2YLMA

Mechanism of usp7 (hausp) activation by its c-terminal ubiquitin-like domain (hubl) and allosteric regulation by gmp-synthetase.
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
529
structure length
529
Chain Sequence
GPLGSEAHLYMQVQIVAEDQFCGHQGNDMYDEEKVKYTVFKVLKNSSLAEFVQSLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDNEADGNKTMIELSDNENPWTIFLETVDPELAASGATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPVMCDRAGFIQDTSLILYEEVKPNLTERIQDYDVSLDKALDELMDGDIIVFQKDDPENDNSELPTAKEYFRDLYHRVDVIFCDKTIPNDPGFVVTLSNRMNYFQVAKTVAQRLNTDPMLLQFFKSQGYRDGPGNPLRHNYEGTLRDLLQFFKPRQPKKLYYQQLKMKITDFENRRSFKCIWLNSQFREEEITLYPDKHGCVRDLLEECKKAVELGEKASGKLRLLEIVSYKIIGVHQEDELLECLSPATSRTFRIEEIPLDQVDIDKENEMLVTVAHFHKEVFGTFGIPFLLRIHQGEHFREVMKRIQSLLDIQEKEFEKFKFAIVMMGRHQYINEDEYEVNLKDFEPQPGNMSHPRPWLGLDHFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mechanism of Usp7/Hausp Activation by its C- Terminal Ubiquitin-Like Domain and Allosteric Regulation by Gmp-Synthetase
pubmed doi rcsb
molecule keywords UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 7
molecule tags Hydrolase
source organism Homo sapiens
total genus 124
structure length 529
sequence length 529
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12436 USP7_ICP0_bdg ICP0-binding domain of Ubiquitin-specific protease 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2ylmA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2ylmA02
3ZTCA 1JRUA 1LXDA 4MGIE 2BYFA 2HD5B 4B95A 2C7NB 2WX1A 3SD5A 3ZDTA 5AZGA 3B0AA 2ZJDA 4KZ0A 3ZO5B 4AUQC 4I6PA 2REXA 2KXJA 5CHVC 2KFKB 2GMIC 3BINA 3HM6X 4GSWA 1Y8RC 4M8MA 4PYZA 1P98A 4W9FA 1OGWA 3H7PB 4K7UA 4BOSC 1KLVA 1YX5B 3DDCB 2XBBC 2MBEA 2JVCA 1R4NI 3KVFB 2LASA 1ZGUB 2KFKA 2JRHA 3MHSD 4KSKC 5AZHA 3ZTDA 2CU1A 1UBQA 2A5UA 4RM9A 1EO6A 1H4RA 4II3B 4IWQA 4MJSA 3VTUA 5DPSA 2K8BA 4PYUA 3V6EB 2LXCA 3TL5A 2V1YA 4G11A 2OJRA 2KDEB 1Q5WB 1XT9B 5J2RA 2RSUA 4KSLC 2NS5A 2FCNA 2HJ8A 3WA0A 1TTNA 1WZ3A 2G4DB 2JY6A 1V9JA 2DAFA 3L17A 4DBGA 2IY0B 2PEAA 4K7SA 2N9EB 2J0KA 4KDIC 2KTFA 4TUUA 2L05A 1GC7A 5HKHA 5TR5A 1J8CA 3ECIA 4G50A 2KWCA 2NBVB 1UH6A 3ZNZB 2YVCA 3W1YA 2XK5A 1IP9A 4PS7A 3AU5A 2R2QA 4PS8A 3DBHI 4MSMB 3U7DA 3IVFA 3PREA 3U8ZA 3DVGY 4W9GA 4WWPA 2M8SA 2JPHA 1V81A 1WIAA 1F9JA 2FCQA 3JVZX 2K8HA 2KJ6A 3NY5A 4KZCA 3CF6E 3PRPB 1I42A 1RFAA 1VCBA 1T0YA 4RM8A 3S2AA 3RZWC 4YL8A 2MBBB 2L0FA 3H7SA 4LCDE 2KMCA 4DHZB 5LXIB 2MBQA 5KHQA 4KVGB 4MELA 2BPSA 2VRRB 3H6NA 4AJYB 4MGYE 1GG3A 4E3CA 3PTFC 4GDLB 3RT3B 2D10A 3VXWA 4FN2A 2AL6A 1M94A 2GBKA 3B08A 5JZEB 4CO7A 2RGFA 4HWIB 3A1QB 1IPGA 4OVVA 4IWOA 4GDKB 4URKA 5C23A 2NPTA 4NY0A 4K7WA 4KDLB 3KH0A 4GDLA 4HDQA 4IWPA 4MGKE 4EEWA 4OVUA 2V4LA 3RYTA 1WGGA 1WXMA 2HE7A 3SU8X 3PT2B 4HDOA 4CYEA 3A1QA 2D2QA 3UQAA 5C1ZA 4GDKA 3TBLD 1I35A 2RPQA 1S3SG 2JXXA 4BBNC 3PRZA 4FJVB 2IY1B 3KYDD 2LUEA 2N7DA 3APDA 4MGZE 4HLEA 1NDDA 3L0WB 4HK2A 5DPTA 3CMMB 1XQQA 1WJ6A 2G3QB 3NZUA 3GZNI 3VFKA 4MSQB 3HM3A 3ZKJC 2DZKA 4TQ1A 4TKNA 1VD2A 4XC2A 1UGMA 3T9LA 3VUYA 3AU4A 4W9JA 4KV2A 2C60A 2N9PC 3A9KA 1E8WA 2G4SA 2BF8B 3CSTA 3M63B 2KD0A 4BBNF 5EDSA 4DHZE 4FADA 2FCMA 3T8MA 2KQ7A 3IHPC 3IBEA 3X23A 3PSEB 4GB9A 2LWPA 2K6DB 2EMSA 3ML8A 4BKSD 1L2NA 2KFJA 1P9DU 2PJHA 2NVUI 1WX7A 3ZLZA 1XD3B 2BWES 2KO3A 1LFDA 2I1JA 2DYBA 3PVLA 4W9EA 1J19A 2CHWA 4K1RB 2GBRA 4HCPB 1R4MI 2ASQA 2MA9B 3VUWA 1GUAB 4GOCA 1OTRB 2KQSA 2WYQA 3V61A 3O65B 2PE9A 4I6LB 2LVQA 3QWZB 1V5OA 2CS4A 4LJPB 2KJRA 3OLMD 1V6EA 4G0NB 4WJNA 4JLCA 4WWNA 5BO4B 3R7RA 1KOTA 1NBFC 4X57B 4IG7B 1OQYA 3OJ4B 4NAWB 5CHFA 4FULA 2M17A 4NJ7A 2MWSB 2KK8A 3H7PA 3VHTC 4PS3A 2ZCBA 1E8XA 1E8ZA 2KOXA 2J7QB 2FIDA 3P2BA 4HXDA 2CHXA 1A5RA 4IW0A 1Q1OA 3KYCD 3Q3JA 1UELA 2K25A 1SE9A 1QZEA 4ANVA 3A33B 2GBMA 2HTHA 4ICVA 2JZZA 4MDKE 2AL3A 2LJ5A 1WZ0A 2K6QA 5GMVA 3ZVVA 5FR6A 2CHZA 2R2OA 2Z0EB 1WI0A 2OOBB 3RCZA 4FLHA 3HIZA 2KHWB 2W9NA 1D3ZA 4JQWC 2BGFA 3QA8A 2LGDA 1Q0WB 3DVNU 4AJWA 1WGDA 3PPAA 1V2YA 3WANA 1ZW7A 5AEKB 1E90A 2IBIB 4TV3A 4P7IA 4WWOA 2L7RA 1WMHB 2J0JA 2KJHB 2JRIB 3DVGX 4NPNA 5L83A 2IO1B 4IM3A 2LXAA 1E7UA 3EFUA 2C5LC 2MX2A 3UQBA 2KMAA 2I1KA 4GXBA 5AZFA 2J0MA 3NS8A 2L00B 2L3ZA 2KN5A 2BWFA 4W9KA 4DK5A 2JT4B 3I3TB 4NQLB 2DZMA 3LJ3A 3EECA 1WM3A 1PQSA 3NHEB 1WY8A 3R66C 3AULA 2C9WB 3L16A 2LRUA 3M3JA 3RUIB 1RAXA 3RULA 3L13A 4M0WB 3AI5A 3PHXB 1MG8A 4GMVA 4AWJA 3DBSA 5J17A 2D3GA 2AWTA 2ZNVC 3N3KB 1FXTB 2EKEC 3QARA 5IA7A 2WX0A 4ZYNA 3GOEA 4ICUA 3D32A 3TJPA 2BYVE 4MM3A 3WAOA 3QHTA 2EMTA 2KX0A 3W1SC 4HCNB 5D6JB 4EFOA 2KC2A 2UWQA 3NOBA 3PZDA 4BOZB 4NQKE 1P1AA 2KLGA 3L10B 2KDBA 1K8RB 4ZRJA 1C3TA 3V6CB 1V49A 4JL9A 1RLFA 4M8NA 1OEYJ 3A9JB 4A20A 5KHOA 4MH0E 1NI2A 2FUHB 1EUVB 3CSFA 2L0TA 5G55A 1TZ1A 4F1SA 2G45B 3PRMB 4ZRKA 5E6PA 1V80A 2N7EA 1H8CA 3ZW3A 3Q3FA 3ZRCA 2DX5B 2Y5BB 2MLBA 3A9JA 3ZUNA 4DDGD 1WJNA 4BKSA 2N1WA 3QCAA 2UYZB 4K81A 3IFWB 2D11A 3M62B 1WR6E 2MQJA 3JSVB 1C1YB 3PLVA 3K9OB 1SIFA 1SGHA 3QAQA 4GIVA 4WQOB 3HHMA 4II2B 3BY4B 3VTWA 1P0RA 1KJTA 2JZ3B 1ISNA 3PGEA 2LZ6A 3ONSA 1UD7A 3JSVA 5JH5C 1WM2A 4WAAA 2ZCCA 1EF5A 4JGHB 3APFA 2DYOA 3A4SC 2RR9A 4ZDVA 4W9LA 2NCNA 4IM0A 1E5WA 1WGRA 1S1QB 4HVBA 1WR1A 2V3SA 4FHJA 5CX3A 3H1UA 2B3AA 3V62A 4EZJA 2L8JA 2LVPA 1TGZB 3ML9A 4ASWC 2CR5A 3QQ8B 2K39A 2DZJA 3JW0X 3L54A 4JIOU 2JWZA 2KWVB 3HK0A 5JHBA 2WDTB 4HPLB 2M0XA 3VAWA 1WJ4A 4LJOB 5D7GA 3PS6A 2BKRB 2DAJA 3SDLC 3ZNID 3ZNHB 2JF5A 4W9HA 3WAMA 1YQBA 3PHWB 1V5TA 3OAWA 4DHJB 4EZKA 3DQVA 2GBJA 2MBHA 3UF8A 3PLUA 4FA6A 3A4RA 3LDZE 3TCAA 2NR2A 4DWFA 2ZPYA 3DBRI 2K8CA 5CHWA 3VTVA 5JHAA 2AEHA 3SHQA 4XX5A 1HE8A 2A4ZA 2FAZA 4NAWA 2CKHB 3KUCB 4FJZA 1TBEA 2ZPNA 1WX9A 4HJKA 1UBIA 1WH3A 4F8CB 4A3OA 4IUMB 4ZRIA 4BKGA 1G6JA 2DENB 1GNUA 4AOFA 3N32A 4RMAA 3JYUA 3B1LX 3APCA 4EOYA 3N30A 1E7VA 3QIJA 3IG3A 2KVRA 4MJSB 1V86A 2NBUA 4FJYA 1WRDB 4EZLA 4BVUC 3TIXA 3RZFA 1WE7A 2N4FA 2LGXA 1WYWB 2WWZA 1E8YA 4ANXA 3MTNB 2BYEA 4ANUA 2L76A 4DHJD 5LLIA 3EHVA 2C7HA 2Z0DB 4KIKB 1WXSA 2K1FA 2KX3A 1WFYA 1Z2MA 3VQIA 4W9IA 4G3XB 4E74A 2AYOB 2ZEQA 2IO3B 3WALA 3C0RB 3M95A 1WMHA 1GC6A 3TMPB 2KC1A 2XK5B 4I6NB 3KUZA 4KIKA 4FHKA 1X1MA 5IAAC 3VUXA 4IM2A 1EF1A 2KZRA 2N1VA 4DDID 4J6IA 1YIWA 2JUOA 3ENEA 3UIOB 3ZRFA 2GBNA 4WJQA 5J18A 3ALBA 5L95C 3QK0A 1YJ1A 1Z5SB 2FIFA 3DOWA 3UIPB 4FBJB 2N9XA 2D07B 4EKUA 1WGHA 2KNBA 2MRPA 3EC8A 4BKTA 2KANA 5DPWA 2FNJB 1L7YA 3UGBB 2M1MA 2O2VB 2RD0A 4GGQA 3WAPA 2GOWA 4F7ZA 2LD9A 3DBLI 2O6VB 2XEWA 2KDFB 4B6WA 4XZ4A 2IO0B 3DPDA 2PPHA 3VH3B 3RD2A 4N9F4 4ANWA 1WF9A 1AARA 1ZKHA 2KKCA 2LI5A 2MBOA 2ZNVB 1P3QU 2O2VA 3OJ3A 4LDTB 4TQ0A 3ZDMC 3VVWB 2NPTB 2O6VA 2ZZPB 4WJOA 3AXCA 4B9KA 2MP2B 3PV1A 4IC7B 2DYMA 2ZVOA 3X0WA 2C7MB 4GU2A 2MW5A 3W1SA 1WGYA 1GJZA 4DXAB 2IZVB 2NBWB 1YD8U 2KDIA 2MP2A 1OEYA 2PE6B 3DVNV 2MCNB 3KW5B 3U30A 3ZNGC 4AP4C 1WE6A 3H9DA 2LGYA 3R7QA 4WJPA 4BFRA 1CMXB 1KM7A 4HPMB 2O6VD 5CTRC 2IO2B 3KUDB 5D2MB 5D94A 2FCSA 5E6OA 1LQBA 2MSED 4NJ6A 4E71A 2KTRB 2ZVNA 3DCGA 4LDTD 2KWUB 1LM8B 1BT0A 3L08A 1WXAA 4W9DA 3NZSA 3WIMA 4MEMA 5E6NA 3A9KB 3QC8B 2Z59B 4CHKA 2QHOA 3K9PB 1WJUA 2DHZA 2DZIA 4EUTA 1IYFA 5DCNA 3VH4B 4NNJB 3VDZA 2KTRA 3QX1A 1RRBA 5LXHA 3R3MA 4A3PA 4W9CA 3UINB 1J0GA 2M4NA 5G2NA 1WX8A 1YX6B 4GN1A 2LRWA 2BKFA 1WXVA 3V60A 1UZXB 2LVOA 3MJWA 3ZIMA 2IYDB 3QJZA 2KLCA 5DPRA 2YLMA 1U4AA
chains in the Genus database with same CATH superfamily
4OZAA 3CIRB 1JRUA 2BYFA 2HD5B 2LGSA 2C7NB 5AZGA 2QEJC 1PDXA 2W3SA 2KXJA 2KFKB 4M8MA 4GSWA 4W9FA 1TJEA 1KLVA 1YX5B 2XBBC 3KVFB 1R4NI 2LASA 2N0SB 3NG0A 5AZHA 3IT6B 1UBQA 1EO6A 4MJSA 3VTUA 1R7SA 2QMTA 3IAS1 4PYUA 2LXCA 1OQQA 1WYGA 2QJLA 1UNSA 1Q5WB 2RSUA 1FFVA 2NS5A 4DBGA 2DAFA 4K7SA 2PEAA 5HKHA 3KLSX 4LLGM 4N59A 2NBVB 4P1BC 3ZNZB 2YVCA 1NYQA 4PS8A 1FNVA 1GAQB 3V05A 3Q8FA 1F9JA 5MPOA 3PRPB 1R4MB 1VCBA 4RM8A 2BQQA 3S2AA 3RZWC 1HTQA 2MBBB 5BYRA 2MBQA 1TY0A 1QOBA 2OEDA 2VRRB 3RNFC 3H6NA 4E3CA 3PTFC 4GDLB 3RT3B 3VXWA 2AL6A 2WXMA 4IOIE 4OVVA 3NVYA 4EEWA 4OVUA 3GE3C 2HE7A 2RMMA 1I4RA 1I4PA 4M02A 1SSNA 3CWIA 1BXTA 3GS2A 1SB3C 2IY1B 3KYDD 3APDA 4HLEA 5DPTA 3H8HA 2XNAC 2K22A 3NZUA 4TQ1A 3MHZA 1UGMA 3AU4A 4W9JA 3AECB 1E8WA 1YJIA 2BF8B 2G4SA 4BBNF 5EDSA 1TS3A 2FCMA 3IBEA 3PSEB 2K6DB 2MJ3A 5EE3A 1TZOA 2KWDA 2I1JA 1R4MI 2ASQA 3VUWA 1GUAB 1C4CA 3BWUD 3TEYA 1V6EA 3AEDB 1NBFC 2HDEA 4IG7B 2AQ1B 4NAWB 5CHFA 3RN9C 1FRDA 3VHTC 2W54A 2ZCBA 3NS1A 3BVZA 2CHXA 1HQRD 1Q1OA 3KYCD 2K9XA 1SE9A 2J4XA 1K51A 4NJCA 2JZZA 1WZ0A 2K6QA 2QSDA 5GMVA 1ZUD2 2KACA 1SE4A 1WI0A 4XE0A 1TKEA 2W9NA 2DBYA 1VLBA 3QA8A 4UDUC 2LGDA 1WGDA 3PPAA 2JX5A 1V2YA 1ZW7A 2IBIB 3DVGX 4ZHPA 5L83A 4IM3A 1E7UA 2MX2A 5AUIA 2KAJA 4GXBA 3NS8A 4DK5A 3AMZA 1T0QC 4ZHOA 3NHEB 2LRUA 3M3JA 4C7YA 4M0WB 4GMVA 3DBSA 2L1AA 3ETRA 2ZNVC 3N3KB 3MFGA 3GOEA 4ICUA 2BYVE 3WAOA 3W1SC 4EFOA 4HCNB 5D6JB 3NOBA 4BOZB 2X38A 2KLGA 2VH2A 2KDBA 1K8RB 1VDVA 4RH6A 2QILA 4M8NA 1OEYJ 4A20A 2YEPB 3AE3B 2PIAA 1J7CA 4F1SA 3PRMB 5E6PA 1N5XA 2BTEA 2JQRB 1L6UA 2LHEA 3Q3FA 3ZUNA 5G5HA 2N1WA 2D11A 1WR6E 3PLVA 1N6ZA 1SIFA 1LO5D 1SGHA 3K9OB 3NZ3A 3BY4B 4H2AA 2WXOA 1MHHE 4RNAA 1FCLA 3PGEA 1HXYD 2I38A 3ONSA 1UD7A 4XWWA 5BMGA 4WURA 3EUB2 5JH5C 1EF5A 4JGHB 2DYOA 3A4SC 4IM0A 1LGRA 1E5WA 1S1QB 2VH1A 1WRIA 4HPPA 2LVPA 1L4DB 2MH7A 4ASWC 2KWVB 5H8YE 1JWUD 2MEKA 1SF0A 4LJOB 5D7GA 3I5JC 3ZNID 4C56C 3NJTA 1YQBA 3PHWB 1V5TA 5D3IB 4DHJB 3PLUA 2FUG1 4FA6A 3LDZE 3ZQ4A 2ONQA 1P7EA 5CHWA 2LEKA 2A4ZA 1QKZA 1WX9A 4F8CB 2Y5CA 1GB4A 1TKYA 1I4GA 3HVZA 1F0ZA 1F77A 4RMAA 4EE2A 4EOYA 1E7VA 4MJSB 2KVRA 1V86A 4FJYA 1WRDB 4EZLA 4AS1A 3RZFA 1C4PA 3ZXVA 2PVOD 1FRRA 5LNK1 2C7HA 1I4QA 1KTKA 2K1FA 1HA5A 3DHHC 2AYOB 1QOFA 2WXIA 3M95A 1WMHA 2BT6A 1GC6A 2AQ2B 4I6NB 3KUZA 1N60A 3NUHB 3VUXA 4YTPB 1EF1A 3MJ5A 1JRPA 1ZDVA 1PGAA 1Z5SB 4US8A 3P4RB 3DHGC 3UIPB 1VZ6A 3AM9A 4EKUA 5DPWA 2FNJB 4OZCA 3UGBB 3TSSA 4J3OD 3N9YC 2XEWA 1XLNA 4XZ4A 3DPDA 4JX1C 4N9F4 1WF9A 1AARA 2KKCA 2LI5A 3MC9A 2O2VA 3OJ3A 3ZDMC 3VVWB 4P16A 1XO3A 1EWCA 3DWGC 4LNFA 2DYMA 1ESFA 1GJZA 1AWDA 1YD8U 2PE6B 3ZXRA 3MC0B 3I9V1 2IO2B 5D2MB 5D94A 2FCSA 4NJ6A 4W9DA 2KWUB 3L08A 1BT0A 1OFFA 1WJUA 1IYFA 3DBHB 2TSSA 3VH4B 3AH7A 4XDCA 3QX1A 1RRBA 4GN1A 1ZE3D 2BKFA 1UZXB 1T0SC 2L52A 2YLMA 4RFBA 1K50A 4MGIE 4RGNA 3B0AA 4OW0A 2ZJDA 4DXGA 4AUQC 1TYGB 4KKJA 1Y8RC 1P98A 1FO4A 3DDCB 2JVCA 2BB5A 5EE9A 1C9FA 1MJDA 1H4RA 4PT5A 4IWQA 5D3DA 2K8BA 4XYCA 3TL5A 5GXGB 2BVCA 4G11A 2VZKD 4KSLC 3T3OA 2HJ8A 1JW9D 1TTNA 4LK0M 1AN8A 4JE3B 1WZ3A 2IY0B 2D5GA 2PMVA 2ON8A 5TR5A 2WP9B 4ACFA 1UH6A 3HRDD 3AU5A 2WXHA 1VZ8A 3DBHI 1E0ZA 4W9GA 4WWPA 2FCQA 3JVZX 2K8HA 4ZYSA 1I42A 3N1ZC 1HZ5A 1EM7A 2KMCA 2LFIA 5KHQA 3BK1A 4KVGB 3AN1A 2BPSA 1RWSA 1ACCA 3VR8B 4MGYE 2QC8A 2BS3B 3LXFA 4FN2A 1YN5A 1TKGA 4BZAA 4CO7A 2RGFA 3U2SC 4IWOA 4GDKB 1T6BX 4NY0A 4MGKE 2V4LA 1WGGA 4HDOA 3A1QA 2D2QA 1N5WA 3ABVB 1I35A 2RPQA 1YQ4B 1N63A 4BBNC 3P1MA 2J42A 1D4BA 4MGZE 1C77A 1NDDA 3L0WB 4HK2A 1WJ6A 3HM3A 4TKNA 1VD2A 3VUYA 2C60A 3AEEB 3FKYA 4DHZE 1SBBB 4YSZB 1TY2A 3PZ8A 2LWPA 2EMSA 1JWMD 3P4QB 1JWSD 2G9HD 1L2NA 2NVUI 2KO3A 2DYBA 3PVLA 2CHWA 2JWUA 2WXGA 2WQYB 1YMHE 2JXTA 4GOCA 1OTRB 3V61A 2PW9A 3NRZA 4IDIA 4NAMA 3R7RA 1D5MC 3Q8BA 1FPYA 1OQYA 2KMMA 4FULA 1WXQA 2M17A 4NJ7A 2MWSB 1JWAD 3H7PA 2L83A 2SEBD 2KOXA 2J7QB 2FIDA 2CJNA 2BYTA 2GI9A 1KLGD 1UELA 4TMAB 1QZEA 2PLPA 2GBMA 4MDKE 4FLHA 4KGRA 2BW2A 2G1EA 1UWMA 4AJWA 3MC8A 1XCTL 3WANA 4P7IA 4WWOA 1WMHB 3Q69A 2B76B 2Y5PA 1I4XA 1UF0A 2KMAA 2J0MA 3EA6A 3NVVA 4W9KA 2DZMA 3N1YC 3EECA 1PQSA 2C9WB 2W82A 4HJGE 3W9CB 1N61A 3PHXB 1MG8A 2KQ4X 4AWJA 2AWTA 3Q3MC 1FXTB 4B0MA 2V3PA 2WX0A 3D32A 3TJPA 4MM3A 4A90A 2BS4B 2QIEB 1C3TA 4N6EB 1V1OA 4WH4A 3A9JB 5G5GA 4MH0E 1NI2A 3CSFA 4RCOA 5G55A 1RM6C 5FR3A 2N7EA 3ZRCA 2LMCA 3ZYYX 3M62B 1XLOA 2MQJA 1I7HA 2IGDA 4GIVA 4QAYA 1KJTA 4OHJA 1T5XD 2ICIA 3JSVA 3AE6B 1WM2A 3Q8AA 3RPFC 4WAAA 2ZCCA 5BYQA 2RR9A 2JYEA 4ZOHC 3BIID 1WGRA 4HKZE 2GRIA 5CX3A 4FHJA 5C3JB 3V62A 2ZW0A 2L8JA 3ML9A 3QQ8B 4C4VA 3E56A 3HK0A 2WDTB 1QQRA 2M0XA 4S0RA 2CJOA 2WGSA 2JF5A 3WAMA 2NTTA 4EZKA 3Q6BA 1XLQA 1V97A 4ITKA 2NR2A 2WLBA 4K3CA 4DWFA 2ZPYA 3ZGZA 4A9AA 3HUIA 4XX5A 1HE8A 3KUCB 1E10A 4HJKA 1UBIA 1P7FA 2IGHA 4IUMB 1VR9A 1G6JA 4AOFA 3N32A 2KVZA 1CJEA 4YSXB 2WDRB 3QIJA 2N9LA 3P63A 1YNTE 1FMAD 1TIFA 4BVUC 2N4FA 1K52A 1WYWB 2WXNA 4ANXA 2BYEA 2IJ0A 5LLIA 3EHVA 5E6JA 4KIKB 1Z2MA 2H88B 2ZEQA 3C0RB 2WXJA 4XDDA 2V3NA 1XF5L 4IM2A 4M00A 4P1CC 4J6IA 2JUOA 3ENEA 2GBNA 5J18A 3ALBA 5L95C 1STEA 1ZOYB 1IGDA 2Z8LA 3DOWA 1FFUA 2N9XA 2MRPA 4BKTA 3EC8A 1PGBA 4US9A 3GP7A 3FILB 2RD0A 1KRHA 2O6VB 2KDFB 2WXLA 2ZNVB 1I4HA 2RPVA 1JCKB 1EWYC 4R3DA 1D5ZC 3AXCA 3X0WA 1WGYA 4DXAB 4HRSA 2K5PA 1C4AA 2IZVB 2NBWB 2KDIA 2MP2A 4AP4C 2MCNB 1RYJA 3KW5B 1WE6A 1IUEA 3TEZA 3FC4A 3GB1A 1KM7A 1HZ6A 1Q10A 5CTRC 4YT0B 5BMIA 1J7AA 1CK1A 2MSED 4L2YA 4E71A 4LDTD 3U8ZA 3Q8EA 1WXAA 3WIMA 3IT4B 3NZSA 1ET6A 3KWVA 1VJKA 2DHZA 4EUTA 1BMLC 2M56B 5DCNA 2KTRA 5LXHA 4RF0A 4A3PA 1B9RA 5T8IA 1J0GA 5G2NA 4YSYB 1YX6B 3ZIMA 3QJZA 2KLCA 4KGTA 1IBXA 5DPRA 3HVDA 2EELA 1LXDA 4B95A 2WX1A 3SD5A 3WCQA 3ZO5B 1AW7A 2REXA 5CHVC 3BINA 2GMIC 3HM6X 4O1NA 1FCCC 4PYZA 1OGWA 3H7PB 4CQNA 2MBEA 3O13A 3FAHA 4YTMB 1ZGUB 2KFKA 5HG2A 3I63C 4KSKC 4P6VF 2MHJA 1B1ZA 4RM9A 2A5UA 3BK2A 1JQ4A 2NTSA 1TT5B 3AE8B 2V1YA 2OJRA 2KDEB 3P4PB 1XT9B 5J2RA 1NENB 2G4DB 2JY6A 1V9JA 3L17A 2N9EB 1MVKA 4KDIC 2KTFA 1GC7A 1J8CA 3ECIA 4XGAB 3W1YA 2XK5A 2R2QA 4MSMB 2INPE 3IVFA 4USAA 1GOZA 3DVGY 1NEKB 3LB8C 2M8SA 1WIAA 2BB6A 2NMQA 3NY5A 2KJ6A 3Q3OC 4KZCA 1M4VA 4B0EA 1RFAA 3Q14C 4LNOA 3T3NA 1SE3A 4LCDE 3W2DA 3NVWA 4DHZB 3C8YA 3BVGA 3UI3A 1C78A 1IGCA 1GG3A 3SR6A 3B08A 1KH0A 1IPGA 1XEEA 5C23A 2NPTA 4K7WA 4KDLB 4IWPA 4GDLA 5C2TB 2EKIA 1SJHD 1C76A 3SU8X 3PT2B 5TSSA 3UQAA 3R2TA 2D3AA 5HI1A 3TBLD 3U4EG 1S3SG 1FD6A 5AUKA 2YEPF 2LUEA 2N7DA 1AYFA 3RFZB 1XQQA 2G3QB 3GZNI 3VFKA 3ZKJC 2DZKA 4D2KA 3N20C 1QOAA 5FK9C 2KD0A 1J7BA 4FADA 3IHPC 4A8XC 1NVID 2D3CA 3ML8A 4BKSD 4C4VB 2KDMA 1P9DU 2E3TA 4A55A 3AEGB 1WX7A 3ZLZA 4W9EA 2LGIA 1XXGA 2GBRA 1D6EC 4HCPB 2MA9B 3NVZA 1MPEA 2KQSA 4C7ZA 3Q8CA 1MG4A 4I6LB 2LVQA 3QWZB 1V5OA 3OLMD 4G0NB 1UGJA 4WWNA 3VRBB 3OJ4B 1MHXA 3Q3NC 2Y3AA 1ROEA 4PS3A 1E8XA 1E8ZA 4HXDA 3P2BA 4NZLB 1A5RA 2K25A 2JYTA 3A33B 4ICVA 2LJ5A 3AE2B 2CHZA 1L6VA 2D3BA 2Z0EB 4LNKA 2OOBB 4REZA 1D3ZA 2KHWB 4JQWC 2BGFA 3KQ4A 1Q0WB 1V8CA 2IPKD 2CU3A 2INDC 1E90A 4TV3A 4OVZA 3AB5A 3EFUA 5I4DA 5AZFA 4RF1A 4NQLB 3LJ3A 4ZRQA 2QDFA 1SJED 2WDVB 3RUIB 1RAXA 1NI3A 3L13A 5J17A 2D3GA 2EKEC 3DBRB 1DGJA 4M0WA 2W3RA 5JXVA 2KC2A 4ARCA 1YN4A 4NQKE 4L23A 3OG5A 1MFWA 3L10B 1L4ZB 3KWLA 3V6CB 2FUHB 3DHIC 2XN9C 1TZ1A 2GLSA 1V80A 1H8CA 3ZW3A 1TS2A 1E7PB 2DX5B 2Y5BB 1ZXHA 1JROA 4DDGD 1GB1A 1WJNA 3QCAA 3C19A 3J9CA 1C1YB 3QAQA 3VTWA 2SAKA 1L0XB 1ZPSA 1JALA 2IGGA 2LZ6A 2ZW1A 4WWMA 3APFA 2X8XX 4ZDVA 2RDGA 1KFYB 1DOIA 2WDQB 4EZJA 2CR5A 3L54A 3W5VB 4YWGG 3VAWA 1WJ4A 3DBLB 1L0VB 2BKRB 3SDLC 4W9HA 4JWUC 3OAWA 1BUIC 2MBHA 3SEBA 3UF8A 2JZPA 2GB1A 3URYA 5HHDG 3DBRI 2K8CA 5FKAC 5JHAA 2J53A 2CKHB 4FJZA 2ZPNA 1SXTA 1N62A 2DWQA 4A3OA 2AX5A 2FBWB 4BKGA 1TS5A 4N58A 1GNUA 4JWSC 3ZJUA 3N30A 2PVGC 2NBUA 3ZJVA 1FNWA 2WWZA 3RI7C 3MTNB 1YOVB 1RFKA 4DHJD 1WXSA 4W9IA 4G3XB 4E74A 2IO3B 1ENFA 3WALA 1ZDXA 2XK5B 4FHKA 1X1MA 5IAAC 1V1PA 4DDID 1YIWA 1Y56A 3RNCC 3UIOB 3R8BA 3ZRFA 4WJQA 1YJ1A 2FIFA 3VR9B 2Q5WD 2D07B 2KNBA 2KANA 1L7YA 2O2VB 4GGQA 2L32A 1CZPA 4F7ZA 3DBLI 3RNEC 2IO0B 3AEFB 1ZKHA 2MBOA 1FXIA 2WXRA 2INCC 4TQ0A 4MH8A 2HTME 1XLPA 5EE1A 2NPTB 2ZZPB 4WJOA 4B9KA 4IC7B 3B2GA 2ZVOA 2MW5A 2WXPA 4HEA1 3W5UB 1K53A 3DVNV 3IAM1 3ZJTA 4YTNB 3H9DA 2LGYA 4BFRA 1CMXB 4HPMB 1DOYA 3KUDB 1XCQL 2MJEA 5E6OA 2W55A 4L1BA 3DCGA 1T3QA 4MEMA 4CHKA 2Z59B 2QHOA 3K9PB 4BAXA 2RDHA 1PYWD 5IO9A 1D5XC 3VDZA 2UU7A 2WXFA 1FM0D 3UINB 1HTOA 2M4NA 3GE8C 2LRWA 1WXVA 3V60A 3EFCA 1KF6B 3MJWA 2IYDB 2DNFA 4WQMA 4FXCA 1U4AA 2ACZB 3ZTCA 2VZKB 2IDYA 3ZDTA 1FNUA 4KZ0A 3SFEB 1SIJA 4I6PA 1NYRA 3P4SB 5IP4D 4K7UA 4BOSC 2AQ3B 4DXFA 2QCZA 2JRHA 3MHSD 3ZTDA 2CU1A 2M0AA 4II3B 1WWTA 5DPSA 3V6EB 4S17A 2FCNA 2E6XA 4KX6B 4LNIA 3WA0A 4AQ7A 2WS3B 2J0KA 4TUUA 2L05A 3AEAB 2HJ1A 4G50A 2KWCA 1SE2A 4HROA 1IP9A 4PS7A 3U7DA 3PREA 4OZBA 3BZDB 1V81A 2JPHA 1UWXA 1VZ7A 3CF6E 4K3BA 3RNAC 1T0YA 3LYYA 4YXDB 3RMKC 4YL8A 2L0FA 3H7SA 4LNNA 5H92C 5BMHA 5LXIB 1C79A 4MELA 1QILA 1PFDA 1VRAB 4AJYB 2D10A 2BBCA 1M94A 2GBKA 5JZEB 3TEXA 4HWIB 3A1QB 4URKA 2KT7A 3KH0A 4HDQA 2J52A 3IXSA 3RYTA 4MT5A 1WXMA 4CYEA 5C1ZA 4GDKA 2JXXA 3PRZA 4FJVB 3CMMB 2BS2B 2R61A 3AEBB 3N1XC 5HFYA 3B9JA 4MSQB 4XC2A 3T9LA 4KV2A 3BYTB 2N9PC 3A9KA 3CSTA 3M63B 4LTUA 3T8MA 2KQ7A 3X23A 1EU4A 2PKOA 4GB9A 5IKCM 1L5PA 3BVMA 4DQOC 3DWMA 3PO0A 2KFJA 2PJHA 1XD3B 2BWES 1LFDA 4RGOS 1J19A 2WNMA 4PK1A 4K1RB 1F2RC 2OJWA 3I57A 4GLSC 1OQRA 2WYQA 3O65B 2PE9A 4WAFA 3AE4B 3U52E 4LJPB 2CS4A 2KJRA 1QT9A 4WJNA 4JLCA 5BO4B 2H89B 1KOTA 4X57B 1DYQA 1F1HA 4A6QA 1YJJA 2KK8A 2WXKA 1ET9A 4IW0A 1EU3A 3Q3JA 4ANVA 2HTHA 2AL3A 3GZNB 3ZVVA 5FR6A 2R2OA 1ZP0B 5EE0A 1JMLA 3RCZA 3HIZA 3B2FA 4WIPA 4ZRPA 3DVNU 5IOIA 5AEKB 2L7RA 2J0JA 2KJHB 2JRIB 1ZXIA 4NPNA 3RNBC 1E6EB 2IO1B 2LXAA 3AE1B 4XWTA 2C5LC 3UQBA 1V1PB 2I1KA 2L00B 2L3ZA 2KN5A 2BWFA 2JT4B 3I3TB 1YQ3B 1WM3A 2KN4A 4TSSA 1FXAA 1WY8A 3R66C 3AULA 3L16A 4MACA 2I2YA 1CQVA 3RULA 4MM3B 1L0YB 3AE9B 3AI5A 2KYWA 3PZ7A 2K3UA 4RGMA 3QARA 5IA7A 4ZYNA 3QHTA 3BYYB 2EMTA 2KX0A 3PZDA 2UWQA 1P1AA 4ZRJA 2LHDA 3AE7B 1F2RI 1V49A 4JL9A 1RLFA 1HEZE 4C00A 5KHOA 2PTLA 2V9HA 1EUVB 2L0TA 1MI0A 2G45B 2RDBC 4ZRKA 3SFDB 3A9JA 2MLBA 1JWBD 3VRAB 2N9KA 4BKSA 2UYZB 3Q2AC 4K81A 3IFWB 3AV8A 3JSVB 4WQOB 3HHMA 4II2B 1P0RA 3R2IA 4JPSA 2LJIA 2JZ3B 1ISNA 1A70A 4M01A 4W9LA 2NCNA 2WHIA 1QLBB 4HVBA 1WR1A 2V3SA 3H1UA 4KKIA 2B3AA 3EGRA 1TGZB 2K39A 2DZJA 3JW0X 4JIOU 2JWZA 5JHBA 4HPLB 4ARIA 1PGXA 3PS6A 2DAJA 3ZNHB 3DQVA 2GBJA 1WSPA 3A4RA 4C80A 3TCAA 3TUOA 3P42A 3VTVA 2AEHA 3SHQA 2FAZA 4NAWA 1TBEA 2WU2B 1WH3A 1SEBD 5BYSA 4ZRIA 2DENB 2LUMA 1FIQA 3E9SA 3JYUA 3B1LX 3APCA 2V0GA 3IG3A 2JU6X 2JSVX 2K0PA 3TIXA 1WE7A 2INNE 2LGXA 1E8YA 1FEHA 3MP9A 4ANUA 2L76A 4IKGA 2Z0DB 2KX3A 1WFYA 3VQIA 1KLUD 2MJDA 3TMPB 4KGSA 2KC1A 4KIKA 3AE5B 2M19A 2N1VA 2KZRA 2DLBA 2WU5B 3QK0A 4FBJB 1WGHA 1T0RC 3U7ZA 2M1MA 3WAPA 2GOWA 2OHFA 2LD9A 2WXQA 4B6WA 1UUPA 2PPHA 3VH3B 3RD2A 4ANWA 3FILA 2FE8A 1P3QU 4LDTB 1QF6A 2N7JA 2O6VA 1R4NB 2MP2B 3PV1A 2C7MB 4GU2A 3RNGC 3W1SA 1GPXA 3V3XA 3ZNGC 1OEYA 3U30A 3L4PA 1QOGA 3R7QA 4WJPA 1TS4A 2O6VD 1DOXA 1LQBA 2KTRB 2ZVNA 3TEWA 1LM8B 5E6NA 4Q2JA 3A9KB 3QC8B 1F52A 2DZIA 1PUTA 4NNJB 1E9MA 3R3MA 5IN7A 1WGKA 4HKQA 4W9CA 1IBXB 2V4IB 1WX8A 3OWEB 2LVOA 1YN3A 4RGTA
chains in the Genus database with same CATH topology
3ZTCA 1JRUA 1LXDA 4MGIE 2BYFA 2HD5B 4B95A 2C7NB 2WX1A 3SD5A 3ZDTA 5AZGA 3B0AA 2ZJDA 4KZ0A 3ZO5B 4AUQC 4I6PA 2REXA 2KXJA 5CHVC 2KFKB 2GMIC 3BINA 3HM6X 4GSWA 1Y8RC 4M8MA 4PYZA 1P98A 4W9FA 1OGWA 3H7PB 4K7UA 4BOSC 1KLVA 1YX5B 3DDCB 2XBBC 2MBEA 2JVCA 1R4NI 3KVFB 2LASA 1ZGUB 2KFKA 2JRHA 3MHSD 4KSKC 5AZHA 3ZTDA 2CU1A 1UBQA 2A5UA 4RM9A 1EO6A 1H4RA 4II3B 4IWQA 4MJSA 3VTUA 5DPSA 2K8BA 4PYUA 3V6EB 2LXCA 3TL5A 2V1YA 4G11A 2OJRA 2KDEB 1Q5WB 1XT9B 5J2RA 2RSUA 4KSLC 2NS5A 2FCNA 2HJ8A 3WA0A 1TTNA 1WZ3A 2G4DB 2JY6A 1V9JA 2DAFA 3L17A 4DBGA 2IY0B 2PEAA 4K7SA 2N9EB 2J0KA 4KDIC 2KTFA 4TUUA 2L05A 1GC7A 5HKHA 5TR5A 1J8CA 3ECIA 4G50A 2KWCA 2NBVB 1UH6A 3ZNZB 2YVCA 3W1YA 2XK5A 1IP9A 4PS7A 3AU5A 2R2QA 4PS8A 3DBHI 4MSMB 3U7DA 3IVFA 3PREA 3U8ZA 3DVGY 4W9GA 4WWPA 2M8SA 2JPHA 1V81A 1WIAA 1F9JA 2FCQA 3JVZX 2K8HA 2KJ6A 3NY5A 4KZCA 3CF6E 3PRPB 1I42A 1RFAA 1VCBA 1T0YA 4RM8A 3S2AA 3RZWC 4YL8A 2MBBB 2L0FA 3H7SA 4LCDE 2KMCA 4DHZB 5LXIB 2MBQA 5KHQA 4KVGB 4MELA 2BPSA 2VRRB 3H6NA 4AJYB 4MGYE 1GG3A 4E3CA 3PTFC 4GDLB 3RT3B 2D10A 3VXWA 4FN2A 2AL6A 1M94A 2GBKA 3B08A 5JZEB 4CO7A 2RGFA 4HWIB 3A1QB 1IPGA 4OVVA 4IWOA 4GDKB 4URKA 5C23A 2NPTA 4NY0A 4K7WA 4KDLB 3KH0A 4GDLA 4HDQA 4IWPA 4MGKE 4EEWA 4OVUA 2V4LA 3RYTA 1WGGA 1WXMA 2HE7A 3SU8X 3PT2B 4HDOA 4CYEA 3A1QA 2D2QA 3UQAA 5C1ZA 4GDKA 3TBLD 1I35A 2RPQA 1S3SG 2JXXA 4BBNC 3PRZA 4FJVB 2IY1B 3KYDD 2LUEA 2N7DA 3APDA 4MGZE 4HLEA 1NDDA 3L0WB 4HK2A 5DPTA 3CMMB 1XQQA 1WJ6A 2G3QB 3NZUA 3GZNI 3VFKA 4MSQB 3HM3A 3ZKJC 2DZKA 4TQ1A 4TKNA 1VD2A 4XC2A 1UGMA 3T9LA 3VUYA 3AU4A 4W9JA 4KV2A 2C60A 2N9PC 3A9KA 1E8WA 2G4SA 2BF8B 3CSTA 3M63B 2KD0A 4BBNF 5EDSA 4DHZE 4FADA 2FCMA 3T8MA 2KQ7A 3IHPC 3IBEA 3X23A 3PSEB 4GB9A 2LWPA 2K6DB 2EMSA 3ML8A 4BKSD 1L2NA 2KFJA 1P9DU 2PJHA 2NVUI 1WX7A 3ZLZA 1XD3B 2BWES 2KO3A 1LFDA 2I1JA 2DYBA 3PVLA 4W9EA 1J19A 2CHWA 4K1RB 2GBRA 4HCPB 1R4MI 2ASQA 2MA9B 3VUWA 1GUAB 4GOCA 1OTRB 2KQSA 2WYQA 3V61A 3O65B 2PE9A 4I6LB 2LVQA 3QWZB 1V5OA 2CS4A 4LJPB 2KJRA 3OLMD 1V6EA 4G0NB 4WJNA 4JLCA 4WWNA 5BO4B 3R7RA 1KOTA 1NBFC 4X57B 4IG7B 1OQYA 3OJ4B 4NAWB 5CHFA 4FULA 2M17A 4NJ7A 2MWSB 2KK8A 3H7PA 3VHTC 4PS3A 2ZCBA 1E8XA 1E8ZA 2KOXA 2J7QB 2FIDA 3P2BA 4HXDA 2CHXA 1A5RA 4IW0A 1Q1OA 3KYCD 3Q3JA 1UELA 2K25A 1SE9A 1QZEA 4ANVA 3A33B 2GBMA 2HTHA 4ICVA 2JZZA 4MDKE 2AL3A 2LJ5A 1WZ0A 2K6QA 5GMVA 3ZVVA 5FR6A 2CHZA 2R2OA 2Z0EB 1WI0A 2OOBB 3RCZA 4FLHA 3HIZA 2KHWB 2W9NA 1D3ZA 4JQWC 2BGFA 3QA8A 2LGDA 1Q0WB 3DVNU 4AJWA 1WGDA 3PPAA 1V2YA 3WANA 1ZW7A 5AEKB 1E90A 2IBIB 4TV3A 4P7IA 4WWOA 2L7RA 1WMHB 2J0JA 2KJHB 2JRIB 3DVGX 4NPNA 5L83A 2IO1B 4IM3A 2LXAA 1E7UA 3EFUA 2C5LC 2MX2A 3UQBA 2KMAA 2I1KA 4GXBA 5AZFA 2J0MA 3NS8A 2L00B 2L3ZA 2KN5A 2BWFA 4W9KA 4DK5A 2JT4B 3I3TB 4NQLB 2DZMA 3LJ3A 3EECA 1WM3A 1PQSA 3NHEB 1WY8A 3R66C 3AULA 2C9WB 3L16A 2LRUA 3M3JA 3RUIB 1RAXA 3RULA 3L13A 4M0WB 3AI5A 3PHXB 1MG8A 4GMVA 4AWJA 3DBSA 5J17A 2D3GA 2AWTA 2ZNVC 3N3KB 1FXTB 2EKEC 3QARA 5IA7A 2WX0A 4ZYNA 3GOEA 4ICUA 3D32A 3TJPA 2BYVE 4MM3A 3WAOA 3QHTA 2EMTA 2KX0A 3W1SC 4HCNB 5D6JB 4EFOA 2KC2A 2UWQA 3NOBA 3PZDA 4BOZB 4NQKE 1P1AA 2KLGA 3L10B 2KDBA 1K8RB 4ZRJA 1C3TA 3V6CB 1V49A 4JL9A 1RLFA 4M8NA 1OEYJ 3A9JB 4A20A 5KHOA 4MH0E 1NI2A 2FUHB 1EUVB 3CSFA 2L0TA 5G55A 1TZ1A 4F1SA 2G45B 3PRMB 4ZRKA 5E6PA 1V80A 2N7EA 1H8CA 3ZW3A 3Q3FA 3ZRCA 2DX5B 2Y5BB 2MLBA 3A9JA 3ZUNA 4DDGD 1WJNA 4BKSA 2N1WA 3QCAA 2UYZB 4K81A 3IFWB 2D11A 3M62B 1WR6E 2MQJA 3JSVB 1C1YB 3PLVA 3K9OB 1SIFA 1SGHA 3QAQA 4GIVA 4WQOB 3HHMA 4II2B 3BY4B 3VTWA 1P0RA 1KJTA 2JZ3B 1ISNA 3PGEA 2LZ6A 3ONSA 1UD7A 3JSVA 5JH5C 1WM2A 4WAAA 2ZCCA 1EF5A 4JGHB 3APFA 2DYOA 3A4SC 2RR9A 4ZDVA 4W9LA 2NCNA 4IM0A 1E5WA 1WGRA 1S1QB 4HVBA 1WR1A 2V3SA 4FHJA 5CX3A 3H1UA 2B3AA 3V62A 4EZJA 2L8JA 2LVPA 1TGZB 3ML9A 4ASWC 2CR5A 3QQ8B 2K39A 2DZJA 3JW0X 3L54A 4JIOU 2JWZA 2KWVB 3HK0A 5JHBA 2WDTB 4HPLB 2M0XA 3VAWA 1WJ4A 4LJOB 5D7GA 3PS6A 2BKRB 2DAJA 3SDLC 3ZNID 3ZNHB 2JF5A 4W9HA 3WAMA 1YQBA 3PHWB 1V5TA 3OAWA 4DHJB 4EZKA 3DQVA 2GBJA 2MBHA 3UF8A 3PLUA 4FA6A 3A4RA 3LDZE 3TCAA 2NR2A 4DWFA 2ZPYA 3DBRI 2K8CA 5CHWA 3VTVA 5JHAA 2AEHA 3SHQA 4XX5A 1HE8A 2A4ZA 2FAZA 4NAWA 2CKHB 3KUCB 4FJZA 1TBEA 2ZPNA 1WX9A 4HJKA 1UBIA 1WH3A 4F8CB 4A3OA 4IUMB 4ZRIA 4BKGA 1G6JA 2DENB 1GNUA 4AOFA 3N32A 4RMAA 3JYUA 3B1LX 3APCA 4EOYA 3N30A 1E7VA 3QIJA 3IG3A 2KVRA 4MJSB 1V86A 2NBUA 4FJYA 1WRDB 4EZLA 4BVUC 3TIXA 3RZFA 1WE7A 2N4FA 2LGXA 1WYWB 2WWZA 1E8YA 4ANXA 3MTNB 2BYEA 4ANUA 2L76A 4DHJD 5LLIA 3EHVA 2C7HA 2Z0DB 4KIKB 1WXSA 2K1FA 2KX3A 1WFYA 1Z2MA 3VQIA 4W9IA 4G3XB 4E74A 2AYOB 2ZEQA 2IO3B 3WALA 3C0RB 3M95A 1WMHA 1GC6A 3TMPB 2KC1A 2XK5B 4I6NB 3KUZA 4KIKA 4FHKA 1X1MA 5IAAC 3VUXA 4IM2A 1EF1A 2KZRA 2N1VA 4DDID 4J6IA 1YIWA 2JUOA 3ENEA 3UIOB 3ZRFA 2GBNA 4WJQA 5J18A 3ALBA 5L95C 3QK0A 1YJ1A 1Z5SB 2FIFA 3DOWA 3UIPB 4FBJB 2N9XA 2D07B 4EKUA 1WGHA 2KNBA 2MRPA 3EC8A 4BKTA 2KANA 5DPWA 2FNJB 1L7YA 3UGBB 2M1MA 2O2VB 2RD0A 4GGQA 3WAPA 2GOWA 4F7ZA 2LD9A 3DBLI 2O6VB 2XEWA 2KDFB 4B6WA 4XZ4A 2IO0B 3DPDA 2PPHA 3VH3B 3RD2A 4N9F4 4ANWA 1WF9A 1AARA 1ZKHA 2KKCA 2LI5A 2MBOA 2ZNVB 1P3QU 2O2VA 3OJ3A 4LDTB 4TQ0A 3ZDMC 3VVWB 2NPTB 2O6VA 2ZZPB 4WJOA 3AXCA 4B9KA 2MP2B 3PV1A 4IC7B 2DYMA 2ZVOA 3X0WA 2C7MB 4GU2A 2MW5A 3W1SA 1WGYA 1GJZA 4DXAB 2IZVB 2NBWB 1YD8U 2KDIA 2MP2A 1OEYA 2PE6B 3DVNV 2MCNB 3KW5B 3U30A 3ZNGC 4AP4C 1WE6A 3H9DA 2LGYA 3R7QA 4WJPA 4BFRA 1CMXB 1KM7A 4HPMB 2O6VD 5CTRC 2IO2B 3KUDB 5D2MB 5D94A 2FCSA 5E6OA 1LQBA 2MSED 4NJ6A 4E71A 2KTRB 2ZVNA 3DCGA 4LDTD 2KWUB 1LM8B 1BT0A 3L08A 1WXAA 4W9DA 3NZSA 3WIMA 4MEMA 5E6NA 3A9KB 3QC8B 2Z59B 4CHKA 2QHOA 3K9PB 1WJUA 2DHZA 2DZIA 4EUTA 1IYFA 5DCNA 3VH4B 4NNJB 3VDZA 2KTRA 3QX1A 1RRBA 5LXHA 3R3MA 4A3PA 4W9CA 3UINB 1J0GA 2M4NA 5G2NA 1WX8A 1YX6B 4GN1A 2LRWA 2BKFA 1WXVA 3V60A 1UZXB 2LVOA 3MJWA 3ZIMA 2IYDB 3QJZA 2KLCA 5DPRA 2YLMA 1U4AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZTC A;  1JRU A;  1LXD A;  4MGI E;  2BYF A;  2HD5 B;  4B95 A;  2C7N B;  2WX1 A;  3SD5 A;  3ZDT A;  5AZG A;  3B0A A;  2ZJD A;  4KZ0 A;  3ZO5 B;  4AUQ C;  4I6P A;  2REX A;  2KXJ A;  5CHV C;  2KFK B;  2GMI C;  3BIN A;  3HM6 X;  4GSW A;  1Y8R C;  4M8M A;  4PYZ A;  1P98 A;  4W9F A;  1OGW A;  3H7P B;  4K7U A;  4BOS C;  1KLV A;  1YX5 B;  3DDC B;  2XBB C;  2MBE A;  2JVC A;  1R4N I;  3KVF B;  2LAS A;  1ZGU B;  2KFK A;  2JRH A;  3MHS D;  4KSK C;  5AZH A;  3ZTD A;  2CU1 A;  1UBQ A;  2A5U A;  4RM9 A;  1EO6 A;  1H4R A;  4II3 B;  4IWQ A;  4MJS A;  3VTU A;  5DPS A;  2K8B A;  4PYU A;  3V6E B;  2LXC A;  3TL5 A;  2V1Y A;  4G11 A;  2OJR A;  2KDE B;  1Q5W B;  1XT9 B;  5J2R A;  2RSU A;  4KSL C;  2NS5 A;  2FCN A;  2HJ8 A;  3WA0 A;  1TTN A;  1WZ3 A;  2G4D B;  2JY6 A;  1V9J A;  2DAF A;  3L17 A;  4DBG A;  2IY0 B;  2PEA A;  4K7S A;  2N9E B;  2J0K A;  4KDI C;  2KTF A;  4TUU A;  2L05 A;  1GC7 A;  5HKH A;  5TR5 A;  1J8C A;  3ECI A;  4G50 A;  2KWC A;  2NBV B;  1UH6 A;  3ZNZ B;  2YVC A;  3W1Y A;  2XK5 A;  1IP9 A;  4PS7 A;  3AU5 A;  2R2Q A;  4PS8 A;  3DBH I;  4MSM B;  3U7D A;  3IVF A;  3PRE A;  3U8Z A;  3DVG Y;  4W9G A;  4WWP A;  2M8S A;  2JPH A;  1V81 A;  1WIA A;  1F9J A;  2FCQ A;  3JVZ X;  2K8H A;  2KJ6 A;  3NY5 A;  4KZC A;  3CF6 E;  3PRP B;  1I42 A;  1RFA A;  1VCB A;  1T0Y A;  4RM8 A;  3S2A A;  3RZW C;  4YL8 A;  2MBB B;  2L0F A;  3H7S A;  4LCD E;  2KMC A;  4DHZ B;  5LXI B;  2MBQ A;  5KHQ A;  4KVG B;  4MEL A;  2BPS A;  2VRR B;  3H6N A;  4AJY B;  4MGY E;  1GG3 A;  4E3C A;  3PTF C;  4GDL B;  3RT3 B;  2D10 A;  3VXW A;  4FN2 A;  2AL6 A;  1M94 A;  2GBK A;  3B08 A;  5JZE B;  4CO7 A;  2RGF A;  4HWI B;  3A1Q B;  1IPG A;  4OVV A;  4IWO A;  4GDK B;  4URK A;  5C23 A;  2NPT A;  4NY0 A;  4K7W A;  4KDL B;  3KH0 A;  4GDL A;  4HDQ A;  4IWP A;  4MGK E;  4EEW A;  4OVU A;  2V4L A;  3RYT A;  1WGG A;  1WXM A;  2HE7 A;  3SU8 X;  3PT2 B;  4HDO A;  4CYE A;  3A1Q A;  2D2Q A;  3UQA A;  5C1Z A;  4GDK A;  3TBL D;  1I35 A;  2RPQ A;  1S3S G;  2JXX A;  4BBN C;  3PRZ A;  4FJV B;  2IY1 B;  3KYD D;  2LUE A;  2N7D A;  3APD A;  4MGZ E;  4HLE A;  1NDD A;  3L0W B;  4HK2 A;  5DPT A;  3CMM B;  1XQQ A;  1WJ6 A;  2G3Q B;  3NZU A;  3GZN I;  3VFK A;  4MSQ B;  3HM3 A;  3ZKJ C;  2DZK A;  4TQ1 A;  4TKN A;  1VD2 A;  4XC2 A;  1UGM A;  3T9L A;  3VUY A;  3AU4 A;  4W9J A;  4KV2 A;  2C60 A;  2N9P C;  3A9K A;  1E8W A;  2G4S A;  2BF8 B;  3CST A;  3M63 B;  2KD0 A;  4BBN F;  5EDS A;  4DHZ E;  4FAD A;  2FCM A;  3T8M A;  2KQ7 A;  3IHP C;  3IBE A;  3X23 A;  3PSE B;  4GB9 A;  2LWP A;  2K6D B;  2EMS A;  3ML8 A;  4BKS D;  1L2N A;  2KFJ A;  1P9D U;  2PJH A;  2NVU I;  1WX7 A;  3ZLZ A;  1XD3 B;  2BWE S;  2KO3 A;  1LFD A;  2I1J A;  2DYB A;  3PVL A;  4W9E A;  1J19 A;  2CHW A;  4K1R B;  2GBR A;  4HCP B;  1R4M I;  2ASQ A;  2MA9 B;  3VUW A;  1GUA B;  4GOC A;  1OTR B;  2KQS A;  2WYQ A;  3V61 A;  3O65 B;  2PE9 A;  4I6L B;  2LVQ A;  3QWZ B;  1V5O A;  2CS4 A;  4LJP B;  2KJR A;  3OLM D;  1V6E A;  4G0N B;  4WJN A;  4JLC A;  4WWN A;  5BO4 B;  3R7R A;  1KOT A;  1NBF C;  4X57 B;  4IG7 B;  1OQY A;  3OJ4 B;  4NAW B;  5CHF A;  4FUL A;  2M17 A;  4NJ7 A;  2MWS B;  2KK8 A;  3H7P A;  3VHT C;  4PS3 A;  2ZCB A;  1E8X A;  1E8Z A;  2KOX A;  2J7Q B;  2FID A;  3P2B A;  4HXD A;  2CHX A;  1A5R A;  4IW0 A;  1Q1O A;  3KYC D;  3Q3J A;  1UEL A;  2K25 A;  1SE9 A;  1QZE A;  4ANV A;  3A33 B;  2GBM A;  2HTH A;  4ICV A;  2JZZ A;  4MDK E;  2AL3 A;  2LJ5 A;  1WZ0 A;  2K6Q A;  5GMV A;  3ZVV A;  5FR6 A;  2CHZ A;  2R2O A;  2Z0E B;  1WI0 A;  2OOB B;  3RCZ A;  4FLH A;  3HIZ A;  2KHW B;  2W9N A;  1D3Z A;  4JQW C;  2BGF A;  3QA8 A;  2LGD A;  1Q0W B;  3DVN U;  4AJW A;  1WGD A;  3PPA A;  1V2Y A;  3WAN A;  1ZW7 A;  5AEK B;  1E90 A;  2IBI B;  4TV3 A;  4P7I A;  4WWO A;  2L7R A;  1WMH B;  2J0J A;  2KJH B;  2JRI B;  3DVG X;  4NPN A;  5L83 A;  2IO1 B;  4IM3 A;  2LXA A;  1E7U A;  3EFU A;  2C5L C;  2MX2 A;  3UQB A;  2KMA A;  2I1K A;  4GXB A;  5AZF A;  2J0M A;  3NS8 A;  2L00 B;  2L3Z A;  2KN5 A;  2BWF A;  4W9K A;  4DK5 A;  2JT4 B;  3I3T B;  4NQL B;  2DZM A;  3LJ3 A;  3EEC A;  1WM3 A;  1PQS A;  3NHE B;  1WY8 A;  3R66 C;  3AUL A;  2C9W B;  3L16 A;  2LRU A;  3M3J A;  3RUI B;  1RAX A;  3RUL A;  3L13 A;  4M0W B;  3AI5 A;  3PHX B;  1MG8 A;  4GMV A;  4AWJ A;  3DBS A;  5J17 A;  2D3G A;  2AWT A;  2ZNV C;  3N3K B;  1FXT B;  2EKE C;  3QAR A;  5IA7 A;  2WX0 A;  4ZYN A;  3GOE A;  4ICU A;  3D32 A;  3TJP A;  2BYV E;  4MM3 A;  3WAO A;  3QHT A;  2EMT A;  2KX0 A;  3W1S C;  4HCN B;  5D6J B;  4EFO A;  2KC2 A;  2UWQ A;  3NOB A;  3PZD A;  4BOZ B;  4NQK E;  1P1A A;  2KLG A;  3L10 B;  2KDB A;  1K8R B;  4ZRJ A;  1C3T A;  3V6C B;  1V49 A;  4JL9 A;  1RLF A;  4M8N A;  1OEY J;  3A9J B;  4A20 A;  5KHO A;  4MH0 E;  1NI2 A;  2FUH B;  1EUV B;  3CSF A;  2L0T A;  5G55 A;  1TZ1 A;  4F1S A;  2G45 B;  3PRM B;  4ZRK A;  5E6P A;  1V80 A;  2N7E A;  1H8C A;  3ZW3 A;  3Q3F A;  3ZRC A;  2DX5 B;  2Y5B B;  2MLB A;  3A9J A;  3ZUN A;  4DDG D;  1WJN A;  4BKS A;  2N1W A;  3QCA A;  2UYZ B;  4K81 A;  3IFW B;  2D11 A;  3M62 B;  1WR6 E;  2MQJ A;  3JSV B;  1C1Y B;  3PLV A;  3K9O B;  1SIF A;  1SGH A;  3QAQ A;  4GIV A;  4WQO B;  3HHM A;  4II2 B;  3BY4 B;  3VTW A;  1P0R A;  1KJT A;  2JZ3 B;  1ISN A;  3PGE A;  2LZ6 A;  3ONS A;  1UD7 A;  3JSV A;  5JH5 C;  1WM2 A;  4WAA A;  2ZCC A;  1EF5 A;  4JGH B;  3APF A;  2DYO A;  3A4S C;  2RR9 A;  4ZDV A;  4W9L A;  2NCN A;  4IM0 A;  1E5W A;  1WGR A;  1S1Q B;  4HVB A;  1WR1 A;  2V3S A;  4FHJ A;  5CX3 A;  3H1U A;  2B3A A;  3V62 A;  4EZJ A;  2L8J A;  2LVP A;  1TGZ B;  3ML9 A;  4ASW C;  2CR5 A;  3QQ8 B;  2K39 A;  2DZJ A;  3JW0 X;  3L54 A;  4JIO U;  2JWZ A;  2KWV B;  3HK0 A;  5JHB A;  2WDT B;  4HPL B;  2M0X A;  3VAW A;  1WJ4 A;  4LJO B;  5D7G A;  3PS6 A;  2BKR B;  2DAJ A;  3SDL C;  3ZNI D;  3ZNH B;  2JF5 A;  4W9H A;  3WAM A;  1YQB A;  3PHW B;  1V5T A;  3OAW A;  4DHJ B;  4EZK A;  3DQV A;  2GBJ A;  2MBH A;  3UF8 A;  3PLU A;  4FA6 A;  3A4R A;  3LDZ E;  3TCA A;  2NR2 A;  4DWF A;  2ZPY A;  3DBR I;  2K8C A;  5CHW A;  3VTV A;  5JHA A;  2AEH A;  3SHQ A;  4XX5 A;  1HE8 A;  2A4Z A;  2FAZ A;  4NAW A;  2CKH B;  3KUC B;  4FJZ A;  1TBE A;  2ZPN A;  1WX9 A;  4HJK A;  1UBI A;  1WH3 A;  4F8C B;  4A3O A;  4IUM B;  4ZRI A;  4BKG A;  1G6J A;  2DEN B;  1GNU A;  4AOF A;  3N32 A;  4RMA A;  3JYU A;  3B1L X;  3APC A;  4EOY A;  3N30 A;  1E7V A;  3QIJ A;  3IG3 A;  2KVR A;  4MJS B;  1V86 A;  2NBU A;  4FJY A;  1WRD B;  4EZL A;  4BVU C;  3TIX A;  3RZF A;  1WE7 A;  2N4F A;  2LGX A;  1WYW B;  2WWZ A;  1E8Y A;  4ANX A;  3MTN B;  2BYE A;  4ANU A;  2L76 A;  4DHJ D;  5LLI A;  3EHV A;  2C7H A;  2Z0D B;  4KIK B;  1WXS A;  2K1F A;  2KX3 A;  1WFY A;  1Z2M A;  3VQI A;  4W9I A;  4G3X B;  4E74 A;  2AYO B;  2ZEQ A;  2IO3 B;  3WAL A;  3C0R B;  3M95 A;  1WMH A;  1GC6 A;  3TMP B;  2KC1 A;  2XK5 B;  4I6N B;  3KUZ A;  4KIK A;  4FHK A;  1X1M A;  5IAA C;  3VUX A;  4IM2 A;  1EF1 A;  2KZR A;  2N1V A;  4DDI D;  4J6I A;  1YIW A;  2JUO A;  3ENE A;  3UIO B;  3ZRF A;  2GBN A;  4WJQ A;  5J18 A;  3ALB A;  5L95 C;  3QK0 A;  1YJ1 A;  1Z5S B;  2FIF A;  3DOW A;  3UIP B;  4FBJ B;  2N9X A;  2D07 B;  4EKU A;  1WGH A;  2KNB A;  2MRP A;  3EC8 A;  4BKT A;  2KAN A;  5DPW A;  2FNJ B;  1L7Y A;  3UGB B;  2M1M A;  2O2V B;  2RD0 A;  4GGQ A;  3WAP A;  2GOW A;  4F7Z A;  2LD9 A;  3DBL I;  2O6V B;  2XEW A;  2KDF B;  4B6W A;  4XZ4 A;  2IO0 B;  3DPD A;  2PPH A;  3VH3 B;  3RD2 A;  4N9F 4;  4ANW A;  1WF9 A;  1AAR A;  1ZKH A;  2KKC A;  2LI5 A;  2MBO A;  2ZNV B;  1P3Q U;  2O2V A;  3OJ3 A;  4LDT B;  4TQ0 A;  3ZDM C;  3VVW B;  2NPT B;  2O6V A;  2ZZP B;  4WJO A;  3AXC A;  4B9K A;  2MP2 B;  3PV1 A;  4IC7 B;  2DYM A;  2ZVO A;  3X0W A;  2C7M B;  4GU2 A;  2MW5 A;  3W1S A;  1WGY A;  1GJZ A;  4DXA B;  2IZV B;  2NBW B;  1YD8 U;  2KDI A;  2MP2 A;  1OEY A;  2PE6 B;  3DVN V;  2MCN B;  3KW5 B;  3U30 A;  3ZNG C;  4AP4 C;  1WE6 A;  3H9D A;  2LGY A;  3R7Q A;  4WJP A;  4BFR A;  1CMX B;  1KM7 A;  4HPM B;  2O6V D;  5CTR C;  2IO2 B;  3KUD B;  5D2M B;  5D94 A;  2FCS A;  5E6O A;  1LQB A;  2MSE D;  4NJ6 A;  4E71 A;  2KTR B;  2ZVN A;  3DCG A;  4LDT D;  2KWU B;  1LM8 B;  1BT0 A;  3L08 A;  1WXA A;  4W9D A;  3NZS A;  3WIM A;  4MEM A;  5E6N A;  3A9K B;  3QC8 B;  2Z59 B;  4CHK A;  2QHO A;  3K9P B;  1WJU A;  2DHZ A;  2DZI A;  4EUT A;  1IYF A;  5DCN A;  3VH4 B;  4NNJ B;  3VDZ A;  2KTR A;  3QX1 A;  1RRB A;  5LXH A;  3R3M A;  4A3P A;  4W9C A;  3UIN B;  1J0G A;  2M4N A;  5G2N A;  1WX8 A;  1YX6 B;  4GN1 A;  2LRW A;  2BKF A;  1WXV A;  3V60 A;  1UZX B;  2LVO A;  3MJW A;  3ZIM A;  2IYD B;  3QJZ A;  2KLC A;  5DPR A;  2YLM A;  1U4A A; 
#chains in the Genus database with same CATH topology
 4OZA A;  3CIR B;  1JRU A;  2BYF A;  2HD5 B;  2LGS A;  2C7N B;  5AZG A;  2QEJ C;  1PDX A;  2W3S A;  2KXJ A;  2KFK B;  4M8M A;  4GSW A;  4W9F A;  1TJE A;  1KLV A;  1YX5 B;  2XBB C;  3KVF B;  1R4N I;  2LAS A;  2N0S B;  3NG0 A;  5AZH A;  3IT6 B;  1UBQ A;  1EO6 A;  4MJS A;  3VTU A;  1R7S A;  2QMT A;  3IAS 1;  4PYU A;  2LXC A;  1OQQ A;  1WYG A;  2QJL A;  1UNS A;  1Q5W B;  2RSU A;  1FFV A;  2NS5 A;  4DBG A;  2DAF A;  4K7S A;  2PEA A;  5HKH A;  3KLS X;  4LLG M;  4N59 A;  2NBV B;  4P1B C;  3ZNZ B;  2YVC A;  1NYQ A;  4PS8 A;  1FNV A;  1GAQ B;  3V05 A;  3Q8F A;  1F9J A;  5MPO A;  3PRP B;  1R4M B;  1VCB A;  4RM8 A;  2BQQ A;  3S2A A;  3RZW C;  1HTQ A;  2MBB B;  5BYR A;  2MBQ A;  1TY0 A;  1QOB A;  2OED A;  2VRR B;  3RNF C;  3H6N A;  4E3C A;  3PTF C;  4GDL B;  3RT3 B;  3VXW A;  2AL6 A;  2WXM A;  4IOI E;  4OVV A;  3NVY A;  4EEW A;  4OVU A;  3GE3 C;  2HE7 A;  2RMM A;  1I4R A;  1I4P A;  4M02 A;  1SSN A;  3CWI A;  1BXT A;  3GS2 A;  1SB3 C;  2IY1 B;  3KYD D;  3APD A;  4HLE A;  5DPT A;  3H8H A;  2XNA C;  2K22 A;  3NZU A;  4TQ1 A;  3MHZ A;  1UGM A;  3AU4 A;  4W9J A;  3AEC B;  1E8W A;  1YJI A;  2BF8 B;  2G4S A;  4BBN F;  5EDS A;  1TS3 A;  2FCM A;  3IBE A;  3PSE B;  2K6D B;  2MJ3 A;  5EE3 A;  1TZO A;  2KWD A;  2I1J A;  1R4M I;  2ASQ A;  3VUW A;  1GUA B;  1C4C A;  3BWU D;  3TEY A;  1V6E A;  3AED B;  1NBF C;  2HDE A;  4IG7 B;  2AQ1 B;  4NAW B;  5CHF A;  3RN9 C;  1FRD A;  3VHT C;  2W54 A;  2ZCB A;  3NS1 A;  3BVZ A;  2CHX A;  1HQR D;  1Q1O A;  3KYC D;  2K9X A;  1SE9 A;  2J4X A;  1K51 A;  4NJC A;  2JZZ A;  1WZ0 A;  2K6Q A;  2QSD A;  5GMV A;  1ZUD 2;  2KAC A;  1SE4 A;  1WI0 A;  4XE0 A;  1TKE A;  2W9N A;  2DBY A;  1VLB A;  3QA8 A;  4UDU C;  2LGD A;  1WGD A;  3PPA A;  2JX5 A;  1V2Y A;  1ZW7 A;  2IBI B;  3DVG X;  4ZHP A;  5L83 A;  4IM3 A;  1E7U A;  2MX2 A;  5AUI A;  2KAJ A;  4GXB A;  3NS8 A;  4DK5 A;  3AMZ A;  1T0Q C;  4ZHO A;  3NHE B;  2LRU A;  3M3J A;  4C7Y A;  4M0W B;  4GMV A;  3DBS A;  2L1A A;  3ETR A;  2ZNV C;  3N3K B;  3MFG A;  3GOE A;  4ICU A;  2BYV E;  3WAO A;  3W1S C;  4EFO A;  4HCN B;  5D6J B;  3NOB A;  4BOZ B;  2X38 A;  2KLG A;  2VH2 A;  2KDB A;  1K8R B;  1VDV A;  4RH6 A;  2QIL A;  4M8N A;  1OEY J;  4A20 A;  2YEP B;  3AE3 B;  2PIA A;  1J7C A;  4F1S A;  3PRM B;  5E6P A;  1N5X A;  2BTE A;  2JQR B;  1L6U A;  2LHE A;  3Q3F A;  3ZUN A;  5G5H A;  2N1W A;  2D11 A;  1WR6 E;  3PLV A;  1N6Z A;  1SIF A;  1LO5 D;  1SGH A;  3K9O B;  3NZ3 A;  3BY4 B;  4H2A A;  2WXO A;  1MHH E;  4RNA A;  1FCL A;  3PGE A;  1HXY D;  2I38 A;  3ONS A;  1UD7 A;  4XWW A;  5BMG A;  4WUR A;  3EUB 2;  5JH5 C;  1EF5 A;  4JGH B;  2DYO A;  3A4S C;  4IM0 A;  1LGR A;  1E5W A;  1S1Q B;  2VH1 A;  1WRI A;  4HPP A;  2LVP A;  1L4D B;  2MH7 A;  4ASW C;  2KWV B;  5H8Y E;  1JWU D;  2MEK A;  1SF0 A;  4LJO B;  5D7G A;  3I5J C;  3ZNI D;  4C56 C;  3NJT A;  1YQB A;  3PHW B;  1V5T A;  5D3I B;  4DHJ B;  3PLU A;  2FUG 1;  4FA6 A;  3LDZ E;  3ZQ4 A;  2ONQ A;  1P7E A;  5CHW A;  2LEK A;  2A4Z A;  1QKZ A;  1WX9 A;  4F8C B;  2Y5C A;  1GB4 A;  1TKY A;  1I4G A;  3HVZ A;  1F0Z A;  1F77 A;  4RMA A;  4EE2 A;  4EOY A;  1E7V A;  4MJS B;  2KVR A;  1V86 A;  4FJY A;  1WRD B;  4EZL A;  4AS1 A;  3RZF A;  1C4P A;  3ZXV A;  2PVO D;  1FRR A;  5LNK 1;  2C7H A;  1I4Q A;  1KTK A;  2K1F A;  1HA5 A;  3DHH C;  2AYO B;  1QOF A;  2WXI A;  3M95 A;  1WMH A;  2BT6 A;  1GC6 A;  2AQ2 B;  4I6N B;  3KUZ A;  1N60 A;  3NUH B;  3VUX A;  4YTP B;  1EF1 A;  3MJ5 A;  1JRP A;  1ZDV A;  1PGA A;  1Z5S B;  4US8 A;  3P4R B;  3DHG C;  3UIP B;  1VZ6 A;  3AM9 A;  4EKU A;  5DPW A;  2FNJ B;  4OZC A;  3UGB B;  3TSS A;  4J3O D;  3N9Y C;  2XEW A;  1XLN A;  4XZ4 A;  3DPD A;  4JX1 C;  4N9F 4;  1WF9 A;  1AAR A;  2KKC A;  2LI5 A;  3MC9 A;  2O2V A;  3OJ3 A;  3ZDM C;  3VVW B;  4P16 A;  1XO3 A;  1EWC A;  3DWG C;  4LNF A;  2DYM A;  1ESF A;  1GJZ A;  1AWD A;  1YD8 U;  2PE6 B;  3ZXR A;  3MC0 B;  3I9V 1;  2IO2 B;  5D2M B;  5D94 A;  2FCS A;  4NJ6 A;  4W9D A;  2KWU B;  3L08 A;  1BT0 A;  1OFF A;  1WJU A;  1IYF A;  3DBH B;  2TSS A;  3VH4 B;  3AH7 A;  4XDC A;  3QX1 A;  1RRB A;  4GN1 A;  1ZE3 D;  2BKF A;  1UZX B;  1T0S C;  2L52 A;  2YLM A;  4RFB A;  1K50 A;  4MGI E;  4RGN A;  3B0A A;  4OW0 A;  2ZJD A;  4DXG A;  4AUQ C;  1TYG B;  4KKJ A;  1Y8R C;  1P98 A;  1FO4 A;  3DDC B;  2JVC A;  2BB5 A;  5EE9 A;  1C9F A;  1MJD A;  1H4R A;  4PT5 A;  4IWQ A;  5D3D A;  2K8B A;  4XYC A;  3TL5 A;  5GXG B;  2BVC A;  4G11 A;  2VZK D;  4KSL C;  3T3O A;  2HJ8 A;  1JW9 D;  1TTN A;  4LK0 M;  1AN8 A;  4JE3 B;  1WZ3 A;  2IY0 B;  2D5G A;  2PMV A;  2ON8 A;  5TR5 A;  2WP9 B;  4ACF A;  1UH6 A;  3HRD D;  3AU5 A;  2WXH A;  1VZ8 A;  3DBH I;  1E0Z A;  4W9G A;  4WWP A;  2FCQ A;  3JVZ X;  2K8H A;  4ZYS A;  1I42 A;  3N1Z C;  1HZ5 A;  1EM7 A;  2KMC A;  2LFI A;  5KHQ A;  3BK1 A;  4KVG B;  3AN1 A;  2BPS A;  1RWS A;  1ACC A;  3VR8 B;  4MGY E;  2QC8 A;  2BS3 B;  3LXF A;  4FN2 A;  1YN5 A;  1TKG A;  4BZA A;  4CO7 A;  2RGF A;  3U2S C;  4IWO A;  4GDK B;  1T6B X;  4NY0 A;  4MGK E;  2V4L A;  1WGG A;  4HDO A;  3A1Q A;  2D2Q A;  1N5W A;  3ABV B;  1I35 A;  2RPQ A;  1YQ4 B;  1N63 A;  4BBN C;  3P1M A;  2J42 A;  1D4B A;  4MGZ E;  1C77 A;  1NDD A;  3L0W B;  4HK2 A;  1WJ6 A;  3HM3 A;  4TKN A;  1VD2 A;  3VUY A;  2C60 A;  3AEE B;  3FKY A;  4DHZ E;  1SBB B;  4YSZ B;  1TY2 A;  3PZ8 A;  2LWP A;  2EMS A;  1JWM D;  3P4Q B;  1JWS D;  2G9H D;  1L2N A;  2NVU I;  2KO3 A;  2DYB A;  3PVL A;  2CHW A;  2JWU A;  2WXG A;  2WQY B;  1YMH E;  2JXT A;  4GOC A;  1OTR B;  3V61 A;  2PW9 A;  3NRZ A;  4IDI A;  4NAM A;  3R7R A;  1D5M C;  3Q8B A;  1FPY A;  1OQY A;  2KMM A;  4FUL A;  1WXQ A;  2M17 A;  4NJ7 A;  2MWS B;  1JWA D;  3H7P A;  2L83 A;  2SEB D;  2KOX A;  2J7Q B;  2FID A;  2CJN A;  2BYT A;  2GI9 A;  1KLG D;  1UEL A;  4TMA B;  1QZE A;  2PLP A;  2GBM A;  4MDK E;  4FLH A;  4KGR A;  2BW2 A;  2G1E A;  1UWM A;  4AJW A;  3MC8 A;  1XCT L;  3WAN A;  4P7I A;  4WWO A;  1WMH B;  3Q69 A;  2B76 B;  2Y5P A;  1I4X A;  1UF0 A;  2KMA A;  2J0M A;  3EA6 A;  3NVV A;  4W9K A;  2DZM A;  3N1Y C;  3EEC A;  1PQS A;  2C9W B;  2W82 A;  4HJG E;  3W9C B;  1N61 A;  3PHX B;  1MG8 A;  2KQ4 X;  4AWJ A;  2AWT A;  3Q3M C;  1FXT B;  4B0M A;  2V3P A;  2WX0 A;  3D32 A;  3TJP A;  4MM3 A;  4A90 A;  2BS4 B;  2QIE B;  1C3T A;  4N6E B;  1V1O A;  4WH4 A;  3A9J B;  5G5G A;  4MH0 E;  1NI2 A;  3CSF A;  4RCO A;  5G55 A;  1RM6 C;  5FR3 A;  2N7E A;  3ZRC A;  2LMC A;  3ZYY X;  3M62 B;  1XLO A;  2MQJ A;  1I7H A;  2IGD A;  4GIV A;  4QAY A;  1KJT A;  4OHJ A;  1T5X D;  2ICI A;  3JSV A;  3AE6 B;  1WM2 A;  3Q8A A;  3RPF C;  4WAA A;  2ZCC A;  5BYQ A;  2RR9 A;  2JYE A;  4ZOH C;  3BII D;  1WGR A;  4HKZ E;  2GRI A;  5CX3 A;  4FHJ A;  5C3J B;  3V62 A;  2ZW0 A;  2L8J A;  3ML9 A;  3QQ8 B;  4C4V A;  3E56 A;  3HK0 A;  2WDT B;  1QQR A;  2M0X A;  4S0R A;  2CJO A;  2WGS A;  2JF5 A;  3WAM A;  2NTT A;  4EZK A;  3Q6B A;  1XLQ A;  1V97 A;  4ITK A;  2NR2 A;  2WLB A;  4K3C A;  4DWF A;  2ZPY A;  3ZGZ A;  4A9A A;  3HUI A;  4XX5 A;  1HE8 A;  3KUC B;  1E10 A;  4HJK A;  1UBI A;  1P7F A;  2IGH A;  4IUM B;  1VR9 A;  1G6J A;  4AOF A;  3N32 A;  2KVZ A;  1CJE A;  4YSX B;  2WDR B;  3QIJ A;  2N9L A;  3P63 A;  1YNT E;  1FMA D;  1TIF A;  4BVU C;  2N4F A;  1K52 A;  1WYW B;  2WXN A;  4ANX A;  2BYE A;  2IJ0 A;  5LLI A;  3EHV A;  5E6J A;  4KIK B;  1Z2M A;  2H88 B;  2ZEQ A;  3C0R B;  2WXJ A;  4XDD A;  2V3N A;  1XF5 L;  4IM2 A;  4M00 A;  4P1C C;  4J6I A;  2JUO A;  3ENE A;  2GBN A;  5J18 A;  3ALB A;  5L95 C;  1STE A;  1ZOY B;  1IGD A;  2Z8L A;  3DOW A;  1FFU A;  2N9X A;  2MRP A;  4BKT A;  3EC8 A;  1PGB A;  4US9 A;  3GP7 A;  3FIL B;  2RD0 A;  1KRH A;  2O6V B;  2KDF B;  2WXL A;  2ZNV B;  1I4H A;  2RPV A;  1JCK B;  1EWY C;  4R3D A;  1D5Z C;  3AXC A;  3X0W A;  1WGY A;  4DXA B;  4HRS A;  2K5P A;  1C4A A;  2IZV B;  2NBW B;  2KDI A;  2MP2 A;  4AP4 C;  2MCN B;  1RYJ A;  3KW5 B;  1WE6 A;  1IUE A;  3TEZ A;  3FC4 A;  3GB1 A;  1KM7 A;  1HZ6 A;  1Q10 A;  5CTR C;  4YT0 B;  5BMI A;  1J7A A;  1CK1 A;  2MSE D;  4L2Y A;  4E71 A;  4LDT D;  3U8Z A;  3Q8E A;  1WXA A;  3WIM A;  3IT4 B;  3NZS A;  1ET6 A;  3KWV A;  1VJK A;  2DHZ A;  4EUT A;  1BML C;  2M56 B;  5DCN A;  2KTR A;  5LXH A;  4RF0 A;  4A3P A;  1B9R A;  5T8I A;  1J0G A;  5G2N A;  4YSY B;  1YX6 B;  3ZIM A;  3QJZ A;  2KLC A;  4KGT A;  1IBX A;  5DPR A;  3HVD A;  2EEL A;  1LXD A;  4B95 A;  2WX1 A;  3SD5 A;  3WCQ A;  3ZO5 B;  1AW7 A;  2REX A;  5CHV C;  3BIN A;  2GMI C;  3HM6 X;  4O1N A;  1FCC C;  4PYZ A;  1OGW A;  3H7P B;  4CQN A;  2MBE A;  3O13 A;  3FAH A;  4YTM B;  1ZGU B;  2KFK A;  5HG2 A;  3I63 C;  4KSK C;  4P6V F;  2MHJ A;  1B1Z A;  4RM9 A;  2A5U A;  3BK2 A;  1JQ4 A;  2NTS A;  1TT5 B;  3AE8 B;  2V1Y A;  2OJR A;  2KDE B;  3P4P B;  1XT9 B;  5J2R A;  1NEN B;  2G4D B;  2JY6 A;  1V9J A;  3L17 A;  2N9E B;  1MVK A;  4KDI C;  2KTF A;  1GC7 A;  1J8C A;  3ECI A;  4XGA B;  3W1Y A;  2XK5 A;  2R2Q A;  4MSM B;  2INP E;  3IVF A;  4USA A;  1GOZ A;  3DVG Y;  1NEK B;  3LB8 C;  2M8S A;  1WIA A;  2BB6 A;  2NMQ A;  3NY5 A;  2KJ6 A;  3Q3O C;  4KZC A;  1M4V A;  4B0E A;  1RFA A;  3Q14 C;  4LNO A;  3T3N A;  1SE3 A;  4LCD E;  3W2D A;  3NVW A;  4DHZ B;  3C8Y A;  3BVG A;  3UI3 A;  1C78 A;  1IGC A;  1GG3 A;  3SR6 A;  3B08 A;  1KH0 A;  1IPG A;  1XEE A;  5C23 A;  2NPT A;  4K7W A;  4KDL B;  4IWP A;  4GDL A;  5C2T B;  2EKI A;  1SJH D;  1C76 A;  3SU8 X;  3PT2 B;  5TSS A;  3UQA A;  3R2T A;  2D3A A;  5HI1 A;  3TBL D;  3U4E G;  1S3S G;  1FD6 A;  5AUK A;  2YEP F;  2LUE A;  2N7D A;  1AYF A;  3RFZ B;  1XQQ A;  2G3Q B;  3GZN I;  3VFK A;  3ZKJ C;  2DZK A;  4D2K A;  3N20 C;  1QOA A;  5FK9 C;  2KD0 A;  1J7B A;  4FAD A;  3IHP C;  4A8X C;  1NVI D;  2D3C A;  3ML8 A;  4BKS D;  4C4V B;  2KDM A;  1P9D U;  2E3T A;  4A55 A;  3AEG B;  1WX7 A;  3ZLZ A;  4W9E A;  2LGI A;  1XXG A;  2GBR A;  1D6E C;  4HCP B;  2MA9 B;  3NVZ A;  1MPE A;  2KQS A;  4C7Z A;  3Q8C A;  1MG4 A;  4I6L B;  2LVQ A;  3QWZ B;  1V5O A;  3OLM D;  4G0N B;  1UGJ A;  4WWN A;  3VRB B;  3OJ4 B;  1MHX A;  3Q3N C;  2Y3A A;  1ROE A;  4PS3 A;  1E8X A;  1E8Z A;  4HXD A;  3P2B A;  4NZL B;  1A5R A;  2K25 A;  2JYT A;  3A33 B;  4ICV A;  2LJ5 A;  3AE2 B;  2CHZ A;  1L6V A;  2D3B A;  2Z0E B;  4LNK A;  2OOB B;  4REZ A;  1D3Z A;  2KHW B;  4JQW C;  2BGF A;  3KQ4 A;  1Q0W B;  1V8C A;  2IPK D;  2CU3 A;  2IND C;  1E90 A;  4TV3 A;  4OVZ A;  3AB5 A;  3EFU A;  5I4D A;  5AZF A;  4RF1 A;  4NQL B;  3LJ3 A;  4ZRQ A;  2QDF A;  1SJE D;  2WDV B;  3RUI B;  1RAX A;  1NI3 A;  3L13 A;  5J17 A;  2D3G A;  2EKE C;  3DBR B;  1DGJ A;  4M0W A;  2W3R A;  5JXV A;  2KC2 A;  4ARC A;  1YN4 A;  4NQK E;  4L23 A;  3OG5 A;  1MFW A;  3L10 B;  1L4Z B;  3KWL A;  3V6C B;  2FUH B;  3DHI C;  2XN9 C;  1TZ1 A;  2GLS A;  1V80 A;  1H8C A;  3ZW3 A;  1TS2 A;  1E7P B;  2DX5 B;  2Y5B B;  1ZXH A;  1JRO A;  4DDG D;  1GB1 A;  1WJN A;  3QCA A;  3C19 A;  3J9C A;  1C1Y B;  3QAQ A;  3VTW A;  2SAK A;  1L0X B;  1ZPS A;  1JAL A;  2IGG A;  2LZ6 A;  2ZW1 A;  4WWM A;  3APF A;  2X8X X;  4ZDV A;  2RDG A;  1KFY B;  1DOI A;  2WDQ B;  4EZJ A;  2CR5 A;  3L54 A;  3W5V B;  4YWG G;  3VAW A;  1WJ4 A;  3DBL B;  1L0V B;  2BKR B;  3SDL C;  4W9H A;  4JWU C;  3OAW A;  1BUI C;  2MBH A;  3SEB A;  3UF8 A;  2JZP A;  2GB1 A;  3URY A;  5HHD G;  3DBR I;  2K8C A;  5FKA C;  5JHA A;  2J53 A;  2CKH B;  4FJZ A;  2ZPN A;  1SXT A;  1N62 A;  2DWQ A;  4A3O A;  2AX5 A;  2FBW B;  4BKG A;  1TS5 A;  4N58 A;  1GNU A;  4JWS C;  3ZJU A;  3N30 A;  2PVG C;  2NBU A;  3ZJV A;  1FNW A;  2WWZ A;  3RI7 C;  3MTN B;  1YOV B;  1RFK A;  4DHJ D;  1WXS A;  4W9I A;  4G3X B;  4E74 A;  2IO3 B;  1ENF A;  3WAL A;  1ZDX A;  2XK5 B;  4FHK A;  1X1M A;  5IAA C;  1V1P A;  4DDI D;  1YIW A;  1Y56 A;  3RNC C;  3UIO B;  3R8B A;  3ZRF A;  4WJQ A;  1YJ1 A;  2FIF A;  3VR9 B;  2Q5W D;  2D07 B;  2KNB A;  2KAN A;  1L7Y A;  2O2V B;  4GGQ A;  2L32 A;  1CZP A;  4F7Z A;  3DBL I;  3RNE C;  2IO0 B;  3AEF B;  1ZKH A;  2MBO A;  1FXI A;  2WXR A;  2INC C;  4TQ0 A;  4MH8 A;  2HTM E;  1XLP A;  5EE1 A;  2NPT B;  2ZZP B;  4WJO A;  4B9K A;  4IC7 B;  3B2G A;  2ZVO A;  2MW5 A;  2WXP A;  4HEA 1;  3W5U B;  1K53 A;  3DVN V;  3IAM 1;  3ZJT A;  4YTN B;  3H9D A;  2LGY A;  4BFR A;  1CMX B;  4HPM B;  1DOY A;  3KUD B;  1XCQ L;  2MJE A;  5E6O A;  2W55 A;  4L1B A;  3DCG A;  1T3Q A;  4MEM A;  4CHK A;  2Z59 B;  2QHO A;  3K9P B;  4BAX A;  2RDH A;  1PYW D;  5IO9 A;  1D5X C;  3VDZ A;  2UU7 A;  2WXF A;  1FM0 D;  3UIN B;  1HTO A;  2M4N A;  3GE8 C;  2LRW A;  1WXV A;  3V60 A;  3EFC A;  1KF6 B;  3MJW A;  2IYD B;  2DNF A;  4WQM A;  4FXC A;  1U4A A;  2ACZ B;  3ZTC A;  2VZK B;  2IDY A;  3ZDT A;  1FNU A;  4KZ0 A;  3SFE B;  1SIJ A;  4I6P A;  1NYR A;  3P4S B;  5IP4 D;  4K7U A;  4BOS C;  2AQ3 B;  4DXF A;  2QCZ A;  2JRH A;  3MHS D;  3ZTD A;  2CU1 A;  2M0A A;  4II3 B;  1WWT A;  5DPS A;  3V6E B;  4S17 A;  2FCN A;  2E6X A;  4KX6 B;  4LNI A;  3WA0 A;  4AQ7 A;  2WS3 B;  2J0K A;  4TUU A;  2L05 A;  3AEA B;  2HJ1 A;  4G50 A;  2KWC A;  1SE2 A;  4HRO A;  1IP9 A;  4PS7 A;  3U7D A;  3PRE A;  4OZB A;  3BZD B;  1V81 A;  2JPH A;  1UWX A;  1VZ7 A;  3CF6 E;  4K3B A;  3RNA C;  1T0Y A;  3LYY A;  4YXD B;  3RMK C;  4YL8 A;  2L0F A;  3H7S A;  4LNN A;  5H92 C;  5BMH A;  5LXI B;  1C79 A;  4MEL A;  1QIL A;  1PFD A;  1VRA B;  4AJY B;  2D10 A;  2BBC A;  1M94 A;  2GBK A;  5JZE B;  3TEX A;  4HWI B;  3A1Q B;  4URK A;  2KT7 A;  3KH0 A;  4HDQ A;  2J52 A;  3IXS A;  3RYT A;  4MT5 A;  1WXM A;  4CYE A;  5C1Z A;  4GDK A;  2JXX A;  3PRZ A;  4FJV B;  3CMM B;  2BS2 B;  2R61 A;  3AEB B;  3N1X C;  5HFY A;  3B9J A;  4MSQ B;  4XC2 A;  3T9L A;  4KV2 A;  3BYT B;  2N9P C;  3A9K A;  3CST A;  3M63 B;  4LTU A;  3T8M A;  2KQ7 A;  3X23 A;  1EU4 A;  2PKO A;  4GB9 A;  5IKC M;  1L5P A;  3BVM A;  4DQO C;  3DWM A;  3PO0 A;  2KFJ A;  2PJH A;  1XD3 B;  2BWE S;  1LFD A;  4RGO S;  1J19 A;  2WNM A;  4PK1 A;  4K1R B;  1F2R C;  2OJW A;  3I57 A;  4GLS C;  1OQR A;  2WYQ A;  3O65 B;  2PE9 A;  4WAF A;  3AE4 B;  3U52 E;  4LJP B;  2CS4 A;  2KJR A;  1QT9 A;  4WJN A;  4JLC A;  5BO4 B;  2H89 B;  1KOT A;  4X57 B;  1DYQ A;  1F1H A;  4A6Q A;  1YJJ A;  2KK8 A;  2WXK A;  1ET9 A;  4IW0 A;  1EU3 A;  3Q3J A;  4ANV A;  2HTH A;  2AL3 A;  3GZN B;  3ZVV A;  5FR6 A;  2R2O A;  1ZP0 B;  5EE0 A;  1JML A;  3RCZ A;  3HIZ A;  3B2F A;  4WIP A;  4ZRP A;  3DVN U;  5IOI A;  5AEK B;  2L7R A;  2J0J A;  2KJH B;  2JRI B;  1ZXI A;  4NPN A;  3RNB C;  1E6E B;  2IO1 B;  2LXA A;  3AE1 B;  4XWT A;  2C5L C;  3UQB A;  1V1P B;  2I1K A;  2L00 B;  2L3Z A;  2KN5 A;  2BWF A;  2JT4 B;  3I3T B;  1YQ3 B;  1WM3 A;  2KN4 A;  4TSS A;  1FXA A;  1WY8 A;  3R66 C;  3AUL A;  3L16 A;  4MAC A;  2I2Y A;  1CQV A;  3RUL A;  4MM3 B;  1L0Y B;  3AE9 B;  3AI5 A;  2KYW A;  3PZ7 A;  2K3U A;  4RGM A;  3QAR A;  5IA7 A;  4ZYN A;  3QHT A;  3BYY B;  2EMT A;  2KX0 A;  3PZD A;  2UWQ A;  1P1A A;  4ZRJ A;  2LHD A;  3AE7 B;  1F2R I;  1V49 A;  4JL9 A;  1RLF A;  1HEZ E;  4C00 A;  5KHO A;  2PTL A;  2V9H A;  1EUV B;  2L0T A;  1MI0 A;  2G45 B;  2RDB C;  4ZRK A;  3SFD B;  3A9J A;  2MLB A;  1JWB D;  3VRA B;  2N9K A;  4BKS A;  2UYZ B;  3Q2A C;  4K81 A;  3IFW B;  3AV8 A;  3JSV B;  4WQO B;  3HHM A;  4II2 B;  1P0R A;  3R2I A;  4JPS A;  2LJI A;  2JZ3 B;  1ISN A;  1A70 A;  4M01 A;  4W9L A;  2NCN A;  2WHI A;  1QLB B;  4HVB A;  1WR1 A;  2V3S A;  3H1U A;  4KKI A;  2B3A A;  3EGR A;  1TGZ B;  2K39 A;  2DZJ A;  3JW0 X;  4JIO U;  2JWZ A;  5JHB A;  4HPL B;  4ARI A;  1PGX A;  3PS6 A;  2DAJ A;  3ZNH B;  3DQV A;  2GBJ A;  1WSP A;  3A4R A;  4C80 A;  3TCA A;  3TUO A;  3P42 A;  3VTV A;  2AEH A;  3SHQ A;  2FAZ A;  4NAW A;  1TBE A;  2WU2 B;  1WH3 A;  1SEB D;  5BYS A;  4ZRI A;  2DEN B;  2LUM A;  1FIQ A;  3E9S A;  3JYU A;  3B1L X;  3APC A;  2V0G A;  3IG3 A;  2JU6 X;  2JSV X;  2K0P A;  3TIX A;  1WE7 A;  2INN E;  2LGX A;  1E8Y A;  1FEH A;  3MP9 A;  4ANU A;  2L76 A;  4IKG A;  2Z0D B;  2KX3 A;  1WFY A;  3VQI A;  1KLU D;  2MJD A;  3TMP B;  4KGS A;  2KC1 A;  4KIK A;  3AE5 B;  2M19 A;  2N1V A;  2KZR A;  2DLB A;  2WU5 B;  3QK0 A;  4FBJ B;  1WGH A;  1T0R C;  3U7Z A;  2M1M A;  3WAP A;  2GOW A;  2OHF A;  2LD9 A;  2WXQ A;  4B6W A;  1UUP A;  2PPH A;  3VH3 B;  3RD2 A;  4ANW A;  3FIL A;  2FE8 A;  1P3Q U;  4LDT B;  1QF6 A;  2N7J A;  2O6V A;  1R4N B;  2MP2 B;  3PV1 A;  2C7M B;  4GU2 A;  3RNG C;  3W1S A;  1GPX A;  3V3X A;  3ZNG C;  1OEY A;  3U30 A;  3L4P A;  1QOG A;  3R7Q A;  4WJP A;  1TS4 A;  2O6V D;  1DOX A;  1LQB A;  2KTR B;  2ZVN A;  3TEW A;  1LM8 B;  5E6N A;  4Q2J A;  3A9K B;  3QC8 B;  1F52 A;  2DZI A;  1PUT A;  4NNJ B;  1E9M A;  3R3M A;  5IN7 A;  1WGK A;  4HKQ A;  4W9C A;  1IBX B;  2V4I B;  1WX8 A;  3OWE B;  2LVO A;  1YN3 A;  4RGT A; 
#chains in the Genus database with same CATH homology
 3ZTC A;  1JRU A;  1LXD A;  4MGI E;  2BYF A;  2HD5 B;  4B95 A;  2C7N B;  2WX1 A;  3SD5 A;  3ZDT A;  5AZG A;  3B0A A;  2ZJD A;  4KZ0 A;  3ZO5 B;  4AUQ C;  4I6P A;  2REX A;  2KXJ A;  5CHV C;  2KFK B;  2GMI C;  3BIN A;  3HM6 X;  4GSW A;  1Y8R C;  4M8M A;  4PYZ A;  1P98 A;  4W9F A;  1OGW A;  3H7P B;  4K7U A;  4BOS C;  1KLV A;  1YX5 B;  3DDC B;  2XBB C;  2MBE A;  2JVC A;  1R4N I;  3KVF B;  2LAS A;  1ZGU B;  2KFK A;  2JRH A;  3MHS D;  4KSK C;  5AZH A;  3ZTD A;  2CU1 A;  1UBQ A;  2A5U A;  4RM9 A;  1EO6 A;  1H4R A;  4II3 B;  4IWQ A;  4MJS A;  3VTU A;  5DPS A;  2K8B A;  4PYU A;  3V6E B;  2LXC A;  3TL5 A;  2V1Y A;  4G11 A;  2OJR A;  2KDE B;  1Q5W B;  1XT9 B;  5J2R A;  2RSU A;  4KSL C;  2NS5 A;  2FCN A;  2HJ8 A;  3WA0 A;  1TTN A;  1WZ3 A;  2G4D B;  2JY6 A;  1V9J A;  2DAF A;  3L17 A;  4DBG A;  2IY0 B;  2PEA A;  4K7S A;  2N9E B;  2J0K A;  4KDI C;  2KTF A;  4TUU A;  2L05 A;  1GC7 A;  5HKH A;  5TR5 A;  1J8C A;  3ECI A;  4G50 A;  2KWC A;  2NBV B;  1UH6 A;  3ZNZ B;  2YVC A;  3W1Y A;  2XK5 A;  1IP9 A;  4PS7 A;  3AU5 A;  2R2Q A;  4PS8 A;  3DBH I;  4MSM B;  3U7D A;  3IVF A;  3PRE A;  3U8Z A;  3DVG Y;  4W9G A;  4WWP A;  2M8S A;  2JPH A;  1V81 A;  1WIA A;  1F9J A;  2FCQ A;  3JVZ X;  2K8H A;  2KJ6 A;  3NY5 A;  4KZC A;  3CF6 E;  3PRP B;  1I42 A;  1RFA A;  1VCB A;  1T0Y A;  4RM8 A;  3S2A A;  3RZW C;  4YL8 A;  2MBB B;  2L0F A;  3H7S A;  4LCD E;  2KMC A;  4DHZ B;  5LXI B;  2MBQ A;  5KHQ A;  4KVG B;  4MEL A;  2BPS A;  2VRR B;  3H6N A;  4AJY B;  4MGY E;  1GG3 A;  4E3C A;  3PTF C;  4GDL B;  3RT3 B;  2D10 A;  3VXW A;  4FN2 A;  2AL6 A;  1M94 A;  2GBK A;  3B08 A;  5JZE B;  4CO7 A;  2RGF A;  4HWI B;  3A1Q B;  1IPG A;  4OVV A;  4IWO A;  4GDK B;  4URK A;  5C23 A;  2NPT A;  4NY0 A;  4K7W A;  4KDL B;  3KH0 A;  4GDL A;  4HDQ A;  4IWP A;  4MGK E;  4EEW A;  4OVU A;  2V4L A;  3RYT A;  1WGG A;  1WXM A;  2HE7 A;  3SU8 X;  3PT2 B;  4HDO A;  4CYE A;  3A1Q A;  2D2Q A;  3UQA A;  5C1Z A;  4GDK A;  3TBL D;  1I35 A;  2RPQ A;  1S3S G;  2JXX A;  4BBN C;  3PRZ A;  4FJV B;  2IY1 B;  3KYD D;  2LUE A;  2N7D A;  3APD A;  4MGZ E;  4HLE A;  1NDD A;  3L0W B;  4HK2 A;  5DPT A;  3CMM B;  1XQQ A;  1WJ6 A;  2G3Q B;  3NZU A;  3GZN I;  3VFK A;  4MSQ B;  3HM3 A;  3ZKJ C;  2DZK A;  4TQ1 A;  4TKN A;  1VD2 A;  4XC2 A;  1UGM A;  3T9L A;  3VUY A;  3AU4 A;  4W9J A;  4KV2 A;  2C60 A;  2N9P C;  3A9K A;  1E8W A;  2G4S A;  2BF8 B;  3CST A;  3M63 B;  2KD0 A;  4BBN F;  5EDS A;  4DHZ E;  4FAD A;  2FCM A;  3T8M A;  2KQ7 A;  3IHP C;  3IBE A;  3X23 A;  3PSE B;  4GB9 A;  2LWP A;  2K6D B;  2EMS A;  3ML8 A;  4BKS D;  1L2N A;  2KFJ A;  1P9D U;  2PJH A;  2NVU I;  1WX7 A;  3ZLZ A;  1XD3 B;  2BWE S;  2KO3 A;  1LFD A;  2I1J A;  2DYB A;  3PVL A;  4W9E A;  1J19 A;  2CHW A;  4K1R B;  2GBR A;  4HCP B;  1R4M I;  2ASQ A;  2MA9 B;  3VUW A;  1GUA B;  4GOC A;  1OTR B;  2KQS A;  2WYQ A;  3V61 A;  3O65 B;  2PE9 A;  4I6L B;  2LVQ A;  3QWZ B;  1V5O A;  2CS4 A;  4LJP B;  2KJR A;  3OLM D;  1V6E A;  4G0N B;  4WJN A;  4JLC A;  4WWN A;  5BO4 B;  3R7R A;  1KOT A;  1NBF C;  4X57 B;  4IG7 B;  1OQY A;  3OJ4 B;  4NAW B;  5CHF A;  4FUL A;  2M17 A;  4NJ7 A;  2MWS B;  2KK8 A;  3H7P A;  3VHT C;  4PS3 A;  2ZCB A;  1E8X A;  1E8Z A;  2KOX A;  2J7Q B;  2FID A;  3P2B A;  4HXD A;  2CHX A;  1A5R A;  4IW0 A;  1Q1O A;  3KYC D;  3Q3J A;  1UEL A;  2K25 A;  1SE9 A;  1QZE A;  4ANV A;  3A33 B;  2GBM A;  2HTH A;  4ICV A;  2JZZ A;  4MDK E;  2AL3 A;  2LJ5 A;  1WZ0 A;  2K6Q A;  5GMV A;  3ZVV A;  5FR6 A;  2CHZ A;  2R2O A;  2Z0E B;  1WI0 A;  2OOB B;  3RCZ A;  4FLH A;  3HIZ A;  2KHW B;  2W9N A;  1D3Z A;  4JQW C;  2BGF A;  3QA8 A;  2LGD A;  1Q0W B;  3DVN U;  4AJW A;  1WGD A;  3PPA A;  1V2Y A;  3WAN A;  1ZW7 A;  5AEK B;  1E90 A;  2IBI B;  4TV3 A;  4P7I A;  4WWO A;  2L7R A;  1WMH B;  2J0J A;  2KJH B;  2JRI B;  3DVG X;  4NPN A;  5L83 A;  2IO1 B;  4IM3 A;  2LXA A;  1E7U A;  3EFU A;  2C5L C;  2MX2 A;  3UQB A;  2KMA A;  2I1K A;  4GXB A;  5AZF A;  2J0M A;  3NS8 A;  2L00 B;  2L3Z A;  2KN5 A;  2BWF A;  4W9K A;  4DK5 A;  2JT4 B;  3I3T B;  4NQL B;  2DZM A;  3LJ3 A;  3EEC A;  1WM3 A;  1PQS A;  3NHE B;  1WY8 A;  3R66 C;  3AUL A;  2C9W B;  3L16 A;  2LRU A;  3M3J A;  3RUI B;  1RAX A;  3RUL A;  3L13 A;  4M0W B;  3AI5 A;  3PHX B;  1MG8 A;  4GMV A;  4AWJ A;  3DBS A;  5J17 A;  2D3G A;  2AWT A;  2ZNV C;  3N3K B;  1FXT B;  2EKE C;  3QAR A;  5IA7 A;  2WX0 A;  4ZYN A;  3GOE A;  4ICU A;  3D32 A;  3TJP A;  2BYV E;  4MM3 A;  3WAO A;  3QHT A;  2EMT A;  2KX0 A;  3W1S C;  4HCN B;  5D6J B;  4EFO A;  2KC2 A;  2UWQ A;  3NOB A;  3PZD A;  4BOZ B;  4NQK E;  1P1A A;  2KLG A;  3L10 B;  2KDB A;  1K8R B;  4ZRJ A;  1C3T A;  3V6C B;  1V49 A;  4JL9 A;  1RLF A;  4M8N A;  1OEY J;  3A9J B;  4A20 A;  5KHO A;  4MH0 E;  1NI2 A;  2FUH B;  1EUV B;  3CSF A;  2L0T A;  5G55 A;  1TZ1 A;  4F1S A;  2G45 B;  3PRM B;  4ZRK A;  5E6P A;  1V80 A;  2N7E A;  1H8C A;  3ZW3 A;  3Q3F A;  3ZRC A;  2DX5 B;  2Y5B B;  2MLB A;  3A9J A;  3ZUN A;  4DDG D;  1WJN A;  4BKS A;  2N1W A;  3QCA A;  2UYZ B;  4K81 A;  3IFW B;  2D11 A;  3M62 B;  1WR6 E;  2MQJ A;  3JSV B;  1C1Y B;  3PLV A;  3K9O B;  1SIF A;  1SGH A;  3QAQ A;  4GIV A;  4WQO B;  3HHM A;  4II2 B;  3BY4 B;  3VTW A;  1P0R A;  1KJT A;  2JZ3 B;  1ISN A;  3PGE A;  2LZ6 A;  3ONS A;  1UD7 A;  3JSV A;  5JH5 C;  1WM2 A;  4WAA A;  2ZCC A;  1EF5 A;  4JGH B;  3APF A;  2DYO A;  3A4S C;  2RR9 A;  4ZDV A;  4W9L A;  2NCN A;  4IM0 A;  1E5W A;  1WGR A;  1S1Q B;  4HVB A;  1WR1 A;  2V3S A;  4FHJ A;  5CX3 A;  3H1U A;  2B3A A;  3V62 A;  4EZJ A;  2L8J A;  2LVP A;  1TGZ B;  3ML9 A;  4ASW C;  2CR5 A;  3QQ8 B;  2K39 A;  2DZJ A;  3JW0 X;  3L54 A;  4JIO U;  2JWZ A;  2KWV B;  3HK0 A;  5JHB A;  2WDT B;  4HPL B;  2M0X A;  3VAW A;  1WJ4 A;  4LJO B;  5D7G A;  3PS6 A;  2BKR B;  2DAJ A;  3SDL C;  3ZNI D;  3ZNH B;  2JF5 A;  4W9H A;  3WAM A;  1YQB A;  3PHW B;  1V5T A;  3OAW A;  4DHJ B;  4EZK A;  3DQV A;  2GBJ A;  2MBH A;  3UF8 A;  3PLU A;  4FA6 A;  3A4R A;  3LDZ E;  3TCA A;  2NR2 A;  4DWF A;  2ZPY A;  3DBR I;  2K8C A;  5CHW A;  3VTV A;  5JHA A;  2AEH A;  3SHQ A;  4XX5 A;  1HE8 A;  2A4Z A;  2FAZ A;  4NAW A;  2CKH B;  3KUC B;  4FJZ A;  1TBE A;  2ZPN A;  1WX9 A;  4HJK A;  1UBI A;  1WH3 A;  4F8C B;  4A3O A;  4IUM B;  4ZRI A;  4BKG A;  1G6J A;  2DEN B;  1GNU A;  4AOF A;  3N32 A;  4RMA A;  3JYU A;  3B1L X;  3APC A;  4EOY A;  3N30 A;  1E7V A;  3QIJ A;  3IG3 A;  2KVR A;  4MJS B;  1V86 A;  2NBU A;  4FJY A;  1WRD B;  4EZL A;  4BVU C;  3TIX A;  3RZF A;  1WE7 A;  2N4F A;  2LGX A;  1WYW B;  2WWZ A;  1E8Y A;  4ANX A;  3MTN B;  2BYE A;  4ANU A;  2L76 A;  4DHJ D;  5LLI A;  3EHV A;  2C7H A;  2Z0D B;  4KIK B;  1WXS A;  2K1F A;  2KX3 A;  1WFY A;  1Z2M A;  3VQI A;  4W9I A;  4G3X B;  4E74 A;  2AYO B;  2ZEQ A;  2IO3 B;  3WAL A;  3C0R B;  3M95 A;  1WMH A;  1GC6 A;  3TMP B;  2KC1 A;  2XK5 B;  4I6N B;  3KUZ A;  4KIK A;  4FHK A;  1X1M A;  5IAA C;  3VUX A;  4IM2 A;  1EF1 A;  2KZR A;  2N1V A;  4DDI D;  4J6I A;  1YIW A;  2JUO A;  3ENE A;  3UIO B;  3ZRF A;  2GBN A;  4WJQ A;  5J18 A;  3ALB A;  5L95 C;  3QK0 A;  1YJ1 A;  1Z5S B;  2FIF A;  3DOW A;  3UIP B;  4FBJ B;  2N9X A;  2D07 B;  4EKU A;  1WGH A;  2KNB A;  2MRP A;  3EC8 A;  4BKT A;  2KAN A;  5DPW A;  2FNJ B;  1L7Y A;  3UGB B;  2M1M A;  2O2V B;  2RD0 A;  4GGQ A;  3WAP A;  2GOW A;  4F7Z A;  2LD9 A;  3DBL I;  2O6V B;  2XEW A;  2KDF B;  4B6W A;  4XZ4 A;  2IO0 B;  3DPD A;  2PPH A;  3VH3 B;  3RD2 A;  4N9F 4;  4ANW A;  1WF9 A;  1AAR A;  1ZKH A;  2KKC A;  2LI5 A;  2MBO A;  2ZNV B;  1P3Q U;  2O2V A;  3OJ3 A;  4LDT B;  4TQ0 A;  3ZDM C;  3VVW B;  2NPT B;  2O6V A;  2ZZP B;  4WJO A;  3AXC A;  4B9K A;  2MP2 B;  3PV1 A;  4IC7 B;  2DYM A;  2ZVO A;  3X0W A;  2C7M B;  4GU2 A;  2MW5 A;  3W1S A;  1WGY A;  1GJZ A;  4DXA B;  2IZV B;  2NBW B;  1YD8 U;  2KDI A;  2MP2 A;  1OEY A;  2PE6 B;  3DVN V;  2MCN B;  3KW5 B;  3U30 A;  3ZNG C;  4AP4 C;  1WE6 A;  3H9D A;  2LGY A;  3R7Q A;  4WJP A;  4BFR A;  1CMX B;  1KM7 A;  4HPM B;  2O6V D;  5CTR C;  2IO2 B;  3KUD B;  5D2M B;  5D94 A;  2FCS A;  5E6O A;  1LQB A;  2MSE D;  4NJ6 A;  4E71 A;  2KTR B;  2ZVN A;  3DCG A;  4LDT D;  2KWU B;  1LM8 B;  1BT0 A;  3L08 A;  1WXA A;  4W9D A;  3NZS A;  3WIM A;  4MEM A;  5E6N A;  3A9K B;  3QC8 B;  2Z59 B;  4CHK A;  2QHO A;  3K9P B;  1WJU A;  2DHZ A;  2DZI A;  4EUT A;  1IYF A;  5DCN A;  3VH4 B;  4NNJ B;  3VDZ A;  2KTR A;  3QX1 A;  1RRB A;  5LXH A;  3R3M A;  4A3P A;  4W9C A;  3UIN B;  1J0G A;  2M4N A;  5G2N A;  1WX8 A;  1YX6 B;  4GN1 A;  2LRW A;  2BKF A;  1WXV A;  3V60 A;  1UZX B;  2LVO A;  3MJW A;  3ZIM A;  2IYD B;  3QJZ A;  2KLC A;  5DPR A;  2YLM A;  1U4A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...