 3WEXA 2HG5B 1X6LA 2GIXA 5HGGS 1HSBA 1DSWA 3APCA 3DDGA 3TYGL 3WS3A 1D5IL 4JKMA 4HAKA 4HKJA 4O2EB 4BSWA 2DN7A 3VH8B 2CUAA 2A6JA 5JA8B 2CMRL 2QPEB 3QXUA 2X4UA 5FO8A 3RFZA 1EEYA 2F54D 2EILB 4XHQA 3S35H 5L0QC 1W8NA 3SDYH 4UT9H 2HZHA 1ANUA 1S7TB 1CU4L 1KF9B 1BCIA 3V6ZB 1F0LA 4POUB 5K9JL 1KG0B 2H1XA 2QDWA 2ZOOA 1HXMA 4ZO7A 3VXPB 1F1GA 1LWRA 4KZ0A 2VXSL 4OGXL 5CXPA 5HDBB 3U2SB 4I18A 3UAAA 5JW4M 1AOZA 2ESVE 2WWKO 4JB9L 3U0PB 3B2UD 1U41A 2NNRA 2A6IB 5IG7B 5DI8A 4KHXL 2NXZD 3HI5H 5I2IA 2DJUA 4R7LA 5I19L 4GRLB 4H8WL 4QCIB 1KNOB 5EN2B 2WBJD 1EEQA 2A74A 2CJSA 1I1AC 4I1RA 5DHVH 4IHOA 4LSTL 1BZOA 2LHAA 3ARBB 3BZFB 4AEHL 1XF4B 2DQIL 1RK0A 1S7VA 2OSLA 4JN2A 3U7WL 2VN3A 3W11D 1HDMA 1BD2A 4MJHA 3ZYIA 1QO3A 3OAZH 1KDJA 2A1WL 3ZL4H 2FLMA 3FF7A 5JDSB 4KWUA 2XRAL 5IBUG 4Y5VA 2CKBA 5IWLA 5EU5B 5F89B 3AG2B 4FQQA 2I27N 3DC0A 2E27L 5F72S 3U7YH 3LN5B 3HZYB 4Y2DA 4AENA 4Z9KB 5IVXA 2WANA 4JQVA 1S7QA 4JR9H 1HS6A 3U36A 1N5AB 3N0AA 5I1AA 2PW1B 3DV6B 4J12A 3WHXA 1U8LB 4MKMA 3QHZH 4U0RB 3VXQB 1OK8A 2OL3A 2B1HH 4IBSA 4FEMA 4PGEA 1U8JA 3C5JB 3FQTA 3T77A 4WTWA 2EH8L 2Q20A 5FUCE 3MRPA 3K4DA 3RQ3A 4L8CB 1KXQE 1KYFA 4WO4A 4PS3A 4KKQA 5FWRA 2X28A 3EBGA 5AG8A 2BP8A 3PRZA 4N9GB 1DFBH 3E3QE 1G5AA 3GBLA 2FO1A 4K7PX 1MDAA 5E2VL 2A83B 4M6OL 4AK1A 3V5DA 4DCQA 2RCSL 3HG0A 2F08A 4DP7X 5FDWA 1XH2A 4GAGH 5HDOA 2EIMB 1UTDA 2B5IC 4QRRE 5EZJA 3SDDA 4I3RH 3IJSB 3L3OC 4GSDH 2OM5A 1B90A 4FQPA 4WI3A 4WWKD 3KPSA 3D9AL 4M5YH 1DJGA 4M03A 4A6YL 1A1MB 3O3DA 1JP5A 4JZJC 1IB5A 2QKIC 5DGQA 3KH4A 2LU4A 1IAII 4MYWB 3O4OB 5DVOA 4PMFA 5E6YA 3IAQA 1D5ZA 1DLHA 1X7QA 5D8JL 1ORSB 2B9BA 1FGVL 2APBA 4FZEL 5JOEA 2IANB 3KLAB 5CEZE 4AY0A 3NN8B 4NQVB 4P99A 1H3UA 3KXFA 4FQCH 3CFDA 5K1VA 5DVNA 1CYGA 4XNQB 1BF8A 4HJGA 3OKEA 3QZOA 5DMIH 2FX9L 4K9EL 3VG0H 1FHGA 5HI4C 5HVHB 2R69H 4BH8B 4UAHA 5T33H 2UYLA 4P9ML 4WEUD 4F33A 1MJJB 3RDTD 4A1RA 4PWHA 2HWZL 5C1MB 1DBKH 1L9PA 1D7DA 4H8QA 4LOEA 4XMKH 5KVFE 2ZUQC 2EH7L 1W8OA 2CRMA 3UTTD 4ADIA 1CK0H 3LNGA 4PH8A 2Y36L