2YMLA

Native l-haloacid dehalogenase from a rhodobacteraceae family bacterium
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
228
structure length
228
Chain Sequence
PSRSGILVFDVNETLLDLTSLSPLFERVFGDAKVLREWFPELILYSQTLTLTGLYRPFGEIAAAVFEMVAANHQAKVTPDDIAELKTRLTSMPAYPDVAPALTRLQDAGFRLVTLTNSAPSPAPSPLEKAGIASFFEAHLTVHSSQRFKPHPSVYDSTAETLGAKPEELCMIACHIWDTIGAQARGWRGGFVARPHNTPLTLAEVPQPDFIGRDMGELADQLIASLTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Marine Rhodobacteraceae L-Haloacid Dehalogenase Contains a Novel His/Glu Dyad that Could Activate the Catalytic Water.
pubmed doi rcsb
source organism Rhodobacteraceae
molecule tags Hydrolase
molecule keywords L-HALOACID DEHALOGENASE
total genus 87
structure length 228
sequence length 228
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2ymlA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2ymlA01
5AVZA 2ZBDA 1RKUA 5AK5A 3KD3A 5ALOA 5AW7A 3QUQA 1QQ7A 4EX6A 1VJ5A 4EZEA 3KC2A 4BKMA 3QLEA 4NFLA 3OTQA 4CF4A 3QU5A 4G9BA 3EF0A 5AVRA 2G09A 3SKYA 4F71A 3E84A 5AI5A 1RKQA 1U2SA 2O2XA 1T5SA 2B1RA 1U7PA 3FGOA 2YMLA 5AW6A 3WKBA 4EELA 2BDEA 1RMQA 3EF1A 1RQLA 3AR9A 2WHEA 2P69A 3L8FA 3TLMA 4DW8A 2IA5A 2Q5EA 3L7YA 4Y2XA 2EATA 2GFHA 3BA6A 5AW3A 5ALMA 2JARA 3A1CA 1YJ5A 2WF7A 3W5BA 3L8GA 4YGYA 3DAOA 2YY6A 3SHQA 1WPGA 2NO4A 3BWVA 2YJ3A 3W5AA 3L1UA 5AIAA 2B30A 4MWOA 5AKHA 2B0CA 2W43A 5ALIA 1Q92A 3EPRA 3F9RA 1RMYA 1YNSA 4UMFA 4AS2A 5AW1A 3SF0A 1CR6A 5AW2A 3NIWA 5ALKA 1TA0A 4FE3A 2G06A 3U7GA 2WF9A 4KYTA 4CE6A 3QUCA 4XPZA 2HI0A 1NF2A 1SWWA 1NNLA 2Q4TA 3L0YA 3IB6A 2BDUA 2HEGA 3ZVNA 3I76A 3OPXA 3ZTWA 1Z4NA 1ZS9A 3ZU6A 2P11A 3OCXA 1YDFA 1L7OA 2O9JA 4Y2PA 4PNHA 5AVXA 5AM0A 1N8NA 2AUTA 2DQSA 5ALVA 3AR7A 1Z4MA 1EK2A 2GMWA 5A3RA 4EEKA 1Z4OA 4KX3A 3WGUA 2EAUA 5AKXA 2CFSA 2CN1A 4L57A 1L6RA 3OCWA 4JB3A 2C88A 4CF5A 1RDFA 4I9FA 3U7HB 3A1EA 3FM9A 1Q91A 5AI4A 1L8OA 3AR6A 1RQNA 1ZD5A 2B8EA 1ZD4A 3ZI4A 2Q4RA 5ALGA 1YS9A 3QNMA 4F72A 2R8XA 3E58A 4Y2JA 3QU2A 2HOQA 2P9JA 1XVIA 1IWOA 5ALQA 4NABA 1Z4QA 4UAVA 5ALYA 2QYHA 4UATA 4UW9A 3MC1A 5ALNA 4FYPA 4BX2A 5IS2A 3M1YA 2OM6A 3K1ZA 1YV9A 4GXTA 4KN8A 3ZX4A 4BEVA 5AK6A 4BYGA 1Z4JA 5AVWA 4KNVA 2HHLA 5ALWA 2R8ZA 4HGQA 1ZOLA 1WZCA 3W5DA 3N5KA 3KZXA 4L6CA 3QYPA 5AESA 2PR7A 4ZEWA 3N07A 3SMVA 2FDRA 3ET4A 1VJRA 4NAVA 3ZWKA 1RLOA 2I55A 2PQ0A 4AS3A 2P27A 4OHFA 4UMEA 4UU0A 1RPZA 4HGOA 5IT4A 3MPOA 5ALHA 2B1QA 2RBKA 3NUQA 3WK8A 3MMZA 2ZXEA 2NYVA 4UASA 2RARA 4XE5A 1S8OA 2HCFA 1SU4A 4GIBA 1VFPA 3OCVA 1N9KA 2HX1A 5AM2A 3WKEA 2D2VA 2YJ6A 4CNQA 5AVQA 4H1WA 1RMTA 1RRCA 2IOFK 2GHTA 3L5KA 2YMQA 1TJ5A 5AKZA 5AKYA 2JAOA 4KX5A 3HYCA 3UMCA 4DCCA 5ALZA 5AM4A 1QQ5A 2WF5A 4J03A 3UMBA 2GO7A 4KNWA 3ZUPA 1FEZA 4YCMA 4RESA 3WK4A 5ALUA 2OBBA 3S6JA 2I34A 2I7DA 3OCUA 2FUCA 3SD7A 3I6BA 4OD0A 2PKEA 4HAIA 3HLTA 2GHQA 5AHXA 2MU2A 2ZOSA 1LTQA 2EARA 2WF6A 3WK9A 1ZRNA 3QU9A 3ONNA 4UM5A 2HO4A 3U26A 4AP9A 2AGVA 3ZX5A 1WR8A 1CQZA 4Y2UA 3WKCA 3FVVA 1TE2A 3WKAA 1S2OA 3AR2A 4UMDA 4YIHA 5AVSA 2R8YA 4FFDA 2W4MA 4YH1A 2HSZA 5AW0A 1F5SA 5AVTA 5AVUA 1QQ6A 2I33A 4DFDA 5AKKA 2YMMA 4BNDB 1Z5UA 2WF8A 1U7OA 3L8HA 3U7FB 3EWIA 2AH5A 3IJ5A 3VAYA 1L7NA 4I9GA 1QYIA 2IYEA 3GYGA 3ZVLA 3ZW7A 1Z88A 3U19A 3AR4A 3E81A 2YJ5A 1L7MA 3WGVA 1YMQA 4IG4A 4L6AA 4BBJA 2YBDA 5ALJA 3FZQA 4HGPA 3KDPA 4MUMA 3ED5A 3DNPA 2X4DA 1QH9A 2IOFA 3QX7A 4Y3UA 5AICA 5ALRA 2CFRA 4UMVA 2JAWA 2IOHA 1Z4LA 2BY4A 1T5TA 2JGAA 2OA0A 5AI8A 3ZVMA 5AM3A 4UU1A 4Y2TA 5ALXA 4C4RA 1J8DA 1RC8A 4HGNA 3PGVA 1Y8AA 3B8EA 4QQFA 5ALDA 3UMGA 2I54A 3U7EB 1XPJA 4Y2SA 4YCLA 5AK3A 4G63A 4B6JA 4Y2RA 2CFTA 4E88A 4YIKA 3RFUA 5AI0A 3CZ4A 4XQ0A 2NO5A 2FPXA 3QXGA 1NRWA 2VKQA 3ESRA 3WK7A 3ZWDA 1JUDA 1L8LA 3N1UA 4QJBA 5AI6A 2FUEA 3NALA 4BEWA 1X42A 3W5CA 3DV9A 3OCZA 5AM1A 1XP5A 3PDWA 1RLTA 3FPBA 4UM7A 2ZBFA 5AVYA 3NASA 3N8GA 3QU7A 3L1VA 2OYCA 1MH9A 5T41A 2HDOA 5A3QA 5AI9A 5AKIA 5E0OA 3P96A 4IFTA 5ALSA 4UARA 4OFZA 1RLMA 5ALPA 3MN1A 1ZRMA 4RETA 4ZEVA 3B9RA 3R09A 2FPWA 4BX3A 1T9ZA 1LVHA 1ZJJA 3NRJA 2FPRA 5IT0A 2MSNA 4HGRA 2HF2A 3KOOA 5ALEA 5A3SA 1KYTA 3QGMA 1ZD3A 3WK6A 2ODAA 1WVIA 4J2TA 3PGLA 3L0BA 2QLTA 3I1YA 2G08A 4NWIA 5AVVA 1Z4IA 2YMPA 1ZD2P 5AKEA 1U02A 2C8LA 3WK5A 5ALTA 4C4TA 4DWOA 5AKGA 2FEAA 1AQ6A 3ET5A 2JAUA 5AW9A 3E8MA 5AKLA 3ESQA 4HYTA 5AW8A 3OCYA 4JDPA 3U13A 3QU4A 1O03A 3KBBA 2YN4A 3L8EA 4UAUA 1U2TA 3J7TA 5ALFA 4EENA 4YCNA 4OCZA 4Y2QA 2I6XA 2FPSA 2W11A 3R4CA 3B9BA 3SLRA 3RF6A 3WKDA 1RKVA 3L0CA 2FPUA 2YFYA 3DDHA 2AMYA 4XOUA 2ZG6A 5AKJA 4NV0A 3A3YA 3R9KA 2YJ4A 4ZEXA 3UM9A 5AW4A 4O8CA 3NAMA 3I28A 4C4SA 2MU1A 1Z4PX 5FP0A 3A1DA 2C4NA 3ZTYA 2ZBEA 1O08A 4EX7A 5AIBA 2R8EA 3PCTA 5AW5A 1Z5GA 3N28A 2B82A 2C8KA 3M9LA 3AR3A 2FI1A 3QUBA 1TJ3A 4Y2VA 4CF3A 5ALLA 3AR5A 1L7PA 1Z4KA 3SKXA 5JJBA 2C9MA 3NANA 2HF7A 3D6JA 4BX0A 1EK1A 2ZBGA 2G1AA 2WM8A 2G0AA 3FPSA 2G80A 3CNHA 1TJ4A 1PW5A 4BNDA 2WFAA 4Y2YA 2RAVA 1K1EA 1J97A 2G07A 1SWVA 2B8JA 5AK4A 3AR8A 2RB5A 3IRUA 5AM5A 3QUTA
chains in the Genus database with same CATH superfamily
4NI5A 4R41A 3JAMA 3I2JA 3RSZA 1RAIA 5K6TA 1JKFA 3QUQA 4YD1A 4DEYA 4RQ7A 4OXKA 2NU6A 4XUDA 2NTNA 4UUBA 3QU5A 4GW3A 3NH6A 4KZKA 5FEUA 4YAOA 4J9RA 3QOXA 4AZSA 2VH1A 3MGGA 3GPLA 1M6EX 1RR6A 2QZ4A 1QGED 2XUFA 1DAHA 1GZ5A 1M34A 2JD0A 5TDHA 1TQ6A 3L6OO 3T35A 5BSFA 3WNDA 2YQ4A 4DBVO 1MJNA 1O97D 4QASA 2DWUA 4O1HA 2FYTA 3UHOA 3TLMA 3GFBA 1J5PA 4NOKA 2PSJA 5AK0A 4F7WA 5AW3A 3RFTA 3TR5A 3F3SA 4LZJA 5F9NA 1GRQA 3NU1A 2CJXA 3FUVA 4Q12A 3I32A 4MS1B 1T8RA 3RU3A 4TQSA 3L8GA 4Q34A 1XELA 2NT3A 2GAAA 4DMUB 3FDSA 3OLXA 2C07A 1WXQA 4X93A 5I48A 1USVA 4JV0A 4KDCA 1ILWA 1V45E 2BM0A 1PK9A 1YBHA 3C5VA 6ADHA 4TSFD 1ODIA 3KS9A 5M04A 4B7ZA 4XWKA 1R8XA 1JHPA 1TA4A 3BTUA 4GVLA 5JQGF 4QU8A 5BNIA 5DBCA 4OGLA 4G0NA 1LI7A 2PNJA 1YU9A 3TMAA 2W43A 3KKAA 4G25A 1J2UA 5A9SB 3TTYA 1N2BA 2ZUSA 3KHKA 4LBWA 2QTMA 3H99A 4IIXA 2WRZA 3VAAA 2NPIA 5AW2A 1TKBA 5BYAA 1I94B 1VCOA 9ICKA 3AZOA 3MS7A 4JKYA 3PFIA 1WU7A 1R4MB 1JFFA 1V26A 3AY3A 4U0JA 1A9XA 3A9CA 3UK0A 1KGDA 4W9RA 2LYAA 2WJIA 2ZQYA 4PHHA 4WERA 2M98A 1KJZA 2R2GA 4GR4A 1XD2B 2RC5A 2QTLA 3O3NB 4FNOA 4G81A 4E2ZA 1BEUB 1MB2A 2C28A 1DL5A 1YULA 2OAQ1 3HJTA 4HB0A 2BISA 3IB6A 2FSIA 4DCVA 1E7SA 5BMVF 1KZ7B 2IC5A 2ECOA 2NZWA 2QENA 3N0WA 1WHTA 3L8CA 4F4UA 4RE5A 5F21A 1WS6A 2RAUA 1GM5A 5DDYA 2AUTA 3F9IA 3LT0A 3UA4A 1I24A 3WJ7A 3JASA 4YQEA 4TURA 4LMBA 4B17A 3KXDA 4AYXA 4L3VA 2P3QA 1EVYA 1C8BA 4MWSA 3K70B 1R88A 2D0IA 4KE8A 4R8MA 4FW9A 5JAHA 1LVUA 5G1PA 5GADl 2C2YA 3PSAA 4J7AA 4XDYA 2Q4OA 1FU4A 2X42A 3FFAA 1F44A 3TD6A 2WMDA 2FRDA 3W06A 3RHSA 4F4DA 4MKRA 4NESA 4UOZA 1SCQA 2CVFA 2NV6A 1LNZA 1NBOA 3L41A 2O5CA 2C7PA 1A6SA 1BYIA 2FMSA 2B8EA 4XR9A 3RUAA 3HL4A 4BNNA 1UXOA 1LW6E 1CW2B 2WWYA 1BKDR 4O1MA 1LSSA 2JHAA 1G17A 3H2IA 3ZHUA 3AW9A 1N5OX 4MX8A 4L9WA 4KQIA 3DMGA 3PFWO 3GLHB 3G2KA 3HB0A 1JAIA 1ULAA 1EX9A 2E9SA 2RG1A 4X60A 2XDQB 3Q3GE 1DDGA 4B6QA 2X0IA 1M2OA 1N6LA 3U40A 4CR6A 2OORC 3CMMA 4AJIA 2OKCA 3OEED 4ML3A 4UW9A 2IEYA 5IYZB 3OX2A 3L6RA 3NVAA 4UFNA 2CEAA 2NV2B 3K1ZA 2W2XA 4I2HA 4PSKA 3WR5A 2M6SA 3EBLA 4WCFA 4LX0A 5EWLB 1JHUA 2BEUA 1H2EA 1QHFA 2UVPB 4E4RA 1T9AA 2C4HA 4EHFA 1KP2A 4G9GA 1CK4A 1UIRA 1S02A 4KN5A 3HA5A 3RJJA 3G8CA 3HI6A 5LP6F 4YJ3F 1J7JA 4QHTA 5DCYA 4WLNA 3NCHA 4LHYA 2YYYA 7ICFA 3OQVA 5CB6A 4BNYA 3ENKA 2YX8A 3PQCA 3KCQA 4L6CA 1Z47A 4G4JA 5H70A 3CRXA 3Q40A 4M1SA 1GAEO 4FS1A 2BT4A 2O20A 3OURA 4MVXA 4LJ7A 3VSBA 1H5QA 1SB3C 1PHPA 3E9NA 3ENQA 3MA0A 2GFQA 4QFCA 2IWHA 2F3TA 4A23A 2VJMA 3INNA 1E0AA 5C81A 3PX0A 2AEJA 2YBEA 5IBQA 3SXUB 5BY2A 4RS4A 5LSAA 3UWDA 1GNPA 1D8YA 3O5AA 5A6SA 1ZU5A 3LX6A 2JGEA 1RZTA 2Y2UA 1E69A 1PD1A 4P31A 5DG7A 2AG1A 3GFFA 5IBCA 1MIHA 4B6FA 1EVEA 4QPNA 4F5ZA 1NNSA 4LQ4A 1DJNA 2DPYA 5CH3A 1WMBA 5KYWA 4TXLA 1XDBA 1YE5A 1IZ7A 1YRLA 2H7CA 2NSYA 2GN4A 3DHVA 3N7AA 4OBWA 4WNCA 3CVVA 2Z6AA 2K4HA 1VFPA 4JENA 3KT8A 4HCJA 4ZTUB 1BPXA 4EM6A 1Y42X 2ZI9A 1S2GA 4MUNA 5EIBD 5F3WB 2HCJB 1YC5A 1RYZA 4H7DA 1Q5PA 3F1LA 4K9OA 1DQYA 4WLFA 3H2JA 4JUZA 4ED8A 3LVFO 5IH7A 4YRRA 1BDJA 2O3TA 3R74A 4EABA 4YR7A 4ZMBA 5KFMA 4MKXA 1Q77A 1P6XA 1MOZA 3RYCA 4KX5A 3EA0A 2CDRA 4IKOA 1EFAA 2LMRA 5ALZA 1RPJA 5I4KA 3NP9A 2HBJA 3W04A 1U9IA 3NJRA 2HMSA 5ESDA 3COVA 2V0GA 1M3SA 1K5HA 1RHUA 1X7WB 1WV1A 1QVRA 5LYYA 2Q29A 2BR5A 3T3FA 3CLVA 3WYBA 2FW6A 1JEQA 4J1NA 2AXNA 2Y05A 3CZRA 4DAOA 2FZ4A 4HVLA 5B57C 5GAJA 4G0OA 4ECQA 1DAPA 3SZ3A 2C8VA 3HUUA 2E1EA 3EZFA 4S0XA 4PNPA 5I7HA 2UXCB 3L7CA 1O8BA 4K40A 1KBQA 4PZCA 2NLOA 3RRYA 3T4PA 1CZNA 2H7VA 2X7HA 3IXMA 1T3SA 2BEKA 2ODEA 1JHOA 3A6FA 3IURA 3NYIA 4DQRA 2BCEA 2FAXA 3DYVA 5E9AA 2Z8YM 4UM5A 2ZSDA 4PANA 2GEUA 5D51S 3H7IA 3NDJA 2K60A 4UDYX 2HJSA 1TE2A 2FQYA 3PRHA 4BB5A 1OBHA 5K0NA 4YIHA 4J0FA 2Y9UA 1F06A 4O4IB 1ZHHA 4TKUA 3QZ7A 4QX6A 5CEEA 4EITA 1DQNA 4PO1A 4IXTA 2A1UB 2QTVA 4HS9A 4C30A 4MWEA 4O33A 5I7VA 1T5HX 4TKUB 4XM0A 1OZGA 2A84A 4Q18A 3VDXA 6LDHA 1RE0A 4I5GA 4DIOA 2WU4A 2JLZA 1XCJA 2Q6LA 3PJGA 3FJYA 5P8WA 3HXMA 5SY9A 4KC0A 1JI7A 1GRVA 5FI1B 3BK7A 1ONPA 3K8QA 2C3UA 1KQ3A 4WSOA 4TRJA 1A2QA 5CFPA 1I30A 1II8A 2QSZA 3EVGA 3FWZA 4QZBA 4V0OA 4CEJA 1M0SA 4GRIA 1GA4A 3EZ6A 1ODLA 1SK9A 2IGTA 1KJWA 3NXKA 3BGVA 4PZLA 3EGWA 2X0RA 5HE9A 5JS6A 1NBWB 3GDGA 4II2A 3W5SA 2DFVA 2QLBA 1OUQA 3QFTA 1FIQA 3DLBA 5DBIA 1I4OA 2CKDA 5ESXA 1LZKA 1SU8A 2WHXA 1IU9A 2FEMA 1E2PA 4EUHA 2LUOA 1EVLA 2YHBA 1Z8HA 1PG2A 1I4WA 1KAQA 2PSEA 2PZMA 2QB0A 1KRPA 1IJBA 1E3EA 3G6XA 5CJ2A 1TVMA 2XYVA 5HDQA 4CPDA 3CZPA 3WA6A 1X8KA 1RCTE 1AOXA 1N4DA 1F4VA 4Q66C 2XUOA 1XZGA 5FWYB 2ZJ1A 4ED7A 3FETA 2W9BB 3SPXA 4R7GA 4ZYTA 2LM4A 5GZ6A 2NUBA 1A5ZA 4UPVA 2RJOA 4W7HA 5B2FA 2PQ2A 3JQ9C 1SG0A 1LDEA 4Z6DA 1IONA 4XDZA 2JGAA 4RWZA 1BWQA 1QAOA 1H1LB 2YWRA 3OY7A 4IFIA 4Y2TA 1UDXA 4E03A 1NFRA 2EQ5A 1BS1A 2PD4A 4M0PA 1T5IA 4I4TB 4O2BF 3RFVA 2DERA 1G21B 2QGZA 4YCDA 1DAIA 4LNAA 5AUPB 3IVAA 4H16A 4X1OA 3QTTA 5LWHA 4G63A 5TMDA 4B6JA 2IE8A 3EFOB 2I62A 5B3JA 1I7DA 4UNRA 1A7AA 1UMDA 4DMHA 3U7RA 4HLCA 5DHPA 4UAGA 3ZKWB 3C3EA 3KVVA 4XQ0A 1NRWA 1E6CA 3G2IA 4PXYA 5DWQA 3CLSC 3GLIA 1X7ZB 3FOWA 3U48A 4DWVA 1AMNA 2OZEA 1BPEA 4LXTA 4GKBA 3TACB 2KFZA 3EQ2A 5HNKA 2FUEA 3EN0A 3OZVA 4G5YA 4EG3A 3U6KA 3BL8A 4DJEC 1N3YA 2P9ZA 3LGSA 3QMWA 5EXSA 4PW0A 4JXKA 5JDCA 1G5TA 2ZT6A 1MRNA 2IZ6A 1E2GA 2XUJA 3HCFA 3ICWA 3OCZA 5AM1A 4P0PB 4FKBA 3PDWA 4DF3A 3ZWOA 1GTZA 4IRCA 2DLNA 3UJPA 4BNIA 1V47A 3QU7A 4ZH4A 2ZXUA 5DJ5A 1TT7A 1B15A 1UBEA 5HIIA 2OYCA 2A33A 4X1IB 2FPLA 2VWPA 3OSPA 5AI9A 1IN7A 1GA1A 3DOFA 2ZETA 4TSFA 4CCAA 5KT2A 4TTRA 1TZKA 1YUMA 4CQLA 3QLJA 2H92A 4Q4HB 1VYVA 2XGMA 2HSJA 2E7ZA 1LPMA 4J8PA 4OFZA 1CF9A 4OLJA 3TN7A 3QUSA 1RXWA 3DFZA 5FPSA 4UNPA 3RR2A 2QP9X 1BO6A 1KOJA 5LXTB 3PXUA 3EQZA 4CMBA 3MS4A 4K9KA 3T94A 3ETNA 1UT8A 1E66A 3W6ZA 1O6ZA 4MROA 4JBLA 5A06A 1EXDA 1LEHA 1NRJB 4F4ZA 3GCZA 2F64A 2GGSA 5E6RA 3WLTA 1VOTA 2PMFA 4YASA 1DIGA 1KYTA 2VH5R 3KHGA 1BDBA 2ODAA 1ICIA 4Y6PA 3AZPA 2UUPA 5WRFA 1V2GA 3R7DA 2XAUA 1X0VA 4QT0A 4FMDF 4NWIA 2Q5OA 1QYDA 1TYEB 4POAA 4RT2A 4IEIA 3OEHA 4A0RA 1YZ3A 4X1YA 4GNKA 3COWA 4PRYA 1U0RA 3QWFA 4XRGA 2CLLB 1XZMA 4ME6A 5IWCA 4F4KA 3OA2A 4RSHA 1C29B 4JFAA 4JUAA 5G40A 3D0KA 2I8LA 1DPGA 3L7DA 3WAGA 2IPLA 4QRDA 3TNLA 2HT1A 5C3UA 3PENA 1SVSA 1ZQTA 5AOBA 1XSPA 1JMVA 5IINA 3KJQA 5HCIA 5K8TA 1BVHA 3LCCA 5KJEA 4CM7A 2PMBA 3ZXSA 4FILA 5C8DA 4K9SA 3FPCA 4Q3KA 1ZQBA 5IHPA 1RYBA 4DR7B 1UODA 3SLGA 3O94A 5A6VA 4URWR 2B6HA 2IYQA 3C2KA 4KVAA 4BFVA 2V3CC 3C5CA 3EZ5A 3VO8A 4D82A 2CHVA 2I71A 1RWMA 3U4MA 4JFRA 4FFSA 4V0RA 1XSNA 2AMJA 2QV7A 2EBHX 1E77A 3HACA 2W11A 2CBXA 4YFVA 1P29A 1GGKA 2CNLA 3AU9A 3HU1A 1PS9A 2RGWA 4BLOA 1QGUB 5DBBA 2F8KA 3PC4A 4DXHA 4FBMA 4E2WA 2A9OA 5F1PA 4J76A 4QC2A 1FU8A 3SJCA 2WJGA 3KKPA 2ASDA 2VZEA 1BCSB 1ZWLA 3CRVA 1MSWD 1RWBA 3EE6A 4UBLA 4YLGA 3U3OA 4AJJA 1B0PA 4QPJC 3KXPA 1HNNA 5LQRA 2R48A 3P9KA 5C53B 4YRAA 5B58C 3T3PB 4AZTA 1M1NA 3ZJ4A 1SHJA 4R81A 1K7YA 3PUHA 2BGTA 4KVGA 5FOWA 5FP0A 1OPXA 3BMCA 3L0IB 3T1YB 2WZCA 3B1VA 3MTBA 1A04A 3SX0A 3H8VA 4NE2A 1B3BA 3SYNA 5AW5A 4I7EA 3TZQA 4AJEA 2VJNA 4ROTA 5LZ5A 5K8LA 5BRJA 8ICPA 2WU0A 1E2QA 2YV5A 5L1MA 7ICHA 1Z16A 4KWHA 3AR3A 1Z68A 5JMWA 2A19A 3ADKA 3M2PA 1WWUA 4DV0B 2N1MA 2J9ZB 3E9QA 1SOUA 5BSRA 1O1YA 2OE2A 3GT3A 4KFUA 1FFGA 4PLGA 4DMFA 1K6XA 3K71B 4RSGA 1VGQA 2WYWA 3TADC 1CHDA 2DFLA 2UVRA 1JTEA 1V96A 1YRWA 2FX5A 1PCXA 2QGNA 1EG7A 5IKMA 1NXWA 4IIFA 2J9GA 3I58A 3WGLA 3IE0A 2RSLA 4MUAA 3IDQA 1TVCA 4G26A 4EYHB 3FR7A 2Q3JA 3QX9A 4OQYA 3CNHA 1E2BA 3GEDA 4KB5A 4D4JA 5C0YA 4D41A 3PTLA 3EPJA 1SM4A 2A5JA 2J3IA 4Y0NA 2EW8A 3X44A 1AC5A 3D7LA 5H80A 1P7VA 2C78A 3GP5A 4RO0A 1NTOA 5DYTA 3CH7A 3NONA 4EJ2A 3H6HA 3HEMA 1K1QA 5C7OO 1K5GA 3BSSA 3FYUA 3OLWA 3D5EA 4BWMA 1AXEA 1JG3A 2W4IA 2XOKD 3F46A 8ABPA 2B94A 4CJXA 4DL9A 2J9XB 4WW0A 2JCYA 4EYGA 1VLBA 1UOQA 2IUEA 2PQMA 2XCIA 1OGYA 4M8SA 4EX6A 2HU7A 1ZM7A 1SKMA 1VJDA 1KK2A 2YS6A 3AESB 3V97A 1JN3A 2VYND 4J7CA 4ZRMA 2HL6A 3TTXA 3EOAI 1Y89A 2V6GA 2QRVB 1N56A 2V6BA 3LC7O 2DUJA 4C21A 3OP4A 1JQEA 2FMIA 3NWEA 4DF8A 3N58A 5CX4A 1L4YA 4Q7KA 3SENA 4CCHA 3KBOA 5HYVA 4YY3B 1QHHA 1XXLA 2QRPA 2AWNA 2ZWPA 1Z39A 2PL3A 6REQB 1GWNA 4B82A 1YIOA 3R0QA 1R4NA 3Q4GA 2PL5A 4M98A 4D56A 5FLEX 4WE3A 4XYMA 2I7TA 4J0QA 4TMFA 2A0XA 3HKZC 3PFCA 4NBNA 3OHPA 4UVEA 4NEHB 2IH2A 4G23A 1UOEA 2IOYA 3IBTA 1Q8KA 1D3AA 1OX6A 1ZZEA 3A3NA 3M6UA 2WVGA 5EYPA 2WSBA 3GUHA 3L05A 3QXHA 4G56A 1T0JB 3AERA 3GDOA 1E0DA 4OXIA 1Q7BA 4RF4A 2FK7A 1R66A 1WLYA 3G49A 3SAGA 1OWOA 3PUKA 1XLUA 4IY1A 1DTWA 3FNEA 1L5HA 3RJMA 4EHDA 1D9FA 1GCGA 1KFSA 2AGOA 4FDVA 3RBAA 1KI8A 4N4AA 3H8MA 3NV9A 2FZKA 5FB3A 3W79A 3W5AA 1MABA 4MMZB 5AIAA 3KUKA 3T9EA 3WGQA 2QVZX 2WM2A 5AKHA 1YS4A 2Y3IA 3KZOA 4IH1A 5JV5A 1Y9JA 2IYTA 3KQSA 3NOXA 2E89A 1OU0A 5DV9A 4B5LA 1SCDA 3BGOS 2CWWA 4QWCA 3T3EA 4RTSA 1Y9ZA 3GFQA 3MPUA 2OZKA 2F1KA 2WUDA 4M86A 4AD8A 1K7CA 3NVVA 4AN1A 2W3SA 4EW3A 2E5FA 4JC5A 2LNDA 1TAMA 2AMFA 3JVEA 3KJNA 4GLBA 4E5MA 4RHEA 1ZYQA 2X2OA 2JFFA 1LLQA 4ZT5A 3RH6A 1SUEA 3WLKX 2X1MA 2Z4SA 1NFQA 2I4LA 2LVBA 1VIDA 5F3XB 3BK2A 3R7NA 4CE6A 4ENSA 1T8WA 5HQTA 4Q8FA 4IQUA 1V6CA 3ORSA 3BIWA 1K5PA 2XKJE 5FPTA 4K88A 2NZVG 4NC9A 4DAEA 4M9GA 1NI4B 2JBAA 4QFBA 2FSVC 2GSDA 4KQGA 3L82B 2XNDD 3UK2A 4BWJA 1V3UA 1YZVA 1UIMA 1VMAA 4ZYXA 4DQPA 1TMKA 1WUYA 4RF2A 5HJ5A 1L7OA 3N8IA 1J8VA 4TMXA 2L18A 4UUQA 4L5JA 2E87A 3RQIA 5DOVA 4IIUA 5AVXA 1JALA 4NCNA 4CWAA 4G8DA 4ZEMA 2XUPA 3UOAB 1DAGA 2JJ2A 3KRTA 3L77A 3O1JC 3WRWA 4BAZA 2FK8A 4Z4HA 4KX3A 1FBTA 2JANA 5JRJA 5JASA 1QTQA 5DM70 1IPHA 4QSHA 5AJUA 3WRXC 2O1EA 1HYHA 3MCZA 2QB1A 2ABWA 4JVSB 4RA6B 3NBKA 2W83A 5YASA 4AK9A 3K2QA 2G70A 4YCBA 4DADA 2BW0A 4NL9A 1DMRA 2PXCA 3HABA 2XGPA 3RIGA 1Q2UA 3WDSA 3W8FA 5GJWC 4D3YA 3LOUA 4TWRA 1RDFA 2P1ZA 3GP3A 4DQDA 1T4CB 1FFYA 1C1XB 4CV0A 1WU8A 4JODA 3BKWA 2WFZA 1KFTA 1BD3A 3AR6A 3WNBA 1D1PA 4JYZA 1UAGA 4NEGA 1XTUA 3URMA 4GG1A 3MDCA 1K8QA 1OHHA 4YUYA 3VVBA 1ETHA 3RRNA 3C4JA 2O2CA 4GYJA 2PUEA 5LQJA 1AZWA 4J0JA 4TMVA 1IHYA 1SXEA 1XCGB 3U4QB 3LYLA 4MW4A 5CCDA 1HQCA 4NEQA 1NRIA 1QVZA 1X1BA 3VSEA 1SUFA 2BMJA 2Y1JA 3GIDA 4IQ0A 4QGFA 3C1UA 1F0MA 4QD3A 3THRA 3NGXA 4MV6A 5EUQB 1Q7EA 4R1OA 4NDAA 4OQFA 4WESB 3AILA 3R0XA 1AHHA 2HM7A 1JJFA 1RRMA 3KSZO 3QVTA 1NQOA 3M5PA 3ETCA 1GITA 2WB2A 3ER8A 5C1BA 1NOKA 4K86A 1PZNA 5F76A 1I5RA 1XROA 2GPJA 3KUCA 5ALNA 1MGOA 2CMHA 3EXHC 3GDFA 4N0PA 4Z54A 1NYTA 2KE5A 1I36A 2WIBA 1Y3HA 3CU5A 4MLCA 1SHLA 3OCJA 1AG9A 4P6VF 3PEWA 5AVWA 1R4ZA 1NJZA 3PR5B 3O2SB 3JQ7B 4A16A 3TDNA 1U8FO 3HFRA 1MZPA 1VHQA 1LB2B 3IQFA 4GOLD 3T1NA 4EBEA 2VIIA 1BQEA 2NSLA 2MIIA 2W2LA 3FRJA 1TCCA 3MRSA 4XPIB 2OBLA 3GYBA 5G5HA 4IUBS 1M83A 3THXA 1WL8A 2YKGA 4ZVNA 1LW7A 2I9PA 1SKRA 1KO1A 2BI8A 3BYZA 1RLOA 3GGCA 3OUZA 4OP2A 3MRTA 4ILEA 3RYIB 4BO7A 3O0TA 2PQ0A 3W2IA 3WWPA 1NUAA 1XHFA 3ZLTA 4A0HA 2AXQA 3C7CB 2PUGA 4QEDA 4W5WA 2W04A 1XJ5A 2EERA 4MVJM 4BTVA 4TGLA 2IYZA 1FDSA 3A1UA 5IAAA 1JEQB 1R4MA 2K2QB 2X8JB 4WOJA 4QAJA 2DPGA 1H2YA 3MFYA 4Q3DA 4TV9A 1X3SA 5D49A 3N0VA 4YV1A 2QDKA 2HCFA 1SU4A 3MF4A 2O5EA 3FGZA 1UAYA 3SHVA 3C6YA 3UMVA 2NG1A 2GPTA 2D2VA 2GQ0A 3B5EA 1KNQA 3EIXA 4GWGA 3IJEB 4AZWA 3P9YA 5BWCA 1PZGA 3GJQA 1WSWA 1T4DA 4QW8A 2JHCA 2XTNA 3BCSA 4MDHA 2HLDD 5DGDA 1S97A 4GZ3A 1BWSA 4Y9UA 1LRLA 3DO6A 3GL9A 1W19A 1ENZA 1T94A 1TAHA 5AKZA 2VH2A 3GCDA 4BV9A 3RUDA 3LHDA 4CKZA 3CRRA 2MT9A 1Z13A 2QUIA 3IERA 4WT7A 3WTBA 1K06A 5ERYA 1MX3A 4KI0A 4PQRA 4BCDA 3MG9A 4UHKA 3UENA 4HEHA 3DTTA 1HXHA 2HNBA 1Y3AA 5JI3E 3E18A 3KAQA 3PEUA 4EB6A 2VTEA 4FFNA 1AROP 3BQ2A 1E0KA 2W8LA 1V8PA 1WCIB 2HA0A 3G79A 2PH1A 3EVEA 3NKLA 4P7JA 4YBZA 5GWXA 4B83A 2PLFA 1ZR2A 2CDBA 1X1RA 4MV7A 1S89A 1D7OA 1H8HD 4B9EA 2P1DA 2A14A 3B85A 4H7JA 2QXUA 3D2BA 3O8OA 2R62A 1K66A 9ICJA 3BGIA 3ES9A 4ZJPA 4Z5XA 4KWCA 3GU3A 1EGQA 3S7TA 1NLUA 2H54A 1JI3A 3CVWA 5IJXA 1MFZA 1R3UA 1JXLA 2W71A 2W8ZA 4KLCA 2G72A 4YQZA 2Y1FA 4E5YA 4GX1A 2ZOSA 5KBYA 4OHWA 4KWTA 3U7JA 1BROA 5H59A 3O4IA 3A4LA 3DHWC 4QBGB 4CGYA 1AZSC 5BQ3A 1OOEA 4U9HS 4Y2UA 1K92A 1UJBA 1KVSA 1UEIA 2PFNA 1ZW1A 2OORA 4RCZA 1GTMA 3R8XA 3ZWAA 4CR8A 1V9SA 2B1IA 3FTPA 2R8YA 3HJBA 3UF0A 2Q3DA 3BJYA 3AUOA 1NVVQ 2GJSA 2VOJA 3K0HA 5A0TA 3ZIDA 2B7LA 5B55A 3USCS 2Z09A 3M6IA 1M1YA 1E9AA 1TKRA 4QJ4A 1PSWA 3HB1A 5A5FA 2B0JA 1R4AA 2UZ4A 1F7UA 1QC5A 4MO2A 2GM9A 2WF8A 3FZYA 1KZ9A 4OSPA 4CIXA 1VBNA 4FYWA 1GILA 2ZIVA 3NVMB 4QARA 4E33A 3TRDA 2C22A 1LX6A 5IM4A 4F4FA 4HWSA 4KR9A 4PM4A 3CYFA 1S3FA 2AT1A 3HN7A 3LZCA 5TB5A 5JNSA 1P39A 5TPZA 3WHLA 2YDXA 4Q3EA 3N05A 4YJGB 4F3NA 4U7GA 1VRWA 4QE3A 1JBKA 3RAQA 3ELWA 4BLQA 4JMLA 5CLQA 1MUUA 1ZQSA 3IMCA 1Q19A 3A4TA 4YRTA 5M2QA 3ABIA 3KEFA 3B12A 5L4SA 4XVRA 1MO5A 4CMKA 4IUCS 4A0QA 1B42A 1W73A 2I0FA 3ZOZA 4RPZA 2BJHA 3PMNA 2F2TA 3A4YA 1I01A 4HH3C 1VCIA 2HHWA 2OYRA 2HIGA 3ZTTA 5K0CA 2P0YA 1IM8A 3BHMA 4ZO7A 4LN1A 3AU8A 1RHQA 1XDDA 4L1KA 4CCYA 5KTPA 4RVNA 3C6ZA 4BMVA 3AONB 5JH7A 2P5SA 1C2TA 1VGVA 4LEIA 3U3JA 5AM3A 3E35A 1LY1A 1F0PA 1J8DA 9ICRA 2EJUA 2H2AA 2H5JA 1Z0JA 1ZEMA 2AJQA 1SXJD 1ZUNA 2EFJA 2H5IA 3STYA 1B22A 1ZJZA 3ZU5A 4BVKA 5I8PA 1SCUA 3VU8A 1LS1A 4QNRA 4U8GA 4G97A 2ZUWA 3U7EB 4WEOA 3C7AA 1VKJA 2RH4A 1T10A 3A6HA 4FZVA 4YG2A 1C81A 1CUYA 2YC4C 3NHJA 1XMVA 1FL9A 5EJ6A 2CFTA 1P0CA 1ND5A 1V2HE 1WP4A 3DT9A 1TUBA 1BCRA 4IJKA 2HJHA 5ADVA 3VX3A 2X15A 3AYZB 2W03A 4MS4A 4MZXA 5CT9A 2TMKA 2K4IA 3WQRA 4TVSA 2Y0BA 4FKZA 3SX4A 4DLGA 3JTEA 1HE8B 5FX2A 1V48A 5B64A 2Q6OA 3LSYA 4RGVA 4ZVPA 4FCVA 2YZKA 4JJGA 1HZJA 2H31A 2AXPA 3QJGA 3KHRA 4LDAA 2G4VA 4XVCA 2G77B 4ZV9A 1J8YF 1JFFB 1PQPA 3PMLA 3DE6X 3L8YA 3W5CA 5FBVB 4KLZA 1BSVA 3SI8A 1RWQA 1GTL1 2WV9A 4DCGA 5JD6A 3WA7A 3EZ9A 3RRZA 3MCTA 2VHXA 1JJ7A 1T0IA 4LZOA 3TUIC 1W581 1ONBA 1NN0A 4N3GA 4YRLA 1SG6A 2W2KB 4UB5A 2H1OA 2JFYA 1AN0A 4HMQA 1CUAA 2YICA 3HB5X 3S2FA 2AOTB 4LGVA 1XN4A 1K3UB 3QE3A 1VCHA 1HKHA 1SC4A 1NJGA 1US8B 3D5QA 2C9DA 1N0HA 3CF2A 3D4OA 4B31A 1HT1E 1KZ1A 5T7BA 3QELB 2DCUA 1HZZC 2QMHA 1IJFA 5K4AA 3AF2A 3SF8A 1DS6A 2AHOA 2GCIA 2QL5A 3CLRC 4URXR 4TT3A 1T9BA 1RSZA 1CC1S 2DBQA 4YK7A 5DWDA 2R1VB 1D0IA 1MAWA 3N7TA 1BJTA 4S1NA 5DP2A 3JY6A 1QAMA 4ISBA 4JIMA 1KGSA 1HLFA 1KS2A 2PANA 4IXDA 4C8LA 5TRTA 3NRJA 7ICVA 2CFCA 1W88B 1JA0A 2AOWA 1BGVA 2P9HA 3HA3A 5G02A 1XN1A 1WEKA 5IC5A 1JBEA 2OMKA 2ZK7A 2NZ8A 1W35A 4H6XA 3T3DA 3AN1A 5ALEA 2JFNA 1YF3A 1A9TA 1ZNYA 5DYWA 1RBYA 5KVCA 4MUIA 1SBIA 2OESA 3JVIA 3TKAA 4RNCA 4C4XA 1LWOA 4OHKA 1CS0A 1FS6A 2HMTA 1HURA 2WQ6A 3RS3A 4DREA 1A98A 3H6KA 3QX8A 1E9CA 4KLEA 1FTNA 1Q20A 4RV4A 4Z9YA 3C5EA 1NQTA 2BGKA 4FQ7A 5J5VA 5IKPA 4O4JF 1TLFA 2DTEA 1GAXA 1EDOA 1AT1A 1C3EA 1PBNA 3GV7B 3NVYA 1HDZA 1O8CA 2AN5A 3BRWA 1E9SA 1JHDA 3ICPA 2ERCA 1PI3A 2ZRNA 2KJQA 2OBMA 3LDGA 9ICEA 3QTBA 4H7IA 1CR0A 1NJ1A 1LBEA 2FEAA 5LNK6 3EPHA 3O0DA 3UB3A 2XGGA 1TK3A 2J9YB 3A4IA 4ALJA 5EJ8A 3J81A 2CXRA 4MA4A 4WWHA 4INOA 4Q93A 2HDNB 4UREA 3W6OA 1UKAA 3VJRA 3OA0A 5KFVA 1S96A 4DOBA 3SHOA 1NVEA 1ZBDA 2J7KA 4FFBA 1NZFA 3WICA 4UVIA 3NGDA 3RIXA 1MHPA 4FSHA 2BBWA 2VRNA 2Q07A 4FUQA 4OHBA 4NZYA 3RM3A 4RVFA 4BQFA 3BXEA 3JQAB 2QI9C 4HXYA 2YOHA 2WTMA 4QTUB 5FFFA 5IAJA 1AB5A 1NJSA 1MR3F 3O03A 5L6MB 1RI3A 1UMBA 3QEMB 4YUZA 1JRPA 5E9QA 4IZOA 5JAUA 4YJ2B 2FPSA 1US8A 3TOZA 1W0KA 3SLRA 3Q8LA 3TOXA 3ZWQA 4ZZ0A 5LQKA 1LFAA 3WYFA 1IBKB 4F5EA 5B4TA 1YT3A 4B47A 3DZJA 4CMCA 5E79U 2ORIA 3Q12A 2XTAA 3B48A 5TQJA 4JN6B 4W6ZA 3P9SA 1M5UA 2D1YA 4TTVA 2IV3A 2OV6A 2ZIWB 2Q49A 2PZKA 3H1PA 3I72A 5DEOA 1QYRA 3R9KA 4HXGA 5J40A 2A1JA 1SXGA 2P62A 3CLTD 4ZEXA 3DOIA 3RNLA 2WD7B 3LU1A 4PHPA 1NU6A 5JEEA 1F6BA 4KPUB 3N2KA 2G8NA 3PX4A 1E8NA 4DJ5X 4WI1A 4JGBA 4KLIA 3GT7A 4UTXA 2PRIA 4N3NA 1D4ZA 1QHGA 2VYVD 3EQ9A 4HI0E 3C41J 1WQ4A 2QW8A 4ESEA 4DLTA 5JALA 2PLRA 2GBPA 4PN3A 4DSFA 4E08A 3MUFA 4BC1A 2GO1A 4H7KA 5TC4A 2C8KA 3GBSA 3B7PA 1R0ZA 4K9MA 4ARZB 3HWX1 3IOBA 1GLVA 1Z17A 1JG2A 3QSGA 2B4AA 1T8PA 3AOGA 3I12A 3KV3O 3CUKA 4CF3A 4XJXA 1ZWKA 2L82A 3AKYA 4MKHA 1I6KA 1W5SA 2IEAA 2COEA 4IKPA 2RGAA 3E2EA 3ROQA 2B2NA 2YZNA 1UPUA 4G8JA 1U0LA 2PWYA 2C9MA 3MR3A 3NAGA 4GI3A 3T38A 4C0KA 4F46A 2BGNA 2NPFA 3CVXA 1BPZA 2KBFA 2FSVA 2Q8QA 4LCBA 3OT1A 4MIEA 3ORYA 1P4JA 2WJJA 3Q10A 1L3SA 1SUBA 2RMKA 3HN6A 4UNQA 4YJFA 3X1JA 1RQPA 3EXEA 3E22B 2DB3A 2ZSHA 2JPDA 4LWPA 3RFAA 1NP6A 3V8QA 2AR7A 3D64A 4HJXA 2G1JA 4CM1A 2VCYA 2ZTSA 2IU6A 3DZBA 3HVUA 5KVVA 3GA5A 3SBXA 4C80A 4DC1A 2WFAA 3SZ2A 2UVUA 2PGJA 3EVDA 5JZOA 1T35A 3X1YA 3NNSA 5ANRB 1Q0SA 3EOBI 3ZDRA 4G0QA 3V4VB 3N75A 4Z7JA 2ARKA 3G3EA 2QARA 3AR8A 2WT4A 3V46A 1DLJA 1G8PA 2RK3A 2C3PA 1PFVA 4NMLA 3IRUA 1L5UA 2AF4C 3PUXA 4PYNA 2NXEA 1L5LA 1A7KA 1AKVA 1NUPA 1X7GA 4BL5A 4BWGA 1AB6A 2XEDA 5DLYA 5ISMA 5FKJA 2E18A 2H4JA 5EMJA 1FNSA 2CFIA 3GEEA 4LJLA 4LMAA 4PYKA 2PH3A 1W2WB 3IPYA 1QIJA 2O14A 4MYHA 4YCCA 3SSNA 4Z6EA 1HOXA 4MW7A 4K3UA 1I0ZA 4CLRA 2VF7A 5IXYA 4AI6A 1ZP6A 3PCRB 1R15A 1AKUA 3PYXA 5EXDA 2CXHA 3TAHA 4CKBB 4YT8A 1Q1NA 1DHTA 2XCSB 1IOVA 3NS1A 2IQIA 1BH2A 1RKQA 2R7MA 3EUB2 1MPXA 3A7EA 2WLSA 3CW9A 4KNWA 5CRIA 5EKDA 5HTOA 2SCUA 4G85A 3PSIA 4ONEA 4OHYA 4U6PA 1GZHB 1Z0SA 2HWKA 1I7LA 2BDEA 1KU6A 3CRNA 4WKGA 5JNWA 1CWUA 4F5PA 1EE2A 1SEPA 2P2NA 2VATA 3EF1A 2ZZKA 3AJEA 1KFJB 4BNZA 3ICCA 2A7QA 4K2AA 3H9UA 4DW8A 1CUGA 1Q11A 2IYLD 3HJRA 2HC9A 2PVSA 4DL5A 4BMNA 5HZGA 5B2ZA 1A5BB 4Y1EA 5A4AA 3FBGA 3D7MA 4AF7A 4L2IA 4AX4A 1SXJE 2W7TA 4BBAA 3AKDA 2E49A 1J21A 3TQFA 4PFSA 2O50A 2ILTA 4MV4A 3TD9A 2BUAA 1CI4A 1RJGA 2ORED 3JQBC 2IKQA 3CNLA 3M2TA 3OM9A 4XVQA 5G4LA 1KF0A 3S5JA 2XY6A 3L1JA 5I47A 4DTCA 1NKTA 2JFGA 5IDQA 1T8YA 3NATA 5F77A 3RYFB 5KJFA 4B3SB 2BN4A 1SBZA 1UZAA 2DKOA 5JTTA 4UMFA 1RYYA 3EPRA 2BH2A 3Q5GA 4DSIA 4KGZA 4UB1A 1YSCA 1IATA 2Q0XA 2ZJOA 3LCUA 5KNBD 1MW8X 5BOLA 2AF3C 3NEAA 2V7GA 2E55A 4ND8A 2J5BA 1AVTA 3WMEA 4P83A 3WGMA 3IR6A 4PGQA 4AZ3A 4DLSA 3M6FA 4W1SA 3FNRA 3PSHA 1JR3D 1NUHA 1FYDA 5IXSA 2DWQA 3R7AA 4G0MA 2WLTA 4GPAA 3RASA 5FOTA 4EBFA 4LKOA 1XKXA 1YRAA 1FA9A 1OXKB 3AJRA 3JQCA 1MDBA 2HEGA 5IARA 5I7WA 3U3MA 4B80A 4HXEB 2FMQA 2PZAA 4GMGA 2OCBA 3GLFA 3CCCA 4EZBA 4F4IA 3QQ5A 5D7BA 4OI2A 4XH9B 3T79A 1N8NA 1PK3A 1ZLYA 2O2YA 4QAQA 1E5QA 2O8VA 3B1ZA 4R8RA 5LBTA 4GZ6A 3DAHA 2ZULA 3OZ7A 4DLZA 1JLLA 4C7XA 4DLKA 2H5XA 3Q8KA 4KOAA 4EH1A 4M6WB 3ISCA 1OYOA 3IO3A 5A3RA 1EE1A 1GNQA 3D6TB 3ABSB 3H11A 3IT2A 3IA7A 3LQFA 3NB0A 3MFHA 3F0TA 4PGFA 4YAKA 2NSJA 1NDQA 5LFAA 2J0SA 4AJ9A 3K72B 2CN1A 1JMSA 1XYVA 4R7ZA 1X14A 3KVOA 2YRWA 1UZMA 2HOIA 3UWSA 4BKRA 1CXZA 2DQYA 4RQ0A 1RTTA 2DYKA 2P9YA 3IAM6 1KEVA 2IYOA 3K0KA 1G2PA 4Q4DA 4ZT4A 2FLLA 2EX1A 2SHKA 1YFZA 1KSFX 2FMUA 5T14A 1UK9A 3A1EA 2QPAA 3B6JA 1NZPA 4M7RA 1B74A 4N8EA 4P32A 2VYNA 1ZD5A 2LW7A 4I9NA 3T4EA 1JQLB 4JXJA 1UJ2A 3L0SA 3SC2B 4I2IA 1KTQA 2MSDB 3WL7A 1M1YE 2A5YB 4NBRA 2IPNA 2E5WA 1C0PA 3K9HA 4R8UB 1FUIA 3MBYA 5FTJA 4KLOA 4HHEA 4N82A 4RLHA 1IEVA 3ZU2A 4ZHSA 1CRZA 3OPNA 3UBTA 4E0DA 5JYBA 2C9CA 3P5SA 1J20A 1PE0A 1EU1A 1GV1A 4JUBA 3TRFA 3EGDB 2FZGA 4I66A 1NK6A 2GN1A 3C3PA 2VC2B 3CKKA 2UKDA 5AQ1A 1NVBA 3RSLA 5EE5B 4MDEA 4YUAA 3PW5A 2V6IA 5FO0A 4DC0A 3PFGA 5K6AC 4YNBA 4PZOA 2XGOA 4LSWA 4U6NA 4D79A 2JH8A 3K1YA 4KLRA 3MC1A 3P45A 4Q3NA 4ACBA 2O54A 4NCXA 4DSEA 5IF3A 2VP5A 4XJVA 1RJ9A 2HH9A 4GI5A 4UQOA 3VFDA 2PUHA 3DF9A 3IPCA 4Q4AB 4DE5A 2W58A 1UPBA 5TGDA 1VG1A 3DOJA 4H1TA 3UICA 4B4VA 4R4JA 5J58A 4ZC1A 4YJHA 2A1AA 3RTVA 1OWMA 1FK8A 2E82A 2XNCA 4E5PA 4Z7QB 3KHSA 3GEBA 3LRTA 1XI2A 4EG7A 1PDOA 2QYOA 4FHDA 3E3NA 3WGIA 3CA8A 4UEJA 3A9WA 3HFJA 1KEZA 2QXYA 1CUJA 3A10A 5EMLA 4LC0A 1OLXA 1UBCA 5DGTA 2W93A 3SMVA 4I3HA 4K2HA 1NXVA 4ZQBA 4ZZIA 2XB6A 5EJ9A 2EHDA 4DQLA 1QU2A 4UEKA 1R6VA 2CV1A 2BC9A 2Q5LA 3U7QA 2CL7X 3MWEB 3U3ZA 2FH5B 4BWVA 2ZIVB 3IKVA 1YT5A 1NLMA 2QYTA 4A6PA 1HE4A 2ZFUA 3FVTA 3QE0A 5K0TA 1U4BA 5H9WA 5INTA 3EAFA 4RTOA 1YR2A 1AK1A 3AQEA 1Y33E 2B1QA 1YJCA 4I1OA 4M38A 3WNCA 4B9MA 1C1YA 5I6DA 3DA8A 4M1ZA 2NYVA 3IHQB 3SVTA 2ASVA 1HL3A 1S8OA 2HK8A 4JLUA 1Q2XA 1U9CA 3CKYA 5E3IA 3RI3A 3QFFA 4BS9A 1XWWA 1Y4ZA 2G4CA 1N9KA 1NVTA 3WKEA 2A1TS 1NVXQ 4OOFA 4YRIA 2IOQA 4B9NA 4H1WA 1RMTA 5FUXA 4ACAA 1MV5A 2B6GA 1XU9A 3H2GA 2WG0A 3FUWA 4HADA 1XQ6A 3EXEB 2EGGA 2VS1A 3D02A 3PA6A 4KFRA 4LTDA 5BWOA 3ELBA 4IDNA 2XICA 1FZQA 2DHRA 3HYCA 4YMWA 2PGNA 4NL9C 3TCNA 4G8BA 5AM4A 5EOZA 3E05A 2D1QA 5M3BA 1ZOPA 1HZZA 1W5FA 4G2NA 4M0FA 3RK1A 2C82A 4E6EA 3HXOA 3AUUA 2EAOA 5CB8A 3DEZA 2IIPA 3V5NA 1YA8A 3RWOA 4YP9A 3ANMA 4B7AA 2BF7A 2CXQA 2CXXA 3ZDDA 2NO9A 2CJWA 4PIMA 1LLUA 4WKBA 3DSRA 4P58A 4YCMA 5E4TA 2IODA 5DTIA 5A2GA 3ESDA 2BHLA 2RI6A 4TZTA 3P8ZA 1BVYF 1D09A 2FF5A 1OIVA 2VF2A 4MF2A 3D7NA 4JBXA 1C9KA 2QD2A 3JYHA 5D84A 2ONCA 3QFSA 2EJWA 4ELVA 1KMIY 2ADOA 4OBXA 3SE0A 1KK1A 3WK9A 2Q6VA 3H86A 3IKMB 3IM1A 1SNYA 2GOYA 4EY6A 4U2EA 3IEIA 3FA2A 3W9YA 4L16A 3F9CA 3P2JA 4LBVA 1QV7A 1I13A 4M8IA 2I2DA 1PR0A 1UKZA 3NBFA 4F5OA 2G1KA 4J43A 3SJAA 3UOGA 5AVSA 1E3JA 2XOEA 4ND4A 5H83A 3W8EA 4J3JA 2F76X 1X86B 3TTUA 4DHEA 3NEJA 3FXAA 4J16C 3SEZA 2FX2A 2IIVA 3DFMA 4Q3LA 2K4PA 1QG0A 5AVTA 3T3NA 3AKCA 1R27A 2GJKA 4R5HA 5REQA 2CXYA 3I6MA 1GAQA 4LHXA 2C29D 4XJTA 4ZCTA 3IA2A 3GLUA 4ZI5A 2EX0A 1Q16A 2RKOA 4HVTA 3T0GA 4MGIR 2VF5X 3EF3A 3WG9A 2E3JA 4EG0A 3LKVA 3RS2A 1GPLA 3PV0A 1BPDA 1COWD 3N74A 2NU8B 3KLBA 2XF2A 3VSDA 2GPAA 1NN3A 1T3ZA 2EW2A 1C9EA 5EKTA 3PXBA 4TTSA 2H3QA 1UK8A 4M0UA 2F43A 4EB3A 3S99A 5FNZA 5FTKA 1IZ0A 2YJ5A 1P3JA 3HMQA 4IG4A 1G66A 3WGVA 5H82A 1VPWA 5JUMA 2VAWA 3EZYA 4KQ9A 3ZHQA 5K7SA 1Y1TA 4O5EA 1XVAA 2FPPB 3FNGA 4FOLA 1YBVA 3TOCA 3ZE7A 2QPOA 1RAGA 3FHTA 1PFUA 3VU3A 1ZQNA 1A71A 2IOFA 3QVXA 3H8SA 4QECA 1P1JA 1T1IA 4Y3UA 4Q7QA 5IC4A 5IZCC 3HCNA 1BFDA 3O95A 4WXPA 5KTNA 3HADA 4YDRA 1TW2A 1CQIB 5TQ0A 1OAOC 4JUDX 1F1JA 1ORHA 4O29A 5FHRA 3VC7A 4R2MA 5ER6A 2JJ8A 5EMMA 1GYRA 1PUXA 3II6X 3K4QA 1XDSA 1V71A 1T6NA 3KVRA 2Z3ZA 1N5DA 1GPMA 1VL6A 2VWGA 4HAUA 3N2IA 2GZ2A 3OZUA 1XMIA 4HGNA 3PGVA 1WXFA 2OFFA 1WRBA 1TVKA 3KFUF 4ZDWA 5ALDA 3CG4A 2O8BB 1NQVA 4JC8A 4I8DA 1QV6A 5JVDB 3RTBA 5TMPA 2QVYX 3DC7A 1VXRA 1XAHA 3TQSA 1OXVA 4P08A 4NULA 4ZALA 4E88A 1KJQA 1AHNA 1RYUA 1XZAA 2C20A 3S2ZA 2KEYA 3CZ4A 3AXSA 4Q24A 5KYUA 1SKSA 4HV4A 1E61A 3TW4A 3V8BA 1GPJA 1YMUA 1Q84A 3CN7A 3F67A 3KQWA 3ESZA 4KSYA 4QUHA 5U1PA 5JNVA 3PDIA 1N6RA 1VDZA 2GEDA 2VDWA 3H0EA 5EJ7A 1NF8A 3K5WA 3QWBA 2GXSA 4ZGGA 1P73A 1UC5B 1J1ZA 1T5BA 2ZRHA 1EP9A 4L8YA 2DECA 5EFOA 4EPTA 3L9WA 1R8SA 4K9DA 1X42A 1VSTA 1YI0A 3S4YA 5I7FA 2VHYA 1YB6A 1A69A 4MR9A 2XXAB 3JZIA 4HNAB 4A2CA 1J33A 2O3SA 2X4IA 1JF8A 5K0GA 2CNOA 2YYZA 5CT5A 5KTYA 1A1VA 1JPVA 4RZHA 4F91B 4MWCA 3DUFB 1ENOA 1BJKA 2Y99A 2FWJA 1QANA 2C9OA 2OCIA 3DDSA 3CLTC 1OBCA 4P9NA 1U90A 4L3WA 5JMOA 2REQB 2BCSA 3WJ2A 2WUVA 2JGLA 4EMSA 3T1QA 2WABA 4NTZA 1R0KA 3RD5A 1V3TA 2C5GA 2YC2C 1F8XA 2H00A 2Z3VA 1U7UA 2XB9A 1ZRMA 1AX9A 1M33A 4RDXA 1Q0UA 3ND9A 4UHDA 3MJVA 4K7JA 2ACWA 2PO7A 1AGNA 3G2OA 2ZBRA 1D2GA 2PD6A 2AGQA 3E8XA 3KSRA 3L5OA 3RT7A 2C5SA 4KVZA 5JSHA 1N34B 1USIA 4HQFA 4HDSA 2O3JA 1HLPA 1K8YB 1V5FA 1LKYB 1PKXA 4MLDA 2B4TO 4HGRA 3KOOA 2HMXA 3EIFA 5LXTF 1JVSA 2X9VA 4PC1A 2H1WA 2JI4A 3PJFA 4YJKA 3C85A 3X3HA 3IODA 3ANXA 1J0DA 1JJVA 2QLNA 1C3VA 3KKOA 2J7PA 3L4EA 3PGJA 3RFFA 1ZN8A 4L9SA 1CV2A 4B3GA 2ON6A 3R5JA 1EG2A 1XNRB 1T2CA 2C3OA 3LP5A 3V9PA 3PNCA 1Z4IA 3M7DA 3C16C 1F0NA 1W1WA 1F7VA 2JAXA 2PUWA 4TX1A 2X6TA 2N75A 1FP2A 3H4MA 3U49A 4OQQA 3KSAC 1UT6A 4TKZA 2A4MA 4CXMA 1JT2A 1XCLA 1BX3A 1A8QA 1RQ7A 1W49A 3OZWA 2X3UA 3FIUA 1LBHA 2X9QA 2H65A 1PLJA 2UU9B 3VKWA 2C4WA 2R5WA 3E8MA 2E48A 2HVIA 4OTZA 4TV8B 2XHEA 2KX7A 1DUSA 1FJGB 1W5BA 2BMDA 4QBKA 3CLKA 2V6JA 2DSTA 4P22A 2IU0A 1DC4A 3T7IA 1HFEL 3PZPA 2F48A 3I6QA 4PGMA 1WUHS 2YN4A 1D9DA 1AA9A 4OJYA 1EZZA 4JYCA 3SDBA 4AU1A 2NU7B 1SD5A 3W3AA 3UAOA 4G0UA 4Y0AA 4HNUA 5TLSA 5DBHX 4A6XA 4HK4A 1R9NA 2J45A 4M37A 1X66A 3HU3A 3W3ZB 3SQNA 1KQGA 4BFWA 3PQDA 3BD8A 2ISOA 1DBWA 4PHDA 2BKEA 3BDPA 5LP6A 2J4FA 1XS9D 3F6YA 2GTIA 2OHIA 4V1CA 4CQNA 2LP4Y 2AN4A 4GZ5A 4R3UC 2DHEA 2ZEJA 4EG5A 1Z56C 2PX5A 3E2PA 1KWKA 1DDOA 4E5DA 2V55B 3HLKA 4LDQA 4GLXA 2LWIA 2QPLA 3NZEA 5EXPA 4CQJA 1HC7A 2W8KA 2J5QA 1QR6A 5LBIA 4GP6A 4NL4H 4R40A 1N0VC 4O8CA 4YXFA 1HYGA 4KL8S 1Z4PX 5DLQC 1XLWA 4G5XA 3VR6A 3SYZA 2GBCA 2CVOA 3GA7A 3AYXB 1UKEA 3K0EA 4HAOA 1J7KA 2PBFA 2WM9B 3BSFA 5TT0A 5CFLA 4MVJD 3N28A 2WHYA 1A95A 1QU3A 1C14A 2Y1DA 4KXFB 3CJQA 1P19A 2XYGA 1DKQA 5C18A 4JX9A 3UXHA 1EP2B 2OHFA 1VB3A 1DARA 1ZCZA 3NJ8A 4Q47A 2AVNA 2VPIA 3K2IA 1E9VA 1KZ6A 2FW1A 3UG6A 2E8OA 5J2UA 1Z4KA 4J9KA 2R6JA 1HM5A 1HDGO 2DUNA 1V11B 5GQSA 2LZ0A 5G0UA 1KO7A 5A6SB 4HFNA 1PDVA 4Q7LA 3HCOA 7GPBA 2W8BA 3UAYA 4ITVA 3DXYA 2ZTVA 5L3RA 1OFHA 5TJ9A 3CE9A 2BSQA 3LKBA 2XVAA 3IP5A 2A1IA 2HXGA 4PJ0U 5HJ2A 4TS4A 4R31A 4AG3A 4DZTA 2UUCB 4BNDA 3NCTA 3ND7A 1IHXA 3ZD9A 4MQBA 3JPPA 1AGYA 3EQ6A 4BFSA 4RIIA 3ZHTA 2YJNA 5HRUA 2XDYA 4GQIA 2CJPA 2LIPA 4Z8YA 3H7AA 2POQX 2RH8A 1E64A 1MJFA 1YR1A 3E15A 3O9VA 3M3DA 5TS2A 2ZKIA 3QUTA 3WGHA 4IZ6A 1Z7YA 1OASA 3LHKA 3P2YA 2PT9A 4CRWB 1N48A 5AW7A 5ALOA 4CL3A 4UNNA 4EBCA 2HRBA 1P1IA 2RAPA 1Z34A 4I3FA 1A77A 1C1DB 4QUEA 4X6LA 3ED1A 3U9TA 3KCNA 5JECA 1SZDA 3P9IA 5A1TA 1OW5A 1H8HA 3K0FA 4UTZA 3DM5A 5KFSA 3R2JA 4J49A 4MP6A 4M9UA 4MICA 3KYCB 4MHOA 4OGKA 8ICFA 5KYUB 2J9FB 2A3VA 2GTHA 1E99A 3GLHA 2FSSA 1M76A 4RBNA 3WJ1A 3UGJA 3JX9A 3RVKA 1MIOB 3BJEA 3GV0A 2QVLA 1LSOA 3H1AA 4LJSA 5IDYA 3TG2A 5B2EA 3MUNA 3TI0A 1RMQA 2CNBA 3O3OB 3UZUA 1QPZA 5DT2A 5D3QA 2MYNA 3PR3A 5HMMA 1JU4A 3CXRA 2Y0DA 3E4CA 1Q0ZA 1SZCA 3L7LA 4EPXA 2FHSA 1GDHA 4DUZB 4BQOA 2JAHA 4CDNA 2R9VA 5CBKA 1C4OA 4UB3A 1DIHA 1O95D 5ETJA 5TMBA 2KZMA 2YY6A 4MOWA 3SFZA 3UCFA 2QR2A 4CG2A 5KNLA 2EKPA 4OK6A 4RC9A 2Q2NA 4P93A 2P3LA 1D07A 3Q85A 4DQIA 3A06A 4LWQA 2NP6A 1M9NA 2BHRA 1Y7PA 1R6TA 1RPNA 1RWNA 3OE7D 3ORRA 3ROGA 1DI0A 2VIXA 3TD2A 4GPTA 1SKQA 2BGMA 2Z9BA 2ZI4A 3IS3A 4Q00A 2H18A 5KUTA 2AJ8A 2YJZA 2MYPA 4MSUA 4MWTA 1ZX1A 1DO2A 4CM6A 3N7PD 4JWMA 4CMGA 2PX3A 3A1FA 1WCWA 5LQUA 4MRMB 2H08A 2I91A 2Z58A 4P3OA 4R9VA 3VR2A 4F6RA 2GOLA 1JPUA 2H1VA 3KKEA 2HADA 3ZD8A 2PKXA 1XQVA 2WF9A 3MTIA 3FAKA 1DK2A 4YO8A 3SEAA 4EYKA 1C1XA 3H5OA 3O83A 5LYJB 1IN8A 3H1TA 2V98A 1E1MA 5FWNA 3B3QA 5DN6A 2RGNC 4TPKA 2XV1A 3T3IA 2ZRMA 1PGNA 1KR5A 1CBUA 1ZQRA 1DVRA 1IL0A 1WY5A 2DBVO 3BSYA 4EI7A 3IKTA 3G02A 4H59A 3QITA 4NP6A 2ORYA 5FAXA 4EGFA 1JEEA 5KTMA 3H1BA 1N3BA 2V74B 2WWIA 3VYWA 1JAHA 2OD9A 2QN1A 4M9QA 3BQ0A 4U7WA 1CSEE 3K70D 1CCWA 1ZIOA 4M8LA 4BNJA 2X0JA 3MOGA 3DBVO 4BJ6A 4M6WA 4J9OA 2IQ5A 3FCOA 5KG3A 3L7NA 4DL7A 4G5SA 1B0XA 4A26A 1RXYA 3LUHA 5HKKA 2C83A 1NR1A 3VJKA 2HQBA 5DGAA 1TMOA 2ICAA 4JL8A 1ADJA 4LNUB 1N2JA 5FBKA 4P35A 4RAOA 1KE2A 4EG4A 3K0AB 4M3NA 1QRUA 1Z6GA 3DEJA 1J56A 3EXAA 1EJBA 4I4TF 4M53A 3BD7A 3IT1A 5AOVA 2VYVA 1PF7E 2GS9A 2OHOA 1UJ6A 1OILA 1VPDA 2JBAB 5CVDA 1JXAA 1NMZA 4JB3A 3TM5A 4CN8A 1DBPA 3CUVA 1V1MB 3CKMA 4WIAA 4LCJA 5K20A 1E9FA 4P4TA 1TEZA 3PDJA 4L50A 5CCEA 1T9DA 3IAUA 1GKLA 2CC2A 4F60A 4Q44A 5KFAA 2EV9A 1WP9A 3H4VA 5BW8A 2ONYA 3ISBA 1SQSA 3FDXA 4DA6A 4F6RB 2NUAB 4OO1J 1H66A 3CNOA 1ZQ9A 1K8RA 4FKMA 4PBSA 3UV3A 3ZZNA 3FTFA 2PJUA 1KI1A 2W6CX 2F8SA 1Y48E 1NKSA 4TKLA 1YL6A 4FCTA 4O3RA 3D1LA 4OM7A 4H08A 3L4BA 4EUNA 3EAQA 1PNRA 5F7OA 1MABB 1OCEA 1DX4A 5CB0A 3ZZMA 1FSSA 1DAOA 1QFXA 4QA9A 3A4VA 4XR4A 1GTVA 4RQBA 5J4LA 4FZLA 1RJEA 1XQYA 3ESAA 3GLQA 4WBNA 4BX2A 1X2EA 3P0RA 3T5PA 1YV9A 4P84A 2IELA 5D85A 1U1IA 1Y8RA 4BEVA 5KSOA 1QX4A 1U5CA 4ALMA 5A71A 1CQPA 3IUMA 2LKYA 1ISFA 4YMLA 1XXHE 3WDLA 2XVZA 1IB0A 1MXFA 3PLNA 3GEIA 2PUVA 3ON5A 4AICA 2JLCA 2DWOA 4JY7A 4NONA 4QVKA 3NPMA 4L7VA 4B3CA 3WZMA 2XB8A 3B3FA 1X9HA 3FG9A 4F21A 1QIIA 3RB3A 1IY1A 5CHYA 1U3UA 3TLZA 1YGYA 3SQOA 4L28A 5I9LA 1VJRA 1UANA 1P0PA 1PL7A 3MWEA 4NAVA 4P7BA 3TTVA 3ZWKA 2SBTA 4D6PA 5JS1A 2QX9A 3UJ3X 4DS5A 1R0BA 3KOUA 4LDZA 4LTMA 4PFJA 5J59A 3DCIA 3OH8A 3F73A 3RJEA 4RHXA 4MPJA 4U7PB 4UHBA 2AKAB 3IEMA 4KQ1A 2OWOA 3EH2A 4C06A 2X0DA 5IT4A 5FEMA 4EK9A 3LFTA 4DA8A 3RRHA 1VLQA 2FV8A 2VNSA 4RPCA 2PJRA 3FYUB 2ZXEA 5GZ3A 4RD0A 5L7YA 4XE5A 2Y1GA 2IEIA 3EDMA 3FMPB 1E2EA 1GGNA 4DSKA 2CB9A 2NZUG 3EXIB 3OLCX 4PSCA 2GK3A 3VC3A 4BFLA 4XYEA 1M6NA 3O74A 4QREA 2JEOA 1YASA 1JYSA 4JITA 4PX9A 4CKEB 4IWYA 2Z4RA 1RRGA 4D4HA 2KJ8A 1NDHA 3LQRA 3RK4A 5FA6A 1Q7CA 5LNK1 7MDHA 1NVMB 1N5WA 2J3HA 4RAQA 2P91A 2BFCA 4Z0HO 4BMZA 4LHZA 4B6RA 3KQMA 2PYIA 1NVGA 3NM4A 5J0XA 5B7QA 1L1FA 1TQ8A 1LQTA 3NT5A 4HH1A 5C8ZA 4QIWC 3A7DA 4P5EA 4RQ4A 4LYEA 1RYEA 3K31A 1T13A 5E8RA 3E3AA 2XUDA 1IHDA 4J03A 3TFOA 1C0IA 5BMVA 3D0QA 3SKVA 3DQPA 1QYVA 1TIPA 2YW2A 4GUAA 2QUJA 2GDZA 2JGJA 1XP8A 3NC4A 2ZIZA 3PZBA 4PZUA 2NUTA 4LA4A 2HOFA 1LRKA 1RI4A 4B4WA 1VE3A 2REXB 3K75D 2DM6A 2I4RA 1MD9A 2ZTUA 2V4MA 4LSZA 4ZCQA 3ZY6A 1WXGA 3D8NA 4ZOHC 3DEKA 3PT9A 1AHPA 2XIQA 3CH6A 4RY2A 4RTNA 1M6HA 3K94A 5HUHA 1XB2A 2CLDX 5FV7A 5JISA 1EM8B 3TFSA 1CDDA 1LDGA 1LTQA 2CUZA 4NYMR 3FPAA 5C5DA 3MR2A 2QD5A 1QIDA 3I2YX 4WOBA 4IIYA 2QP4A 3D6NB 4EBBA 3E9EA 3LP8A 3C14C 4I1VA 4KV9A 2NAFA 2UXDB 4YJ3B 4JL6A 4Q9LA 4E3WA 4CEHA 4JL5A 1M2HA 3OJEA 4LQLA 2EIHA 3LPNA 1FYEA 4IWXA 4TMKA 3TSOA 3UH1A 1QWOA 3L4JA 4HPWA 3PDCA 3HRHA 3WRXA 3ASYA 3IHTA 3VR5A 4BASA 5F1OA 2Z5FA 2XY7A 2WJHA 1XNQB 4BIMA 4E0BA 4E1AA 5AVUA 1M0EA 2I1QA 4BZQA 3EJWA 1CP2A 1O5IA 1M8PA 4GLLA 1KZHA 4I50B 3LCVB 4HQRA 3L8HA 4FS2A 3CR8A 3THSA 4IG9A 5HFJA 2H4WA 3HXKA 3UMSA 2BH9A 4NNPA 4ALIA 2EQBA 3FCYA 3IP9A 3PKJA 4HPXB 4LS3A 5FD8A 3AVTA 1QYIA 4FGWA 4EHLA 1TECE 1RWOA 4I2JA 3MLAA 3ZVLA 2NP7A 5DT9A 1ZMXA 1X7DA 3I64A 5FIUA 3T8YA 3WHPA 3OIVA 1TYBE 2IXBA 4N49A 1M2FA 4CKCB 2B83A 2XX3A 3AR4A 7ICGA 3I9FA 4PTYA 5LUAA 4JJ8A 3GMSA 2X5XA 2N9UA 3OWOA 2GESA 1LGYA 4XGQA 3RV3A 2H57A 3W6PA 1PK1B 1RKBA 2C4TA 1QIEA 2IE0A 4Q7EA 3V8NA 5I7RA 1B6GA 2HNAA 4Q21A 4LPSA 4P2GA 4ROSA 3GVHA 3DNPA 4AMVA 4XARA 1CB7A 2IPMA 5CYOA 1ABEA 4TLMB 5GGYA 3QX7A 4CMJA 4DDUA 4N76A 1ZIXA 3U1VA 1KI2A 2M9MA 1SQ0A 2H06A 3STUA 4JK3A 2C1XA 3JU3A 4H0CA 3SZOA 3T7EA 3UCEA 1EB8A 1MNQA 3WE7A 1RWVA 1IZZA 3WLNA 3FI9A 4JLPA 4AAYA 2QLJA 4IIVA 5FL7A 2PU7A 2EL9A 1ZQZA 5ALXA 3CCFA 4NYJR 4WECA 4L2IB 1UKYA 5EHXA 1E3WB 1GYQA 2VI5A 1I32A 1Y8AA 4KH1A 3UMMA 2R3SA 3B8EA 5F98A 5B58T 4R1SA 1NXSA 3DF7A 3L8MA 2FA9A 3V55A 1XPJA 4ARBA 3ONWA 3PU6A 3DDUA 5C37A 5IZ4A 5AK3A 2ZTMA 4J90A 5EJMA 1NXXA 2VPTA 1CPYA 4MKZA 4HB2A 2GJAA 3ZOKA 4CKCA 2C2OA 2K8CB 4DNPA 1GT6A 2F1RA 4ER6A 3ANYB 4O0LA 3UVEA 5AI0A 2PIDA 5L1KA 3RVRA 2A9QA 4FK8A 5H3HA 4DJJA 3V6JA 2F2AB 2JGFA 1U8YA 4XWWA 1FMLA 3BAFA 1E5VA 3QOWA 4M2YA 1XJQA 3GJ6A 4AM8A 4BOYA 1EA7A 1ZHFA 4CLRB 1W5AA 5C7YA 5AI6A 3GVIA 3CX7A 1UPXA 3KYBA 3OZSA 5FT9A 1BMFD 1Y6QA 4GBMA 1W36B 5KIAA 5FNVF 3AIKA 5GGXA 4M9HA 1J2RA 3TNDA 4DDKA 2P3SA 3S8YA 1PS8A 3QKIA 3ZDZB 1CUZA 4FUTA 4MYTA 2HDWA 2XYPA 2BGJA 3CS3A 3I37X 3N76A 4KHZA 1NM5A 1QZTA 2QARB 3BFJA 3OMWA 2ZZNA 5HUJA 1KP9A 3DVSX 2JG3A 3OC0A 3YASA 3KTQA 1PTJC 3ICOA 4HG2A 1ZI9A 1WDTA 1E6WA 4FMCB 1P75A 2AHRA 3RYHB 2ES4A 3E4DA 4EKGA 5B5SA 5LD2B 3R6GA 4LV5B 1VRCA 2ZB7A 2RGYA 3CG0A 5DCUA 1RC1A 2W9AA 5HWSA 3T34A 4JLAA 4NPAA 3CO5A 3I5MA 2FPGA 3QK7A 2HNKA 3HUTA 1P91A 3KZ1E 3RIEA 3OPVA 1COOA 2HW8A 2D8AA 2OFWA 2FPWA 3HRIA 2J6SA 1ZQQA 2R6HA 3R09A 1T8UA 2ZQZA 3AFHA 4QKQA 2WBLC 5I7EA 4XQEA 3VSAA 1QOPB 3CUUA 2CWDA 3QX3A 3UUWA 2MSNA 3GK3A 5EWMB 8ICWA 1X94A 2J08A 1DC8A 3PUZA 1DWPA 4IYJA 5KNDH 2IZ1A 3IAXA 4MRNA 4XSVA 5F2OA 1ZMOA 3I9MA 2GHIA 1JWAB 5DBOA 5FJJA 3AHJA 3JRWA 3VR1A 1V4NA 4MFAA 2VYQA 3P19A 5JRDS 2J3LA 1OI3A 1W30A 4FHEA 4ZD6A 1MV8A 3O75A 1NF3A 4PO9A 2C8LA 4Z9XA 4HL6A 2F8TA 1O6FA 1K5DA 2CUNA 4QFDA 3E5RA 2EQAA 1KS9A 3G2LA 5DLDA 3U4QA 4JOCA 2WMOB 3R3SA 2E3TA 2QTBA 1HEYA 4N0MA 5AKGA 3LF1A 4OB6A 3STHA 2WAMA 3QVKA 4YCAA 2AB0A 5FPQA 4QJFB 3ZCPA 4AUKA 4GBED 3MB8A 2R8GA 2JAUA 1XTZA 1N78A 1ZK2A 2P7HA 4HYTA 3I01A 1VL0A 4XQ8A 1U5BA 1KDPA 2EZ8A 3H9BA 4EARA 3LTNC 3VOTA 3ASUA 3I5AA 3IIEA 4P5PA 4AUNA 4X00A 5C51B 4B9VA 2XMGA 1M34B 3E5NA 5EEGA 2Z56A 3H5AA 4TYNA 1NT2A 3SNKA 1X74A 1U2GA 2A9FA 2JCXA 4AECA 2P77A 4BMOB 1FXSA 4LGMA 4KODA 1M6WA 1K68A 4A6DA 2FVYA 2J3MA 3H05A 2V7QD 4URUR 4X65B 5PGMA 5C8YA 4JI8B 5E9JA 3LCRA 2O2JA 2E4AA 1A0OA 2TMGA 2LE0A 4MJ7A 4WL0A 5TEWA 2IZ7A 4ZZ1A 5LQCA 4L0QA 4D0NA 3KE9A 3MJRA 1OGJA 4BNXA 1RRPA 2VTDA 4JQSA 5H9VA 1B4FA 1U6JA 1OFUA 2YFYA 2AMYA 1Y5RA 1USGA 2YFHA 3DULA 7ICEA 2Y1EA 4MLZA 4BC0A 1D03A 4QZHA 1OTXA 4H9GA 3ZDBA 5IJ9B 3FZGA 1AUPA 3K6JA 5KMGA 1XTJA 3WRVA 3HDTA 3WWCA 2DBRA 2EZZA 3L07A 4M0EA 4HNGA 2JEYA 1B73A 5JSFA 1DMSA 1UADA 3HP6A 2IA6A 3PQ3A 4GP9A 4OBEA 1NC1A 3JPRA 3CF6R 3FSJX 2QV0A 5AXCA 4IS7A 3O8LA 4ZXFA 3IUNA 1TZCA 5ICCA 4Q3OA 3MGKA 3N3AC 2H8GA 4ZQGA 1JBQA 4GLJA 4YWHA 4FWTA 1W36C 4BN0A 1X80A 2NTJA 1U80A 3GGJA 2IS2A 1XKLA 4Y1RA 2EKLA 4PAWA 2AI1A 4PO8A 1HDEA 3EC1A 2YWGA 2A3NA 2A2ZA 1HT2E 3B38A 4KE9A 4QICA 3FYHA 1XZLA 2RB4A 1Q7RA 3HDJA 4IGAA 4MJXA 4A8HA 2ZB4A 4S35A 3ZHXA 3CLSD 2A0FA 3A6KA 3FR8A 3IUPA 3G6VA 4QDXA 3ZXYA 2OZLA 4M36A 4HZUB 2I7CA 4A82A 1N5XA 2YXPX 5T6BA 1EK6A 3QA3E 4L6IA 1R5BA 1V1RB 3ISDA 2JIDA 4NHOA 5CTJA 1VLMA 2IPAB 1THGA 4GLFA 9ICVA 5T57A 1XG5A 1J0CA 1XTPA 2HBZA 2P6OA 4PLWA 3SF8B 1O95C 2XD4A 5FL7D 3IGFA 1XVLA 1YONA 2Y93A 1KI3A 5K3OA 1L5QA 3D3EA 4J0HA 1KKLA 4RE6A 1NBAA 1HDCA 4G1FA 4OHZA 2AFRA 4Y2YA 1P81A 2VDVE 1P4SA 3SV4A 4I50A 4CTJA 4EUFA 4X62B 4O3FA 3EYWA 2PMDA 3LT1A 3RR7A 1PZEA 2AOTA 4IV0A 2AFIA 4LYGA 2YNMC 1ZQVA 1Z7WA 2RK6A 3O91A 4V0NA 4TLBA 4J1QA 5T64A 5THKA 1QNFA 1RT9A 1GO2A 2QRGA 3TR6A 2Q27A 4ZVTA 2D3TA 4BNFA 4CIYA 3QXJA 3MM4A 3KOYA 3OKAA 2YW9A 1BMTA 3TEFA 5LDGA 4O4LB 1ZQAA 2BFFB 3A6JA 3S3TA 421PA 4LF4B 3KD3A 1P1FA 5KYTA 4RPXA 5J9FA 1MMFB 5DB9A 1NDUA 1I7NA 1VHDA 2QAGC 1RYDA 4MQMA 4K4GA 2XVXA 2OG2A 2EL7A 2V9ZA 4U2FA 4ZOLF 5JAZA 3EF0A 5A0FA 2C2MA 2R8JA 1IULA 1JAYA 1QCZA 1M8KA 1AIPA 1YZGA 2BKAA 2P2ZA 4ITRC 1U2SA 3B0XA 4I4IA 4NE7A 3N6XA 4EJSB 3PPVA 2B1RA 1M1ZA 1QUEA 4HBGA 3N6RA 1RYRA 4YYEA 5JZSA 1RLUA 4XRRA 2ACKA 2WWGA 2WTAA 3EIUA 5BW4A 8ICCA 2GLTA 4B7CA 1UL1X 1PNTA 2NUTB 3BWEA 4Y2XA 3GI1A 3BA6A 4MIYA 2MMGA 5LBUA 3V2IA 5B1EA 4DCOA 5TIIA 1ZQKA 1KR2A 2UZ1B 1Z15A 4IFEA 5DLEA 4JCCA 1YACA 4DEVA 1HDYA 4JVLA 1HE3A 5J2UB 4X5OA 1YB1A 1CX9B 2ATEA 4LKRA 3I34X 4Y6OA 3IIKA 1X2BA 2F00A 3CLUC 4MI6A 4ETIA 5E8JA 1U2DC 2MJLA 4YHHB 2FN7A 4LF8B 3OAAD 3DOUA 2HT6A 2LIVA 1B8PA 2JVKA 2GN2A 3T7TA 1OMOA 2ZSFA 3RSSA 2N46A 2BV3A 4MCHA 5AW1A 3TCXB 4S1OA 3GCWA 3UB4A 4RZ3A 1JQJC 5K01A 4H3SA 4N6NA 1C30A 2FXVA 1ZN2A 2CZCA 2DU8A 1XQ1A 3IRVA 4LAFA 2NTVA 3GGOA 2QRQA 2I76A 3F7TA 4JGIA 2J59A 4G5OA 2G71A 3PD1A 3ZLBA 3IQDB 3JXEA 2R1ZA 3LOPA 1EFTA 1Z0ZA 3VJMA 4W6QA 2JFXA 1KYQA 1ULUA 1JECA 2OCPA 2JA1A 4H1UA 4HRXA 5J2KA 5SV2A 4KSBA 3CPSA 4MYCA 4NBUA 3FVQA 2WINI 3JQPA 1PZXA 4QDOA 2ZIEA 2HHVA 1LI4A 4LDPA 4IOMA 1L5RA 1R0LA 5CFMA 2R1UA 3EXG2 4EFKA 1FDUA 1YVRA 4JJIA 5FUYA 3SG0A 2NU9B 4D9HA 3OZDA 2D7DA 3SQXA 1OFUX 4LVNA 3TX2A 2W9MA 1QR2A 2BZFA 3L0PA 4C3ZA 3IBCA 3A25A 2RH5A 4KLJA 3P0FA 2Q41A 5JCJD 2W2OA 2BGUA 1JP7A 3V42A 2QJTA 1UFKA 2GD6A 5KFHA 1DOQA 2C2GA 2I03A 3FFBA 1XC9A 3A05A 4R3WA 5D5HA 1TM3E 3AM3A 3WIDA 1YS2X 2X3FA 1LDNA 1ZKMA 3NUGA 3TSAA 4DLAA 5EOVA 3U5TA 1GRNA 1EUDB 1V8DA 3ACDA 4DMCA 4QWDA 2XW6A 3G9ZA 4OKSA 1MJHA 4JA0A 4L8VA 3S2SA 3FNBA 4Q3AA 5KFKA 1V97A 3AM5A 2C88A 3REGA 4Z86A 1TNDA 4FO6A 3U7HB 1PEAA 4R68A 4XA8A 1WMDA 1ISSA 3U3KA 4ZI7B 1NVWQ 2GK7A 1C9JA 3KPWA 2W00A 4NFHA 3IXLA 5C1PA 2CHGA 3SAJA 4OSOA 3HK2A 4RVSA 3SEIA 2PCJA 4ILKA 5EA2A 1KI6A 1SUAA 4U2BA 2OYSA 4D1YA 4OBBA 5ICEA 2PFGA 2W6PA 4RKYA 2PYZA 1XEWX 3CWZA 4AP6A 2B98A 4YRBA 3TB4A 4B8ZA 3CB2A 1TAGA 4ARZA 2C7BA 4Y2JA 1YKSA 5CAEA 2R96A 2A86A 3FGNA 4IXMA 3BFVA 4RDCA 2O57A 5KNDD 3Q0TA 3UGKA 1CUVA 3ZK9A 3A9TA 4IDOA 5HEKA 4ZCMA 4NQZA 3I2FA 2WW8A 4EO9A 3NWBA 4KBGA 2G1UA 4UAVA 1NR5A 5FBRB 5EXEA 4LFBB 2AJDA 3ECSA 1Q15A 1AUQA 2C3YA 4TS1A 3RUIA 3V7FA 1ZAKA 1L7EA 3W0LB 1U2ZA 3OZFA 3B5IA 1F3LA 1WZEA 2O52A 2QN8A 2RIPA 4IH9A 1NYRA 2CNNA 3UUFA 3A1SA 4IIBA 4TSKA 2HBLA 5DTRA 2DR3A 4HVCA 1Z4JA 1ZU4A 2E8PA 3FPGA 3IXQA 4MLPA 1CS4C 1Z0DA 4RQ1A 2IYUA 3HWSA 3M6VA 3MW8A 5I9SA 4BJ1A 3SQLA 4BNUA 1ETUA 3CO0S 4KK4A 3QP9A 3B36A 5FPYA 2GJ4A 4MRAA 1PJZA 9ICPA 4FFWA 5KAFU 1EQAA 4AO8A 5AESA 5LR6A 2BKVA 1DGJA 2HUPA 2QM8A 1QE3A 3CN9A 3QM1A 5AJHA 1UZNA 3ET4A 1PT8A 4UB8U 4MUEA 5EVCA 3WV4A 4YA6A 5LKAA 3RBDA 4ENWA 721PA 4Q4LA 4YRPA 1P0IA 1XEXB 1C50A 2KSQA 2YXDA 4M87A 3RB8A 3RSHA 4WHMA 2XMCA 4X8OA 4R6XA 1M1UA 1S2LA 5TGZA 3TS1A 3UFBA 1WNFA 2P9QA 1QP7A 1ZK3A 2O1SA 2PGAA 1THTA 5I7AA 4DJFC 1FW8A 1C3JA 1ZKDA 4O5AA 5KJ1A 3QUAA 2PS9A 4N48A 3A6PC 2NNLD 4HQLA 2CB0A 2HK7A 1KERA 4J0CA 5H3CA 4BX8A 3EVAA 1CQJB 3RVBA 1VYHA 3PNBA 3V1TC 4E1VA 1CR4A 1QIFA 1K