2YLKA

Carbohydrate-binding module cbm3b from the cellulosomal cellobiohydrolase 9a from clostridium thermocellum
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
145
structure length
145
Chain Sequence
MDVKVQYLCENTQTSQQEIKGKFNIVNTGNRDYSLKDIVLRYYFTKEHNSQLQFICYYTPIGSGNLIPSFGGSGDEHYLQLEFKDVKLPAGGQTGEIQFVIRYADNSFHDQSNDYSFDPTIKAFQDYGKVTLYKNGELVWGTPPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Single Mutation Reforms the Binding Activity of an Adhesion-Deficient Family 3 Carbohydrate-Binding Module
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
molecule keywords CELLULOSE 1,4-BETA-CELLOBIOSIDASE
total genus 36
structure length 145
sequence length 145
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.91: Cellulose 1,4-beta-cellobiosidase (non-reducing end).
pdb deposition date 2011-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00942 CBM_3 Cellulose binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.710 Mainly Beta Sandwich Immunoglobulin-like Endoglucanase-like 2ylkA00
1GA2A 1NBCA 1KFGA 2YLKA 4B9PA 2WO4A 2L8AA 4B9FA 4B9CA 1K72A 3ZUCA 2XFGB 3ZQXA 1G87A 2XBTA 3ZU8A 4JO5A 2WOBA 1G43A 4C8XA 1JS4A 3ZQWA 2WNXA 1TF4A 4B96A 3TF4A 4TF4A 4B97A
chains in the Genus database with same CATH superfamily
3LEXB 2VC2L 4WFGD 4YIQA 1A8ZA 4PP2A 1E65A 4H8VA 1UACH 5CCHE 2P8PB 3O8XB 3P9LA 3PWJA 1I1FA 2NPLX 3FC8A 3H2WA 5J56B 4S1SL 1FLRH 4FFTA 1NWOA 1MLBB 2XCMC 3E6HB 5IF0A 5LBVA 1Q90A 1KBWA 5CS7A 3KYAA 8FABB 3JTSA 3P1VA 1OGSA 2V5MA 4JPSA 4TUOA 4AX3A 3E9TA 3G08B 3CVHA 2E86A 1X6NA 2VXUH 1Q9OB 3HC4L 5LGJA 3GMPA 2NNFA 4OGAC 2WWMD 3BFOA 3LQZA 5KZCD 1SEQH 1HEJC 3H9SB 2GSIA 3I75B 4DKTA 4LLMB 4K3JL 5PCYA 1P7KA 2VDRH 3UJTL 2BIOA 1PYWB 5EIIG 1X9LA 3A4DA 3VTAA 2HVJA 5D72H 4XWGL 4ORZC 4KV5E 3ESNA 5EIIB 3SKMB 4DF9A 4PWGA 3BAXA 1AHWC 2CLVA 3IPFA 1UC6A 3OF6D 4KXBA 3A6CL 3MRLB 5E8EB 3WD5L 3MLSL 4BSWA 2WXIA 1IKNC 3WTWA 3ULSA 3QXDB 4LHQB 4HYTB 3TCTA 1AANA 2O72A 4ES9A 4P46D 4Z7UA 2VMCA 1PQZA 1F3JB 2WSDA 4I18A 4LSTH 4PJCF 1JV2A 3QZLA 3R8QA 5IW6B 1EHLL 3P4NB 1K8IB 2KLRA 2AVGA 3RWGA 4D9RE 3D06A 2A4CA 4G9DA 5LXGH 2F0CA 3EBHA 3D7PA 4ISVB 4MA7L 3NCEB 3G5YA 4WFED 4EF3A 5TH2B 3IRPX 1J5DA 4NUGL 4F2ME 1PZAA 5HJ3B 4U1KA 1CDGA 1XSKA 2XBDA 4ZXBB 4AIZB 1Z9NA 3BT0A 1ZK9A 4L1BA 3MUGB 3QR2A 5I5IA 3X14B 5HHXL 2ADYA 3S5LG 2PCFB 2Y3AA 4L37B 1X5HA 1HILA 1G7QB 1KYOK 2X4NA 1SGKA 3A6BL 3JWOH 2W9EL 4MTMA 2Y7SA 2D7TH 5T3XD 2VLRD 4KDVA 4YDIL 1PLGH 4IRJB 1JZIA 3UO8B 1CBJA 4RRPM 2NR6A 4EI0A 1AC0A 2BW4A 4WKZA 4NAMA 1E30A 4KK9D 1S7UA 1L5GB 1NEUA 3LXAA 4HKJA 2R29L 4GQ9H 4KHXH 4M8VA 2DQUH 1OL0A 4JQXC 4P06A 2XDHA 1YMMA 2AI0L 3I50L 2GSMB 2JXMB 2UXTA 3BQUA 1LGVA 1N5AA 1AZUA 3CVIH 1T5WA 5T33H 3MA9L 3MX0A 3MBXL 1JZ3A 3B34A 4AGPA 4R7NA 2NNXA 3V9FA 3D6GA 3HZMB 1AKJB 4OIFA 3SGKC 1MCJA 2DWXA 2IFGA 1TZHA 3RGVD 1PZ2A 4AEIH 1XEUA 1S7RB 1CGXA 1U8MB 2ZUWA 3D39A 4L3EB 4WI5A 4FEMA 3UO1L 2ALWA 2KZWA 3ECVA 4QRUA 3H9SD 2HRPH 4J12A 5EN2B 2DQGL 4X4XA 3N85L 4OW6A 4OZ4B 2AXFA 1HHGA 2AQ1A 2CJUH 2YGNA 2F1BA 3SDXF 1DL7H 2G2NA 3GI9L 3KXFB 4GS7B 5F71A 3X2QB 5LG6A 4Q9QL 1XD1A 3TT1H 3GINA 2XN1A 4XO9A 2PR4L 3MJ8B 5T3ZE 3INUH 4JKKA 4PS4H 4HS6A 4HEPA 1QBBA 3QXAB 5JR1H 1AGCB 4P5TD 1RULL 5C0AE 5TFSH 2DJ4A 2JF1A 4FDWA 5MENB 1E5CA 2VC2B 4XGZA 5IMMB 1YEJH 3FQNB 5JHLL 4EEEA 1XBDA 5TE6H 4L8SB 4R4NC 4C4KO 3NCYP 3UC0L 2XKNB 4JRXE 1Y1UA 1NANI 1ZDQA 1PLCA 1B4JH 2L04A 4U3XA 4Z7UF 2Y06L 3TJEL 3U82B 3ZOAA 1J8HA 3L4YA 1UTDA 2WLJA 3VI3A 4DUXA 5L88H 4NM4H 3JVGC 3GBLA 1RLWA 5FCSH 1UADC 2V9RA 3QDJA 3WXVL 5A2KH 1R46A 1KPRB 3N50A 4GEJA 5GRWA 2BVPA 3M1BA 2ESVD 4DP7X 5TDNA 3HAEB 4KWUA 2BSEA 4RMTA 2AXGB 2XKSA 4F80A 7TAAA 3UZEA 2G0LA 1FAIH 2HA1A 1EO5A 1L0YA 1IARB 1L9MA 2WVUA 4JN2A 3JVFC 2ROXA 4OJCA 4FEIA 4UQIM 3C60A 2JB6B 3IFLH 1TJHH 4O2CA 5HHPA 4UQ3B 4YK4B 4CMMB 5EDSA 4LIQL 1FA4A 2YJLA 5I5JA 3MNVB 3IF1B 4BZ1A 3MUZ1 3IPBA 3FOLB 4NQCD 1BPLB 1D5MB 3DX0A 4PJ5B 3GIZH 4LSDA 5F89A 2CNYA 4KI5F 5LBSA 4NFBA 2E7LC 3NJNA 4P59L 4FYRA 4F8PA 3KH4A 3WKQA 5JORB 2HKFH 3QIBB 2AFNA 1DO6A 1A6UH 1RUPL 3C08L 4J1UB 1KDJA 3BPOC 2G0KA 2MQ0A 4JFXB 1GKOA 5ID1A 3H85A 3QZMA 2VMEA 4JHWL 3QFDB 2X70A 5GPRA 5T1KA 3FB8A 3ENEA 2Q5BA 4YGVA 5D9SB 1P6FA 4YDLB 4P5SA 5LGHL 1RURL 4UM9A 3SPVA 2YN3A 5CR1A 4UNIA 4WWID 4YBLC 2HMID 5K39B 3V5DB 1X3DA 4TQPA 5EG6C 3ARGA 1QLRB 3G04A 1MLCA 2QQLL 1NGYB 1KN4L 4M43H 1DVYA 2WCSA 5KYWB 3L17A 3TEXA 1LEIA 1P4BL 3K6SA 1G9MC 4KZEH 1R5VA 1SDYA 4ZXBD 1C08B 1ZDSA 4BZ2A 2EIEA 4ELMF 1OGAA 1I1FB 1W8OA 1RJZA 2EE3A 3B43A 1GW6A 1NUGA 2DAVA 5TJWK 2EYTA 3EOAB 4QYOA 2AJSH 1WAEA 3B1TA 3MOBH 3IGAB 1SJVA 1UKQA 5CBAB 4P46B 3DTXB 4Y88A 3GBDA 1MQKL 1W72H 1JS4A 2A0LC 2FZ3A 4RAVB 1LDPL 4TTDC 1S5IH 4ZXBA 1MI5E 4PJ9B 3C9NA 4L4TA 3T6QC 2XWJB 4KY1H 3W9DB 4NGHH 5DUML 2LVEA 3FTWA 4TQEL 4U0RB 4NRZA 3ZPDA 5SWZA 2WINB 5C0AA 5F88B 3MAWA 4PRNB 4AMWA 3T3PF 2VISA 2Y06H 3UTOA 2IGFH 3IDYC 3K71B 5ILTH 3SPJA 3QEGH 3BVWA 2EEAA 2WYTA 4N1EA 5I1JH 3PJSA 3RDJA 3VDAA 2VDNL 2PWGA 4GKSA 3SQBA 3BLKA 4G3YL 4NZUL 1FNGB 2VQTA 1IFHL 1NINA 3OR7B 3PL6C 4A55A 5TQ0H 2QR0A 4F27A 4L4TD 5E5MB 2JXMA 2ZUXA 3HHSA 1F41A 3HE6B 4NNPH 1KGUA 4MQSB 3FQXA 5IW1A 5GZNA 5LLIC 1KN2H 1B0GB 2W9LA 4W9HC 3T0XA 5HJBA 1IGIL 1CU4L 4J8QA 2BVTA 2XU9A 3PY9A 4XVTL 2VL5B 3STZA 4BCYA 5A2LH 4NC1E 2NY6B 3CSGA 1X7TA 3CLWA 4Z76A 3MUGA 5DJZB 1UB5B 5B3NA 3FTGA 2A77L 3RBGA 1MWAA 3JUZA 2GBVA 5KBNC 4MBOA 2BFGA 2R23A 4U4BA 3FTXA 3KW8A 2BY3A 4QKTA 5I1DA 1FZKA 2XUWA 3MNZA 3ZVVA 1NPNA 1SQMA 4HSAC 5J1AA 4BXSV 1S7UB 3HS8A 4HEME 4Q4IA 3CIAA 3POHA 5DXWA 4OGYH 3CVIL 4ODSL 3L48A 2OZ4L 3O4OC 3Q48A 1FFNB 2W91A 4PJBB 4OZIA 2VDOH 2MH4A 1SUHA 3ME0A 5ID0B 3ZTJH 1QX1A 2IAMC 3N41B 2CGYA 4N8VG 4PJFF 4PJAB 3PV6B 3BI9X 4N0UA 2YIHA 4JFDA 5DLMH 3EHBB 1YDPA 4Q0XL 1CN4A 3T8XA 2IMNA 1CDHA 5DJCB 4PP1D 2EYSB 3UTQB 3CXDL 5IVXE 1ML0A 1JUFA 3X11B 4ANKA 2AS5M 2EXTA 4XMLH 4X4XB 1NA8A 3ARDB 1B88A 5LUMA 1G9ML 2HG5B 5DLLA 3WUWA 2IDTA 1S2EA 2DQGH 4ZFFB 3N44F 3HCVB 4WWNA 5D1ZD 3VXRB 1A7PH 2JI3A 4EXPX 4W6YB 4MYWB 5FDWA 2Y2WA 3CFCL 4DEPC 4NSKB 3D39D 5KG9A 2EIDA 3FHEA 1QBLH 2AABL 4HHWA 4OZGB 3GMLB 4JCLA 4J3VA 4LGSB 4NBZB 1B0IA 4LL1A 5DEFB 1BFSA 3ARFA 4XOEA 5ALBL 3FQNA 1ONQA 2B9AA 1A7QH 3VH8B 5K59F 1KULA 1MHEB 4LLYB 3K6FA 4XI5D 3RL2A 1FE8H 4BQ6A 2E7DA 2Z0UA 3QAQA 3MXWH 4PRIE 5IMLB 3VW3L 4W9FC 5FGCE 2VDLL 2VH5L 1OARH 3O3BA 4P5KA 1KBVA 1J9TA 1QR1A 1E7VA 3KWXA 4RFOL 1SOXA 2DMGA 4W9GC 5D7JC 1XF2A 5B22A 1EZUA 3BSGA 1GS6X 4LGPB 5TDPB 2EE0A 3P4OB 4TNWK 1YEDB 1KCVH 1FHGA 4I0PA 5C6TL 1F4WH 3GEWB 3WIAA 4UM9B 5DVKA 1TEGA 4NDMA 4NQSB 3HC4H 1H19A 1HSBB 4QXVA 1LL1A 4ZMYA 2XTJB 4NUGH 1JRHL 3ESVF 4NJ9H 5DJCA 3TM6A 2FATL 3C2AL 1CG9B 1S3KH 3L3JB 3Q3GA 4OVVA 2CO6A 2V2XB 4FQQB 3PHQA 3DX7A 3KZ8A 1OCWH 1JPSH 1PEZA 5DFVC 4W93A 2WQWA 3CPLB 4GBXA 5JQ6H 2FGWL 4H40A 5DURB 1GJWA 4HULB 4PJDA 5F89B 4NAJA 5KVFE 2ERJB 1J9CT 3QFJD 4FNLL 1WHPA 2X4RB 4OZGE 2XTJD 4QAMB 1Q1JL 1J1PL 3WE1A 4ZFOA 3SPHA 2P5PA 3DLQR 3QUYC 1CGWA 3LD8B 4NM8L 1ZVHA 4EZLA 5GGSB 2V2TB 3K2MC 3GPSA 5DHVB 1OAYL 2C3GA 3FDWA 2ENQA 5DVPA 3ESOA 5E23A 4OFPA 3QFDA 1UKSA 3APMA 2FWLB 3VXTA 5FGCB 5D1XA 4KKCC 3BQUD 1Q0EA 5AZEL 2VMFA 2Q20A 1G7LB 1IV8A 2VDRL 1UA6H 3UJTH 1G9NC 1GIGL 3U4EB 3GDBA 1TQUA 5AVTB 4JEGB 5I5MA 2X28A 1BGXH 3REVA 4M48H 1CXLA 4LDCA 3V5HA 4GRWE 3LH2H 3V4VL 3IM1A 2NCEA 5EUKB 2WXLA 5CD3A 3AT9A 4ELKB 4ZMTA 5C2UB 2XA3A 1EDYA 4XN5A 3DV6B 4QHPA 5F8RC 4HIJB 2BVQA 5C0ND 5BJTA 1S5HA 1UACL 2H1PH 2R0WH 4J3UA 5KN5A 2XQBL 3CFEA 4JFFA 3FN0L 2V0AA 5IVZA 4KUZH 2BO0A 2CNZA 4QXTB 2BC4A 2ESVA 4V1DB 4PMEA 5FYJH 1J0ZA 1P7QD 4U31A 2CA3A 4UBDC 2VDMB 4RGOL 5LAXA 1IC5L 4PLNC 3CBRA 5AW6B 3TBWB 5H35B 3MRKB 5KYXA 4Z95H 1ZE3H 6PAZA 3BUDA 4HUWB 5IB5A 4PJ9A 3ARDC 1WDAA 3H9HB 2EDYA 4YQXH 3CVHH 4KQ3L 2WLIA 1T0NA 3KPSA 3MV8B 4DP1X 3GKWL 4CSSA 1A7BA 3QIBC 5IZ7A 4K73A 3IU3B 3L9EA 1ERNA 1I85A 3X3GL 3R1GL 4M62L 1QA9A 4JRYA 2Q7AA 1OE2A 3HB3B 4MMZB 4Y1AB 4ELME 2E9IA 4NC2B 1WTLA 4WI6A 1E5UI 1U95A 3NJHA 2YMTA 1BBDL 2FJGB 4KX9A 4LBAA 4H2CA 2Z31D 1JFHA 5ICXB 1Z3GH 2J8HA 4KPHL 4LPVA 3B37A 3NJIA 4QPEA 3V55A 2AJUL 2YOAA 2QSCL 4U7SA 3O4LA 1J86A 1BJ1J 2VTFA 4GPVA 4WU7B 5I6XB 5C3IA 2FLRT 4OZFG 1A3QA 3RPIB 1NC4A 3LDBB 1P4UA 3TBYA 1OTTC 1SOQA 3E8UL 4PWJA 2FUQA 1MSPA 3FS9A 2HTKD 1EXHA 1KTBA 1YUHA 2ZUSA 4O00A 5IBUB 4IJTA 1UB5A 2QPEB 1XGQB 2QV2A 2AK4B 5L2KB 4JG5A 3VA2C 3SYOA 3WUWB 4XBPB 3M8OL 1GJIA 1GRWA 3S4SG 2QLYA 4GRWH 4PLKD 2DLHA 4ONFL 1JHLL 1FLTX 2DH3A 3LZLA 2O26U 3MLUL 1VFUA 4DPBX 5I1DB 5KAQG 3C6SA 2EABA 5SWQA 3WEBA 3PU7A 5BOZG 3EJZC 4IEFA 4KZCA 3QWRA 1ZK5A 1YECL 5AENA 1HHIA 3FB8B 3O6FC 4NJ9L 3CG8A 4X9FA 3GMLA 5BZZA 1CDJA 2BNRA 2IF7A 5CP7B 3QCUL 2H4EA 3RY5A 1J5HA 1DJHA 1NCNA 2D3NA 3MRMA 1QPXA 4FX5A 1L4IA 1LEGA 4PPTA 3UZVA 5JXEA 4JO5A 3Q6GH 2PYEB 1T1XB 3MRQA 4WO4B 1TKWA 3BJLA 1E8XA 3QARA 3E3QE 4JKNA 5C0CD 1YDPB 3SO3B 3NGBC 5DHXB 1G7MB 3ZE1E 2V37A 3EBGA 2TRHA 1XD0A 1PDKB 3W3BA 2VXTL 5D71L 4Z7VA 1LWRA 1ZKAA 4DHLA 4PGEA 2ICEA 3KEHA 4UNTA 1DQJA 3BSZA 5EIVA 4QRPE 3KLHC 2BMKA 4EI5A 1JF5A 2O5NA 2JKJA 1EHXA 4YE4H 3BAEL 4ZFFA 1KGCE 2BINA 5FDWB 1OP5K 4L8SC 1U58A 3D3VE 2EIZB 2ZXGA 4TYUA 1NCCL 1DBBH 1DQTA 2YS4A 2CO1A 3ZMEA 2K7PA 1Q0YL 1N3NA 3N40P 1U2CA 3FN9A 3K4AA 5F7KC 2WW8A 3U7WH 5IB1B 5GS1A 1P1ZB 3CFTA 2ZG2A 2A9MH 1OW0A 1Q0YH 4LXFA 3EFFB 3DUUB 5HGDB 1F13A 1FYTA 3LRSB 3GK8H 1DBMH 2FBJL 3VQMA 4BZ1H 1GGCL 3WIHL 5B1JA 2EVFA 3OKDA 5AW2B 1IAOA 5LO7A 3VFNA 3A67L 1EX0A 4FFVC 1RZFH 3K3QA 2X4OB 4WTZA 4GXVL 4M1GL 1N6VA 2A74B 2NY5C 2Z7WA 5F0LB 5DD5H 3A47A 4OFIA 2JSFA 4LK4A 1KT2B 4M7JH 3CHSA 1TYEB 4FNSA 1Q1PA 4OLUL 3RJQB 1E9QB 5D7KD 3BCDA 2CPUA 4F5CE 4DT2A 4BV1A 1AFVH 3BYTA 3QJZA 4JRYE 5B1CA 2VN4A 4BDVA 2F7IA 3II3A 5DJYA 4I8DA 3QFJE 2OZ4H 3CH8A 1VADB 4XNAA 3PXLA 5GGTA 3P77A 2E6PA 3L7FA 3SDXB 3QUXA 3BGMA 4ZX4A 1Q9LA 1K4CB 4DGIH 4RQQB 1ACYL 3D3VB 1VZGA 4I0PD 2A9AA 1FVCB 4LNRA 5C0IA 3MLUH 2FH6A 4KQ0A 1GMEA 1Z5HA 1BZQK 3WTYA 4N8UA 1TVBA 4HX1A 3M8OH 4G9FD 3MV7B 4U6VH 1MI5A 3IFNH 3CFEB 4JFFB 4QRBA 4HKXB 3F7PC 4JDZB 1O9ZA 2BC4B 2ESVB 2GJJA 5KVGH 3MLTA 4P48A 3V0JA 3TIDA 1U8CB 4C47A 5KTEL 4L8BA 1MFBL 5EC1A 1AD0A 1I1AD 5I6NA 5GGQL 5HDBB 2V7HA 3QZWB 5HYJA 4UQCA 4X9HA 5GGVY 4PLJD 2C9SA 1REIA 1HESA 2DWTA 3CHXA 3TONA 4MD4A 3IN2A 3Q0HA 5JHDB 3PWPD 4XT1C 5FYLH 4GAFB 2IOMA 5BZDB 4RA0C 4JRYB 1IJ9A 1KGXA 2YQ3A 5F9OH 2EDFA 4NO2A 4L0ZA 4IGBA 5IQ7H 4JM2D 4H8WH 1NDMB 4DFHA 2FDBP 4Y4FD 4URKA 5IHHA 1AGBB 1LMKA 1BZ8A 3UYRL 4X7SL 1C9SA 3NSDA 1W91A 4UWQB 1VFBA 2P7TB 2JI2A 3BUYB 3PE9A 4ZYKB 1E7UA 1JXKA 4F20A 4Z7OE 1KLUB 4FMVA 1JGIA 5EEXA 2UZXA 3GI8H 3RWHB 1RSFA 4A6YB 3FO0H 2VDOB 1IAIM 1CI3M 5I76A 5GGSY 3QI9A 2IGLA 3DIDA 4DGYH 3RNKA 5HYEA 1PCXA 3VCLB 3T3PB 3WDIA 4YO0A 3MV7E 5KVEH 3LZFL 2ITFA 3RUGE 3VGDA 4N2LA 2EECA 4UILH 1T6VN 2CDGB 4LHJB 3B5GA 4WO0A 1TJGL 5E1IA 1E5BA 2E6QA 2JLLA 4LSSH 3CCHA 2GTZB 1YEFH 4JCWA 3TPUB 1R6VA 3NCMA 5FUZH 2YSSB 3L5XH 4XRCA 5EUOA 4HAFA 4M9OA 3SQOH 2OAAA 3DETC 2GYSA 3DOHA 4WEEA 3PHSA 3FOMB 4FTVD 4ODTH 4XXCC 4M1CD 5DHEA 3HRZC 2ZQKA 5HVGB 2YPVA 4XC1H 2J1KA 4TUOB 3RGBA 4W9IC 1LEGB 4U1NB 3Q1SL 4MNQA 4KVCL 1QFWL 4NOBA 4PY7B 5DU7A 3QI9D 1CF1A 4GSQA 1JPGA 4JPVL 5DQDH 1KPUB 2QL1A 2BOBB 3NK4A 1AYRA 1ET7A 3NCFB 1BMGA 4BE5A 1IU1A 5B39B 1LYQA 1XR8B 1EEYB 4OCNC 3UTPE 3BHBA 5DC4B 1D5IL 4PTTA 2HKFL 1XGQA 5IKCB 3V52H 4Z3JA 4I1RA 4NCC2 4K8RL 2UX6A 1A7QL 4OCWH 1BFVL 2J20A 4AJWA 3C6SB 3PWNB 5J6GA 3TJPA 4P9MH 1RZGA 5KS9F 4IEFB 3L3KA 1FAKT 4CJ1A 1F56A 4HBCL 3B2VL 2QKIA 4PJGF 1TETH 1S3KL 3FPYA 5GRUH 4LFHG 5IUSA 1RZKC 3US9A 2GIXA 1C5DA 2W81C 4MYPA 1JRHH 2NXYD 5SV4A 3GMQB 3MRMB 3HOGA 1ZLWH 3U4EA 4NN5B 4ISVA 3F58H 4P2RD 3JSSA 2B7DT 1KXVC 5LCVL 3KPTA 1HEZB 2J6EA 2QLVB 3WXVH 2KZ1B 4U1KB 3CWGA 1Z5LB 2Z8SA 1JMXA 3L2NA 3RDTB 5D1ZC 2AQ2A 4PGEB 1HL9A 2O5XL 3D25B 1KT2A 2X5PA 2F54D 2Z64C 5DMGC 3FQYA 5FS5A 5B7MA 2KC0A 3DGGA 4LAQL 4AV4A 5TE6L 2ZAGA 4IHOB 4YSUA 3S37H 5CJXA 1JV2B 2CBPA 3V0GA 4WKZB 4HUVA 4BZYA 3BEVA 4ODSH 1O0VA 1G4RA 5D7LD 2NY7H 5H35A 2YMXH 4GMTH 4KKBC 4D9RD 1BZ7B 5CJQL 1QBLL 3D18A 4C4KT 2YPVL 3DUUA 1WJ3A 4OAWB 3TA4D 4OZHA 3PIQB 2W0PA 3VRIB 1ZVYA 2FHFA 4X6CB 2OL3A 4NWTL 3NFSL 1TZHB 1FL6A 3TJHD 4E41E 1WISA 2LABA 4WNSA 2GW5A 4FXGA 1A4JB 4NWTH 1S8DA 4JR9H 3ULVH 1HL5A 2DPKA 4XMLL 1YPZF 1IKFL 1L5GA 2YD6A 1BWWA 1QFPA 2FK9A 1A4KA 2KQNA 4PJAF 4TQ8A 3KGRA 5CU5A 1A5FH 3UBXG 4HVBA 5I0ZA 2FJGA 5EC1B 4P4KC 4FXGC 1IBGH 2A9DA 4DUVA 4KXCA 3SCMC 4UIKH 2WKOF 4G6JH 5LNDA 3MOAL 3FSWA 2FNWA 1COBA 3T0EB 3RVTC 3BFQG 4X8XA 4DP4X 2WUBH 1MXGA 1JNHB 1WAPA 2F74A 3EFOB 2V8LA 4QHUB 1FIEA 3C5ZA 4R5TA 4AY0A 2MIZA 5GQBA 5BZDA 2O5XH 4I2XB 3MJGX 4YHYC 5M95B 4UILL 3VXMB 1G87A 4PJHF 5HYSB 3H3PL 4S11A 5BO1H 2CKBA 4XBPA 2XKNA 4G7YL 1LNUB 4GRLC 3AS1A 4FFYH 5ESVB 5FYJD 4POZC 3QHTC 1B0RB 2ZSWB 5TPWL 1AG6A 3AQXA 1KLUA 1GA2A 4APXB 3HZ3A 2JIXD 3FO9B 5E4AA 5C0JB 4V2BA 4X6CE 3RVWD 4HS6B 4LNVA 3ULUF 2QELA 4GSUA 1H8NA 2BVPB 3M1BB 3HG4A 4YLQT 4G2AA 3IAGC 1C1EL 2DB8A 3DJ9A 2UWEE 2AXGA 2G9HA 3LVEA 1F58H 1HL4A 3UABA 5F7UA 1PX4A 3VWKA 4MMXC 1NGXA 3VRLE 3ETTA 4LKXA 1MFMA 4FZEH 1AOHA 4MD4B 2OMXB 4TPRL 4LDOB 2R56H 5DA4A 3T2NL 1UWYA 4YXLL 1S7VB 1MCNA 1PX3A 1KN4H 4EI6A 4IGBB 4HLEA 4J39A 1DQLL 5I75B 4P2OA 2AJVH 4XVUD 43C9A 3KPMB 1F11A 2XPYA 4YSSA 1WH0A 4AYFB 2X7LB 3P2TA 1AP2A 4IU2B 4MQ7A 2J4WL 2DLTA 4I3SL 4PRHA 2BDNL 3CVBA 4PJIA 5C0BD 5J9PB 1FCCA 5SX4H 4Y8AA 4AGMA 3Q6FB 3MV9D 1TQBB 4GQRA 2OI9C 4M4PA 2NDGA 1JZ6A 1CWVA 2WKLA 3BOVA 1DJXA 4G5AA 1RZJL 3IS1X 3DV4B 4HJSA 1WPCA 3TEYA 2PO6D 4FQHB 1KPVA 3DSNB 1C5BH 1ACYH 2BVOA 2YD0A 3FFCE 3H42H 4UT9L 2EXYC 2R8SL 2AEWA 4P23B 5IVNA 5HBBA 3FH8A 2DEYX 3SJVE 3JWNH 3VTTA 4AGOA 3L7EB 5DA0B 2F2HA 2D9CA 4G6ML 2OR9H 3RAJH 3RY4A 1UM6H 3PP3H 2WBJC 1AXSB 2NY0B 1HXYA 3LZFH 1KENL 1TLKA 1JN6B 1YEGH 3WHE0 5KSBE 1SDDB 2Q9OA 2IVFC 4PJ7B 2PWHA 3BVUA 4DKFL 3C8HA 4WK4B 2APSA 4NQDB 1I8IB 1BIHA 1OTUC 3BIBX 2LGNA 5A2AA 1A02N 1ZVSB 3SDAA 1P7QA 1OSZA 3H56A 2H26A 5J06A 3L2LA 2DLGA 4JKMA 3IJSA 4XB7A 4QXUH 3MRCB 1UXWB 3QI9C 3HG1D 4CU6A 3LKOA 3AQZA 5I8EA 4MHHI 4BCXA 4H0HB 4TN9A 3L3IB 3N6YA 1R5IA 3QCTH 1FRGL 3K4DA 1OTTD 1VPOL 3D25A 4NBYB 3EO1A 5E9DD 4FMKA 1A6UL 1VEPA 5K9QI 2NOYA 4G59C 3QDJD 2X2JA 4G7VH 3W0WD 2I85A 2Y7LA 3TU6A 3ZDYF 3LNGA 2C9XA 3RBSA 2K4WA 2ENSA 4PLKC 1IAIL 2MMXA 3L4ZA 1BJ8A 1BZEA 5TK2A 3MRJA 4JFWA 3ARRA 1C12A 4BIKA 1BVLB 2H5UA 2ZYIA 1TJHL 3BEWB 4Y9GA 2Z35B 3D18B 2FYYA 4YX2H 4LFHD 2V7HB 3DX1A 3PWLA 1G9EA 4WEUD 4AL8L 4IDJH 2CSPA 4CRPA 1AI1L 4KKQA 4MKTA 2NXYC 2QQKL 2ENJA 3IDNB 3NPSB 4G6FD 1URLA 3Q9PA 4LL9A 1BEYL 4BBWA 4PCSA 3ZZQA 5DVOA 3ZE2E 2ZKMX 2AEPH 2QDVA 3MRRA 1JHKL 3GHBH 2VR7A 3WTUA 3ARBD 1CFVL 3O4LD 3T65A 5D7JD 4R96B 2EP6A 4H44C 5JLZA 1YEKL 2OMYB 4JLRA 1F6FB 3L54A 4LPTA 3QWQB 3DX6B 3X13B 4XHJC 4FA6A 4ZMLA 4TNEA 3C60D 3MRHB 1T66C 3F84A 3HUJA 4NI3A 3BISA 4AM0B 5BS0A 4JKPL 4QTIH 5TE4H 4GUQA 4WUUA 1HHHA 2C34A 5D4IA 1IBFA 5DJZA 4OAWA 4YDIH 4I0KA 3VNZA 4WGVB 1O7SA 5HDOA 4CMHB 1QSEA 1LWHA 4FZ8L 2EDTA 2GJ6B 4IQHA 5IHWA 2PR9A 4MJ5B 2FJUB 1OAXL 3DJZA 1XAUA 3CCHB 4JFEB 1G1KA 2I5YH 3RX8A 3UTQA 4P46C 3G6DH 3K72B 1CDYA 2YSSA 4XRCB 4YBLB 3KPRD 3F6IA 2JKTM 1ADWA 1IEHA 2HG5A 5AVZB 4ACTA 5L8LB 2Q86A 3ZHKA 3SJVA 2R7EB 4DERA 5B1JC 5E1AB 4A66A 3IPEA 3HCVA 3HR5B 3NOIA 1QVOA 2P5EB 3TA3D 3IGLA 4U0RC 4QEGA 4PJFB 1YC7A 1PD1A 5BRZA 2VZVA 4HPHA 1R17A 3ATEA 5AW0B 3K6DA 4ZMNA 1ZGLA 4HIXH 4UB0H 4QXUL 3V8CA 1I9JL 1OW0C 3GBNH 5JO5B 5IB3A 2QSTA 2CJSA 2EYSA 2YD4A 1CE1H 3MRIA 3MI6A 1GZPB 2IQ9H 2YD3A 1FSKB 5DS2A 4FD0A 4PTTB 2DJUA 2UZYB 4J6IA 2GBAA 4IU2A 1DHKA 3WTSA 1MDAA 1LK3L 3JTBA 1BYNA 2KS0A 2RACA 5BQ7B 4EI5C 1RZGB 3I6SA 3SDDB 4HFWA 3RGVA 3E6FA 3QCUH 4HIHB 1FYTD 4UQ2A 5T1DH 3QQ9C 2WLZA 5I1EL 2QT6A 3JV4A 3KL0A 3WFBH 4Y4KD 3RVWC 3C5SA 4MA7H 1GR7A 1M7UA 4ZMZA 3EH1A 1R0AH 5B38A 3ARED 2QVKA 3DSNA 4HPYL 1MW3A 3G9AB 2JTDA 5JXEC 1B6DA 1BSIA 1JPTH 4FFYA 2QGBA 4LGRB 4AXWA 1CR9L 2VQ1B 3RL1A 3D85B 4UQEA 4HCGA 2HZHA 1ZANL 4IBUA 2X2IA 4Y4HD 1MHHB 1EFXB 5IQNA 2IBBA 3BDXA 5KSAB 4Z3HA 3QJFA 4KVNL 3QPXH 3FRUA 3M86A 2VZ3A 4JM2C 5E6ZA 5CILH 1ACCA 2WMPB 1IBHA 2GC4C 2XQ0A 3MLYH 1OAYH 4HUVB 2XQYA 3WJLA 2A9CA 2K9UA 3KS0H 4FXKA 1E5ZA 1AD9A 4MWFA 2BW5A 1GSKA 1CG9A 3Q6FA 3LKNB 1FNSL 4FFWC 3N43B 5LBGA 3VFPB 1MAML 4NHUA 4QYAA 3WEAA 3KYOB 3AM8A 1E4HA 1U8NB 4JW3A 1EO8L 4BHUI 2WZ6A 4AZ8B 1TSRA 4Z7QB 4PG2A 4L1DA 2ARJA 2NSMA 5B1KA 2X2YA 5JIQA 2OCJA 5L0QB 4JG1H 1FVEA 5C09A 2O30A 4ERSL 3KJ4C 4M61A 2BSBA 3MRJB 4DN3L 4ZNEE 2OULB 3LQAL 2QDWA 1DVSA 1ZLSL 4GRWB 2OYLA 3MPCA 1JXDA 4JKWA 4KNUA 1I8IA 4QNPF 1MRCH 1XAKA 3T0EA 4XCNB 3S97C 1N6QL 5TQ2L 5IT2H 1EO7A 4TV3A 1ZVNA 4PJ9C 5DGRA 2BRQA 2X1OA 1IL1A 2K4AA 3NIFE 4J23A 2MCG1 3ET9F 1UXWA 2DQTL 2PCXA 3PUCA 2IH8A 5EZOL 4NHCH 4P4RA 3QYNA 3EUDA 3FUKA 3WE6B 3RY6C 2BVQB 4KK6C 3UXFA 4E0RB 4NKQB 2RAMA 3H7BB 2WXQA 1TZGH 3AWFA 1P7BA 1K4DA 1PFCA 5I1IH 2OMVA 3SJVD 3NAAH 3SGDH 5DMKA 1BIIA 4R83A 2Q3ZA 3KYNB 1TITA 4PV1C 2AJ3A 4G6KH 3DGCR 2CCLA 2AQQA 2ODHA 4NKDB 3OSVA 3L5JA 4L29B 4NZRH 5IK3B 4UTCA 1L7IH 1EJ8A 2H6PA 1QEWB 3ALPA 5D7HA 2WJ5A 2KLTA 5JYMA 5C7XL 4OCLC 2Z8RA 2E3VA 1KZYA 5ETUB 2EIMB 3GRWL 3TNNA 4JFEA 4S1RH 3TLRA 2H6UA 2VLLB 1ZTXL 2JTYA 4NI6A 1EZVX 3BFWA 4F57L 4W68A 3KYKH 1JTPA 3KPMA 2C3VA 3AWEA 3OHXA 4PV8B 1BOYA 4UOW0 5D8JL 4MQXD 2HT3C 1NAML 4MQ7B 5FGBA 4DP8X 3OKEA 3BKJL 3B5HA 2M2DA 2XN9E 3MOAH 4R96A 5CCKH 3NFNA 3GSUB 3HJEA 5SWQB 3ZHFA 3V4UH 1S9XA 3CX5K 2VQ4A 2YKKA 3OX8B 3GS7A 3G6JA 3B2PA 3EH3B 2XI9A 2NY4B 4IKJA 2HTLD 4J7RA 3NABL 3QVAA 4F37F 5JHLA 3KVPA 2YUZA 5LQBL 4MJ2A 2LR4A 3AS3A 5GRZA 3NN8B 1MIMH 1QSEB 3F6LA 4JJ5B 2NTFB 5HHVH 5E24E 1QLFB 1C5CH 1YAZA 2Y22A 3BYYA 4BFGA 1MFUA 4BSWB 4ZMPA 5CD5C 4ZD3H 1TOXA 4DPAX 4NC1C 2PYEE 4XP1H 3MRGB 1PCSA 1HQRA 3CSYB 2M26A 4KRPB 3WFEL 4DQAA 1WA2X 4X4YA 3P4NA 4PB0H 1MFDH 1XH0A 4F8TA 2WWKT 1JGDB 2V5YA 3SDAD 3ARFC 4BRJA 1UQSB 4HLZG 2BP3A 2EIJB 5IJDC 3MYJA 2OTWB 4PTUA 1E3ZA 2WYHA 4E5XG 2V8MA 2FSEB 1MCRA 4XP6L 2YO3A 5DEGB 2DLIA 5KW9H 4N8CH 4HWZA 5HI5D 3CXDH 3ISWA 3F2LA 5JW4M 1DFXA 5DVLA 1UZ8A 3QPQD 2IWFA 5I0VA 1DFBH 3FRUB 1TCRB 1XIWA 4Y5YB 1U3NA 3GMNA 1F86A 2P5WE 4IIQB 3I85A 2FJHB 4HJ0D 3MREB 2NY5H 1X5ZA 5FO8A 2DYRB 2X2UA 2CIIB 3IDMA 3LN4B 4R8WL 2CKNA 1G7HB 1I9IL 3X3FH 1T7YA 2YPLB 4OBSA 4PYGA 3RB5A 4ZW7A 3KLKA 1PY9A 1H0DA 4PP1C 3WDJA 4YDZA 3QNFA 1ZJAA 1VADA 1ZPUA 4RESB 4HLJA 3O9WD 2Z91A 1NUFA 5IBUG 1PIFA 4QDGA 1HH9B 3L3HA 3TESA 4R4ND 5I0XA 3JXAA 2CCVA 3B9KD 3BAWA 2W95A 3QO0A 3T6VA 1QI3A 1IM9D 3IJ8A 1OSYA 2N7SA 5KSVA 2IADA 3IDJA 3C6LD 1B4RA 3KXFA 5E6IB 1LQBC 4KVCH 1D6EA 1LE5A 1IC1A 2NUPB 5FKPB 5C08A 4AYDC 3UYRH 2C9VA 2K6YA 4FG6D 3TTSA 3DX6A 4XCNA 3HMXL 1HDMB 1UGKA 4LOUC 5IIEA 5I16A 3IGFA 3ULVE 4K23L 3LKNA 3VFPA 3EYUH 4ZMOA 4XBEH 5GJTL 2LQRA 4J27A 4AQ8A 1JE6A 1SXSA 3RVTD 4OF7A 1A9BA 5GJTH 4EVNA 2HJLA 4L3AA 2WXRA 4PYHA 3TFKD 4P5RA 4R6UA 2MQ3A 3WE6A 4NP9A 1N70A 3G6JE 3MLVH 2Q10A 3QUGA 4D0CA 4HX1B 1T04A 5AYUH 4AUYA 5IFAL 3VWJD 1I8KA 2PTTA 3DVNA 5EZJB 3CFDA 4P3DA 4PRDB 4JREB 1X5XA 2P44B 5E8PA 4H8WC 4JUTA 4HW6A 5EA0L 3QHFH 2AJ3B 3QNXB 2PPFA 4TVPL 3NGBB 2QQNL 5EA0H 3LIZH 1MFAH 4MCZB 5EO1A 3F7QA 3IVKB 3EGXB 4XPGL 2PW1B 5EO9B 4TMPA 1GOGA 1OF0A 4PMFA 5KVDE 4KK8C 4O58L 2EDQA 3NACL 4B5EA 3P0VL 3TNNB 4DWHA 1N8ZA 2VERA 3BSZH 1D5MA 1U30A 3S48A 3GSWB 3UC0H 3NSXA 1BQSA 1NBYA 4NFDA 5KSAC 1JF1A 2F54E 2ZD0A 4CSTA 4XNQB 3HJ0A 4QCIB 4MQTB 2CDGA 2CUAA 4E0RA 2HKAA 4NQEB 5HYJD 1RUAL 2OJEB 3Q01A 1CICA 1INDH 4OLUH 2ZKHH 2XWCA 4UDUA 1XCTB 3O3DB 3QA3B 1CLZL 2ADIB 3TPUA 5ID1B 5ISZB 1J05B 3A67H 1RURH 2P43B 4GAJL 1X5KA 2DD8H 2OJZH 1G6RB 5DD6B 3WHE1 1XO8A 1N64H 2LT9A 2YAPA 3SOBL 2GEQA 3PAYA 4ZUVB 4L4VE 1MCOH 1OOWA 3DROB 3DO4A 3HG3A 2Y6SD 5J3HC 3SDCB 5BV7C 1DBAH 3GZPA 4GLRH 1PZ3A 3HMXA 1BM3L 3VXNA 4KO7A 2WLKA 1AAJA 3OHXC 1PAMA 3T2LA 1AHKA 2DBLH 2HRHA 2VW4A 3L5WB 3N04A 3UAJA 5MI0C 5J4MA 2NSQA 4GLRI 3Q8FA 1MN4A 1Q94B 1T66D 5CU9A 4AIXA 4FQXD 5DMYA 4R3SB 4NO0A 3ZL4H 2YR3A 4LAQH 5I30H 2F9BT 3CVHB 3ZE0F 4QO1A 1DJGA 1JK9B 3TT3H 1J5IA 2QKIB 2CO3A 4GXVH 3DRTA 1E27A 2F8VA 3C09C 1JYNA 1AE6H 2JI1A 3A6BH 3C60C 1R3KB 1PL3A 4H13C 4ZFZB 2WSKA 3RWCB 1GTFA 2A73B 4R4BB 5ABAA 1MHCB 2B59B 4D9LL 3WJJC 3RY6A 2YEZB 3T04D 2YFOA 1UT1A 1YMMD 2EXWD 5AVWB 1NBQA 3JVGA 5EOCH 4YL9A 4F7KA 2Z7YA 3LKSB 4KJQD 2FX9H 3DGGB 4FNQA 4HUNB 4DW2L 4G9DB 2XETA 2VXQH 3SCMB 4MRBA 4HOWA 1U8LA 5CKGA 4KJPC 1HEZA 1KYUA 3GXUB 3VDBA 3QEQE 4I1NB 1T0OA 5HI4C 1BVOA 4JFPA 4YR6B 3TBVA 1Z5LA 3GM8A 1U2YA 4NQVA 1NGPH 3BRDA 1MWAB 3U36B 5JDJA 2AK1L 1PZBA 2EADA 5MHSD 2IADB 2EJ1A 4TNVK 4PD4K 5CGBA 5FF6A 3CPUA 3SOTA 1XIWB 4HWBL 4EDWL 1AO7B 1S9KC 3HG0A 2FJHA 1I1CA 5AEAA 1QRNA 1G84A 2BIMA 2WP3O 2E75C 3G5VA 5HY9A 5EZIH 2LU5A 3R1GH 4DGVL 1RH8A 4IRSC 4M29A 1J8RA 3NEXA 1NFDA 4GKNA 4CILA 4BFRA 4FXKC 4HLZH 3D08A 3SGKA 1XMEB 3AROA 2FEDD 4JFDB 3HZMA 1T1ZB 4WSJA 5BW7C 2QMJA 2K7QA 2Z91B 4GI8A 4ODBD 4JQXA 5FB8B 1PS3A 5GS0D 1NSNL 4OLXL 3LZNA 35C8L 2I9LA 3WLBA 1WEJH 2F53D 5GS2H 5I75C 3WEXB 1YPZB 2WC7A 3C8KA 1A3ZA 1NC4D 4H0GA 4JVPA 5D7LE 4JRLA 3S35X 2H0PA 5DZAA 5EIQA 3JWNE 3B3IB 3LYRA 4KRPC 3QUZD 1U3ZA 2DYPA 5ICUA 3VQ2C 2WD0A 2XYCA 2YARA 4IM8A 5HTSA 4CVXB 3HC2A 1QEXA 1RHHB 2AEOA 3IGUA 4HQQH 4UOQA 4OI8A 1K6QL 2DBJA 4PIRF 4U1MB 3ABGA 5EOQH 2X9ZA 1CLVA 1JG9A 2PW1A 5CP3A 5EO9A 2B3IA 3LX9A 1JNHA 4KC3B 4PCYA 1SPDA 4HXBH 5EU4B 4UOW1 4J3WA 2PXYA 1G9NL 1OAJA 5I1LA 2D7MA 1Q9KA 1E6OH 4QF1B 2BJMH 2WCPA 1P5VA 5CZXD 4LCUA 3RGVC 5DEFA 5MI0B 1BCIA 2BSTB 2P48B 3GYRA 1ZA6B 4QT5B 4WWPA 4GKOA 2MCPL 2MEJB 5IFJB 1K85A 4P2RE 5ELIA 3W5NA 4QCIA 4K15A 5EFIA 4I18C 4LARH 1B0RA 5D72L 4O2FB 1S7VA 2UUDK 3BDBA 2UV3A 4Z95L 5CLXA 5LBSL 4NM8H 1WEJL 3WKYA 5M94B 4OGXL 4NCDA 1RK1B 3CLFL 2VM3A 1M71A 1MJ7L 4PJGA 1A2YA 1I3GL 1N0LB 4Y2DA 3UC2A 4U1HB 2H1PL 2R0WL 3DHJA 3OG4B 5J9PA 3RTQB 4JG1L 4AQEA 4MD0A 1A3LL 5HDWA 1JPSL 5HHOE 2OMXA 4DESA 2APTA 4N2EA 1ZT7B 3SY0B 5FA3B 4QWWC 1TXKA 3QXWA 3R4DA 1HVXA 2VR4A 4L1TA 5FV2A 3FT3A 3UACA 5C0RH 4FHKA 5EF3A 1NBYB 4YHPA 3K74B 4QRPD 2ZE0A 2BS8A 1OHZA 4A37A 2Y1YA 1ZXQA 1NFDF 4NQEA 3KGTA 1L9OA 1JCVA 3DYOA 5F93C 1LK3H 2OMTB 4E2OA 2Y7MA 5HYQB 3ZT5A 4NYLB 2K3HA 1VFOA 1HK6A 1F4YH 5AVSB 1E3FA 2EINB 4XNUL 3J2PA 5G4MA 3S35H 1UUNA 5DJ8A 4UBDD 2CBOA 3ZQXA 3O6FD 4DKDC 3PDDA 3LS4H 4Z3EA 5K39A 1LILA 2FIRT 4NCC1 3V5DA 5BVJA 4XMTA 4X99B 4JPKH 1ZANH 3CLEH 3IS0X 5D6CA 1AQKL 4PJEB 3U0TA 3VFRB 2YEZA 3U79A 3ZTEA 5JQ6L 2ZOUA 4UUJB 2IPUK 5FGRA 4NQCE 3RX5A 4MA1B 1T4WA 4A2HA 1QLEB 4F15C 5B8CB 3L95A 3KMDA 3HMWH 4DOHB 3EYOB 4ZMVA 3AB0B 3MV11 1A3RL 3B9DA 3ZZLA 1S5HB 2OR8A 4PJ7A 4FI6A 1PEWA 2MNJB 2PXYC 1LLAA 1PW3A 2EKSB 1AGFA 4R3SA 4Y2DD 3CZJA 5DGQA 3US0A 3K2UL 1SJEB 2IO5A 4JVUA 4HCFA 3CN0A 3AC0A 4KRNA 2FR4A 1JK9A 1OSZB 2GC7C 1SVZA 2J1XA 3WU1A 1NGPL 2DIJA 2W59A 1OSEA 3IJ7A 4HISA 4PBDA 4QRFA 1JD9A 4N5UA 2VO8A 1PG7L 4HCRA 2WGXA 3P9MB 2ZP9A 4U1SA 4WTXA 3GTTA 2DKSA 4Q2ZA 4PU2A 5L0QC 5JW3H 2G30A 3QIWB 4WNJA 5AVQB 3U0PA 4WKXA 1I8KB 1RY7B 2PTTB 5BW7A 2IANE 1QA9B 3HNVH 2E76C 1YQVH 5E8PB 1SJHB 4AENB 3EH2A 1QQDB 4Q7DA 2AEPL 1E4XL 3EJRA 2XXMB 2A6JB 3FTSA 4S10A 3S7GA 5FCUH 3SDAC 2BWIA 5DSCA 3S37X 3VFTB 4D9LH 3MV9E 5ABZA 3BZEA 2MFNA 2F1EA 4ZX6A 1DVTA 1R3JB 3LXCA 3STZB 2DQIH 4BK5A 2WNKA 1QUNA 2O5ZH 3KGSA 1A6WL 4ENEC 3GSWA 3QPQC 2WBJA 4KK5D 3SN6N 3KJ4B 1YUKB 1GGUA 3WJMA 4Z7NE 5F6HI 1MHPL 3VD9A 2DYPB 2GJ6A 5FA4B 5L7XH 5E7FA 1HJBC 5K1NA 5D1QB 1RHHA 4GMSL 5DS8B 3TO4B 2VDNH 5ADPH 3PJLA 4C83A 3COOA 5K69A 4X6EB 1XSJA 2YD1A 3LXUX 2R2HB 2WQSA 5GGVL 4ZDHA 5AYTA 2IGFL 3BESR 5CZVH 3SPCA 4GRWF 3NACH 4WUUB 5L9DL 4N0YL 3SYQA 4NERA 3GB7A 4KTGA 4D7PA 1JZEA 2WNWA 1TKWB 3UTSE 3CVHL 4KQ3H 4PBVC 4Q4EA 4DP9X 2KUTA 2DH2A 1CE6A 3WJJA 5FB8A 4UQBA 5DR5L 4C54A 5GJSL 4PB9L 4TSCL 2P5EE 1Q4NX 3L1EA 3WLBB 4PJHA 1MNUL 3HC3H 1MCWW 1JD7A 2IDSA 4XXDA 2XTJE 5J6SA 2GITA 3MO1A 4FFZA 2LAAA 3MLXH 2H41A 4YZFE 3VRJB 3WG7B 3W38A 4JFQA 5HXMA 1JWUA 2ZWNA 5AB1A 2NXZD 4HWUA 1I8AA 4Y16B 4A7TA 4MB3A 1K2DA 4MMXA 4PBWD 5GGRA 1DDHB 2K70A 5IMKB 3NZHH 1FNAA 1LO3H 5HHQB 1J7VR 4KZEL 5EU4A 1P1VA 5LN8A 1RZJH 3QS3A 4UQ2B 5FA3A 3WFDL 3T77A 2UY7B 4K23H 1VPOH 3L3GB 1XB6A 1F5WA 2DMCA 3UAJC 3BKML 2Q8BL 1N2RA 4UTBL 2Z7ZA 3VWJC 3KBFA 1CIDA 3QUMA 3U4BH 3RL2B 2XNAA 3V6ZB 3SSGA 5HGHA 2E5EA 1GGTA 3FONB 4OBRA 5KJRH 2F8XC 1DR9A 4GH7B 4K2UH 3US1A 2IFFL 5C0AD 5CBEB 4LCIL 4WU5B 1PJ9A 1ZT4A 2LTQC 3DPBB 5AD0B 4NYLA 2WOYA 3QJFB 3C5ZC 3IKCB 2ZOKB 3VSUA 2JQZA 4XP5L 4M6OH 3RWIB 1IKOP 4EBQL 5CHNA 5B4MD 4PJGB 3FUHA 4TPRH 1WTGT 4MZ2A 1DQQB 4IOIB 3SCMA 3FCBA 1DBJL 5DRNA 3VGAB 1T3FA 4KMQA 1J9QA 1CICC 3VFRA 4N0CD 1W8EA 5FFGA 5J6HA 4WFGE 2OX5B 1WCQA 4MMYA 3L16A 4V1DE 5KSAA 1KZQA 2GAZA 2FT6A 1IM9A 4MDIA 3HMXH 1OWWA 5L8JB 2HN7A 2Z7UA 1FJ1B 5E00A 1EEZB 4E9RA 4P3WA 2MNUA 4GRLD 4JPQA 5F0MB 1BMWA 4XZUA 3ARGD 4KI5D 2WWOA 5HYQA 5TE7H 2WIIB 1SXCA 1OAQL 3N43F 1Y18B 1IM3D 3BIKB 1P2CA 5D1XB 4OF8A 4M4RB 3O11B 1HWGB 2NMSA 1CL7I 2GPZA 2PWEA 4X9YA 5LNGA 2OR7A 1SLXA 1HU8A 3VW3H 3CC5A 5JHLH 2ITEA 1JZDC 5C7ZA 2CJTA 5J11C 4YLBA 3H9YA 1GC1C 1R3LB 4QIRA 4FZEL 4A67A 3HNTL 1VGEL 3FPXA 1T5XA 5D1ZA 4Z5RA 4YHML 4N28A 2DMKA 4OCYL 3PS6A 5BXFB 4XH2A 1E28B 1KJVB 5EU5A 1S7TA 4AQ8C 1KXVA 5DI8A 3C5JA 1FAIL 1KXQE 2CJUL 2F19L 1FGNL 4MJ6B 3PXJA 2V3DA 4R7DA 4A2MA 1RIVL 3ZX1A 3NCCB 3VMNA 4K3DL 5I76B 2W5PA 2DF3A 3OM3B 2XRAL 3UO1H 2Q87A 4Z77B 2NX5A 2H2PD 3ZE2F 1FWXA 1V7NL 3OR6A 3MJ6A 3GSVA 5CZVL 2O61A 2EYRB 4Q0XH 3S6CA 3ZKMD 2WLIB 4MXWH 5SV3A 3MTRA 2W65B 4YZFF 1GHFH 2FEEL 1EWHA 1NLDH 1BQLH 5CIPA 5L4IA 1YNLL 3I3DA 4PRBB 4CN6A 1G6VK 4LCCC 3V2AR 2VLLA 5SWSE 4PW3A 3PL6D 2OSYA 4Y1AA 3RA7L 1QYGL 1UASA 2W38A 1IBGL 4NQXA 1SMDA 4NB7A 3OHMB 5IBLC 1V7NH 1NMAH 4RGND 4F2MA 1JXJA 4L9LC 1MPAL 3D34A 5E8DL 4GSRA 1PF3A 4KJPD 4R97B 2EO1A 5DK0A 2E9JA 2V9UA 4M5YH 5EO0B 5I74B 4AQ1C 3A3YB 5HHVL 1ESOA 4PY7A 4R97C 2X6CA 4ABVA 5EV7A 3TBTA 3ARYA 1FL3A 5F1IB 2J6WA 2XVGA 3BWAB 4BQ9A 4F7PB 2ZPKH 1XIWC 5AOMA 5EZLA 2AGJH 1QSFB 2RMNA 2DQEL 3MZGB 1CB4A 2FAUA 2YBRB 2HJFA 4XMUA 4L3FA 4IOSD 1BMZA 4UT6H 5D4QA 3VRJA 2UXVA 2DLEA 3BKYL 5F7EH 3TCLB 3O6LL 5D5MB 4GG6B 2WPGA 1MG2C 1XGPA 1YMME 3UYPA 1URZA 3QDGD 3BH4A 1BFVH 2PMZA 5CCKL 3RQ3A 4H1LA 3I9GH 2VITA 5I1HH 1AJ7L 4QHKJ 4N90D 1MVUA 2NTSP 3L6FB 3BVTA 4LLMA 3D07A 1OZUA 3T0AA 4MXWL 2OXGA 4JMXA 1LWJA 5EBWB 4HGMA 5TD4A 5FECA 2BH0A 2CHXA 3UGXA 4IRSD 4I88A 3M17A 3DI3B 3BVXA 3F7LA 5C0DA 3I6KA 1X5FA 3Q1SH 3JYBA 3KYMB 4FCAA 4K07A 5ECJE 4QHKI 5JNYB 1NEZG 3EHBC 2X9XA 3CFBB 3X14A 4KZDL 1DUYA 4FE9A 1E4XI 4GB9A 2BNQE 3UPAA 3B83A 4ILDA 3FRPB 4WENB 2ZYRA 4A2GA 4EI5B 4UNVA 3CJJA 1WVZA 2OXHA 5FM5O 4XNDA 2XTLA 3LCYA 4K9EC 3HKZA 2NZ1A 5GXBB 4LSTL 4PJ5E 3LSOA 1OIOA 2ADJB 1SJEA 2PPCA 1DQQA 1NCHA 4IOIA 3GNML 4O9HH 2WQAA 4FQPA 4RLDA 5C0FA 5KVFL 5LGJB 1EPFA 3BC9A 1B6UA 3DNKA 1T3FB 4KO6A 4XE5B 3D09A 3LOWA 1C8QA 3FB7B 1IGTA 3IDIA 5EZOH 3VI3F 5FGBC 4NXSA 1H5BA 2C7UA 3FCSA 1SXNA 3PIQA 4KTYA 4U7KA 2WVTA 2ZKYA 5I1GL 4YFDB 1U8PB 2EUWA 2A6IA 4CC1A 1O6TA 1MRCL 15C8H 1TTFA 2X3AA 3AITA 2ADFL 1BWMA 1E2ZA 5DZJA 2XPZA 1NTDA 4JBSA 4P49A 2DQJH 4YWGH 1NL0H 3DPBA 2XA8H 1EEUA 1U8OB 1JSYA 4POZD 5AD0A 4NKMB 1JGUH 3IDJB 2G75B 5CF3A 4X8JA 1KUMA 3V95A 3QEQA 1U21A 2YPLA 1A7OH 2PTVA 5I2IA 2QFRA 4JG9A 2XN9D 4FYQA 2MTAA 1RMFL 4F7EA 2DJMA 3LEYL 3QXAA 1M1XB 1R3LA 3PYCA 2XWRA 2E8YA 1JTOA 1DVFB 1EO8H 1NGQL 4UI2A 4AIZA 1K5NB 3NQIA 1MJ7H 1NMCC 2JJVA 4TSBL 3MCG1 1NCIA 4FF9A 2X09A 1J1XL 3S5ZA 1LEKA 5C07E 1ZT1B 4HDIB 3G9VA 4LEXH 1KB5B 4OIAA 3BAIA 3H9SE 1OP4A 4ORGB 1XH3A 4P3CL 4WWKA 1EQWA 2ERJC 4MJ6A 3MMEB 4BD4A 1Q38A 3LN9A 3D4GA 3T0EC 2OW6A 5IIEB 4Y4KC 3CBJB 4LPCA 5I6LA 2VDQB 3UZQA 5GS1C 2F5AL 3QUYD 1WSST 3B2XA 3PDGA 2GJZB 4RETB 5BUGA 1I9JH 2FT7A 3LY6A 1U8KA 1JK8B 4AMKH 5T3ZH 4L8SA 3M7FB 3ZTNH 1M05A 4Y0GA 1T7WA 2DTMH 3QJVB 4LKXB 4PCKA 2V9QA 1EUUA 2CUMA 4HPYH 2DWEB 4XO8A 2JKLA 3V5KB 1E8ZA 1M2OA 2ICEC 5C0NC 2FX7H 2KQMA 3CFNA 3ZTJG 2DKUA 2E9GA 3NIFF 1KTRL 5K9KA 2EVIA 4JFQB 2CDEA 4XCEB 1V27A 3HAEA 5A1AA 3AM8C 5I8CA 4Q9QH 1CCZA 2Q8AH 3QO1A 4HUCA 1M56B 2BFVH 1JRHI 2WLMA 5F7YC 1YMHB 1H3PH 3BPOB 4NIYE 4JN2B 2XIIA 3VD1A 5CR8A 3MJ8A 4PJ8B 2E7BA 2J73A 4RA3A 2HRPL 4I87A 4JM2A 4DGUA 1QSFA 4UU9A 5JIMA 3EYSH 4YO0B 3T3MF 2ZIDA 2YXMA 3Q05A 1GVIA 1E40A 7CGTA 4F3FA 3DX4A 4AQOA 3LNIA 3F8UB 5H4YA 2BVOB 5H2BA 2H3NB 2IIJA 1IO4C 1YHPA 2OYKA 3PQYE 5E70A 4A68A 3HVNA 4YLCA 3VXNB 5GGVH 5DHVH 4Y5VB 3UGUA 1RJCA 4WVRA 3GHBL 2X6UA 4NQTA 4NN5C 4C57C 5ISZA 4R90H 3FRPG 3PRZA 1CYWA 1BD2A 2VR6A 4BFJA 2XWZA 3RWIA 4XOAA 4RAUB 1UCBL 3PAUA 4L0PB 2DEWX 4X0KB 1RP9A 4XNXH 3FXIC 3MBEB 1KCSL 2PPAA 5KJ4A 3BMVA 4AQAA 4APQA 2DQIL 2HKHL 3I02A 4LVOC 3OTTA 4JPIB 5JNYA 2VXQL 4MRCA 4AV5A 5E6UB 3UIZA 4HD9A 4MNGE 2F53E 1KTDA 3OMIB 2Z65C 4LSQH 4QTIL 4L3CB 1SN2A 1ZLDA 3SE6A 1I85C 2YAMA 1QBAA 3AQYA 1QHQA 2V33A 3M07A 5I66A 3W2DL 1OT4A 3QIBA 3DETD 4NKOB 2QSVA 3QXVA 1EVUA 2VISB 1XGPB 3CDYA 4Y4KA 3RX9A 1KJMA 2ADJA 4LSVL 2FJFA 1IVLA 4ODVH 3BPLB 5FUCE 3CDGB 3CH1A 4FP8H 3DX8B 5L6YL 1CLOH 5AL0A 2FZ3B 2Z4TA 3HI5H 2FUTA 3BE1H 4RAVA 3VAEA 2WQVA 4K94H 5LB1A 5JW3L 3O0RL 2G2RB 2VZ1A 3E8UH 3GLAA 3ZR6A 1YVLA 4GW5B 1WBZB 1EMTH 1PG7H 2N59A 4OKDA 3IJYB 2P8MA 4HA1A 1B9KA 4JRXD 4Z7WF 1CF8H 5CWSA 1JZ8A 4AL8H 3I6KB 5DC9B 3CN1A 4NZTL 2ZWYA 2A83A 1PIGA 1ROWA 1B0WA 1CVSC 2ZXCA 1J1XH 4XNZC 5I24A 3TYGH 1UD8A 2W80C 1SEQL 4OZFB 3DX3A 1KDIA 2YLHA 2LHAA 5DMIH 5BXFA 4NKMA 3VXPB 1FNGA 1YEIH 4WI8A 2BZ7A 3DSFH 1MWAL 1UWFA 3QEQB 4XVSH 1A3RH 5F6HJ 5B3JF 3PGFL 4LO9A 5HGAA 3ZIYA 2E9WA 3V10A 4QAWA 2EDHA 4NQUA 4XP9H 5IESL 3BEVB 3PWPA 5HJDA 2ZUYA 1H8LA 3MRHA 4ZPVA 5DWPA 4DFIA 4OLEA 5FYKH 3EYSL 4PJXA 5H94A 3WFHB 1T4KB 3OB8A 3LHAA 2Z4QA 1MCOL 3OKMA 3D0VB 5BRQA 1J5CA 3Q5OA 1X5JA 1O9WA 4L48A 4P2QE 5AWNH 3IDGB 5EU3B 2R83A 1FZMA 4Z7QF 3ZRCC 1H5BC 1D3CA 2EH7H 3S35L 2W65A 2BDNH 1LEKB 5CIPH 2A6IB 3T8XB 4FQ2L 1J5OL 2HVKA 4GFXA 5JPMB 5FWQA 1UXMA 3VG0L 2OMNA 4QKXB 4JG0L 4H8HA 1F90H 5K9OA 2V9TA 3WTVA 4KNTA 4Q52A 1JUFB 2MTPA 4M93B 1QRNB 2J6EL 1HCFX 1GOFA 3HLAA 1WT5C 4OH2A 4YXLH 1KY7A 2OZNA 1E6JH 4X6BB 3NP4A 3VD4A 3QZBA 5E1AA 5ID0A 2YC1A 1KCBA 2DTML 5AVVB 3VYNA 3VXUA 3AXHA 2E0PA 4B9GA 4PJDF 2DI7A 4A2FA 2X3BA 4F7EB 5I6OA 1KG0A 2EDXA 1BD2E 4ADJA 4I0PC 3UBHA 3O3UN 3F7KA 3ZKQD 2AJZB 1Z66A 1L3WA 4GP5B 3ZTCC 1QFHA 4X6DE 4HV8B 1RK0A 1MHEA 3AAZB 4W6WB 3FB5A 3RVUD 2I7SA 4P2AA 1KGYE 2EDRA 4FKEA 4ORGA 2F53A 2UVEA 4C56A 5C9JB 2E74C 4XCYA 3TH2T 3ARPA 4P2QB 2R2EA 3BT2L 5DJ2A 3WI9A 4XB3A 3QYMA 1E4WL 1P7HL 3W39A 4ELDA 4KK9C 4CADA 4DK6A 2NYYD 2DQCH 3CN3A 5IHUH 4Z7AA 5C97A 1ZLWK 4TKWA 1YNTB 1U6AL 1OK8A 2VUYA 4BRVA 1HCVA 2OK0L 3HI1B 1ADQH 1JJUA 5EFIB 3L3JA 3Q3GB 1IGFL 2JIXA 5KANG 4BM7A 2XG4B 3Q7JA 3QFGA 2Y7OA 2XA8L 3MCLH 1PNCA 4CGTA 4GW4B 3FJTA 4NQDE 4PJIF 4Z0BH 2VJ8A 3Q8EA 5J89A 4JGUA 5IY5B 2FD6H 3GJFK 5AW5B 4QHNA 5I1AA 1FFPB 1JHTA 4Y89A 4JX0A 5MEOA 3OC8A 4AYID 5DUBB 5J5EA 1SF5A 1MZYA 4FFYL 4WHDA 4C4BA 5JQIB 4BH8B 3WTTA 3CHOA 5F9WB 3KPSE 7PAZA 1JNLH 2C3WA 1IAMA 3TFKC 3EJQA 4O51A 1ZIBA 5EU6D 4YXHL 1ZEAH 2L4OA 1FBIL 4LOUD 3QB7C 3ARFB 1J0JA 5T5NG 5DUPL 2IXQB 4P2OC 4GOSA 1U8PA 3CZLA 3FFOA 4CVZA 2E47A 2UZIL 1KB9J 1KIRB 5EHFA 4MSWA 5CEZE 1AH1A 5E4EB 4HFUL 1GHFL 5J12C 4ZTPL 3DOIA 5E2TH 1WRFA 4A1RA 5KBPA 4G1EA 3VWKC 4PS8A 5GRVL 1VCBC 2NXZC 3P69A 4ONGH 4F8QA 2DY2A 1WD9A 5I73B 2BS71 3CUPB 1RP8A 3APCA 5AALA 2VRQA 1SDDA 2KYIA 2FO8A 5GZNC 1HYSD 1AXTH 4KI5C 5C71A 3F7VA 3GSQB 4M1CC 3MUY1 1U3HD 4ZTPH 1KLFB 3QORB 12E8L 1MJJA 4J4PC 4R2GD 5LAXB 4PJEA 3S96B 3U0TB 3QNYB 1H3WM 1A7RH 1A7NL 2OL3H 3MRCA 2IPUG 3OWRA 1K5NA 5IJCC 2L7JA 2A4ZA 4JE0A 1UT9A 3QUXD 3ZXAC 1TFHA 2WXMA 2VYRE 4BKLA 1NC2A 3EUUA 4CSZA 1DLHA 5DRZA 3EO1B 4QRRD 3RWDA 1BQHA 2F18A 3MRBB 3WL9A 2HT2D 2PKDA 4PJBF 2XWBB 4QHMB 1KEMH 3N1GC 1NAKH 1AGEA 3S37L 5GGSA 1NKRA 1SBSH 1W6WA 2C3HA 2I25N 4P9HL 1DN0A 3QJOA 4YDMA 5G55A 3WMSA 1CL7L 5I18L 1T4KA 4PRIB 1WAAF 3EO0B 4GS7C 4ELKA 3BAJA 2X4QB 4HJ0C 4LHUG 1XF4B 2CG9X 4JFEE 3NBNA 2WZPA 3CK0H 4DAGH 3O3EA 4XVTH 1CICD 1FI8C 3OKOA 3NCXA 4OQTH 5GZOA 5FYJE 1G0YR 5FYLD 4WI9A 1L9NA 3VA6A 4RFNB 4LCWB 3D0LA 3GBML 2UY6B 2ZICA 3FSVA 1ITBB 3WO4B 1KNOB 2Y6SC 3QIUB 4LQFL 1ADQL 3QSKB 1D6VL 1T7VA 1S6NA 5F7WC 4YIQB 2NZIA 1A1NB 2VN7A 1ETA1 3BXNB 1ZWIB 1NAMH 3P2DA 3ULVD 3HBZA 1QQDA 1JZFA 4ZMXA 3L1GA 4U1LB 1EFQA 2CDEB 1BQLL 4X6BA 3W1ZA 1FIGH 3ARGC 3ELQA 3GZQA 5AW9B 5FWRA 5BCAA 5EDXA 2CK2A 4TVPE 4C83B 4OCSL 4OCWL 1TUPA 3ARWA 2RQEA 2IWGA 1AR1C 3FTVA 5HHOD 4V2CB 2B3RA 2R0KL 4QXGL 3WFHA 5A7EA 5DZVA 2WLNA 4UU9B 4N24A 2AJZA 2R39A 2XRAH 4D94A 4JDVB 4ALAL 3VWJA 4HUWA 3I74A 4MA3B 4NNXA 3LS5H 4LPUA 1ID5I 2A0LD 4TTDD 3IMBA 2AQSA 1QABA 3DMMC 1RIUL 4LSPH 5I1CH 2NZ9D 4IBYA 3SKJL 1UFGA 4B95C 4R26H 3VSQA 3SKMA 1D2OA 4RDQF 3LRKA 4UMSA 4F5CA 3ASWA 1NIFA 1RVFH 3FBKA 3V4PB 4Z6AT 1M4KA 1EVTC 2R2HA 3ULUL 3HNTH 5ADOL 1NDGB 1MRDL 2EXWC 2BNRB 4NHCL 2WZ0A 3BVNA 4ZQTA 1K5WA 4S1DD 4DUWA 1Z9PA 4OZIF 3FQUB 5JIDA 4J2XA 1XMWA 1GS8A 2CGZA 5D55A 5C0GA 1TJGH 2J8UE 1DANT 1UEYA 3M45A 4JFVA 4PJFA 4Z8FL 2Q7YB 3VG0H 4U6YB 1NIBA 3L2MA 4NO3A 2KZKA 1QBMH 4PJCA 2V5RA 4WHYH 4WY7H 3LQAC 3P0YL 4OLVL 3V7AE 1WUNT 4JQIL 2NSXA 1MFAL 5HGHB 4U6VL 2Y7QA 1JXGA 3F5WB 5FKAA 3D5OF 5E1QA 3QPKA 3MLWH 2IDFA 1SMOA 1ADQA 1IAOB 4C56B 4AK1A 5LCVA 1FNEA 4KHTH 2EVJA 5F1KC 3RUGB 3MREA 4I4WA 1SMAA 4S1DC 5DDHA 1IJNA 3GMPB 5L9DH 1BYPA 1HH6A 1MXDA 5IR1B 3RJOA 1YCSA 5I1KL 4XXCA 2EVGA 1QW8A 3NZ8B 1FO0H 2PTUA 4NRYA 3W5MA 5L4JA 1F00I 3RWGB 5B38B 2NY3D 1ZXKA 4MNHB 4WFFE 1KEGH 3DECA 2LW3A 3EDJA 1HNGA 1OXYA 1OLLA 1I3VA 4WRLA 5PAZA 4DP5X 2CLVB 5C86A 3QO0B 2OX5A 1TO4A 2BP0A 4ANUA 2EUXA 4JY4A 3ASOB 3QJQB 4JM4L 2PCYA 1ZLUH 4KVNH 2DL9A 3VXPA 2G60L 1A6WH 1ULVA 3CUPA 3WN5C 4JFSA 4RFEA 1PQZB 1QO3A 2R2BA 4I18B 5FYKE 1TVBB 3BE1L 4XO3A 5GRXG 3GSXA 1B9ZA 3UBFA 1NICA 1ZLVK 3CV5A 5LWYH 4KXAA 3QUZC 1MREL 3VM5A 3BQUC 1X5MA 5C0CA 1YY9C 2ZX6A 1RL1A 2X1WL 1OGAD 3DUHA 2R69H 4A04A 4N3TA 2DS4A 1Y18A 4MKMA 1F1GA 3AZUA 3ZLQC 4P5MB 1I7RA 1AZBA 4GT7A 1XGZA 4TNGA 5EU3A 2PCFA 3HE6C 4FTVA 1QWNA 2YUWA 2NR6C 4FHBD 2FECI 2UWEF 4OB5L 3TT1L 3OB0K 2OSWA 1CBVL 2VAAB 3UYOD 1FVEB 4Z78B 3TVMB 4NO2B 1P0SE 4WUKL 4FI7A 3J8F7 4HF5H 3GXDA 3VTMA 5LDUA 2WIIA 3O6KH 3CFJB 4O02L 4L8BB 4XN1A 2VDKB 3ZE1B 2AAAA 2B14A 2Y0SA 2ZWKA 3O45A 4UZGA 2CO7A 1N5AB 3BUTA 3AVEA 3OGCB 3PV7A 1RCYA 1U9KA 4ZUTB 2F5BH 4K7PY 2X6VA 4MX7B 3ZHLA 4PRPD 3BWZA 4AYBA 3IJHB 1OQOA 2WNGA 3HZYA 1ZSDA 4GXUN 3BZ4A 1IBBA 3L3DA 4JGNA 3GFUA 1FG9C 2P52A 4ODVL 4WDIA 4PRHE 3PHOA 3W81A 5ES4B 3PREA 3ZKXC 1OF2B 3FOLA 4IRZL 3X1EA 2R4SH 1IKNA 1CFQB 1PD0A 3D3VA 4N2IA 4HG4K 3O41A 3W2DH 4U49A 4U2YA 5IGXL 1LHZA 3RNQB 1OAUH 3FB5B 4JO2L 4NXKA 3DA0A 3RFZA 2DJSA 5FYLE 4OLWH 1M6OA 1UH3A 3L4TA 5MENE 4XCYB 2ADIA 2BOLA 3B3BA 3GUFA 1J8KA 3HN5A 2FSDA 2HT2C 3N9GL 2VDQL 4J3OH 4RGMC 4UZUA 1TR7A 2X70B 2ZAHA 4HOMA 2LLNA 2X4UB 3NTCH 3ARXA 1G6RA 1MIEH 1CGYA 1HSAB 3FQWA 4AGQA 1A14L 3QORC 3O3EB 2MNWA 2H6PB 3U0WL 5F44A 3EOTL 4BWWA 1LK2A 4HP5A 2C9UA 1N10A 2OYPA 2FO4A 2XXCB 3VI4B 1KPUA 3Q6GL 5LXGL 2P80A 2VSMB 4G7RB 2O6DA 4YH6A 5T5FH 4BQBA 3MNVA 2ZSVA 1RI8A 1PG7X 4MXQD 3T4YB 1EEYA 4RISH 1F3DJ 1BFOB 4G8FB 1NDMA 2X1QA 1T22B 1W15A 4FABL 4Y2DC 4XAKE 2F7OA 4F33B 5BQDA 1D5RA 2P24A 1TJXA 2AZAA 2F5AH 4NO0B 3GKWH 3UYPB 4AQZA 1OPOA 5IJVB 4RWYL 4MNQB 4WHCA 2Z0BA 4XWGH 3RIFF 3SDCC 1JHLH 1MCKA 4QO1B 1JCKA 4JRXA 4OU3A 1DVXA 3QWNA 4Y19E 3JTTB 1TF4A 2AP2A 3ARTA 3TP4A 4QY8B 4HJJH 5JIHA 4N2KA 5C7XH 2Z31A 4MA8L 2LLGA 3LQAH 1MCEA 3H8NA 3NDZE 2ZWZA 1CDIA 3B7TA 2A73A 5C0DB 2WM0A 2ISDA 1OCOB 2EC9T 1M53A 4XNMA 1HKFA 3CU1A 3P9WB 3BUQA 1LEIB 2GIYA 5C0EA 3TZVD 2J8UF 2DQMA 4HJGA 3H3KA 1QR4A 3K80A 1M2VB 4LRNL 2ZTBA 4N6QA 4JM0A 1VSCA 2OXHB 2VDRB 3HN3A 3AWGA 4Z9KB 1UJ3A 4M3KB 1W6LA 5HVHC 1F02I 3KL3A 1XCWA 2WWMC 4EIZC 2FH8A 3BVVA 5CSGA 3A5VA 5D4JA 3HBQA 1YEEH 5CBAA 4HQQL 4R2GB 1NQBA 2A2QT 2NY2D 3NP3A 5TGBB 4PRPE 4J3XA 1IGTB 3IDIB 4JFPB 4YR6A 5EPMA 3C2SA 2H1LM 4JNXA 1XGYL 5B39A 5FUOL 5LVEA 2ZYSA 3FTGB 1RZ7H 2IH9A 3RTLA 3FF8A 5B7EA 4PFEA 4XOCA 1S3RA 5D96C 1CLYH 3MLRL 3RIAF 4NRZB 4AI7A 2DWSA 5DO2D 4IRSA 3CXHJ 3T3PE 4NUJB 4NJAH 1DCLA 3BD5A 1I7ZB 1AO7A 2N0KA 5E51A 3RFRA 4LSRL 4IIQA 4LBEA 5A3IC 4U0QB 4FI8A 2YEQA 1NCGA 3BGFB 3FFCB 1XCQB 2RB8A 4XMPL 1JGEA 3KPRE 3P73A 3PCYA 4WCYL 1NCWH 3EIFA 3BN9C 1R0AL 4DGVH 3HEIB 2AKRB 5HHMB 2JCWA 1XL4A 2WN3A 3OKOB 3WIIL 1AACA 5I1EH 3PV6A 2OSLB 3QEUB 5D7SL 1J11A 3F05A 3KHOA 4CBZA 1MJ8H 4Z7UE 3PAZA 1M1XA 4ZO9A 1HEHC 2XG5B 1S8DB 3O4OB 2VL5A 1X44A 2AK1H 1JZJA 4JY4B 2AJXL 4X9IA 4GSDH 3RDTA 5ANMB 4PGBA 5EB9A 3ARDA 4KY2A 4A2EA 4PH8A 2QGEA 1MCHA 2YKLH 4PJXE 4AEHL 4AEFA 5I19H 4N9GB 3LEVL 3T0BA 1UA7A 4X8JB 4N6RB 1AJ7H 2BWDA 3WSQL 3UPRA 4MA1C 3HI5L 2E59A 5DRXA 4PM1A 3T4AA 1B0GA 2HUHA 4OZGA 1DQKA 2HLAA 5HHNB 5C07B 1HI6B 4O9HL 1LVEA 4LSVH 4P2CG 4XBGA 3HFMH 4HH9A 4LE8A 3FMGL 4LCUB 3QDMB 1NJ9B 2AABH 2QPSA 1YY9D 3HTLX 5F7FA 3HPLB 1UWXH 4EVNB 5JUEH 4BFIA 3WFBL 3IB4A 2D0FA 1XQ4A 5FFLA 1DJZA 2CXGA 2R0ZH 2KHAA 3FU9A 3FUEA 1A4JA 1FZKB 1D9KD 2X2HA 4LVHC 4P2QD 3FU8A 4TRPH 4B3EA 2BSRB 3B7YA 3SE8L 3TNMA 2KI6A 3RZWA 1F4WL 4G6AD 2Q7NA 1YZZA 3X12A 4OJFL 3BW9B 4I3RL 5E0QA 5K9KB 1RK1A 5F70A 4CU7A 5HHOA 5D1XC 5LN4A 3BZFA 4NDMB 3T3ME 4H5SA 1VACB 1EHKB 2ORBL 1J10A 2JK5B 2P9RA 4NSKA 4ANWA 2Q7YA 2F7RA 5EEWA 4RMVA 5JIIA 4Y9CA 4WEBL 2EAEA 2VDOL 5FK9A 4QHUA 4F8NA 1ZT7A 3REWB 5ALBH 3VXRE 3FT3B 4GBXB 3RI5K 3OGOE 4KNSA 3MSPA 4PSRA 4BGDA 3TIEB 4GBXC 4NPYA 2XKUA 2X7LA 2H9GA 2Y7QB 5T1JA 4YHIB 2F5BL 3SO3C 1B2YA 2JJUA 2OKMA 1RIHH 4ZO7A 4HZLB 3WIHA 3K0WA 4YN3A 3SQRA 4WK2B 4O02H 4OFVA 1JPST 2I5YL 4G8GE 3L81A 1INQB 3BLPX 3PUUA 1H3PL 2GJPA 4OV5B 1EAPB 3PQYB 3EJTA 5GZOD 2DWDB 4LDEB 4Y1SA 1AS8A 4OUUB 1OCCB 1KN2L 3B8YA 4OB5H 1HSBA 4WW2C 5JDSB 1WA1X 3I9PA 5ACZB 2NY7L 4Z23A 4HS8L 4H26B 1W0VA 1DEEA 5IMLA 1QFWI 4XWOC 1KV7A 2GUOA 2H26B 5I28A 3O0LA 2NY4C 3GBEA 4YPGB 5HI3C 3DC0A 4NZ8A 3OKLB 1ED3A 1KGCD 3DX2A 3QG6A 2IALA 4LLVA 4Q6YA 1BFOA 3LIUA 4Y19D 2W94A 3LPGA 4PV9A 3FYEB 3R7QA 3S98A 3BSZL 1YEKH 3ELAT 4WI3A 4Z0XA 3PWVA 3GWJA 3GKZA 5BS0E 1SF3A 1OB0A 4X0KA 3K46A 1ES0B 5JMRA 1KJ3H 3V6FB 4KAQH 3OAYK 4M8RA 4JPIA 2WBXA 3D2UA 5FX3A 1FNHA 3BPCB 1EAJA 4K3DH 3FO1B 3FT4A 1KIQB 4P99A 5KYUB 2RBLA 4IDJL 1PYWA 2JFCA 4FADA 3DBXB 4JFZL 2OMZB 1G7PA 5DJ6B 1KB9K 1WBZA 4OTXL 1NM9A 3RWCA 2AEQH 1CBVH 3JWOC 4GI9A 4CC0A 1V54B 4KK5C 5DT1L 4NNPL 1GZHA 5LAPA 1N67A 2CHZA 5EUKA 4J3OG 3V0DA 4X2UA 5E8OA 4HJGB 2W92A 1IFHH 2PXYD 3MV9A 3NYKA 3IE9A 4QJ5B 3AU1B 1JGEB 1P84J 3P73B 1C12B 4HIJA 2CM6A 2XXFA 2H8PB 4XVOA 1D5IH 1WK0A 2RH0A 3QR1A 3U25A 2FYYB 4NZFA 4X5LA 3ZYOA 1BP3B 8PAZA 3TV3L 4OJYA 3IJEA 5CSBA 4PJDE 3T1FA 3R4RA 2X10A 2DLFL 5ENWA 2OSXA 5TGBA 4WY7L 4MNQD 3IDNA 1LD9A 3PHOB 1BX2B 1KC5L 1PBYA 4TVSa 4N2MA 5IW3A 2AMGA 1H3TA 1HHHB 4PRHD 3A0OA 2YZ8A 3TBVB 1A1OA 1UATA 3VFUB 3LNHA 2X1XR 1PLBA 1N9PA 2YD2A 1DQLH 1EUTA 3CAFA 1ZGLP 5GISL 4IRJA 2IV9A 5HGAB 3LDBC 5SWSD 2XTSA 3CN4A 5LGKA 1D9KB 4R4FL 2F15A 3VNYA 4X7DC 1U91A 4YSTA 3QXTA 3H6AA 5KWYC 1X7QB 2I07A 4G6MH 3WOVA 3FFCA 4TULL 5D2LF 3P02A 3VVWA 3QYCA 3PL6A 1YN6A 2QQQA 4J4PD 1E9OA 4YXKH 3EJSA 1KBGL 3T8MA 5TDOA 3QDMD 4M6OL 4Y1AE 4EBQH 1Y07A 2FEEI 1RU9H 3U6RB 1CTMA 2BP8A 1FP5A 2C1PA 3OLGA 5IV2B 5DR5H 2W9DL 3P0GB 5BVPH 2HFFB 5EULV 5F96H 3MKKA 4EIBA 2DL2A 3RKPA 4BH7B 4Q9BA 1KOAA 3FH5A 4WJ5B 4YXKL 4OZ4A 3VMPA 4FQJL 3GIVB 3U1PA 2J4WH 2Q86B 1QATA 3QQ4B 3KG5A 2H32H 3DRQB 2JELH 2OMYA 3II1A 5E2VH 2ZXDA 3NEEA 4OZFH 3AQDA 4IJ3B 3LMJL 2EEFA 3H4FA 3QAZB 4MS8D 5FK9B 1LO3L 5EBLA 1S9WA 2MKLC 5DQJA 2I9TB 3WNLA 3JWDL 4NZDA 5HGDA 4KJYB 5JHBA 1MCSA 2CMRH 1OD9A 1UWXK 4G1MB 3DURA 3FTUA 2IDUA 2QZ5A 3MYZA 2QFPA 4WI0B 3VD7A 3TVMD 1KJ2L 1MNUH 4ZS6C 5C9JA 3OAUH 3RVXC 3UTZA 1EK3A 5C0EB 3TNMB 4XNYL 3T6ZA 2ZPKL 1SY6H 2JKXA 5BOJA 2E7CA 1MQ8A 2H6OA 4OY9A 3B7SA 4Y8DC 2CM5A 1JWMA 4XMKL 1M71B 4QXGH 2K6ZA 1KJ3L 3VSVA 4PS3A 4BDVB 1DVFD 3VFOB 1JDCA 4K0OA 3QE5A 4RMWA 3VM7A 4DOHE 2NY2B 3FTZA 4O2EA 5CN3A 4MFHA 5GHWH 2VQ1A 1P6WA 4MXVE 2XN9B 4FNTA 2YMOA 5CEYA 4WEBH 5D8JH 1BVNP 3MRFA 4Z7VB 3SYCA 2VLJD 4FFZH 5SX4I 4ZAKD 3O4LE 3DOSB 4L37A 3KWTA 1I3RA 1UD5A 2FYVA 1W80A 2VN6A 2X4SB 3R06A 4S1RL 5E5UB 5E5RB 1YJDL 3B9KA 3GGWA 1L6ZA 1Z9SB 1H9VA 1S7WA 2X4OA 3GSNL 3RHWK 5B7FA 1KACB 3GHEL 4LT7A 1YLBB 2PLTA 1DVZA 3TO2A 3KYOA 1E9QA 4BEIA 5KYUA 1FYHB 1P9MA 3HZVB 4OUUA 5F7MC 4JO1L 1KXTB 3BUPA 1CGTA 1V10A 4G43B 3WYRA 3OKKB 4DTGH 1MZZA 1SVBA 4UV4L 3SB3A 2OMWA 3B56A 4ZUSA 2X89D 2YPVH 1AKJA 5BVJB 1DSYA 2J57A 1AIFA 1KIRA 5TF1H 3BWUC 1CQKA 2EC9U 3KJ6H 3UP1A 4AXWB 4DQOL 2RCSH 3OAZK 5JXAH 4X7TB 2XWEA 1Q9LB 4XP1L 3WKML 4NIKB 1IAKB 3K4ZA 4C59B 2YWZA 2CRIA 1NCAL 1PLAA 4K8RH 2W0LA 1W0WB 2FTAA 5I23A 3WD5H 2VRAA 1D7BA 5C0IB 4XO4A 5E6RB 1R24B 5IEHB 1WCBB 2Y36L 2CLZB 2NX5E 2F61A 3VXUD 1MG3C 4AEHH 4YS4A 5KBMA 2E56A 4ZPTB 4KXZI 1V7MH 1N19A 2QEJA 1OAQH 4A6YA 1BD2D 1HJCA 4GW1B 4ETYA 3SPIA 1OPGH 1QNZL 1RFDH 2KL6A 3D2UB 4KMTL 2QVFB 3MOQA 3I6LD 1ZHBA 4HH9B 1BX2A 2HLFD 2VWEC 1XSOA 3DYPA 2WUCH 5D1QE 4WSKA 4PG2C 3WMPA 3L3OA 4E5XB 4EUPB 4DN3H 4B7LA 4YHNA 4U1GC 1WITA 4U1SB 1NCOA 1I4FB 3GQFA 3QUKA 3MFFB 4UYPA 4BFIB 3SDYH 4DCQA 3MZTA 2JQMA 5GS2D 4BK8A 5JUEL 5HVWA 3POCA 1YEFL 4DZ8A 2XWBA 2D03L 2LAGB 3QDGB 4U3CA 5CZRA 1XF3B 4BFBD 3WJLC 2OMVB 3PF2A 2GEEA 1WFOA 1YQ2A 1FYTE 5L2JB 2ZAIA 5LG1A 4LSRH 4QRRA 4P2YA 1TQCC 4LCWE 1F1AA 4L5FL 1E43A 2O4EA 4MJIB 4NKDA 1KY6A 1JNLL 3NZUA 4GIAA 5AKVA 2V17H 1MCPL 3NFNB 4AE1A 1MCCA 1D7CA 1ET5A 3JV0A 5JA8B 5GS3A 4HK3N 3K7UA 3RWHA 1L7IL 3NT0A 1T2JA 3LD8C 1I7TB 1QD0A 4XAKD 3V8OA 4CJ0A 3H7LA 3RNKB 5CEXA 2IFFH 4EDXB 4IKIA 3L9YA 1IGYA 1R3JA 2YOCA 3IF1A 4RZCA 4F7CB 1TJIH 1MRFH 4LPYA 2D0HA 4NNYA 3AS0A 3O3AB 4LB8A 2NT0A 2ZJSH 4H8WL 2Q8BH 3L4VA 3ZJAA 1R34A 1FZOB 1QSZA 2GJRA 1MY7A 4XVJL 5F9OL 4ZYKA 3N3EA 5IQ7L 2W60B