2YLMA

Mechanism of usp7 (hausp) activation by its c-terminal ubiquitin-like domain (hubl) and allosteric regulation by gmp-synthetase.
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
529
structure length
529
Chain Sequence
GPLGSEAHLYMQVQIVAEDQFCGHQGNDMYDEEKVKYTVFKVLKNSSLAEFVQSLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDNEADGNKTMIELSDNENPWTIFLETVDPELAASGATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPVMCDRAGFIQDTSLILYEEVKPNLTERIQDYDVSLDKALDELMDGDIIVFQKDDPENDNSELPTAKEYFRDLYHRVDVIFCDKTIPNDPGFVVTLSNRMNYFQVAKTVAQRLNTDPMLLQFFKSQGYRDGPGNPLRHNYEGTLRDLLQFFKPRQPKKLYYQQLKMKITDFENRRSFKCIWLNSQFREEEITLYPDKHGCVRDLLEECKKAVELGEKASGKLRLLEIVSYKIIGVHQEDELLECLSPATSRTFRIEEIPLDQVDIDKENEMLVTVAHFHKEVFGTFGIPFLLRIHQGEHFREVMKRIQSLLDIQEKEFEKFKFAIVMMGRHQYINEDEYEVNLKDFEPQPGNMSHPRPWLGLDHFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 7
publication title Mechanism of Usp7/Hausp Activation by its C- Terminal Ubiquitin-Like Domain and Allosteric Regulation by Gmp-Synthetase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 124
structure length 529
sequence length 529
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12436 USP7_ICP0_bdg ICP0-binding domain of Ubiquitin-specific protease 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2ylmA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2ylmA02
2G45B 3VVWB 3WANA 2MP2A 1QZEA 1CMXB 1TBEA 3TL5A 2KX3A 2LASA 2L76A 2M4NA 2VRRB 4GSWA 5GMVA 2FCMA 2DX5B 3VXWA 2LVPA 2NBWB 4N9F4 4BVUC 3ZDTA 2DZKA 3EECA 3QJZA 1WGRA 1WGYA 2IO3B 2ZEQA 5G2NA 2CHWA 2UYZB 4DHZE 3UQAA 4W9HA 3RUIB 4AJYB 5IAAC 1WXAA 4I6LB 1UBIA 4CHKA 1J0GA 2M8SA 3LDZE 3W1SA 2HJ8A 1WXVA 3A9KB 4IW0A 3UQBA 4FBJB 1WE7A 1WJ6A 2A4ZA 2Z59B 3AU5A 2N4FA 4GB9A 2J0JA 2I1KA 3H7SA 2MSED 3U7DA 2C60A 2EKEC 4LDTD 4ZDVA 1WE6A 2LXAA 4FLHA 4HCNB 2LD9A 3DOWA 4DDGD 4G50A 3PHXB 4FULA 2IO1B 3GOEA 2M1MA 2D11A 2MBBB 1SGHA 2MWSB 2O2VB 3ZTDA 3H7PB 3ZVVA 1E8WA 4NJ6A 1WJUA 2DENB 4J6IA 2O6VA 2IO0B 4FJZA 4BKSA 3ML9A 5FR6A 4WJQA 2R2OA 1P0RA 4GOCA 3HM3A 2MBOA 1J19A 2ZVNA 2C5LC 3ZUNA 3A9JA 2N9XA 1V2YA 3ZIMA 2NR2A 4MELA 4JIOU 2N1WA 4KIKB 4LCDE 5D6JB 2L8JA 4KSLC 3UGBB 3PLUA 2L0TA 4EKUA 4WWOA 3NZSA 2XEWA 3A4RA 2V1YA 3NOBA 5CTRC 4ZRIA 4ZYNA 1GJZA 1RAXA 4IM2A 5AZGA 2CR5A 4MGKE 4EZJA 2DYBA 3D32A 4GDLB 1UH6A 3DVNU 3T8MA 1JRUA 4FHJA 2G3QB 4K7UA 5KHQA 3QIJA 4BBNF 2D07B 4G11A 3ENEA 3KUDB 3CMMB 3C0RB 2JZ3B 4BOSC 3VUYA 2HD5B 3V6EB 3VQIA 1T0YA 1UZXB 5G55A 5LXHA 2D10A 1M94A 1WI0A 2N7EA 1WMHA 3CSFA 1LFDA 2MW5A 2N9EB 2W9NA 2BWES 2KKCA 1WRDB 2FUHB 2C7HA 1V6EA 3QCAA 3PS6A 4W9FA 5EDSA 4K1RB 1SE9A 4GXBA 3IG3A 1EO6A 3DBHI 1E8XA 3M3JA 2IY1B 3OAWA 2JXXA 1S3SG 4EZLA 2OJRA 5DPSA 4EEWA 3PHWB 2K39A 1AARA 4OVUA 1HE8A 1D3ZA 2JVCA 2JT4B 4W9IA 5DPTA 2LWPA 2KDIA 3HM6X 5D94A 4KDIC 3NHEB 3KVFB 3JSVB 3TMPB 4F1SA 2IZVB 2MX2A 3A1QB 4BFRA 5HKHA 1F9JA 2EMTA 3KH0A 2KANA 3WAMA 3M62B 3RULA 1YIWA 4TQ0A 4LJPB 1KM7A 2B3AA 2D3GA 4KVGB 4MDKE 4MGYE 3IFWB 1H8CA 2GBKA 4GDLA 4HVBA 4TQ1A 2FAZA 4WAAA 4MSMB 3V60A 3MTNB 3HIZA 3APFA 3QWZB 2LI5A 4E3CA 1WGHA 2HE7A 5E6OA 2L05A 2KX0A 3H1UA 4RM8A 2KFJA 5AZHA 4GIVA 5CHWA 4BKGA 2JWZA 4DHZB 2WWZA 4AJWA 4URKA 1XD3B 3T9LA 4K7SA 2KK8A 2KHWB 3PRMB 5IA7A 3H9DA 3PVLA 3A33B 1Z5SB 1WY8A 5J2RA 4HPLB 4B95A 1SIFA 2NPTB 3DBRI 3L54A 3L16A 3OLMD 2R2QA 3H6NA 3L0WB 4W9CA 3W1YA 1X1MA 4DK5A 2KTRA 3U8ZA 4NAWB 4P7IA 3SU8X 3UINB 3PLVA 2OOBB 3DCGA 4MJSB 2K8HA 4KV2A 2KLCA 1WR1A 2WDTB 4PYZA 2GOWA 4JLCA 4EZKA 3N30A 1WX8A 1G6JA 4LJOB 4KSKC 2K6QA 3WA0A 3DQVA 4ICUA 2MA9B 1LM8B 2RR9A 3BY4B 2CHXA 2GBRA 2KTFA 2G4DB 3A4SC 4GDKA 4HDOA 4MSQB 4EUTA 3R7RA 3K9PB 4JGHB 3HK0A 2JY6A 2J7QB 2REXA 3APDA 3V61A 4B6WA 5D2MB 2KO3A 4HXDA 4OVVA 1GC6A 2BGFA 2ZJDA 3QQ8B 3PV1A 2RSUA 1V86A 3RZFA 1YX5B 1E8YA 2ZPYA 4WJPA 3TCAA 4DWFA 1YX6B 1P98A 2RD0A 3L10B 4HDQA 4ANXA 3KUCB 2JF5A 2L7RA 2M17A 4IWQA 4NPNA 4TUUA 4WWPA 2JRHA 2KJ6A 1KLVA 1C1YB 2K6DB 4DXAB 4NY0A 1LXDA 2YLMA 1GC7A 3DDCB 2CHZA 4DBGA 2QHOA 4WJOA 2MRPA 4II2B 2NPTA 1TZ1A 2KMAA 4PYUA 4WWNA 3ALBA 3ZNZB 2XK5B 1E8ZA 2KNBA 3CSTA 3CF6E 1WXMA 1P1AA 4NAWA 5KHOA 3PPAA 5L83A 4HLEA 2DZIA 2PJHA 1WIAA 3Q3JA 4ANUA 3R66C 2ZNVB 3PRPB 5JHAA 5LXIB 4K81A 3UIPB 3VDZA 1Q5WB 2EMSA 1IYFA 1ZGUB 5JH5C 2LJ5A 3A9KA 2N1VA 2L0FA 2LXCA 3KYDD 4JQWC 2ZNVC 2Y5BB 4XZ4A 3PREA 4G0NB 4IWPA 5L95C 5E6NA 5J18A 1OGWA 2ZPNA 3ZNGC 3ZNID 4AP4C 3PGEA 1WM2A 2LRUA 2BPSA 1S1QB 1XQQA 2ASQA 3B08A 2O2VA 4MEMA 3H7PA 1E90A 1Z2MA 3O65B 2L3ZA 4FJVB 3L17A 4PS8A 2KDFB 2AEHA 3SD5A 4B9KA 4BOZB 1V80A 1C3TA 4W9LA 4HJKA 2ZCCA 3QARA 3B1LX 4CYEA 3V6CB 2MLBA 2CS4A 4W9GA 1WH3A 3PZDA 4KZ0A 3QX1A 1WX9A 4KIKA 5CX3A 2NVUI 5AZFA 3AI5A 4W9EA 2MP2B 2C7MB 3KUZA 3RYTA 2GBJA 1A5RA 4ANWA 1NBFC 2V4LA 4GN1A 3JYUA 2BKFA 1P9DU 1BT0A 2FCQA 2KQSA 2ZCBA 1WF9A 3L13A 2DHZA 3P2BA 3TJPA 4AWJA 1L2NA 3AXCA 3VFKA 4IM0A 2KMCA 1I35A 3UF8A 3OJ3A 3ONSA 4BKTA 2WYQA 5D7GA 2DZMA 2KD0A 1E5WA 3RCZA 3ZDMC 4GMVA 1RRBA 2ZZPB 1GNUA 4FN2A 2KDBA 4MGIE 2Z0EB 4HPMB 3ZRCA 4IM3A 2KOXA 5BO4B 4DHJB 1V49A 2FCNA 2DYMA 2IY0B 3X23A 1VCBA 1VD2A 4WQOB 3KYCD 5CHFA 1TGZB 3SDLC 2NBVB 2IO2B 1UD7A 4ZRKA 3R3MA 5LLIA 3S2AA 1WZ3A 2BYEA 2ZVOA 4NNJB 3QC8B 2O6VB 2C9WB 2PE9A 4JL9A 1WZ0A 2RGFA 3SHQA 3ML8A 3QA8A 3PSEB 4FHKA 4FA6A 1ISNA 2LVQA 2KC2A 1ZW7A 1TTNA 4GU2A 2D2QA 3JSVA 2UWQA 1UBQA 3A1QA 3A9JB 2MBHA 4KDLB 1P3QU 2KQ7A 2LGDA 2K1FA 4ICVA 1NDDA 2BWFA 2KVRA 3IBEA 2V3SA 4ZRJA 2BYFA 4XC2A 2M0XA 1WJNA 1R4NI 2NCNA 1Q0WB 4MGZE 1V81A 2CU1A 1RFAA 2KDEB 3PT2B 2DAFA 2KWVB 2AWTA 3AU4A 4W9DA 4IC7B 1EF5A 2JZZA 2MBEA 3M63B 3M95A 2LRWA 3DBSA 3IHPC 3NZUA 3WALA 1IP9A 4M0WB 4E74A 5JHBA 4F7ZA 3EC8A 4FJYA 4GGQA 4DHJD 2G4SA 2LGYA 1RLFA 2FNJB 2GBNA 2KZRA 2YVCA 3QK0A 4NQKE 2MCNB 1Y8RC 2KN5A 2PE6B 2XBBC 3RT3B 3PTFC 3APCA 1OEYA 1WMHB 2O6VD 3NS8A 1WFYA 4BKSD 1U4AA 4E71A 2AL3A 1L7YA 2NBUA 3VTVA 2WX0A 1GG3A 3DPDA 1IPGA 1E7VA 3RD2A 3BINA 3N32A 2FIDA 2Z0DB 2J0KA 2JRIB 4W9KA 2N9PC 4A3OA 4MJSA 2LGXA 1YD8U 2GBMA 1NI2A 1OTRB 2KXJA 2WX1A 4ASWC 2L00B 4IG7B 5C1ZA 1XT9B 2N7DA 3VAWA 1YJ1A 3HHMA 4TV3A 2HTHA 4RM9A 3WAOA 3ZNHB 4MH0E 4ANVA 2FIFA 3KW5B 3VHTC 1V9JA 3VUWA 2FCSA 4NQLB 1J8CA 3OJ4B 3TBLD 4AOFA 2JUOA 4IWOA 2KFKB 2PPHA 3JVZX 1H4RA 3DVGX 4PS7A 1OQYA 3QAQA 5E6PA 3K9OB 1MG8A 3JW0X 3L08A 3MJWA 5DPRA 3NY5A 2K25A 3DBLI 5TR5A 4AUQC 1WR6E 2DAJA 2CKHB 1UELA 3LJ3A 2KWCA 4CO7A 1LQBA 2IBIB 2AYOB 2PEAA 4YL8A 3RZWC 3MHSD 4FADA 3B0AA 3IVFA 5J17A 3ZW3A 1K8RB 4HK2A 4RMAA 5CHVC 1KJTA 1WYWB 5DCNA 3VTUA 3N3KB 4W9JA 3ZLZA 3U30A 1OEYJ 4HWIB 2IYDB 2C7NB 1EF1A 2KJHB 2XK5A 2KC1A 2LZ6A 3TIXA 5DPWA 4BBNC 4K7WA 1FXTB 3VTWA 3VUXA 3ZTCA 4A20A 3PRZA 3I3TB 2KTRB 2MBQA 1EUVB 1WX7A 3X0WA 1YQBA 2A5UA 3ECIA 3R7QA 4M8MA 3EFUA 1WGGA 1E7UA 4I6PA 3EHVA 1R4MI 1UGMA 1V5OA 2AL6A 2LUEA 4X57B 3ZKJC 4I6NB 3V62A 1WXSA 2BKRB 4M8NA 1KOTA 1WGDA 2DYOA 2GMIC 2K8BA 3DVGY 4GDKB 3VH4B 4MM3A 4II3B 1V5TA 3W1SC 2KFKA 4HCPB 3ZO5B 2KLGA 3AULA 3GZNI 5JZEB 3DVNV 1GUAB 2LVOA 4WJNA 1WJ4A 1I42A 3Q3FA 2JPHA 4PS3A 4XX5A 4DDID 2DZJA 1WM3A 2I1JA 4LDTB 2J0MA 4TKNA 2MQJA 4KZCA 5C23A 4NJ7A 2BYVE 4F8CB 3WIMA 2NS5A 4IUMB 2RPQA 3UIOB 2K8CA 2KWUB 1PQSA 1ZKHA 2BF8B 4G3XB 3QHTA 4EFOA 2KJRA 4EOYA 3WAPA 1Q1OA 3VH3B 3ZRFA 5AEKB 4A3PA
chains in the Genus database with same CATH superfamily
2G45B 3WANA 2MP2A 2W82A 1TBEA 1JWAD 2L76A 2VRRB 2WDRB 2FCMA 4RNAA 3AB5A 3ZDTA 2IO3B 3UQAA 4W9HA 4AJYB 5IAAC 1UBIA 1FD6A 3UQBA 4FBJB 2QSDA 4GB9A 1XLNA 2J0JA 3H7SA 4ZYSA 2MSED 1N61A 1WWTA 4DDGD 4G50A 1PYWD 4FULA 3GOEA 2M1MA 2O2VB 3H7PB 4BKSA 4WJQA 3L4PA 3TSSA 2ONQA 2WXJA 2PKOA 2N1WA 4KIKB 2RDGA 4XYCA 5H8YE 3UGBB 1NEKB 4RCOA 3NZSA 3A4RA 1XCTL 3NOBA 4ZYNA 2IJ0A 3Q3NC 4IM2A 4GDLB 5HG2A 1UH6A 2H89B 3IT6B 1TKEA 4ZRPA 2D07B 2JZ3B 2DLBA 2BB5A 3V6EB 1T0RC 1UZXB 1WMHA 2MW5A 2QIEB 3U52E 2W9NA 2LMCA 2KKCA 3NRZA 1WRDB 2J42A 3PS6A 2GRIA 4K1RB 1SE9A 4GXBA 1I4RA 3M3JA 3OAWA 1LGRA 4EZLA 4C80A 2OJRA 3HVZA 2RPVA 4OVUA 1NYRA 2JVCA 4ARCA 1JWMD 1NYQA 4W9IA 2KDIA 3HM6X 5D94A 4KDIC 4F1SA 3KVFB 5BYSA 2YEPF 4BFRA 5HKHA 2IGHA 5H92C 1DOIA 1YIWA 4TQ0A 1KM7A 2B3AA 2D3GA 3IFWB 3I63C 4HVBA 2QILA 2FAZA 1LO5D 4WAAA 1EU3A 4E3CA 1WGHA 5E6OA 2KX0A 3H1UA 2KFJA 4DHZB 2GI9A 4K7SA 5D3DA 2KHWB 3H9DA 3PVLA 3OWEB 1SIFA 3L54A 2R2QA 4OZBA 4A55A 3PO0A 2KTRA 1SE2A 1Q10A 3DCGA 2K8HA 4KGRA 4KV2A 2WDTB 1YQ4B 2GOWA 4QAYA 2AQ2B 1MI0A 1G6JA 3AEEB 4ICUA 2XNAC 2RR9A 4EUTA 2G4DB 2MJEA 4JGHB 2JY6A 4LNNA 3GE3C 3AE2B 2BBCA 3PV1A 1E8YA 3TCAA 4DWFA 4XWWA 3L10B 4US9A 2JF5A 2L7RA 2M17A 3BYYB 4IWQA 4WWPA 1RWSA 2MHJA 2Y5PA 4DXAB 4NY0A 1LXDA 4C4VB 3DDCB 2QHOA 3HUIA 2LEKA 1TS2A 2NPTA 1TZ1A 4PYUA 3ZNZB 2XK5B 1E8ZA 3CSTA 3CF6E 1WXMA 4NAWA 5IO9A 3PPAA 2DZIA 1ZXIA 2ZNVB 2EMSA 4AS1A 3TEXA 5EE1A 1R4MB 5E6NA 3Q2AC 5J18A 1CQVA 3B2FA 4MM3B 1C4AA 1I4PA 2N9KA 2D5GA 2LRUA 2BPSA 3MC8A 4MEMA 2K5PA 1Z2MA 3NVYA 1KRHA 1FIQA 4PS8A 3SD5A 1ZP0B 2BT6A 1V80A 1V1PA 4ITKA 3V6CB 3AE9B 4P6VF 3PZDA 3QX1A 4D2KA 1N62A 1V97A 4ANWA 1NBFC 5EE0A 1B9RA 1L4DB 1P9DU 2KN4A 2ZCBA 1WF9A 3L13A 2DHZA 4AWJA 4IM0A 2KMCA 1D5XC 3OJ3A 3BK1A 2DZMA 1E5WA 1KFYB 4GMVA 4HPPA 4HPMB 2DWQA 2JU6X 3NVWA 2FCNA 5GXGB 2DYMA 1IBXA 4WQOB 1QKZA 3S2AA 2O6VB 3R2TA 2C9WB 1ET6A 3SHQA 2XN9C 3QA8A 4FHKA 2Y3AA 4GU2A 2D2QA 2UWQA 1UBQA 1OQRA 4KDLB 2LGIA 2WXHA 3VRAB 2KVRA 2M0XA 1WJNA 4WQMA 2NCNA 1Q0WB 5FR3A 4MGZE 1V81A 2CU1A 2DAFA 2MBEA 2LRWA 2L83A 4E74A 2D3CA 1EWYC 3B9JA 4DHJD 2G4SA 1K51A 2FNJB 2GBNA 2KZRA 2MCNB 3R2IA 2PE6B 3RT3B 2J53A 3APCA 2ZW0A 4BKSD 2WX0A 1GG3A 2BS2B 3RD2A 4ZHPA 2JRIB 4W9KA 2N9PC 1C4CA 2GBMA 3FILB 2WX1A 3PZ7A 2JZPA 2IPKD 3HHMA 4TV3A 2HTHA 4RM9A 3ZNHB 4ANVA 2L52A 3Q8AA 2PVGC 4L2YA 4AOFA 2JUOA 3JVZX 3ZYYX 1EM7A 2L1AA 1YJIA 3NY5A 3VRBB 2K25A 1YOVB 2GB1A 4K3BA 1HQRD 2CKHB 3LJ3A 2KWCA 4R3DA 2AYOB 3RNFC 4RMAA 2JX5A 1KJTA 5DCNA 3ZLZA 5G5GA 5BMIA 2SAKA 3RPFC 4NAMA 1EF1A 2KJHB 2WXRA 4HRSA 1JRPA 4A20A 1FXTB 2I2YA 3X0WA 4DXFA 1ZDVA 1VZ6A 3EFUA 3TEZA 1WGGA 1E7UA 4I6PA 3EHVA 3P4SB 2BKRB 1JCKB 1WGDA 2DYOA 2V3NA 1JWSD 2LUMA 3RN9C 2MJDA 1PUTA 3W1SC 4BAXA 4P16A 2KLGA 3GZNI 5JZEB 2JQRB 1WJ4A 1UNSA 1PFDA 2JPHA 4PK1A 3WCQA 4PS3A 2WQYB 1WM3A 4YSYB 1T6BX 5TSSA 1PGXA 4OZAA 2BB6A 4RGTA 2W55A 2KJRA 4RGOS 5FKAC 4A3PA 1CMXB 4GSWA 3VXWA 2UU7A 1FRRA 2PLPA 2CHWA 4EE2A 3Q14C 3LYYA 1WXAA 4I6LB 1J0GA 2MEKA 3W1SA 3TUOA 3A9KB 2N4FA 1EWCA 1VDVA 2I1KA 2Z8LA 2JYEA 3E9SA 2EKEC 1WE6A 2LXAA 3PHXB 2MH7A 5EE3A 1BMLC 1SGHA 2WXNA 4JWUC 3ZTDA 1WJUA 4J6IA 4FJZA 2IO0B 2EELA 3ML9A 2WXPA 4S0RA 1JMLA 1KLGD 5FR6A 3TEYA 4GOCA 3HM3A 1J19A 3A9JA 1V2YA 2WXGA 3ZIMA 2NR2A 4MELA 5FK9C 2OHFA 2J4XA 1JWUD 3MC9A 3AH7A 2AQ1B 1V1OA 2X38A 4DXGA 2I38A 4ZRIA 1GJZA 5AZGA 2CR5A 4MGKE 1SJED 3T8MA 1JRUA 3KWLA 4K7UA 1AN8A 1TZOA 1DGJA 5KHQA 3QIJA 1XO3A 3CMMB 1MVKA 3C0RB 3VUYA 3VQIA 1T0YA 3EGRA 5G55A 5LXHA 2D10A 3CSFA 5BYRA 2N9EB 2BWES 2FUHB 2C7HA 2J52A 1V6EA 4W9FA 3DBHI 1E8XA 2JXXA 1F1HA 1N5WA 4EEWA 3KLSX 1AARA 1HEZE 2N0SB 5DPTA 2LWPA 3NHEB 3JSVB 3AE3B 2IZVB 2MX2A 3A1QB 1YMHE 2EMTA 2E6XA 5IOIA 3RULA 1H8CA 4GDLA 4TQ1A 3V60A 1KF6B 3APFA 3V05A 4N58A 2LI5A 2HE7A 2L05A 5AZHA 1PGAA 5CHWA 4BKGA 4URKA 1XD3B 1CK1A 3PRMB 1FCLA 3A33B 4YSXB 5J2RA 1SB3C 3L0WB 3W1YA 1OFFA 4DK5A 4P7IA 3UINB 3PLVA 1AYFA 3GP7A 4RF0A 1WX8A 3RNBC 4KSKC 2MA9B 1LM8B 4RH6A 4WIPA 2GBRA 4GDKA 4XDDA 4MSQB 3R7RA 3HK0A 4UDUC 4YSZB 4HXDA 1TKYA 3AM9A 3AN1A 4HJGE 1T0SC 3I9V1 1N6ZA 4WJPA 2RD0A 3V3XA 1DOXA 1KLVA 2K6DB 4B0EA 2VH2A 4P1CC 2YLMA 1V8CA 3BVMA 1R7SA 5C3JB 3N1XC 2KMAA 4XGAB 4WWNA 2AX5A 3ALBA 1L5PA 2FE8A 1P1AA 3Q3JA 3GE8C 5JHAA 1XLQA 1ACCA 2DNFA 1FRDA 3VDZA 3AE1B 5JH5C 2LJ5A 2ZNVC 1TY2A 2Y5BB 4XZ4A 2Y5CA 5L95C 1VJKA 1OGWA 2ZPNA 1FNUA 1AW7A 1S1QB 3B08A 1SEBD 2L3ZA 1M4VA 2KDFB 2QC8A 2KMMA 4B9KA 2ACZB 1C3TA 3B2GA 2WXOA 4HJKA 2IDYA 2WS3B 1QOFA 4CYEA 1F77A 3ABVB 4KZ0A 1CJEA 3P1MA 5CX3A 2NVUI 2MP2B 3RNCC 2GBJA 3U2SC 1XXGA 4GN1A 4WWMA 2BKFA 1L6VA 1PGBA 1D6EC 1TYGB 1ENFA 1SE4A 2KD0A 2K9XA 3P63A 3ZDMC 2KQ4X 3DHIC 1RRBA 1XEEA 1TY0A 4FN2A 2KDBA 4MGIE 4L1BA 1DYQA 4US8A 1YNTE 4IM3A 2KOXA 3MC0B 4DHJB 2IY0B 3DHGC 5CHFA 1L0YB 3SDLC 1HTQA 4ZRKA 5LLIA 1TS4A 3QC8B 2PE9A 4JL9A 1WZ0A 1D5ZC 4ZOHC 4FA6A 3MFGA 1ISNA 5JXVA 1UGJA 2LVQA 4N59A 3W2DA 4Q2JA 1ZW7A 1TTNA 2KQ7A 1TS5A 2K1FA 4ICVA 1SF0A 3AEDB 2V3SA 4ZRJA 2BYFA 1E6EB 4OW0A 5HFYA 2JZZA 3M63B 2INPE 3WALA 4M0WB 5BYQA 3U4EG 5JHBA 3EC8A 1RLFA 1Y8RC 2KN5A 2XBBC 4JE3B 1WMHB 2Q5WD 3VTVA 2PMVA 1IPGA 2Z0DB 4RFBA 4LLGM 4MJSA 1NI2A 1XF5L 4ASWC 2CJOA 3BVGA 5C1ZA 1XT9B 2N7DA 1HXYD 1YJ1A 1Y56A 4MH0E 2FIFA 1I4HA 3VHTC 1ZDXA 2FCSA 1J8CA 1C76A 2VH1A 1ZOYB 2KFKB 1UWXA 4PS7A 3K9OB 3JW0X 3L08A 3RNEC 2WXKA 1SE3A 4N6EB 2DAJA 3MJ5A 3NG0A 2D3BA 1UELA 2KDMA 1LQBA 2QEJC 1TT5B 4P1BC 2K0PA 3B0AA 5J17A 1MPEA 1WYWB 1P7EA 1MFWA 3U30A 2K22A 1OEYJ 4HWIB 1UUPA 2C7NB 1YN3A 3RNGC 2KC1A 2LZ6A 3P4QB 2BS3B 3N20C 4S17A 3I3TB 2KTRB 1K50A 2MBQA 1EUVB 1WX7A 3KWVA 2A5UA 3P4PB 4KKJA 3R7QA 4KGTA 1R4MI 2LUEA 4I6NB 4XE0A 2BW2A 1XLPA 3P4RB 2GMIC 2QJLA 4II3B 1XLOA 4YT0B 2QMTA 2GLSA 1GUAB 1I42A 1RM6C 2DZJA 3AE8B 5IKCM 2BYVE 4F8CB 2K8CA 2BF8B 3CWIA 2M56B 1HZ5A 1Q1OA 3ZRFA 3VVWB 3AE4B 4ACFA 2LASA 3AECB 2LVPA 4K3CA 4BVUC 2LHDA 1MG4A 2DZKA 3EECA 3QJZA 1WGRA 2ZEQA 1D4BA 2RDHA 4CHKA 1ZXHA 2M8SA 3LDZE 2HJ8A 1WXVA 4JWSC 1WE7A 1WJ6A 2Z59B 4MH8A 1F0ZA 2G1EA 3U7DA 2INCC 4YXDB 2W3SA 1VZ7A 1RFKA 2FUG1 3N1YC 2IO1B 2D11A 2MWSB 3ZVVA 3VR8B 4OHJA 1V1PB 2HTME 3H8HA 1P0RA 1IGCA 2MBOA 3BVZA 5LNK1 2ZVNA 2C5LC 2N9XA 4JIOU 3EFCA 4LCDE 3W9CB 5D6JB 2L8JA 4KSLC 3PLUA 4EKUA 4WWOA 5CTRC 3EA6A 1WGKA 3D32A 3AE5B 2IGDA 3DVNU 3AE6B 1T0QC 4BBNF 4G11A 3BIID 1ZE3D 1YN5A 2HD5B 1M94A 1I7HA 1WI0A 3C19A 3ZGZA 1IBXB 5EDSA 1EO6A 4DQOC 1S3SG 3DBRB 1N60A 4NJCA 3Q69A 1ET9A 2N7JA 3PHWB 3RNAC 1YQ3B 3FAHA 2ICIA 2BYTA 4H2AA 2KANA 3WAMA 2ON8A 4LJPB 4KVGB 4MDKE 1F2RC 4IKGA 2GBKA 4L23A 1R4NB 4OZCA 4MSMB 3HIZA 3QWZB 4USAA 1FO4A 4GIVA 1PDXA 4AJWA 2KK8A 5IA7A 4YTNB 4JPSA 1B1ZA 2LGSA 4B95A 3DBRI 3O13A 1YJJA 3SU8X 1GOZA 4EZKA 4LJOB 2K6QA 3WA0A 1C9FA 3DQVA 2CHXA 4HDOA 2WNMA 3K9PB 4XWTA 5HHDG 1STEA 4A9AA 1GC6A 2ZJDA 1YX5B 5E6JA 2ZPYA 1YX6B 1P98A 2WDVB 1NVID 3KUCB 4NPNA 2V3PA 2JRHA 3BZDB 2SEBD 2R61A 2KT7A 1GC7A 1TJEA 2WLBA 2CHZA 4LK0M 1GPXA 3NVZA 4WJOA 2L32A 2MRPA 2X8XX 1WYGA 2BVCA 3FKYA 2KNBA 5IN7A 5KHOA 5L83A 1FPYA 4ANUA 2PJHA 1WIAA 3PRPB 1JQ4A 2WGSA 3UIPB 5AUIA 2K3UA 3Q8EA 2WDQB 1JWBD 4HKZE 3KQ4A 3NVVA 2L0FA 3KYDD 4JQWC 1TS3A 3ZNGC 3ZNID 4AP4C 4REZA 1VLBA 2H88B 2O2VA 3H7PA 4YWGG 3O65B 1RYJA 4FJVB 3L17A 1WSPA 2V0GA 4W9LA 1SXTA 2MLBA 4W9GA 1WH3A 2AQ3B 1WX9A 4IDIA 4KIKA 3AI5A 4W9EA 3SR6A 2C7MB 3KUZA 1DOYA 3RYTA 1A5RA 3OG5A 2V4LA 3AEBB 1BT0A 2KQSA 1FEHA 2KAJA 2WXLA 3FC4A 3W5VB 3UF8A 4BKTA 1VZ8A 3RCZA 1GNUA 4MACA 5BO4B 1V49A 1VCBA 1VD2A 2MJ3A 3KYCD 1TGZB 1K52A 1UD7A 1WZ3A 2BYEA 2ZVOA 4NNJB 3Q8CA 2OEDA 4YTPB 5HI1A 1E10A 3C8YA 4KX6B 1F2RI 1IUEA 3A9JB 2MBHA 5AUKA 2LGDA 1NDDA 2BWFA 2WXIA 3NJTA 1L0XB 4XC2A 4GLSC 1RFAA 2KDEB 3PT2B 2KWVB 3AU4A 4W9DA 4IC7B 3M95A 3NZUA 3DBSA 1MHHE 1JALA 3DBLB 1I4QA 4FJYA 5EE9A 3AEAB 4NQKE 3QK0A 4XDCA 1OEYA 3EUB2 5BMGA 1I4XA 1WFYA 1FXIA 4E71A 2AL3A 1J7CA 4NZLB 2NBUA 3DPDA 3BINA 3N32A 2FIDA 2LFIA 4A3OA 1YD8U 2N9LA 1L6UA 3E56A 2L00B 2D3AA 3IAS1 5BMHA 3Q3OC 4TMAB 4C56C 1C4PA 1V9JA 3VUWA 4PT5A 3TBLD 2JXTA 4IWOA 2PPHA 3DVGX 1OQYA 3QAQA 1MG8A 5DPRA 3DBLI 5TR5A 4M0WA 4AUQC 1WR6E 2RMMA 2WXFA 4CO7A 2PEAA 4YL8A 1FXAA 3IVFA 4C4VA 3ZW3A 1K8RB 3VTUA 3N3KB 2IYDB 2M0AA 2M19A 1NI3A 4KKIA 1C79A 2VZKD 2XK5A 2IGGA 3TIXA 3NZ3A 1SSNA 3BWUD 4BBNC 4K7WA 3ZTCA 2LHEA 3PRZA 1YN4A 1YQBA 3ECIA 3ETRA 1UGMA 2EKIA 3HVDA 4X57B 3ZKJC 2WXQA 4M8NA 1E9MA 2QCZA 5MPOA 2K8BA 3DVGY 4GDKB 3VH4B 4MM3A 5I4DA 3R8BA 1V5TA 3Q6BA 2KFKA 4HCPB 1KLUD 3DVNV 2LVOA 4WJNA 4C7YA 4DDID 2I1JA 2J0MA 2MQJA 1E7PB 3BYTB 4NJ7A 3WIMA 2NS5A 3UIOB 1PQSA 1AWDA 4G3XB 3QHTA 1A70A 2KWDA 4AQ7A 3VH3B 5AEKB 4OVZA 2PVOD 1QZEA 3TL5A 2KX3A 1I4GA 2M4NA 2TSSA 5GMVA 1E0ZA 2DX5B 4A6QA 2NBWB 4N9F4 1N63A 4M02A 3Q8FA 1WGYA 5G2NA 2UYZB 4DHZE 3RUIB 3RFZB 2KACA 4IW0A 1N5XA 1D5MC 2A4ZA 3AU5A 3ZXRA 2C60A 4LNKA 4LDTD 4ZDVA 4FLHA 4HCNB 1UWMA 2LD9A 3DOWA 2MBBB 1FFUA 1E8WA 4NJ6A 2DENB 2O6VA 4YTMB 3T3NA 3PZ8A 3I5JC 2R2OA 3ZUNA 2B76B 2L0TA 2WU5B 2XEWA 4A90A 2V1YA 4LNFA 1RAXA 3SFEB 4EZJA 2DYBA 2NTTA 1HZ6A 1GAQB 4FHJA 2G3QB 3ENEA 3KUDB 4BOSC 1FNWA 2N7EA 1LFDA 3GB1A 3Q3MC 2OJWA 3QCAA 3IG3A 2IY1B 1WRIA 4RF1A 3AMZA 3FILA 5DPSA 3ZQ4A 2V4IB 2K39A 3DWGC 1HE8A 1D3ZA 2JT4B 2WP9B 3TMPB 4ARIA 1F9JA 3KH0A 4FXCA 1XCQL 3M62B 2DBYA 1VR9A 4MGYE 2NTSA 2BS4B 3MTNB 4WAFA 2KYWA 4HKQA 2G9HD 4RM8A 1J7BA 1VRAB 2JWZA 2WWZA 3T9LA 1QLBB 4CQNA 4M01A 1FNVA 1WXQA 4LNIA 3LB8C 1Z5SB 1WY8A 4HPLB 4WURA 1QT9A 2NPTB 1NENB 3OLMD 3L16A 3H6NA 4W9CA 1X1MA 2JSVX 1GB1A 1MHXA 3U8ZA 4NAWB 2OOBB 4HEA1 4MJSB 2KLCA 1WR1A 4PYZA 4JLCA 3N30A 2KVZA 1TIFA 2FBWB 3BY4B 1F52A 2KTFA 3A4SC 2PTLA 2W54A 3CIRB 3N9YC 4RGMA 3GS2A 2J7QB 2REXA 3APDA 3V61A 4B6WA 5D2MB 2KO3A 4OVVA 3IAM1 2BGFA 3QQ8B 2RSUA 1V86A 5C2TB 3RZFA 1FFVA 1QOGA 4HDQA 4ANXA 4TUUA 2KJ6A 1C1YB 2QDFA 2INDC 3BK2A 4DBGA 1MJDA 4II2B 3IXSA 4ZHOA 3ZJVA 3DHHC 4HLEA 1IGDA 3R66C 5LXIB 4K81A 1Q5WB 1ZUD2 3Q8BA 1IYFA 1ZGUB 2WU2B 2N1VA 3A9KA 2LXCA 4M00A 3SEBA 3PREA 2CJNA 1KTKA 3P42A 4G0NB 4IWPA 1J7AA 5IP4D 1KH0A 3PGEA 2WXMA 1WM2A 3I57A 1XQQA 2ASQA 1E90A 3GZNB 2AEHA 4BOZB 3HRDD 2ZCCA 3QARA 3B1LX 4IOIE 1BXTA 2CS4A 3URYA 3AEFB 5AZFA 3W5UB 3JYUA 3U7ZA 1QOBA 2FCQA 3P2BA 3TJPA 1L2NA 3AXCA 3VFKA 2BQQA 3LXFA 1I35A 1FCCC 3ONSA 2WYQA 1TKGA 5D7GA 1QILA 4JX1C 1T3QA 2ZZPB 3NS1A 2JWUA 2Z0EB 3ZRCA 3X23A 4LNOA 2HDEA 2NBVB 2IO2B 3R3MA 1CZPA 4HROA 3IT4B 3ZJUA 3UI3A 2RGFA 3ML8A 1QOAA 3PSEB 5G5HA 3RMKC 2KC2A 3JSVA 3A1QA 1P3QU 4ZRQA 2HJ1A 1T5XD 3IBEA 3AEGB 1R4NI 3ZXVA 2ZW1A 4RGNA 3AE7B 2AWTA 1GB4A 1SJHD 1EF5A 3N1ZC 1IP9A 3IHPC 4F7ZA 4A8XC 3MP9A 4GGQA 2LGYA 2YVCA 2E3TA 1ZPSA 3TEWA 3PTFC 1C77A 1QQRA 5T8IA 2O6VD 3MHZA 1ESFA 3NS8A 1U4AA 1L7YA 2BTEA 2RDBC 1E7VA 4TSSA 3SFDB 2INNE 2J0KA 2NMQA 2LGXA 3DBHB 4LTUA 3RI7C 1FM0D 1OTRB 2KXJA 2VZKB 1P7FA 1BUIC 1L0VB 4IG7B 1K53A 3VAWA 4BZAA 4C7ZA 3WAOA 1SIJA 3J9CA 3KW5B 1SBBB 4NQLB 3OJ4B 3DWMA 1H4RA 5E6PA 2WHIA 3MJWA 1JROA 3AV8A 2IBIB 3RZWC 3MHSD 1UF0A 4FADA 1OQQA 4HK2A 5CHVC 2V9HA 5D3IB 4W9JA 2CU3A 2LJIA 4MT5A 1L4ZB 1HA5A 2PIAA 5DPWA 4J3OD 3VTWA 3VUXA 4WH4A 4M8MA 1V5OA 2AL6A 3V62A 1WXSA 4B0MA 1QF6A 2JYTA 1KOTA 2PW9A 3ZO5B 3AULA 1EU4A 1ROEA 1C78A 3NUHB 2YEPB 3Q3FA 4O1NA 4XX5A 4LDTB 1JW9D 4TKNA 4C00A 4KZCA 3ZJTA 5C23A 4KGSA 1HTOA 4IUMB 3VR9B 1FMAD 2RPQA 2W3RA 2KWUB 1ZKHA 3T3OA 4EFOA 4EOYA 3WAPA
chains in the Genus database with same CATH topology
2G45B 3VVWB 3WANA 2MP2A 1QZEA 1CMXB 1TBEA 3TL5A 2KX3A 2LASA 2L76A 2M4NA 2VRRB 4GSWA 5GMVA 2FCMA 2DX5B 3VXWA 2LVPA 2NBWB 4N9F4 4BVUC 3ZDTA 2DZKA 3EECA 3QJZA 1WGRA 1WGYA 2IO3B 2ZEQA 5G2NA 2CHWA 2UYZB 4DHZE 3UQAA 4W9HA 3RUIB 4AJYB 5IAAC 1WXAA 4I6LB 1UBIA 4CHKA 1J0GA 2M8SA 3LDZE 3W1SA 2HJ8A 1WXVA 3A9KB 4IW0A 3UQBA 4FBJB 1WE7A 1WJ6A 2A4ZA 2Z59B 3AU5A 2N4FA 4GB9A 2J0JA 2I1KA 3H7SA 2MSED 3U7DA 2C60A 2EKEC 4LDTD 4ZDVA 1WE6A 2LXAA 4FLHA 4HCNB 2LD9A 3DOWA 4DDGD 4G50A 3PHXB 4FULA 2IO1B 3GOEA 2M1MA 2D11A 2MBBB 1SGHA 2MWSB 2O2VB 3ZTDA 3H7PB 3ZVVA 1E8WA 4NJ6A 1WJUA 2DENB 4J6IA 2O6VA 2IO0B 4FJZA 4BKSA 3ML9A 5FR6A 4WJQA 2R2OA 1P0RA 4GOCA 3HM3A 2MBOA 1J19A 2ZVNA 2C5LC 3ZUNA 3A9JA 2N9XA 1V2YA 3ZIMA 2NR2A 4MELA 4JIOU 2N1WA 4KIKB 4LCDE 5D6JB 2L8JA 4KSLC 3UGBB 3PLUA 2L0TA 4EKUA 4WWOA 3NZSA 2XEWA 3A4RA 2V1YA 3NOBA 5CTRC 4ZRIA 4ZYNA 1GJZA 1RAXA 4IM2A 5AZGA 2CR5A 4MGKE 4EZJA 2DYBA 3D32A 4GDLB 1UH6A 3DVNU 3T8MA 1JRUA 4FHJA 2G3QB 4K7UA 5KHQA 3QIJA 4BBNF 2D07B 4G11A 3ENEA 3KUDB 3CMMB 3C0RB 2JZ3B 4BOSC 3VUYA 2HD5B 3V6EB 3VQIA 1T0YA 1UZXB 5G55A 5LXHA 2D10A 1M94A 1WI0A 2N7EA 1WMHA 3CSFA 1LFDA 2MW5A 2N9EB 2W9NA 2BWES 2KKCA 1WRDB 2FUHB 2C7HA 1V6EA 3QCAA 3PS6A 4W9FA 5EDSA 4K1RB 1SE9A 4GXBA 3IG3A 1EO6A 3DBHI 1E8XA 3M3JA 2IY1B 3OAWA 2JXXA 1S3SG 4EZLA 2OJRA 5DPSA 4EEWA 3PHWB 2K39A 1AARA 4OVUA 1HE8A 1D3ZA 2JVCA 2JT4B 4W9IA 5DPTA 2LWPA 2KDIA 3HM6X 5D94A 4KDIC 3NHEB 3KVFB 3JSVB 3TMPB 4F1SA 2IZVB 2MX2A 3A1QB 4BFRA 5HKHA 1F9JA 2EMTA 3KH0A 2KANA 3WAMA 3M62B 3RULA 1YIWA 4TQ0A 4LJPB 1KM7A 2B3AA 2D3GA 4KVGB 4MDKE 4MGYE 3IFWB 1H8CA 2GBKA 4GDLA 4HVBA 4TQ1A 2FAZA 4WAAA 4MSMB 3V60A 3MTNB 3HIZA 3APFA 3QWZB 2LI5A 4E3CA 1WGHA 2HE7A 5E6OA 2L05A 2KX0A 3H1UA 4RM8A 2KFJA 5AZHA 4GIVA 5CHWA 4BKGA 2JWZA 4DHZB 2WWZA 4AJWA 4URKA 1XD3B 3T9LA 4K7SA 2KK8A 2KHWB 3PRMB 5IA7A 3H9DA 3PVLA 3A33B 1Z5SB 1WY8A 5J2RA 4HPLB 4B95A 1SIFA 2NPTB 3DBRI 3L54A 3L16A 3OLMD 2R2QA 3H6NA 3L0WB 4W9CA 3W1YA 1X1MA 4DK5A 2KTRA 3U8ZA 4NAWB 4P7IA 3SU8X 3UINB 3PLVA 2OOBB 3DCGA 4MJSB 2K8HA 4KV2A 2KLCA 1WR1A 2WDTB 4PYZA 2GOWA 4JLCA 4EZKA 3N30A 1WX8A 1G6JA 4LJOB 4KSKC 2K6QA 3WA0A 3DQVA 4ICUA 2MA9B 1LM8B 2RR9A 3BY4B 2CHXA 2GBRA 2KTFA 2G4DB 3A4SC 4GDKA 4HDOA 4MSQB 4EUTA 3R7RA 3K9PB 4JGHB 3HK0A 2JY6A 2J7QB 2REXA 3APDA 3V61A 4B6WA 5D2MB 2KO3A 4HXDA 4OVVA 1GC6A 2BGFA 2ZJDA 3QQ8B 3PV1A 2RSUA 1V86A 3RZFA 1YX5B 1E8YA 2ZPYA 4WJPA 3TCAA 4DWFA 1YX6B 1P98A 2RD0A 3L10B 4HDQA 4ANXA 3KUCB 2JF5A 2L7RA 2M17A 4IWQA 4NPNA 4TUUA 4WWPA 2JRHA 2KJ6A 1KLVA 1C1YB 2K6DB 4DXAB 4NY0A 1LXDA 2YLMA 1GC7A 3DDCB 2CHZA 4DBGA 2QHOA 4WJOA 2MRPA 4II2B 2NPTA 1TZ1A 2KMAA 4PYUA 4WWNA 3ALBA 3ZNZB 2XK5B 1E8ZA 2KNBA 3CSTA 3CF6E 1WXMA 1P1AA 4NAWA 5KHOA 3PPAA 5L83A 4HLEA 2DZIA 2PJHA 1WIAA 3Q3JA 4ANUA 3R66C 2ZNVB 3PRPB 5JHAA 5LXIB 4K81A 3UIPB 3VDZA 1Q5WB 2EMSA 1IYFA 1ZGUB 5JH5C 2LJ5A 3A9KA 2N1VA 2L0FA 2LXCA 3KYDD 4JQWC 2ZNVC 2Y5BB 4XZ4A 3PREA 4G0NB 4IWPA 5L95C 5E6NA 5J18A 1OGWA 2ZPNA 3ZNGC 3ZNID 4AP4C 3PGEA 1WM2A 2LRUA 2BPSA 1S1QB 1XQQA 2ASQA 3B08A 2O2VA 4MEMA 3H7PA 1E90A 1Z2MA 3O65B 2L3ZA 4FJVB 3L17A 4PS8A 2KDFB 2AEHA 3SD5A 4B9KA 4BOZB 1V80A 1C3TA 4W9LA 4HJKA 2ZCCA 3QARA 3B1LX 4CYEA 3V6CB 2MLBA 2CS4A 4W9GA 1WH3A 3PZDA 4KZ0A 3QX1A 1WX9A 4KIKA 5CX3A 2NVUI 5AZFA 3AI5A 4W9EA 2MP2B 2C7MB 3KUZA 3RYTA 2GBJA 1A5RA 4ANWA 1NBFC 2V4LA 4GN1A 3JYUA 2BKFA 1P9DU 1BT0A 2FCQA 2KQSA 2ZCBA 1WF9A 3L13A 2DHZA 3P2BA 3TJPA 4AWJA 1L2NA 3AXCA 3VFKA 4IM0A 2KMCA 1I35A 3UF8A 3OJ3A 3ONSA 4BKTA 2WYQA 5D7GA 2DZMA 2KD0A 1E5WA 3RCZA 3ZDMC 4GMVA 1RRBA 2ZZPB 1GNUA 4FN2A 2KDBA 4MGIE 2Z0EB 4HPMB 3ZRCA 4IM3A 2KOXA 5BO4B 4DHJB 1V49A 2FCNA 2DYMA 2IY0B 3X23A 1VCBA 1VD2A 4WQOB 3KYCD 5CHFA 1TGZB 3SDLC 2NBVB 2IO2B 1UD7A 4ZRKA 3R3MA 5LLIA 3S2AA 1WZ3A 2BYEA 2ZVOA 4NNJB 3QC8B 2O6VB 2C9WB 2PE9A 4JL9A 1WZ0A 2RGFA 3SHQA 3ML8A 3QA8A 3PSEB 4FHKA 4FA6A 1ISNA 2LVQA 2KC2A 1ZW7A 1TTNA 4GU2A 2D2QA 3JSVA 2UWQA 1UBQA 3A1QA 3A9JB 2MBHA 4KDLB 1P3QU 2KQ7A 2LGDA 2K1FA 4ICVA 1NDDA 2BWFA 2KVRA 3IBEA 2V3SA 4ZRJA 2BYFA 4XC2A 2M0XA 1WJNA 1R4NI 2NCNA 1Q0WB 4MGZE 1V81A 2CU1A 1RFAA 2KDEB 3PT2B 2DAFA 2KWVB 2AWTA 3AU4A 4W9DA 4IC7B 1EF5A 2JZZA 2MBEA 3M63B 3M95A 2LRWA 3DBSA 3IHPC 3NZUA 3WALA 1IP9A 4M0WB 4E74A 5JHBA 4F7ZA 3EC8A 4FJYA 4GGQA 4DHJD 2G4SA 2LGYA 1RLFA 2FNJB 2GBNA 2KZRA 2YVCA 3QK0A 4NQKE 2MCNB 1Y8RC 2KN5A 2PE6B 2XBBC 3RT3B 3PTFC 3APCA 1OEYA 1WMHB 2O6VD 3NS8A 1WFYA 4BKSD 1U4AA 4E71A 2AL3A 1L7YA 2NBUA 3VTVA 2WX0A 1GG3A 3DPDA 1IPGA 1E7VA 3RD2A 3BINA 3N32A 2FIDA 2Z0DB 2J0KA 2JRIB 4W9KA 2N9PC 4A3OA 4MJSA 2LGXA 1YD8U 2GBMA 1NI2A 1OTRB 2KXJA 2WX1A 4ASWC 2L00B 4IG7B 5C1ZA 1XT9B 2N7DA 3VAWA 1YJ1A 3HHMA 4TV3A 2HTHA 4RM9A 3WAOA 3ZNHB 4MH0E 4ANVA 2FIFA 3KW5B 3VHTC 1V9JA 3VUWA 2FCSA 4NQLB 1J8CA 3OJ4B 3TBLD 4AOFA 2JUOA 4IWOA 2KFKB 2PPHA 3JVZX 1H4RA 3DVGX 4PS7A 1OQYA 3QAQA 5E6PA 3K9OB 1MG8A 3JW0X 3L08A 3MJWA 5DPRA 3NY5A 2K25A 3DBLI 5TR5A 4AUQC 1WR6E 2DAJA 2CKHB 1UELA 3LJ3A 2KWCA 4CO7A 1LQBA 2IBIB 2AYOB 2PEAA 4YL8A 3RZWC 3MHSD 4FADA 3B0AA 3IVFA 5J17A 3ZW3A 1K8RB 4HK2A 4RMAA 5CHVC 1KJTA 1WYWB 5DCNA 3VTUA 3N3KB 4W9JA 3ZLZA 3U30A 1OEYJ 4HWIB 2IYDB 2C7NB 1EF1A 2KJHB 2XK5A 2KC1A 2LZ6A 3TIXA 5DPWA 4BBNC 4K7WA 1FXTB 3VTWA 3VUXA 3ZTCA 4A20A 3PRZA 3I3TB 2KTRB 2MBQA 1EUVB 1WX7A 3X0WA 1YQBA 2A5UA 3ECIA 3R7QA 4M8MA 3EFUA 1WGGA 1E7UA 4I6PA 3EHVA 1R4MI 1UGMA 1V5OA 2AL6A 2LUEA 4X57B 3ZKJC 4I6NB 3V62A 1WXSA 2BKRB 4M8NA 1KOTA 1WGDA 2DYOA 2GMIC 2K8BA 3DVGY 4GDKB 3VH4B 4MM3A 4II3B 1V5TA 3W1SC 2KFKA 4HCPB 3ZO5B 2KLGA 3AULA 3GZNI 5JZEB 3DVNV 1GUAB 2LVOA 4WJNA 1WJ4A 1I42A 3Q3FA 2JPHA 4PS3A 4XX5A 4DDID 2DZJA 1WM3A 2I1JA 4LDTB 2J0MA 4TKNA 2MQJA 4KZCA 5C23A 4NJ7A 2BYVE 4F8CB 3WIMA 2NS5A 4IUMB 2RPQA 3UIOB 2K8CA 2KWUB 1PQSA 1ZKHA 2BF8B 4G3XB 3QHTA 4EFOA 2KJRA 4EOYA 3WAPA 1Q1OA 3VH3B 3ZRFA 5AEKB 4A3PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G45 B;  3VVW B;  3WAN A;  2MP2 A;  1QZE A;  1CMX B;  1TBE A;  3TL5 A;  2KX3 A;  2LAS A;  2L76 A;  2M4N A;  2VRR B;  4GSW A;  5GMV A;  2FCM A;  2DX5 B;  3VXW A;  2LVP A;  2NBW B;  4N9F 4;  4BVU C;  3ZDT A;  2DZK A;  3EEC A;  3QJZ A;  1WGR A;  1WGY A;  2IO3 B;  2ZEQ A;  5G2N A;  2CHW A;  2UYZ B;  4DHZ E;  3UQA A;  4W9H A;  3RUI B;  4AJY B;  5IAA C;  1WXA A;  4I6L B;  1UBI A;  4CHK A;  1J0G A;  2M8S A;  3LDZ E;  3W1S A;  2HJ8 A;  1WXV A;  3A9K B;  4IW0 A;  3UQB A;  4FBJ B;  1WE7 A;  1WJ6 A;  2A4Z A;  2Z59 B;  3AU5 A;  2N4F A;  4GB9 A;  2J0J A;  2I1K A;  3H7S A;  2MSE D;  3U7D A;  2C60 A;  2EKE C;  4LDT D;  4ZDV A;  1WE6 A;  2LXA A;  4FLH A;  4HCN B;  2LD9 A;  3DOW A;  4DDG D;  4G50 A;  3PHX B;  4FUL A;  2IO1 B;  3GOE A;  2M1M A;  2D11 A;  2MBB B;  1SGH A;  2MWS B;  2O2V B;  3ZTD A;  3H7P B;  3ZVV A;  1E8W A;  4NJ6 A;  1WJU A;  2DEN B;  4J6I A;  2O6V A;  2IO0 B;  4FJZ A;  4BKS A;  3ML9 A;  5FR6 A;  4WJQ A;  2R2O A;  1P0R A;  4GOC A;  3HM3 A;  2MBO A;  1J19 A;  2ZVN A;  2C5L C;  3ZUN A;  3A9J A;  2N9X A;  1V2Y A;  3ZIM A;  2NR2 A;  4MEL A;  4JIO U;  2N1W A;  4KIK B;  4LCD E;  5D6J B;  2L8J A;  4KSL C;  3UGB B;  3PLU A;  2L0T A;  4EKU A;  4WWO A;  3NZS A;  2XEW A;  3A4R A;  2V1Y A;  3NOB A;  5CTR C;  4ZRI A;  4ZYN A;  1GJZ A;  1RAX A;  4IM2 A;  5AZG A;  2CR5 A;  4MGK E;  4EZJ A;  2DYB A;  3D32 A;  4GDL B;  1UH6 A;  3DVN U;  3T8M A;  1JRU A;  4FHJ A;  2G3Q B;  4K7U A;  5KHQ A;  3QIJ A;  4BBN F;  2D07 B;  4G11 A;  3ENE A;  3KUD B;  3CMM B;  3C0R B;  2JZ3 B;  4BOS C;  3VUY A;  2HD5 B;  3V6E B;  3VQI A;  1T0Y A;  1UZX B;  5G55 A;  5LXH A;  2D10 A;  1M94 A;  1WI0 A;  2N7E A;  1WMH A;  3CSF A;  1LFD A;  2MW5 A;  2N9E B;  2W9N A;  2BWE S;  2KKC A;  1WRD B;  2FUH B;  2C7H A;  1V6E A;  3QCA A;  3PS6 A;  4W9F A;  5EDS A;  4K1R B;  1SE9 A;  4GXB A;  3IG3 A;  1EO6 A;  3DBH I;  1E8X A;  3M3J A;  2IY1 B;  3OAW A;  2JXX A;  1S3S G;  4EZL A;  2OJR A;  5DPS A;  4EEW A;  3PHW B;  2K39 A;  1AAR A;  4OVU A;  1HE8 A;  1D3Z A;  2JVC A;  2JT4 B;  4W9I A;  5DPT A;  2LWP A;  2KDI A;  3HM6 X;  5D94 A;  4KDI C;  3NHE B;  3KVF B;  3JSV B;  3TMP B;  4F1S A;  2IZV B;  2MX2 A;  3A1Q B;  4BFR A;  5HKH A;  1F9J A;  2EMT A;  3KH0 A;  2KAN A;  3WAM A;  3M62 B;  3RUL A;  1YIW A;  4TQ0 A;  4LJP B;  1KM7 A;  2B3A A;  2D3G A;  4KVG B;  4MDK E;  4MGY E;  3IFW B;  1H8C A;  2GBK A;  4GDL A;  4HVB A;  4TQ1 A;  2FAZ A;  4WAA A;  4MSM B;  3V60 A;  3MTN B;  3HIZ A;  3APF A;  3QWZ B;  2LI5 A;  4E3C A;  1WGH A;  2HE7 A;  5E6O A;  2L05 A;  2KX0 A;  3H1U A;  4RM8 A;  2KFJ A;  5AZH A;  4GIV A;  5CHW A;  4BKG A;  2JWZ A;  4DHZ B;  2WWZ A;  4AJW A;  4URK A;  1XD3 B;  3T9L A;  4K7S A;  2KK8 A;  2KHW B;  3PRM B;  5IA7 A;  3H9D A;  3PVL A;  3A33 B;  1Z5S B;  1WY8 A;  5J2R A;  4HPL B;  4B95 A;  1SIF A;  2NPT B;  3DBR I;  3L54 A;  3L16 A;  3OLM D;  2R2Q A;  3H6N A;  3L0W B;  4W9C A;  3W1Y A;  1X1M A;  4DK5 A;  2KTR A;  3U8Z A;  4NAW B;  4P7I A;  3SU8 X;  3UIN B;  3PLV A;  2OOB B;  3DCG A;  4MJS B;  2K8H A;  4KV2 A;  2KLC A;  1WR1 A;  2WDT B;  4PYZ A;  2GOW A;  4JLC A;  4EZK A;  3N30 A;  1WX8 A;  1G6J A;  4LJO B;  4KSK C;  2K6Q A;  3WA0 A;  3DQV A;  4ICU A;  2MA9 B;  1LM8 B;  2RR9 A;  3BY4 B;  2CHX A;  2GBR A;  2KTF A;  2G4D B;  3A4S C;  4GDK A;  4HDO A;  4MSQ B;  4EUT A;  3R7R A;  3K9P B;  4JGH B;  3HK0 A;  2JY6 A;  2J7Q B;  2REX A;  3APD A;  3V61 A;  4B6W A;  5D2M B;  2KO3 A;  4HXD A;  4OVV A;  1GC6 A;  2BGF A;  2ZJD A;  3QQ8 B;  3PV1 A;  2RSU A;  1V86 A;  3RZF A;  1YX5 B;  1E8Y A;  2ZPY A;  4WJP A;  3TCA A;  4DWF A;  1YX6 B;  1P98 A;  2RD0 A;  3L10 B;  4HDQ A;  4ANX A;  3KUC B;  2JF5 A;  2L7R A;  2M17 A;  4IWQ A;  4NPN A;  4TUU A;  4WWP A;  2JRH A;  2KJ6 A;  1KLV A;  1C1Y B;  2K6D B;  4DXA B;  4NY0 A;  1LXD A;  2YLM A;  1GC7 A;  3DDC B;  2CHZ A;  4DBG A;  2QHO A;  4WJO A;  2MRP A;  4II2 B;  2NPT A;  1TZ1 A;  2KMA A;  4PYU A;  4WWN A;  3ALB A;  3ZNZ B;  2XK5 B;  1E8Z A;  2KNB A;  3CST A;  3CF6 E;  1WXM A;  1P1A A;  4NAW A;  5KHO A;  3PPA A;  5L83 A;  4HLE A;  2DZI A;  2PJH A;  1WIA A;  3Q3J A;  4ANU A;  3R66 C;  2ZNV B;  3PRP B;  5JHA A;  5LXI B;  4K81 A;  3UIP B;  3VDZ A;  1Q5W B;  2EMS A;  1IYF A;  1ZGU B;  5JH5 C;  2LJ5 A;  3A9K A;  2N1V A;  2L0F A;  2LXC A;  3KYD D;  4JQW C;  2ZNV C;  2Y5B B;  4XZ4 A;  3PRE A;  4G0N B;  4IWP A;  5L95 C;  5E6N A;  5J18 A;  1OGW A;  2ZPN A;  3ZNG C;  3ZNI D;  4AP4 C;  3PGE A;  1WM2 A;  2LRU A;  2BPS A;  1S1Q B;  1XQQ A;  2ASQ A;  3B08 A;  2O2V A;  4MEM A;  3H7P A;  1E90 A;  1Z2M A;  3O65 B;  2L3Z A;  4FJV B;  3L17 A;  4PS8 A;  2KDF B;  2AEH A;  3SD5 A;  4B9K A;  4BOZ B;  1V80 A;  1C3T A;  4W9L A;  4HJK A;  2ZCC A;  3QAR A;  3B1L X;  4CYE A;  3V6C B;  2MLB A;  2CS4 A;  4W9G A;  1WH3 A;  3PZD A;  4KZ0 A;  3QX1 A;  1WX9 A;  4KIK A;  5CX3 A;  2NVU I;  5AZF A;  3AI5 A;  4W9E A;  2MP2 B;  2C7M B;  3KUZ A;  3RYT A;  2GBJ A;  1A5R A;  4ANW A;  1NBF C;  2V4L A;  4GN1 A;  3JYU A;  2BKF A;  1P9D U;  1BT0 A;  2FCQ A;  2KQS A;  2ZCB A;  1WF9 A;  3L13 A;  2DHZ A;  3P2B A;  3TJP A;  4AWJ A;  1L2N A;  3AXC A;  3VFK A;  4IM0 A;  2KMC A;  1I35 A;  3UF8 A;  3OJ3 A;  3ONS A;  4BKT A;  2WYQ A;  5D7G A;  2DZM A;  2KD0 A;  1E5W A;  3RCZ A;  3ZDM C;  4GMV A;  1RRB A;  2ZZP B;  1GNU A;  4FN2 A;  2KDB A;  4MGI E;  2Z0E B;  4HPM B;  3ZRC A;  4IM3 A;  2KOX A;  5BO4 B;  4DHJ B;  1V49 A;  2FCN A;  2DYM A;  2IY0 B;  3X23 A;  1VCB A;  1VD2 A;  4WQO B;  3KYC D;  5CHF A;  1TGZ B;  3SDL C;  2NBV B;  2IO2 B;  1UD7 A;  4ZRK A;  3R3M A;  5LLI A;  3S2A A;  1WZ3 A;  2BYE A;  2ZVO A;  4NNJ B;  3QC8 B;  2O6V B;  2C9W B;  2PE9 A;  4JL9 A;  1WZ0 A;  2RGF A;  3SHQ A;  3ML8 A;  3QA8 A;  3PSE B;  4FHK A;  4FA6 A;  1ISN A;  2LVQ A;  2KC2 A;  1ZW7 A;  1TTN A;  4GU2 A;  2D2Q A;  3JSV A;  2UWQ A;  1UBQ A;  3A1Q A;  3A9J B;  2MBH A;  4KDL B;  1P3Q U;  2KQ7 A;  2LGD A;  2K1F A;  4ICV A;  1NDD A;  2BWF A;  2KVR A;  3IBE A;  2V3S A;  4ZRJ A;  2BYF A;  4XC2 A;  2M0X A;  1WJN A;  1R4N I;  2NCN A;  1Q0W B;  4MGZ E;  1V81 A;  2CU1 A;  1RFA A;  2KDE B;  3PT2 B;  2DAF A;  2KWV B;  2AWT A;  3AU4 A;  4W9D A;  4IC7 B;  1EF5 A;  2JZZ A;  2MBE A;  3M63 B;  3M95 A;  2LRW A;  3DBS A;  3IHP C;  3NZU A;  3WAL A;  1IP9 A;  4M0W B;  4E74 A;  5JHB A;  4F7Z A;  3EC8 A;  4FJY A;  4GGQ A;  4DHJ D;  2G4S A;  2LGY A;  1RLF A;  2FNJ B;  2GBN A;  2KZR A;  2YVC A;  3QK0 A;  4NQK E;  2MCN B;  1Y8R C;  2KN5 A;  2PE6 B;  2XBB C;  3RT3 B;  3PTF C;  3APC A;  1OEY A;  1WMH B;  2O6V D;  3NS8 A;  1WFY A;  4BKS D;  1U4A A;  4E71 A;  2AL3 A;  1L7Y A;  2NBU A;  3VTV A;  2WX0 A;  1GG3 A;  3DPD A;  1IPG A;  1E7V A;  3RD2 A;  3BIN A;  3N32 A;  2FID A;  2Z0D B;  2J0K A;  2JRI B;  4W9K A;  2N9P C;  4A3O A;  4MJS A;  2LGX A;  1YD8 U;  2GBM A;  1NI2 A;  1OTR B;  2KXJ A;  2WX1 A;  4ASW C;  2L00 B;  4IG7 B;  5C1Z A;  1XT9 B;  2N7D A;  3VAW A;  1YJ1 A;  3HHM A;  4TV3 A;  2HTH A;  4RM9 A;  3WAO A;  3ZNH B;  4MH0 E;  4ANV A;  2FIF A;  3KW5 B;  3VHT C;  1V9J A;  3VUW A;  2FCS A;  4NQL B;  1J8C A;  3OJ4 B;  3TBL D;  4AOF A;  2JUO A;  4IWO A;  2KFK B;  2PPH A;  3JVZ X;  1H4R A;  3DVG X;  4PS7 A;  1OQY A;  3QAQ A;  5E6P A;  3K9O B;  1MG8 A;  3JW0 X;  3L08 A;  3MJW A;  5DPR A;  3NY5 A;  2K25 A;  3DBL I;  5TR5 A;  4AUQ C;  1WR6 E;  2DAJ A;  2CKH B;  1UEL A;  3LJ3 A;  2KWC A;  4CO7 A;  1LQB A;  2IBI B;  2AYO B;  2PEA A;  4YL8 A;  3RZW C;  3MHS D;  4FAD A;  3B0A A;  3IVF A;  5J17 A;  3ZW3 A;  1K8R B;  4HK2 A;  4RMA A;  5CHV C;  1KJT A;  1WYW B;  5DCN A;  3VTU A;  3N3K B;  4W9J A;  3ZLZ A;  3U30 A;  1OEY J;  4HWI B;  2IYD B;  2C7N B;  1EF1 A;  2KJH B;  2XK5 A;  2KC1 A;  2LZ6 A;  3TIX A;  5DPW A;  4BBN C;  4K7W A;  1FXT B;  3VTW A;  3VUX A;  3ZTC A;  4A20 A;  3PRZ A;  3I3T B;  2KTR B;  2MBQ A;  1EUV B;  1WX7 A;  3X0W A;  1YQB A;  2A5U A;  3ECI A;  3R7Q A;  4M8M A;  3EFU A;  1WGG A;  1E7U A;  4I6P A;  3EHV A;  1R4M I;  1UGM A;  1V5O A;  2AL6 A;  2LUE A;  4X57 B;  3ZKJ C;  4I6N B;  3V62 A;  1WXS A;  2BKR B;  4M8N A;  1KOT A;  1WGD A;  2DYO A;  2GMI C;  2K8B A;  3DVG Y;  4GDK B;  3VH4 B;  4MM3 A;  4II3 B;  1V5T A;  3W1S C;  2KFK A;  4HCP B;  3ZO5 B;  2KLG A;  3AUL A;  3GZN I;  5JZE B;  3DVN V;  1GUA B;  2LVO A;  4WJN A;  1WJ4 A;  1I42 A;  3Q3F A;  2JPH A;  4PS3 A;  4XX5 A;  4DDI D;  2DZJ A;  1WM3 A;  2I1J A;  4LDT B;  2J0M A;  4TKN A;  2MQJ A;  4KZC A;  5C23 A;  4NJ7 A;  2BYV E;  4F8C B;  3WIM A;  2NS5 A;  4IUM B;  2RPQ A;  3UIO B;  2K8C A;  2KWU B;  1PQS A;  1ZKH A;  2BF8 B;  4G3X B;  3QHT A;  4EFO A;  2KJR A;  4EOY A;  3WAP A;  1Q1O A;  3VH3 B;  3ZRF A;  5AEK B;  4A3P A; 
#chains in the Genus database with same CATH topology
 2G45 B;  3WAN A;  2MP2 A;  2W82 A;  1TBE A;  1JWA D;  2L76 A;  2VRR B;  2WDR B;  2FCM A;  4RNA A;  3AB5 A;  3ZDT A;  2IO3 B;  3UQA A;  4W9H A;  4AJY B;  5IAA C;  1UBI A;  1FD6 A;  3UQB A;  4FBJ B;  2QSD A;  4GB9 A;  1XLN A;  2J0J A;  3H7S A;  4ZYS A;  2MSE D;  1N61 A;  1WWT A;  4DDG D;  4G50 A;  1PYW D;  4FUL A;  3GOE A;  2M1M A;  2O2V B;  3H7P B;  4BKS A;  4WJQ A;  3L4P A;  3TSS A;  2ONQ A;  2WXJ A;  2PKO A;  2N1W A;  4KIK B;  2RDG A;  4XYC A;  5H8Y E;  3UGB B;  1NEK B;  4RCO A;  3NZS A;  3A4R A;  1XCT L;  3NOB A;  4ZYN A;  2IJ0 A;  3Q3N C;  4IM2 A;  4GDL B;  5HG2 A;  1UH6 A;  2H89 B;  3IT6 B;  1TKE A;  4ZRP A;  2D07 B;  2JZ3 B;  2DLB A;  2BB5 A;  3V6E B;  1T0R C;  1UZX B;  1WMH A;  2MW5 A;  2QIE B;  3U52 E;  2W9N A;  2LMC A;  2KKC A;  3NRZ A;  1WRD B;  2J42 A;  3PS6 A;  2GRI A;  4K1R B;  1SE9 A;  4GXB A;  1I4R A;  3M3J A;  3OAW A;  1LGR A;  4EZL A;  4C80 A;  2OJR A;  3HVZ A;  2RPV A;  4OVU A;  1NYR A;  2JVC A;  4ARC A;  1JWM D;  1NYQ A;  4W9I A;  2KDI A;  3HM6 X;  5D94 A;  4KDI C;  4F1S A;  3KVF B;  5BYS A;  2YEP F;  4BFR A;  5HKH A;  2IGH A;  5H92 C;  1DOI A;  1YIW A;  4TQ0 A;  1KM7 A;  2B3A A;  2D3G A;  3IFW B;  3I63 C;  4HVB A;  2QIL A;  2FAZ A;  1LO5 D;  4WAA A;  1EU3 A;  4E3C A;  1WGH A;  5E6O A;  2KX0 A;  3H1U A;  2KFJ A;  4DHZ B;  2GI9 A;  4K7S A;  5D3D A;  2KHW B;  3H9D A;  3PVL A;  3OWE B;  1SIF A;  3L54 A;  2R2Q A;  4OZB A;  4A55 A;  3PO0 A;  2KTR A;  1SE2 A;  1Q10 A;  3DCG A;  2K8H A;  4KGR A;  4KV2 A;  2WDT B;  1YQ4 B;  2GOW A;  4QAY A;  2AQ2 B;  1MI0 A;  1G6J A;  3AEE B;  4ICU A;  2XNA C;  2RR9 A;  4EUT A;  2G4D B;  2MJE A;  4JGH B;  2JY6 A;  4LNN A;  3GE3 C;  3AE2 B;  2BBC A;  3PV1 A;  1E8Y A;  3TCA A;  4DWF A;  4XWW A;  3L10 B;  4US9 A;  2JF5 A;  2L7R A;  2M17 A;  3BYY B;  4IWQ A;  4WWP A;  1RWS A;  2MHJ A;  2Y5P A;  4DXA B;  4NY0 A;  1LXD A;  4C4V B;  3DDC B;  2QHO A;  3HUI A;  2LEK A;  1TS2 A;  2NPT A;  1TZ1 A;  4PYU A;  3ZNZ B;  2XK5 B;  1E8Z A;  3CST A;  3CF6 E;  1WXM A;  4NAW A;  5IO9 A;  3PPA A;  2DZI A;  1ZXI A;  2ZNV B;  2EMS A;  4AS1 A;  3TEX A;  5EE1 A;  1R4M B;  5E6N A;  3Q2A C;  5J18 A;  1CQV A;  3B2F A;  4MM3 B;  1C4A A;  1I4P A;  2N9K A;  2D5G A;  2LRU A;  2BPS A;  3MC8 A;  4MEM A;  2K5P A;  1Z2M A;  3NVY A;  1KRH A;  1FIQ A;  4PS8 A;  3SD5 A;  1ZP0 B;  2BT6 A;  1V80 A;  1V1P A;  4ITK A;  3V6C B;  3AE9 B;  4P6V F;  3PZD A;  3QX1 A;  4D2K A;  1N62 A;  1V97 A;  4ANW A;  1NBF C;  5EE0 A;  1B9R A;  1L4D B;  1P9D U;  2KN4 A;  2ZCB A;  1WF9 A;  3L13 A;  2DHZ A;  4AWJ A;  4IM0 A;  2KMC A;  1D5X C;  3OJ3 A;  3BK1 A;  2DZM A;  1E5W A;  1KFY B;  4GMV A;  4HPP A;  4HPM B;  2DWQ A;  2JU6 X;  3NVW A;  2FCN A;  5GXG B;  2DYM A;  1IBX A;  4WQO B;  1QKZ A;  3S2A A;  2O6V B;  3R2T A;  2C9W B;  1ET6 A;  3SHQ A;  2XN9 C;  3QA8 A;  4FHK A;  2Y3A A;  4GU2 A;  2D2Q A;  2UWQ A;  1UBQ A;  1OQR A;  4KDL B;  2LGI A;  2WXH A;  3VRA B;  2KVR A;  2M0X A;  1WJN A;  4WQM A;  2NCN A;  1Q0W B;  5FR3 A;  4MGZ E;  1V81 A;  2CU1 A;  2DAF A;  2MBE A;  2LRW A;  2L83 A;  4E74 A;  2D3C A;  1EWY C;  3B9J A;  4DHJ D;  2G4S A;  1K51 A;  2FNJ B;  2GBN A;  2KZR A;  2MCN B;  3R2I A;  2PE6 B;  3RT3 B;  2J53 A;  3APC A;  2ZW0 A;  4BKS D;  2WX0 A;  1GG3 A;  2BS2 B;  3RD2 A;  4ZHP A;  2JRI B;  4W9K A;  2N9P C;  1C4C A;  2GBM A;  3FIL B;  2WX1 A;  3PZ7 A;  2JZP A;  2IPK D;  3HHM A;  4TV3 A;  2HTH A;  4RM9 A;  3ZNH B;  4ANV A;  2L52 A;  3Q8A A;  2PVG C;  4L2Y A;  4AOF A;  2JUO A;  3JVZ X;  3ZYY X;  1EM7 A;  2L1A A;  1YJI A;  3NY5 A;  3VRB B;  2K25 A;  1YOV B;  2GB1 A;  4K3B A;  1HQR D;  2CKH B;  3LJ3 A;  2KWC A;  4R3D A;  2AYO B;  3RNF C;  4RMA A;  2JX5 A;  1KJT A;  5DCN A;  3ZLZ A;  5G5G A;  5BMI A;  2SAK A;  3RPF C;  4NAM A;  1EF1 A;  2KJH B;  2WXR A;  4HRS A;  1JRP A;  4A20 A;  1FXT B;  2I2Y A;  3X0W A;  4DXF A;  1ZDV A;  1VZ6 A;  3EFU A;  3TEZ A;  1WGG A;  1E7U A;  4I6P A;  3EHV A;  3P4S B;  2BKR B;  1JCK B;  1WGD A;  2DYO A;  2V3N A;  1JWS D;  2LUM A;  3RN9 C;  2MJD A;  1PUT A;  3W1S C;  4BAX A;  4P16 A;  2KLG A;  3GZN I;  5JZE B;  2JQR B;  1WJ4 A;  1UNS A;  1PFD A;  2JPH A;  4PK1 A;  3WCQ A;  4PS3 A;  2WQY B;  1WM3 A;  4YSY B;  1T6B X;  5TSS A;  1PGX A;  4OZA A;  2BB6 A;  4RGT A;  2W55 A;  2KJR A;  4RGO S;  5FKA C;  4A3P A;  1CMX B;  4GSW A;  3VXW A;  2UU7 A;  1FRR A;  2PLP A;  2CHW A;  4EE2 A;  3Q14 C;  3LYY A;  1WXA A;  4I6L B;  1J0G A;  2MEK A;  3W1S A;  3TUO A;  3A9K B;  2N4F A;  1EWC A;  1VDV A;  2I1K A;  2Z8L A;  2JYE A;  3E9S A;  2EKE C;  1WE6 A;  2LXA A;  3PHX B;  2MH7 A;  5EE3 A;  1BML C;  1SGH A;  2WXN A;  4JWU C;  3ZTD A;  1WJU A;  4J6I A;  4FJZ A;  2IO0 B;  2EEL A;  3ML9 A;  2WXP A;  4S0R A;  1JML A;  1KLG D;  5FR6 A;  3TEY A;  4GOC A;  3HM3 A;  1J19 A;  3A9J A;  1V2Y A;  2WXG A;  3ZIM A;  2NR2 A;  4MEL A;  5FK9 C;  2OHF A;  2J4X A;  1JWU D;  3MC9 A;  3AH7 A;  2AQ1 B;  1V1O A;  2X38 A;  4DXG A;  2I38 A;  4ZRI A;  1GJZ A;  5AZG A;  2CR5 A;  4MGK E;  1SJE D;  3T8M A;  1JRU A;  3KWL A;  4K7U A;  1AN8 A;  1TZO A;  1DGJ A;  5KHQ A;  3QIJ A;  1XO3 A;  3CMM B;  1MVK A;  3C0R B;  3VUY A;  3VQI A;  1T0Y A;  3EGR A;  5G55 A;  5LXH A;  2D10 A;  3CSF A;  5BYR A;  2N9E B;  2BWE S;  2FUH B;  2C7H A;  2J52 A;  1V6E A;  4W9F A;  3DBH I;  1E8X A;  2JXX A;  1F1H A;  1N5W A;  4EEW A;  3KLS X;  1AAR A;  1HEZ E;  2N0S B;  5DPT A;  2LWP A;  3NHE B;  3JSV B;  3AE3 B;  2IZV B;  2MX2 A;  3A1Q B;  1YMH E;  2EMT A;  2E6X A;  5IOI A;  3RUL A;  1H8C A;  4GDL A;  4TQ1 A;  3V60 A;  1KF6 B;  3APF A;  3V05 A;  4N58 A;  2LI5 A;  2HE7 A;  2L05 A;  5AZH A;  1PGA A;  5CHW A;  4BKG A;  4URK A;  1XD3 B;  1CK1 A;  3PRM B;  1FCL A;  3A33 B;  4YSX B;  5J2R A;  1SB3 C;  3L0W B;  3W1Y A;  1OFF A;  4DK5 A;  4P7I A;  3UIN B;  3PLV A;  1AYF A;  3GP7 A;  4RF0 A;  1WX8 A;  3RNB C;  4KSK C;  2MA9 B;  1LM8 B;  4RH6 A;  4WIP A;  2GBR A;  4GDK A;  4XDD A;  4MSQ B;  3R7R A;  3HK0 A;  4UDU C;  4YSZ B;  4HXD A;  1TKY A;  3AM9 A;  3AN1 A;  4HJG E;  1T0S C;  3I9V 1;  1N6Z A;  4WJP A;  2RD0 A;  3V3X A;  1DOX A;  1KLV A;  2K6D B;  4B0E A;  2VH2 A;  4P1C C;  2YLM A;  1V8C A;  3BVM A;  1R7S A;  5C3J B;  3N1X C;  2KMA A;  4XGA B;  4WWN A;  2AX5 A;  3ALB A;  1L5P A;  2FE8 A;  1P1A A;  3Q3J A;  3GE8 C;  5JHA A;  1XLQ A;  1ACC A;  2DNF A;  1FRD A;  3VDZ A;  3AE1 B;  5JH5 C;  2LJ5 A;  2ZNV C;  1TY2 A;  2Y5B B;  4XZ4 A;  2Y5C A;  5L95 C;  1VJK A;  1OGW A;  2ZPN A;  1FNU A;  1AW7 A;  1S1Q B;  3B08 A;  1SEB D;  2L3Z A;  1M4V A;  2KDF B;  2QC8 A;  2KMM A;  4B9K A;  2ACZ B;  1C3T A;  3B2G A;  2WXO A;  4HJK A;  2IDY A;  2WS3 B;  1QOF A;  4CYE A;  1F77 A;  3ABV B;  4KZ0 A;  1CJE A;  3P1M A;  5CX3 A;  2NVU I;  2MP2 B;  3RNC C;  2GBJ A;  3U2S C;  1XXG A;  4GN1 A;  4WWM A;  2BKF A;  1L6V A;  1PGB A;  1D6E C;  1TYG B;  1ENF A;  1SE4 A;  2KD0 A;  2K9X A;  3P63 A;  3ZDM C;  2KQ4 X;  3DHI C;  1RRB A;  1XEE A;  1TY0 A;  4FN2 A;  2KDB A;  4MGI E;  4L1B A;  1DYQ A;  4US8 A;  1YNT E;  4IM3 A;  2KOX A;  3MC0 B;  4DHJ B;  2IY0 B;  3DHG C;  5CHF A;  1L0Y B;  3SDL C;  1HTQ A;  4ZRK A;  5LLI A;  1TS4 A;  3QC8 B;  2PE9 A;  4JL9 A;  1WZ0 A;  1D5Z C;  4ZOH C;  4FA6 A;  3MFG A;  1ISN A;  5JXV A;  1UGJ A;  2LVQ A;  4N59 A;  3W2D A;  4Q2J A;  1ZW7 A;  1TTN A;  2KQ7 A;  1TS5 A;  2K1F A;  4ICV A;  1SF0 A;  3AED B;  2V3S A;  4ZRJ A;  2BYF A;  1E6E B;  4OW0 A;  5HFY A;  2JZZ A;  3M63 B;  2INP E;  3WAL A;  4M0W B;  5BYQ A;  3U4E G;  5JHB A;  3EC8 A;  1RLF A;  1Y8R C;  2KN5 A;  2XBB C;  4JE3 B;  1WMH B;  2Q5W D;  3VTV A;  2PMV A;  1IPG A;  2Z0D B;  4RFB A;  4LLG M;  4MJS A;  1NI2 A;  1XF5 L;  4ASW C;  2CJO A;  3BVG A;  5C1Z A;  1XT9 B;  2N7D A;  1HXY D;  1YJ1 A;  1Y56 A;  4MH0 E;  2FIF A;  1I4H A;  3VHT C;  1ZDX A;  2FCS A;  1J8C A;  1C76 A;  2VH1 A;  1ZOY B;  2KFK B;  1UWX A;  4PS7 A;  3K9O B;  3JW0 X;  3L08 A;  3RNE C;  2WXK A;  1SE3 A;  4N6E B;  2DAJ A;  3MJ5 A;  3NG0 A;  2D3B A;  1UEL A;  2KDM A;  1LQB A;  2QEJ C;  1TT5 B;  4P1B C;  2K0P A;  3B0A A;  5J17 A;  1MPE A;  1WYW B;  1P7E A;  1MFW A;  3U30 A;  2K22 A;  1OEY J;  4HWI B;  1UUP A;  2C7N B;  1YN3 A;  3RNG C;  2KC1 A;  2LZ6 A;  3P4Q B;  2BS3 B;  3N20 C;  4S17 A;  3I3T B;  2KTR B;  1K50 A;  2MBQ A;  1EUV B;  1WX7 A;  3KWV A;  2A5U A;  3P4P B;  4KKJ A;  3R7Q A;  4KGT A;  1R4M I;  2LUE A;  4I6N B;  4XE0 A;  2BW2 A;  1XLP A;  3P4R B;  2GMI C;  2QJL A;  4II3 B;  1XLO A;  4YT0 B;  2QMT A;  2GLS A;  1GUA B;  1I42 A;  1RM6 C;  2DZJ A;  3AE8 B;  5IKC M;  2BYV E;  4F8C B;  2K8C A;  2BF8 B;  3CWI A;  2M56 B;  1HZ5 A;  1Q1O A;  3ZRF A;  3VVW B;  3AE4 B;  4ACF A;  2LAS A;  3AEC B;  2LVP A;  4K3C A;  4BVU C;  2LHD A;  1MG4 A;  2DZK A;  3EEC A;  3QJZ A;  1WGR A;  2ZEQ A;  1D4B A;  2RDH A;  4CHK A;  1ZXH A;  2M8S A;  3LDZ E;  2HJ8 A;  1WXV A;  4JWS C;  1WE7 A;  1WJ6 A;  2Z59 B;  4MH8 A;  1F0Z A;  2G1E A;  3U7D A;  2INC C;  4YXD B;  2W3S A;  1VZ7 A;  1RFK A;  2FUG 1;  3N1Y C;  2IO1 B;  2D11 A;  2MWS B;  3ZVV A;  3VR8 B;  4OHJ A;  1V1P B;  2HTM E;  3H8H A;  1P0R A;  1IGC A;  2MBO A;  3BVZ A;  5LNK 1;  2ZVN A;  2C5L C;  2N9X A;  4JIO U;  3EFC A;  4LCD E;  3W9C B;  5D6J B;  2L8J A;  4KSL C;  3PLU A;  4EKU A;  4WWO A;  5CTR C;  3EA6 A;  1WGK A;  3D32 A;  3AE5 B;  2IGD A;  3DVN U;  3AE6 B;  1T0Q C;  4BBN F;  4G11 A;  3BII D;  1ZE3 D;  1YN5 A;  2HD5 B;  1M94 A;  1I7H A;  1WI0 A;  3C19 A;  3ZGZ A;  1IBX B;  5EDS A;  1EO6 A;  4DQO C;  1S3S G;  3DBR B;  1N60 A;  4NJC A;  3Q69 A;  1ET9 A;  2N7J A;  3PHW B;  3RNA C;  1YQ3 B;  3FAH A;  2ICI A;  2BYT A;  4H2A A;  2KAN A;  3WAM A;  2ON8 A;  4LJP B;  4KVG B;  4MDK E;  1F2R C;  4IKG A;  2GBK A;  4L23 A;  1R4N B;  4OZC A;  4MSM B;  3HIZ A;  3QWZ B;  4USA A;  1FO4 A;  4GIV A;  1PDX A;  4AJW A;  2KK8 A;  5IA7 A;  4YTN B;  4JPS A;  1B1Z A;  2LGS A;  4B95 A;  3DBR I;  3O13 A;  1YJJ A;  3SU8 X;  1GOZ A;  4EZK A;  4LJO B;  2K6Q A;  3WA0 A;  1C9F A;  3DQV A;  2CHX A;  4HDO A;  2WNM A;  3K9P B;  4XWT A;  5HHD G;  1STE A;  4A9A A;  1GC6 A;  2ZJD A;  1YX5 B;  5E6J A;  2ZPY A;  1YX6 B;  1P98 A;  2WDV B;  1NVI D;  3KUC B;  4NPN A;  2V3P A;  2JRH A;  3BZD B;  2SEB D;  2R61 A;  2KT7 A;  1GC7 A;  1TJE A;  2WLB A;  2CHZ A;  4LK0 M;  1GPX A;  3NVZ A;  4WJO A;  2L32 A;  2MRP A;  2X8X X;  1WYG A;  2BVC A;  3FKY A;  2KNB A;  5IN7 A;  5KHO A;  5L83 A;  1FPY A;  4ANU A;  2PJH A;  1WIA A;  3PRP B;  1JQ4 A;  2WGS A;  3UIP B;  5AUI A;  2K3U A;  3Q8E A;  2WDQ B;  1JWB D;  4HKZ E;  3KQ4 A;  3NVV A;  2L0F A;  3KYD D;  4JQW C;  1TS3 A;  3ZNG C;  3ZNI D;  4AP4 C;  4REZ A;  1VLB A;  2H88 B;  2O2V A;  3H7P A;  4YWG G;  3O65 B;  1RYJ A;  4FJV B;  3L17 A;  1WSP A;  2V0G A;  4W9L A;  1SXT A;  2MLB A;  4W9G A;  1WH3 A;  2AQ3 B;  1WX9 A;  4IDI A;  4KIK A;  3AI5 A;  4W9E A;  3SR6 A;  2C7M B;  3KUZ A;  1DOY A;  3RYT A;  1A5R A;  3OG5 A;  2V4L A;  3AEB B;  1BT0 A;  2KQS A;  1FEH A;  2KAJ A;  2WXL A;  3FC4 A;  3W5V B;  3UF8 A;  4BKT A;  1VZ8 A;  3RCZ A;  1GNU A;  4MAC A;  5BO4 B;  1V49 A;  1VCB A;  1VD2 A;  2MJ3 A;  3KYC D;  1TGZ B;  1K52 A;  1UD7 A;  1WZ3 A;  2BYE A;  2ZVO A;  4NNJ B;  3Q8C A;  2OED A;  4YTP B;  5HI1 A;  1E10 A;  3C8Y A;  4KX6 B;  1F2R I;  1IUE A;  3A9J B;  2MBH A;  5AUK A;  2LGD A;  1NDD A;  2BWF A;  2WXI A;  3NJT A;  1L0X B;  4XC2 A;  4GLS C;  1RFA A;  2KDE B;  3PT2 B;  2KWV B;  3AU4 A;  4W9D A;  4IC7 B;  3M95 A;  3NZU A;  3DBS A;  1MHH E;  1JAL A;  3DBL B;  1I4Q A;  4FJY A;  5EE9 A;  3AEA B;  4NQK E;  3QK0 A;  4XDC A;  1OEY A;  3EUB 2;  5BMG A;  1I4X A;  1WFY A;  1FXI A;  4E71 A;  2AL3 A;  1J7C A;  4NZL B;  2NBU A;  3DPD A;  3BIN A;  3N32 A;  2FID A;  2LFI A;  4A3O A;  1YD8 U;  2N9L A;  1L6U A;  3E56 A;  2L00 B;  2D3A A;  3IAS 1;  5BMH A;  3Q3O C;  4TMA B;  4C56 C;  1C4P A;  1V9J A;  3VUW A;  4PT5 A;  3TBL D;  2JXT A;  4IWO A;  2PPH A;  3DVG X;  1OQY A;  3QAQ A;  1MG8 A;  5DPR A;  3DBL I;  5TR5 A;  4M0W A;  4AUQ C;  1WR6 E;  2RMM A;  2WXF A;  4CO7 A;  2PEA A;  4YL8 A;  1FXA A;  3IVF A;  4C4V A;  3ZW3 A;  1K8R B;  3VTU A;  3N3K B;  2IYD B;  2M0A A;  2M19 A;  1NI3 A;  4KKI A;  1C79 A;  2VZK D;  2XK5 A;  2IGG A;  3TIX A;  3NZ3 A;  1SSN A;  3BWU D;  4BBN C;  4K7W A;  3ZTC A;  2LHE A;  3PRZ A;  1YN4 A;  1YQB A;  3ECI A;  3ETR A;  1UGM A;  2EKI A;  3HVD A;  4X57 B;  3ZKJ C;  2WXQ A;  4M8N A;  1E9M A;  2QCZ A;  5MPO A;  2K8B A;  3DVG Y;  4GDK B;  3VH4 B;  4MM3 A;  5I4D A;  3R8B A;  1V5T A;  3Q6B A;  2KFK A;  4HCP B;  1KLU D;  3DVN V;  2LVO A;  4WJN A;  4C7Y A;  4DDI D;  2I1J A;  2J0M A;  2MQJ A;  1E7P B;  3BYT B;  4NJ7 A;  3WIM A;  2NS5 A;  3UIO B;  1PQS A;  1AWD A;  4G3X B;  3QHT A;  1A70 A;  2KWD A;  4AQ7 A;  3VH3 B;  5AEK B;  4OVZ A;  2PVO D;  1QZE A;  3TL5 A;  2KX3 A;  1I4G A;  2M4N A;  2TSS A;  5GMV A;  1E0Z A;  2DX5 B;  4A6Q A;  2NBW B;  4N9F 4;  1N63 A;  4M02 A;  3Q8F A;  1WGY A;  5G2N A;  2UYZ B;  4DHZ E;  3RUI B;  3RFZ B;  2KAC A;  4IW0 A;  1N5X A;  1D5M C;  2A4Z A;  3AU5 A;  3ZXR A;  2C60 A;  4LNK A;  4LDT D;  4ZDV A;  4FLH A;  4HCN B;  1UWM A;  2LD9 A;  3DOW A;  2MBB B;  1FFU A;  1E8W A;  4NJ6 A;  2DEN B;  2O6V A;  4YTM B;  3T3N A;  3PZ8 A;  3I5J C;  2R2O A;  3ZUN A;  2B76 B;  2L0T A;  2WU5 B;  2XEW A;  4A90 A;  2V1Y A;  4LNF A;  1RAX A;  3SFE B;  4EZJ A;  2DYB A;  2NTT A;  1HZ6 A;  1GAQ B;  4FHJ A;  2G3Q B;  3ENE A;  3KUD B;  4BOS C;  1FNW A;  2N7E A;  1LFD A;  3GB1 A;  3Q3M C;  2OJW A;  3QCA A;  3IG3 A;  2IY1 B;  1WRI A;  4RF1 A;  3AMZ A;  3FIL A;  5DPS A;  3ZQ4 A;  2V4I B;  2K39 A;  3DWG C;  1HE8 A;  1D3Z A;  2JT4 B;  2WP9 B;  3TMP B;  4ARI A;  1F9J A;  3KH0 A;  4FXC A;  1XCQ L;  3M62 B;  2DBY A;  1VR9 A;  4MGY E;  2NTS A;  2BS4 B;  3MTN B;  4WAF A;  2KYW A;  4HKQ A;  2G9H D;  4RM8 A;  1J7B A;  1VRA B;  2JWZ A;  2WWZ A;  3T9L A;  1QLB B;  4CQN A;  4M01 A;  1FNV A;  1WXQ A;  4LNI A;  3LB8 C;  1Z5S B;  1WY8 A;  4HPL B;  4WUR A;  1QT9 A;  2NPT B;  1NEN B;  3OLM D;  3L16 A;  3H6N A;  4W9C A;  1X1M A;  2JSV X;  1GB1 A;  1MHX A;  3U8Z A;  4NAW B;  2OOB B;  4HEA 1;  4MJS B;  2KLC A;  1WR1 A;  4PYZ A;  4JLC A;  3N30 A;  2KVZ A;  1TIF A;  2FBW B;  3BY4 B;  1F52 A;  2KTF A;  3A4S C;  2PTL A;  2W54 A;  3CIR B;  3N9Y C;  4RGM A;  3GS2 A;  2J7Q B;  2REX A;  3APD A;  3V61 A;  4B6W A;  5D2M B;  2KO3 A;  4OVV A;  3IAM 1;  2BGF A;  3QQ8 B;  2RSU A;  1V86 A;  5C2T B;  3RZF A;  1FFV A;  1QOG A;  4HDQ A;  4ANX A;  4TUU A;  2KJ6 A;  1C1Y B;  2QDF A;  2IND C;  3BK2 A;  4DBG A;  1MJD A;  4II2 B;  3IXS A;  4ZHO A;  3ZJV A;  3DHH C;  4HLE A;  1IGD A;  3R66 C;  5LXI B;  4K81 A;  1Q5W B;  1ZUD 2;  3Q8B A;  1IYF A;  1ZGU B;  2WU2 B;  2N1V A;  3A9K A;  2LXC A;  4M00 A;  3SEB A;  3PRE A;  2CJN A;  1KTK A;  3P42 A;  4G0N B;  4IWP A;  1J7A A;  5IP4 D;  1KH0 A;  3PGE A;  2WXM A;  1WM2 A;  3I57 A;  1XQQ A;  2ASQ A;  1E90 A;  3GZN B;  2AEH A;  4BOZ B;  3HRD D;  2ZCC A;  3QAR A;  3B1L X;  4IOI E;  1BXT A;  2CS4 A;  3URY A;  3AEF B;  5AZF A;  3W5U B;  3JYU A;  3U7Z A;  1QOB A;  2FCQ A;  3P2B A;  3TJP A;  1L2N A;  3AXC A;  3VFK A;  2BQQ A;  3LXF A;  1I35 A;  1FCC C;  3ONS A;  2WYQ A;  1TKG A;  5D7G A;  1QIL A;  4JX1 C;  1T3Q A;  2ZZP B;  3NS1 A;  2JWU A;  2Z0E B;  3ZRC A;  3X23 A;  4LNO A;  2HDE A;  2NBV B;  2IO2 B;  3R3M A;  1CZP A;  4HRO A;  3IT4 B;  3ZJU A;  3UI3 A;  2RGF A;  3ML8 A;  1QOA A;  3PSE B;  5G5H A;  3RMK C;  2KC2 A;  3JSV A;  3A1Q A;  1P3Q U;  4ZRQ A;  2HJ1 A;  1T5X D;  3IBE A;  3AEG B;  1R4N I;  3ZXV A;  2ZW1 A;  4RGN A;  3AE7 B;  2AWT A;  1GB4 A;  1SJH D;  1EF5 A;  3N1Z C;  1IP9 A;  3IHP C;  4F7Z A;  4A8X C;  3MP9 A;  4GGQ A;  2LGY A;  2YVC A;  2E3T A;  1ZPS A;  3TEW A;  3PTF C;  1C77 A;  1QQR A;  5T8I A;  2O6V D;  3MHZ A;  1ESF A;  3NS8 A;  1U4A A;  1L7Y A;  2BTE A;  2RDB C;  1E7V A;  4TSS A;  3SFD B;  2INN E;  2J0K A;  2NMQ A;  2LGX A;  3DBH B;  4LTU A;  3RI7 C;  1FM0 D;  1OTR B;  2KXJ A;  2VZK B;  1P7F A;  1BUI C;  1L0V B;  4IG7 B;  1K53 A;  3VAW A;  4BZA A;  4C7Z A;  3WAO A;  1SIJ A;  3J9C A;  3KW5 B;  1SBB B;  4NQL B;  3OJ4 B;  3DWM A;  1H4R A;  5E6P A;  2WHI A;  3MJW A;  1JRO A;  3AV8 A;  2IBI B;  3RZW C;  3MHS D;  1UF0 A;  4FAD A;  1OQQ A;  4HK2 A;  5CHV C;  2V9H A;  5D3I B;  4W9J A;  2CU3 A;  2LJI A;  4MT5 A;  1L4Z B;  1HA5 A;  2PIA A;  5DPW A;  4J3O D;  3VTW A;  3VUX A;  4WH4 A;  4M8M A;  1V5O A;  2AL6 A;  3V62 A;  1WXS A;  4B0M A;  1QF6 A;  2JYT A;  1KOT A;  2PW9 A;  3ZO5 B;  3AUL A;  1EU4 A;  1ROE A;  1C78 A;  3NUH B;  2YEP B;  3Q3F A;  4O1N A;  4XX5 A;  4LDT B;  1JW9 D;  4TKN A;  4C00 A;  4KZC A;  3ZJT A;  5C23 A;  4KGS A;  1HTO A;  4IUM B;  3VR9 B;  1FMA D;  2RPQ A;  2W3R A;  2KWU B;  1ZKH A;  3T3O A;  4EFO A;  4EOY A;  3WAP A; 
#chains in the Genus database with same CATH homology
 2G45 B;  3VVW B;  3WAN A;  2MP2 A;  1QZE A;  1CMX B;  1TBE A;  3TL5 A;  2KX3 A;  2LAS A;  2L76 A;  2M4N A;  2VRR B;  4GSW A;  5GMV A;  2FCM A;  2DX5 B;  3VXW A;  2LVP A;  2NBW B;  4N9F 4;  4BVU C;  3ZDT A;  2DZK A;  3EEC A;  3QJZ A;  1WGR A;  1WGY A;  2IO3 B;  2ZEQ A;  5G2N A;  2CHW A;  2UYZ B;  4DHZ E;  3UQA A;  4W9H A;  3RUI B;  4AJY B;  5IAA C;  1WXA A;  4I6L B;  1UBI A;  4CHK A;  1J0G A;  2M8S A;  3LDZ E;  3W1S A;  2HJ8 A;  1WXV A;  3A9K B;  4IW0 A;  3UQB A;  4FBJ B;  1WE7 A;  1WJ6 A;  2A4Z A;  2Z59 B;  3AU5 A;  2N4F A;  4GB9 A;  2J0J A;  2I1K A;  3H7S A;  2MSE D;  3U7D A;  2C60 A;  2EKE C;  4LDT D;  4ZDV A;  1WE6 A;  2LXA A;  4FLH A;  4HCN B;  2LD9 A;  3DOW A;  4DDG D;  4G50 A;  3PHX B;  4FUL A;  2IO1 B;  3GOE A;  2M1M A;  2D11 A;  2MBB B;  1SGH A;  2MWS B;  2O2V B;  3ZTD A;  3H7P B;  3ZVV A;  1E8W A;  4NJ6 A;  1WJU A;  2DEN B;  4J6I A;  2O6V A;  2IO0 B;  4FJZ A;  4BKS A;  3ML9 A;  5FR6 A;  4WJQ A;  2R2O A;  1P0R A;  4GOC A;  3HM3 A;  2MBO A;  1J19 A;  2ZVN A;  2C5L C;  3ZUN A;  3A9J A;  2N9X A;  1V2Y A;  3ZIM A;  2NR2 A;  4MEL A;  4JIO U;  2N1W A;  4KIK B;  4LCD E;  5D6J B;  2L8J A;  4KSL C;  3UGB B;  3PLU A;  2L0T A;  4EKU A;  4WWO A;  3NZS A;  2XEW A;  3A4R A;  2V1Y A;  3NOB A;  5CTR C;  4ZRI A;  4ZYN A;  1GJZ A;  1RAX A;  4IM2 A;  5AZG A;  2CR5 A;  4MGK E;  4EZJ A;  2DYB A;  3D32 A;  4GDL B;  1UH6 A;  3DVN U;  3T8M A;  1JRU A;  4FHJ A;  2G3Q B;  4K7U A;  5KHQ A;  3QIJ A;  4BBN F;  2D07 B;  4G11 A;  3ENE A;  3KUD B;  3CMM B;  3C0R B;  2JZ3 B;  4BOS C;  3VUY A;  2HD5 B;  3V6E B;  3VQI A;  1T0Y A;  1UZX B;  5G55 A;  5LXH A;  2D10 A;  1M94 A;  1WI0 A;  2N7E A;  1WMH A;  3CSF A;  1LFD A;  2MW5 A;  2N9E B;  2W9N A;  2BWE S;  2KKC A;  1WRD B;  2FUH B;  2C7H A;  1V6E A;  3QCA A;  3PS6 A;  4W9F A;  5EDS A;  4K1R B;  1SE9 A;  4GXB A;  3IG3 A;  1EO6 A;  3DBH I;  1E8X A;  3M3J A;  2IY1 B;  3OAW A;  2JXX A;  1S3S G;  4EZL A;  2OJR A;  5DPS A;  4EEW A;  3PHW B;  2K39 A;  1AAR A;  4OVU A;  1HE8 A;  1D3Z A;  2JVC A;  2JT4 B;  4W9I A;  5DPT A;  2LWP A;  2KDI A;  3HM6 X;  5D94 A;  4KDI C;  3NHE B;  3KVF B;  3JSV B;  3TMP B;  4F1S A;  2IZV B;  2MX2 A;  3A1Q B;  4BFR A;  5HKH A;  1F9J A;  2EMT A;  3KH0 A;  2KAN A;  3WAM A;  3M62 B;  3RUL A;  1YIW A;  4TQ0 A;  4LJP B;  1KM7 A;  2B3A A;  2D3G A;  4KVG B;  4MDK E;  4MGY E;  3IFW B;  1H8C A;  2GBK A;  4GDL A;  4HVB A;  4TQ1 A;  2FAZ A;  4WAA A;  4MSM B;  3V60 A;  3MTN B;  3HIZ A;  3APF A;  3QWZ B;  2LI5 A;  4E3C A;  1WGH A;  2HE7 A;  5E6O A;  2L05 A;  2KX0 A;  3H1U A;  4RM8 A;  2KFJ A;  5AZH A;  4GIV A;  5CHW A;  4BKG A;  2JWZ A;  4DHZ B;  2WWZ A;  4AJW A;  4URK A;  1XD3 B;  3T9L A;  4K7S A;  2KK8 A;  2KHW B;  3PRM B;  5IA7 A;  3H9D A;  3PVL A;  3A33 B;  1Z5S B;  1WY8 A;  5J2R A;  4HPL B;  4B95 A;  1SIF A;  2NPT B;  3DBR I;  3L54 A;  3L16 A;  3OLM D;  2R2Q A;  3H6N A;  3L0W B;  4W9C A;  3W1Y A;  1X1M A;  4DK5 A;  2KTR A;  3U8Z A;  4NAW B;  4P7I A;  3SU8 X;  3UIN B;  3PLV A;  2OOB B;  3DCG A;  4MJS B;  2K8H A;  4KV2 A;  2KLC A;  1WR1 A;  2WDT B;  4PYZ A;  2GOW A;  4JLC A;  4EZK A;  3N30 A;  1WX8 A;  1G6J A;  4LJO B;  4KSK C;  2K6Q A;  3WA0 A;  3DQV A;  4ICU A;  2MA9 B;  1LM8 B;  2RR9 A;  3BY4 B;  2CHX A;  2GBR A;  2KTF A;  2G4D B;  3A4S C;  4GDK A;  4HDO A;  4MSQ B;  4EUT A;  3R7R A;  3K9P B;  4JGH B;  3HK0 A;  2JY6 A;  2J7Q B;  2REX A;  3APD A;  3V61 A;  4B6W A;  5D2M B;  2KO3 A;  4HXD A;  4OVV A;  1GC6 A;  2BGF A;  2ZJD A;  3QQ8 B;  3PV1 A;  2RSU A;  1V86 A;  3RZF A;  1YX5 B;  1E8Y A;  2ZPY A;  4WJP A;  3TCA A;  4DWF A;  1YX6 B;  1P98 A;  2RD0 A;  3L10 B;  4HDQ A;  4ANX A;  3KUC B;  2JF5 A;  2L7R A;  2M17 A;  4IWQ A;  4NPN A;  4TUU A;  4WWP A;  2JRH A;  2KJ6 A;  1KLV A;  1C1Y B;  2K6D B;  4DXA B;  4NY0 A;  1LXD A;  2YLM A;  1GC7 A;  3DDC B;  2CHZ A;  4DBG A;  2QHO A;  4WJO A;  2MRP A;  4II2 B;  2NPT A;  1TZ1 A;  2KMA A;  4PYU A;  4WWN A;  3ALB A;  3ZNZ B;  2XK5 B;  1E8Z A;  2KNB A;  3CST A;  3CF6 E;  1WXM A;  1P1A A;  4NAW A;  5KHO A;  3PPA A;  5L83 A;  4HLE A;  2DZI A;  2PJH A;  1WIA A;  3Q3J A;  4ANU A;  3R66 C;  2ZNV B;  3PRP B;  5JHA A;  5LXI B;  4K81 A;  3UIP B;  3VDZ A;  1Q5W B;  2EMS A;  1IYF A;  1ZGU B;  5JH5 C;  2LJ5 A;  3A9K A;  2N1V A;  2L0F A;  2LXC A;  3KYD D;  4JQW C;  2ZNV C;  2Y5B B;  4XZ4 A;  3PRE A;  4G0N B;  4IWP A;  5L95 C;  5E6N A;  5J18 A;  1OGW A;  2ZPN A;  3ZNG C;  3ZNI D;  4AP4 C;  3PGE A;  1WM2 A;  2LRU A;  2BPS A;  1S1Q B;  1XQQ A;  2ASQ A;  3B08 A;  2O2V A;  4MEM A;  3H7P A;  1E90 A;  1Z2M A;  3O65 B;  2L3Z A;  4FJV B;  3L17 A;  4PS8 A;  2KDF B;  2AEH A;  3SD5 A;  4B9K A;  4BOZ B;  1V80 A;  1C3T A;  4W9L A;  4HJK A;  2ZCC A;  3QAR A;  3B1L X;  4CYE A;  3V6C B;  2MLB A;  2CS4 A;  4W9G A;  1WH3 A;  3PZD A;  4KZ0 A;  3QX1 A;  1WX9 A;  4KIK A;  5CX3 A;  2NVU I;  5AZF A;  3AI5 A;  4W9E A;  2MP2 B;  2C7M B;  3KUZ A;  3RYT A;  2GBJ A;  1A5R A;  4ANW A;  1NBF C;  2V4L A;  4GN1 A;  3JYU A;  2BKF A;  1P9D U;  1BT0 A;  2FCQ A;  2KQS A;  2ZCB A;  1WF9 A;  3L13 A;  2DHZ A;  3P2B A;  3TJP A;  4AWJ A;  1L2N A;  3AXC A;  3VFK A;  4IM0 A;  2KMC A;  1I35 A;  3UF8 A;  3OJ3 A;  3ONS A;  4BKT A;  2WYQ A;  5D7G A;  2DZM A;  2KD0 A;  1E5W A;  3RCZ A;  3ZDM C;  4GMV A;  1RRB A;  2ZZP B;  1GNU A;  4FN2 A;  2KDB A;  4MGI E;  2Z0E B;  4HPM B;  3ZRC A;  4IM3 A;  2KOX A;  5BO4 B;  4DHJ B;  1V49 A;  2FCN A;  2DYM A;  2IY0 B;  3X23 A;  1VCB A;  1VD2 A;  4WQO B;  3KYC D;  5CHF A;  1TGZ B;  3SDL C;  2NBV B;  2IO2 B;  1UD7 A;  4ZRK A;  3R3M A;  5LLI A;  3S2A A;  1WZ3 A;  2BYE A;  2ZVO A;  4NNJ B;  3QC8 B;  2O6V B;  2C9W B;  2PE9 A;  4JL9 A;  1WZ0 A;  2RGF A;  3SHQ A;  3ML8 A;  3QA8 A;  3PSE B;  4FHK A;  4FA6 A;  1ISN A;  2LVQ A;  2KC2 A;  1ZW7 A;  1TTN A;  4GU2 A;  2D2Q A;  3JSV A;  2UWQ A;  1UBQ A;  3A1Q A;  3A9J B;  2MBH A;  4KDL B;  1P3Q U;  2KQ7 A;  2LGD A;  2K1F A;  4ICV A;  1NDD A;  2BWF A;  2KVR A;  3IBE A;  2V3S A;  4ZRJ A;  2BYF A;  4XC2 A;  2M0X A;  1WJN A;  1R4N I;  2NCN A;  1Q0W B;  4MGZ E;  1V81 A;  2CU1 A;  1RFA A;  2KDE B;  3PT2 B;  2DAF A;  2KWV B;  2AWT A;  3AU4 A;  4W9D A;  4IC7 B;  1EF5 A;  2JZZ A;  2MBE A;  3M63 B;  3M95 A;  2LRW A;  3DBS A;  3IHP C;  3NZU A;  3WAL A;  1IP9 A;  4M0W B;  4E74 A;  5JHB A;  4F7Z A;  3EC8 A;  4FJY A;  4GGQ A;  4DHJ D;  2G4S A;  2LGY A;  1RLF A;  2FNJ B;  2GBN A;  2KZR A;  2YVC A;  3QK0 A;  4NQK E;  2MCN B;  1Y8R C;  2KN5 A;  2PE6 B;  2XBB C;  3RT3 B;  3PTF C;  3APC A;  1OEY A;  1WMH B;  2O6V D;  3NS8 A;  1WFY A;  4BKS D;  1U4A A;  4E71 A;  2AL3 A;  1L7Y A;  2NBU A;  3VTV A;  2WX0 A;  1GG3 A;  3DPD A;  1IPG A;  1E7V A;  3RD2 A;  3BIN A;  3N32 A;  2FID A;  2Z0D B;  2J0K A;  2JRI B;  4W9K A;  2N9P C;  4A3O A;  4MJS A;  2LGX A;  1YD8 U;  2GBM A;  1NI2 A;  1OTR B;  2KXJ A;  2WX1 A;  4ASW C;  2L00 B;  4IG7 B;  5C1Z A;  1XT9 B;  2N7D A;  3VAW A;  1YJ1 A;  3HHM A;  4TV3 A;  2HTH A;  4RM9 A;  3WAO A;  3ZNH B;  4MH0 E;  4ANV A;  2FIF A;  3KW5 B;  3VHT C;  1V9J A;  3VUW A;  2FCS A;  4NQL B;  1J8C A;  3OJ4 B;  3TBL D;  4AOF A;  2JUO A;  4IWO A;  2KFK B;  2PPH A;  3JVZ X;  1H4R A;  3DVG X;  4PS7 A;  1OQY A;  3QAQ A;  5E6P A;  3K9O B;  1MG8 A;  3JW0 X;  3L08 A;  3MJW A;  5DPR A;  3NY5 A;  2K25 A;  3DBL I;  5TR5 A;  4AUQ C;  1WR6 E;  2DAJ A;  2CKH B;  1UEL A;  3LJ3 A;  2KWC A;  4CO7 A;  1LQB A;  2IBI B;  2AYO B;  2PEA A;  4YL8 A;  3RZW C;  3MHS D;  4FAD A;  3B0A A;  3IVF A;  5J17 A;  3ZW3 A;  1K8R B;  4HK2 A;  4RMA A;  5CHV C;  1KJT A;  1WYW B;  5DCN A;  3VTU A;  3N3K B;  4W9J A;  3ZLZ A;  3U30 A;  1OEY J;  4HWI B;  2IYD B;  2C7N B;  1EF1 A;  2KJH B;  2XK5 A;  2KC1 A;  2LZ6 A;  3TIX A;  5DPW A;  4BBN C;  4K7W A;  1FXT B;  3VTW A;  3VUX A;  3ZTC A;  4A20 A;  3PRZ A;  3I3T B;  2KTR B;  2MBQ A;  1EUV B;  1WX7 A;  3X0W A;  1YQB A;  2A5U A;  3ECI A;  3R7Q A;  4M8M A;  3EFU A;  1WGG A;  1E7U A;  4I6P A;  3EHV A;  1R4M I;  1UGM A;  1V5O A;  2AL6 A;  2LUE A;  4X57 B;  3ZKJ C;  4I6N B;  3V62 A;  1WXS A;  2BKR B;  4M8N A;  1KOT A;  1WGD A;  2DYO A;  2GMI C;  2K8B A;  3DVG Y;  4GDK B;  3VH4 B;  4MM3 A;  4II3 B;  1V5T A;  3W1S C;  2KFK A;  4HCP B;  3ZO5 B;  2KLG A;  3AUL A;  3GZN I;  5JZE B;  3DVN V;  1GUA B;  2LVO A;  4WJN A;  1WJ4 A;  1I42 A;  3Q3F A;  2JPH A;  4PS3 A;  4XX5 A;  4DDI D;  2DZJ A;  1WM3 A;  2I1J A;  4LDT B;  2J0M A;  4TKN A;  2MQJ A;  4KZC A;  5C23 A;  4NJ7 A;  2BYV E;  4F8C B;  3WIM A;  2NS5 A;  4IUM B;  2RPQ A;  3UIO B;  2K8C A;  2KWU B;  1PQS A;  1ZKH A;  2BF8 B;  4G3X B;  3QHT A;  4EFO A;  2KJR A;  4EOY A;  3WAP A;  1Q1O A;  3VH3 B;  3ZRF A;  5AEK B;  4A3P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...