2YMEA

Crystal structure of a mutant binding protein (5htbp-achbp) in complex with granisetron
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
205
structure length
205
Chain Sequence
QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYWERQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
publication title Structural Basis of Ligand Recognition in 5-Ht3 Receptors.
pubmed doi rcsb
source organism Aplysia californica
molecule tags Receptor
total genus 47
structure length 205
sequence length 205
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2012-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2ymeA00
5FJVA 4AFGA 5AFKA 2XZ6A 4LMLA 4Z90A 2XNUA 2YMDA 4QAAA 2XQ7A 4WV9A 4XK9A 2BYRA 4BQTA 5KE4A 2Y56A 4AFHA 2YOEA 4UM3A 3WIPA 3WTNA 3IGQA 2XQ8A 5HCMA 4XHEA 4HFIA 4UXUA 3TLWA 2WNLA 4EZ1A 2BG9B 2XQAA 4ZR6A 4ALXA 4COFA 2ZJUA 4UM3P 2XYTA 4F8HA 4A98A 2YMEA 3SQ6A 5BP0A 2X00D 4QH5A 5L47A 3EI0A 5BRXA 2BYNA 1UX2A 3P4WA 4UM3S 4QACA 3ZDGA 2Y54A 3WTIA 5HEOA 4LMJA 4FRRA 5AFNA 2XYSA 4PIRA 4ZZBA 4ILBA 4HFDA 2ZJVA 2XNTA 3JAFA 2XQ5A 3TLTA 4ZK1A 3T4MA 2BR7A 5AFMB 5HEUA 5JMEA 5J0ZA 4NPPA 4TWHA 2VL0A 3SIOA 3U8NA 2YKSA 2BG9E 5HEHA 4HQPA 2UZ6A 5TVCA 3UU5A 2BJ0A 3RHWA 2PGZA 4TNVA 4BFQA 5LG3A 2W8GA 3WTHA 4A97A 3RIAA 3UU6A 4AFTA 4X5TA 3WTKA 5HEGA 3TLSA 2PH9A 4UM1A 3U8KA 5J5IA 5L4EA 2BR8A 4ZRUA 5L4HA 5AFMA 3UU3A 3ZKRA 3TLUA 2XQ3A 3ZDHA 5AFLA 2WNCA 3C84A 4IL4A 3TLVA 3LSVA 2XZ5A 3SH1A 1UW6A 3UQ4A 3EAMA 2BYSA 2WN9A 4HFHA 2XQ6A 4QH1A 2X00A 5CFBA 3RQUA 2BG9A 4HFCA 2Y58A 2XQ9A 2C9TA 2Y57A 2BYPA 5J5FA 5LXBA 4DBMA 4TNWA 5J5GA 4B5DA 2WZYA 4NZBA 5BW2A 3C79A 3WTLA 3U8MA 2XQ4A 3RQWA 4ZZCA 5AFHA 3RI5A 3RIFA 3UQ7A 1UV6A 3GUAA 4Z91A 2BG9C 3U8JA 3UU8A 2BYQA 4IREA 3WTMA 3WTOA 4ILCA 4LMKA 2W8FA 3PEOA 4ZJTA 4IL9A 3U8LA 3WTJA 5HEJA 2QC1B 3JADA 5J5HA 2Y7YA 4D01A 5HCJA 4ILAA 3SQ9A 3JAEA 4QH4A 5IUXA 2XNVA 3P50A 5CO5A 5AINA 2WNJA 4HFBA 5KZUA 3EHZA 4ZJSA 4ZK4A 5AFJA 4HFEA 2YN6A 4QABA 1I9BA 3UU4A 4TWFA 3PMZA 5SYOA 4UY2A 3UUBA 4TWDA
chains in the Genus database with same CATH superfamily
5FJVA 4AFGA 5AFKA 2XZ6A 4LMLA 4Z90A 2XNUA 2YMDA 4QAAA 2XQ7A 4WV9A 4XK9A 2BYRA 4BQTA 5KE4A 2Y56A 4AFHA 2YOEA 4UM3A 3WIPA 3WTNA 3IGQA 2XQ8A 5HCMA 4XHEA 4HFIA 4UXUA 3TLWA 2WNLA 4EZ1A 2BG9B 2XQAA 4ZR6A 4ALXA 4COFA 2ZJUA 4UM3P 2XYTA 4F8HA 4A98A 2YMEA 3SQ6A 5BP0A 2X00D 4QH5A 5L47A 3EI0A 5BRXA 2BYNA 1UX2A 3P4WA 4UM3S 4QACA 3ZDGA 2Y54A 3WTIA 5HEOA 4LMJA 4FRRA 5AFNA 2XYSA 4PIRA 4ZZBA 4ILBA 4HFDA 2ZJVA 2XNTA 3JAFA 2XQ5A 3TLTA 4ZK1A 3T4MA 2BR7A 5AFMB 5HEUA 5JMEA 5J0ZA 4NPPA 4TWHA 2VL0A 3SIOA 3U8NA 2YKSA 2BG9E 5HEHA 4HQPA 2UZ6A 5TVCA 3UU5A 2BJ0A 3RHWA 2PGZA 4TNVA 4BFQA 5LG3A 2W8GA 3WTHA 4A97A 3RIAA 3UU6A 4AFTA 4X5TA 3WTKA 5HEGA 3TLSA 2PH9A 4UM1A 3U8KA 5J5IA 5L4EA 2BR8A 4ZRUA 5L4HA 5AFMA 3UU3A 3ZKRA 3TLUA 2XQ3A 3ZDHA 5AFLA 2WNCA 3C84A 4IL4A 3TLVA 3LSVA 2XZ5A 3SH1A 1UW6A 3UQ4A 3EAMA 2BYSA 2WN9A 4HFHA 2XQ6A 4QH1A 2X00A 5CFBA 3RQUA 2BG9A 4HFCA 2Y58A 2XQ9A 2C9TA 2Y57A 2BYPA 5J5FA 5LXBA 4DBMA 4TNWA 5J5GA 4B5DA 2WZYA 4NZBA 5BW2A 3C79A 3WTLA 3U8MA 2XQ4A 3RQWA 4ZZCA 5AFHA 3RI5A 3RIFA 3UQ7A 1UV6A 3GUAA 4Z91A 2BG9C 3U8JA 3UU8A 2BYQA 4IREA 3WTMA 3WTOA 4ILCA 4LMKA 2W8FA 3PEOA 4ZJTA 4IL9A 3U8LA 3WTJA 5HEJA 2QC1B 3JADA 5J5HA 2Y7YA 4D01A 5HCJA 4ILAA 3SQ9A 3JAEA 4QH4A 5IUXA 2XNVA 3P50A 5CO5A 5AINA 2WNJA 4HFBA 5KZUA 3EHZA 4ZJSA 4ZK4A 5AFJA 4HFEA 2YN6A 4QABA 1I9BA 3UU4A 4TWFA 3PMZA 5SYOA 4UY2A 3UUBA 4TWDA
chains in the Genus database with same CATH topology
5FJVA 4AFGA 5AFKA 2XZ6A 4LMLA 4Z90A 2XNUA 2YMDA 4QAAA 2XQ7A 4WV9A 4XK9A 2BYRA 4BQTA 5KE4A 2Y56A 4AFHA 2YOEA 4UM3A 3WIPA 3WTNA 3IGQA 2XQ8A 5HCMA 4XHEA 4HFIA 4UXUA 3TLWA 2WNLA 4EZ1A 2BG9B 2XQAA 4ZR6A 4ALXA 4COFA 2ZJUA 4UM3P 2XYTA 4F8HA 4A98A 2YMEA 3SQ6A 5BP0A 2X00D 4QH5A 5L47A 3EI0A 5BRXA 2BYNA 1UX2A 3P4WA 4UM3S 4QACA 3ZDGA 2Y54A 3WTIA 5HEOA 4LMJA 4FRRA 5AFNA 2XYSA 4PIRA 4ZZBA 4ILBA 4HFDA 2ZJVA 2XNTA 3JAFA 2XQ5A 3TLTA 4ZK1A 3T4MA 2BR7A 5AFMB 5HEUA 5JMEA 5J0ZA 4NPPA 4TWHA 2VL0A 3SIOA 3U8NA 2YKSA 2BG9E 5HEHA 4HQPA 2UZ6A 5TVCA 3UU5A 2BJ0A 3RHWA 2PGZA 4TNVA 4BFQA 5LG3A 2W8GA 3WTHA 4A97A 3RIAA 3UU6A 4AFTA 4X5TA 3WTKA 5HEGA 3TLSA 2PH9A 4UM1A 3U8KA 5J5IA 5L4EA 2BR8A 4ZRUA 5L4HA 5AFMA 3UU3A 3ZKRA 3TLUA 2XQ3A 3ZDHA 5AFLA 2WNCA 3C84A 4IL4A 3TLVA 3LSVA 2XZ5A 3SH1A 1UW6A 3UQ4A 3EAMA 2BYSA 2WN9A 4HFHA 2XQ6A 4QH1A 2X00A 5CFBA 3RQUA 2BG9A 4HFCA 2Y58A 2XQ9A 2C9TA 2Y57A 2BYPA 5J5FA 5LXBA 4DBMA 4TNWA 5J5GA 4B5DA 2WZYA 4NZBA 5BW2A 3C79A 3WTLA 3U8MA 2XQ4A 3RQWA 4ZZCA 5AFHA 3RI5A 3RIFA 3UQ7A 1UV6A 3GUAA 4Z91A 2BG9C 3U8JA 3UU8A 2BYQA 4IREA 3WTMA 3WTOA 4ILCA 4LMKA 2W8FA 3PEOA 4ZJTA 4IL9A 3U8LA 3WTJA 5HEJA 2QC1B 3JADA 5J5HA 2Y7YA 4D01A 5HCJA 4ILAA 3SQ9A 3JAEA 4QH4A 5IUXA 2XNVA 3P50A 5CO5A 5AINA 2WNJA 4HFBA 5KZUA 3EHZA 4ZJSA 4ZK4A 5AFJA 4HFEA 2YN6A 4QABA 1I9BA 3UU4A 4TWFA 3PMZA 5SYOA 4UY2A 3UUBA 4TWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FJV A;  4AFG A;  5AFK A;  2XZ6 A;  4LML A;  4Z90 A;  2XNU A;  2YMD A;  4QAA A;  2XQ7 A;  4WV9 A;  4XK9 A;  2BYR A;  4BQT A;  5KE4 A;  2Y56 A;  4AFH A;  2YOE A;  4UM3 A;  3WIP A;  3WTN A;  3IGQ A;  2XQ8 A;  5HCM A;  4XHE A;  4HFI A;  4UXU A;  3TLW A;  2WNL A;  4EZ1 A;  2BG9 B;  2XQA A;  4ZR6 A;  4ALX A;  4COF A;  2ZJU A;  4UM3 P;  2XYT A;  4F8H A;  4A98 A;  2YME A;  3SQ6 A;  5BP0 A;  2X00 D;  4QH5 A;  5L47 A;  3EI0 A;  5BRX A;  2BYN A;  1UX2 A;  3P4W A;  4UM3 S;  4QAC A;  3ZDG A;  2Y54 A;  3WTI A;  5HEO A;  4LMJ A;  4FRR A;  5AFN A;  2XYS A;  4PIR A;  4ZZB A;  4ILB A;  4HFD A;  2ZJV A;  2XNT A;  3JAF A;  2XQ5 A;  3TLT A;  4ZK1 A;  3T4M A;  2BR7 A;  5AFM B;  5HEU A;  5JME A;  5J0Z A;  4NPP A;  4TWH A;  2VL0 A;  3SIO A;  3U8N A;  2YKS A;  2BG9 E;  5HEH A;  4HQP A;  2UZ6 A;  5TVC A;  3UU5 A;  2BJ0 A;  3RHW A;  2PGZ A;  4TNV A;  4BFQ A;  5LG3 A;  2W8G A;  3WTH A;  4A97 A;  3RIA A;  3UU6 A;  4AFT A;  4X5T A;  3WTK A;  5HEG A;  3TLS A;  2PH9 A;  4UM1 A;  3U8K A;  5J5I A;  5L4E A;  2BR8 A;  4ZRU A;  5L4H A;  5AFM A;  3UU3 A;  3ZKR A;  3TLU A;  2XQ3 A;  3ZDH A;  5AFL A;  2WNC A;  3C84 A;  4IL4 A;  3TLV A;  3LSV A;  2XZ5 A;  3SH1 A;  1UW6 A;  3UQ4 A;  3EAM A;  2BYS A;  2WN9 A;  4HFH A;  2XQ6 A;  4QH1 A;  2X00 A;  5CFB A;  3RQU A;  2BG9 A;  4HFC A;  2Y58 A;  2XQ9 A;  2C9T A;  2Y57 A;  2BYP A;  5J5F A;  5LXB A;  4DBM A;  4TNW A;  5J5G A;  4B5D A;  2WZY A;  4NZB A;  5BW2 A;  3C79 A;  3WTL A;  3U8M A;  2XQ4 A;  3RQW A;  4ZZC A;  5AFH A;  3RI5 A;  3RIF A;  3UQ7 A;  1UV6 A;  3GUA A;  4Z91 A;  2BG9 C;  3U8J A;  3UU8 A;  2BYQ A;  4IRE A;  3WTM A;  3WTO A;  4ILC A;  4LMK A;  2W8F A;  3PEO A;  4ZJT A;  4IL9 A;  3U8L A;  3WTJ A;  5HEJ A;  2QC1 B;  3JAD A;  5J5H A;  2Y7Y A;  4D01 A;  5HCJ A;  4ILA A;  3SQ9 A;  3JAE A;  4QH4 A;  5IUX A;  2XNV A;  3P50 A;  5CO5 A;  5AIN A;  2WNJ A;  4HFB A;  5KZU A;  3EHZ A;  4ZJS A;  4ZK4 A;  5AFJ A;  4HFE A;  2YN6 A;  4QAB A;  1I9B A;  3UU4 A;  4TWF A;  3PMZ A;  5SYO A;  4UY2 A;  3UUB A;  4TWD A; 
#chains in the Genus database with same CATH topology
 5FJV A;  4AFG A;  5AFK A;  2XZ6 A;  4LML A;  4Z90 A;  2XNU A;  2YMD A;  4QAA A;  2XQ7 A;  4WV9 A;  4XK9 A;  2BYR A;  4BQT A;  5KE4 A;  2Y56 A;  4AFH A;  2YOE A;  4UM3 A;  3WIP A;  3WTN A;  3IGQ A;  2XQ8 A;  5HCM A;  4XHE A;  4HFI A;  4UXU A;  3TLW A;  2WNL A;  4EZ1 A;  2BG9 B;  2XQA A;  4ZR6 A;  4ALX A;  4COF A;  2ZJU A;  4UM3 P;  2XYT A;  4F8H A;  4A98 A;  2YME A;  3SQ6 A;  5BP0 A;  2X00 D;  4QH5 A;  5L47 A;  3EI0 A;  5BRX A;  2BYN A;  1UX2 A;  3P4W A;  4UM3 S;  4QAC A;  3ZDG A;  2Y54 A;  3WTI A;  5HEO A;  4LMJ A;  4FRR A;  5AFN A;  2XYS A;  4PIR A;  4ZZB A;  4ILB A;  4HFD A;  2ZJV A;  2XNT A;  3JAF A;  2XQ5 A;  3TLT A;  4ZK1 A;  3T4M A;  2BR7 A;  5AFM B;  5HEU A;  5JME A;  5J0Z A;  4NPP A;  4TWH A;  2VL0 A;  3SIO A;  3U8N A;  2YKS A;  2BG9 E;  5HEH A;  4HQP A;  2UZ6 A;  5TVC A;  3UU5 A;  2BJ0 A;  3RHW A;  2PGZ A;  4TNV A;  4BFQ A;  5LG3 A;  2W8G A;  3WTH A;  4A97 A;  3RIA A;  3UU6 A;  4AFT A;  4X5T A;  3WTK A;  5HEG A;  3TLS A;  2PH9 A;  4UM1 A;  3U8K A;  5J5I A;  5L4E A;  2BR8 A;  4ZRU A;  5L4H A;  5AFM A;  3UU3 A;  3ZKR A;  3TLU A;  2XQ3 A;  3ZDH A;  5AFL A;  2WNC A;  3C84 A;  4IL4 A;  3TLV A;  3LSV A;  2XZ5 A;  3SH1 A;  1UW6 A;  3UQ4 A;  3EAM A;  2BYS A;  2WN9 A;  4HFH A;  2XQ6 A;  4QH1 A;  2X00 A;  5CFB A;  3RQU A;  2BG9 A;  4HFC A;  2Y58 A;  2XQ9 A;  2C9T A;  2Y57 A;  2BYP A;  5J5F A;  5LXB A;  4DBM A;  4TNW A;  5J5G A;  4B5D A;  2WZY A;  4NZB A;  5BW2 A;  3C79 A;  3WTL A;  3U8M A;  2XQ4 A;  3RQW A;  4ZZC A;  5AFH A;  3RI5 A;  3RIF A;  3UQ7 A;  1UV6 A;  3GUA A;  4Z91 A;  2BG9 C;  3U8J A;  3UU8 A;  2BYQ A;  4IRE A;  3WTM A;  3WTO A;  4ILC A;  4LMK A;  2W8F A;  3PEO A;  4ZJT A;  4IL9 A;  3U8L A;  3WTJ A;  5HEJ A;  2QC1 B;  3JAD A;  5J5H A;  2Y7Y A;  4D01 A;  5HCJ A;  4ILA A;  3SQ9 A;  3JAE A;  4QH4 A;  5IUX A;  2XNV A;  3P50 A;  5CO5 A;  5AIN A;  2WNJ A;  4HFB A;  5KZU A;  3EHZ A;  4ZJS A;  4ZK4 A;  5AFJ A;  4HFE A;  2YN6 A;  4QAB A;  1I9B A;  3UU4 A;  4TWF A;  3PMZ A;  5SYO A;  4UY2 A;  3UUB A;  4TWD A; 
#chains in the Genus database with same CATH homology
 5FJV A;  4AFG A;  5AFK A;  2XZ6 A;  4LML A;  4Z90 A;  2XNU A;  2YMD A;  4QAA A;  2XQ7 A;  4WV9 A;  4XK9 A;  2BYR A;  4BQT A;  5KE4 A;  2Y56 A;  4AFH A;  2YOE A;  4UM3 A;  3WIP A;  3WTN A;  3IGQ A;  2XQ8 A;  5HCM A;  4XHE A;  4HFI A;  4UXU A;  3TLW A;  2WNL A;  4EZ1 A;  2BG9 B;  2XQA A;  4ZR6 A;  4ALX A;  4COF A;  2ZJU A;  4UM3 P;  2XYT A;  4F8H A;  4A98 A;  2YME A;  3SQ6 A;  5BP0 A;  2X00 D;  4QH5 A;  5L47 A;  3EI0 A;  5BRX A;  2BYN A;  1UX2 A;  3P4W A;  4UM3 S;  4QAC A;  3ZDG A;  2Y54 A;  3WTI A;  5HEO A;  4LMJ A;  4FRR A;  5AFN A;  2XYS A;  4PIR A;  4ZZB A;  4ILB A;  4HFD A;  2ZJV A;  2XNT A;  3JAF A;  2XQ5 A;  3TLT A;  4ZK1 A;  3T4M A;  2BR7 A;  5AFM B;  5HEU A;  5JME A;  5J0Z A;  4NPP A;  4TWH A;  2VL0 A;  3SIO A;  3U8N A;  2YKS A;  2BG9 E;  5HEH A;  4HQP A;  2UZ6 A;  5TVC A;  3UU5 A;  2BJ0 A;  3RHW A;  2PGZ A;  4TNV A;  4BFQ A;  5LG3 A;  2W8G A;  3WTH A;  4A97 A;  3RIA A;  3UU6 A;  4AFT A;  4X5T A;  3WTK A;  5HEG A;  3TLS A;  2PH9 A;  4UM1 A;  3U8K A;  5J5I A;  5L4E A;  2BR8 A;  4ZRU A;  5L4H A;  5AFM A;  3UU3 A;  3ZKR A;  3TLU A;  2XQ3 A;  3ZDH A;  5AFL A;  2WNC A;  3C84 A;  4IL4 A;  3TLV A;  3LSV A;  2XZ5 A;  3SH1 A;  1UW6 A;  3UQ4 A;  3EAM A;  2BYS A;  2WN9 A;  4HFH A;  2XQ6 A;  4QH1 A;  2X00 A;  5CFB A;  3RQU A;  2BG9 A;  4HFC A;  2Y58 A;  2XQ9 A;  2C9T A;  2Y57 A;  2BYP A;  5J5F A;  5LXB A;  4DBM A;  4TNW A;  5J5G A;  4B5D A;  2WZY A;  4NZB A;  5BW2 A;  3C79 A;  3WTL A;  3U8M A;  2XQ4 A;  3RQW A;  4ZZC A;  5AFH A;  3RI5 A;  3RIF A;  3UQ7 A;  1UV6 A;  3GUA A;  4Z91 A;  2BG9 C;  3U8J A;  3UU8 A;  2BYQ A;  4IRE A;  3WTM A;  3WTO A;  4ILC A;  4LMK A;  2W8F A;  3PEO A;  4ZJT A;  4IL9 A;  3U8L A;  3WTJ A;  5HEJ A;  2QC1 B;  3JAD A;  5J5H A;  2Y7Y A;  4D01 A;  5HCJ A;  4ILA A;  3SQ9 A;  3JAE A;  4QH4 A;  5IUX A;  2XNV A;  3P50 A;  5CO5 A;  5AIN A;  2WNJ A;  4HFB A;  5KZU A;  3EHZ A;  4ZJS A;  4ZK4 A;  5AFJ A;  4HFE A;  2YN6 A;  4QAB A;  1I9B A;  3UU4 A;  4TWF A;  3PMZ A;  5SYO A;  4UY2 A;  3UUB A;  4TWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...