2YMLA

Native l-haloacid dehalogenase from a rhodobacteraceae family bacterium
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
228
structure length
228
Chain Sequence
PSRSGILVFDVNETLLDLTSLSPLFERVFGDAKVLREWFPELILYSQTLTLTGLYRPFGEIAAAVFEMVAANHQAKVTPDDIAELKTRLTSMPAYPDVAPALTRLQDAGFRLVTLTNSAPSPAPSPLEKAGIASFFEAHLTVHSSQRFKPHPSVYDSTAETLGAKPEELCMIACHIWDTIGAQARGWRGGFVARPHNTPLTLAEVPQPDFIGRDMGELADQLIASLTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-HALOACID DEHALOGENASE
publication title Marine Rhodobacteraceae L-Haloacid Dehalogenase Contains a Novel His/Glu Dyad that Could Activate the Catalytic Water.
pubmed doi rcsb
source organism Rhodobacteraceae
molecule tags Hydrolase
total genus 87
structure length 228
sequence length 228
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2ymlA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2ymlA01
2NYVA 4KN8A 5ALSA 4ZEXA 1L8OA 1Z4JA 1RLOA 3WKCA 4OFZA 5T41A 3WK9A 5ALUA 3R9KA 3U7GA 4DFDA 3U7HB 4NFLA 2CFTA 1K1EA 3SKYA 2G0AA 1ZJJA 1RQLA 1VFPA 4I9FA 2ZBDA 2HOQA 3IB6A 1ZRNA 3KBBA 1IWOA 1YMQA 3PGVA 3BA6A 3UMCA 2X4DA 2CFSA 2G08A 5AKGA 3OCUA 1RDFA 3KC2A 1T5TA 2IA5A 3MC1A 3ZVMA 3UMGA 1ZD5A 3S6JA 3ZI4A 1Z4OA 1Q91A 3B9RA 3E8MA 3OCYA 3L8EA 3NUQA 4OCZA 3N5KA 5AW9A 2I34A 1RQNA 4UM7A 2YJ6A 3IRUA 2C8KA 3A3YA 1AQ6A 5IT4A 3E58A 2G06A 1MH9A 5AHXA 3PDWA 1F5SA 5AKZA 3R4CA 4UASA 2B82A 1RMQA 2BDUA 2FEAA 4UMEA 4F72A 2HO4A 3W5DA 3QU2A 1YDFA 3WGVA 4ZEVA 3W5CA 4BX2A 2YMQA 1RC8A 3ESRA 2ZOSA 4YH1A 2YJ4A 3MPOA 1QH9A 5AKHA 4CNQA 4L6AA 1Y8AA 1RMTA 1L7PA 2CFRA 4DW8A 1U2SA 1XPJA 3KD3A 5AI6A 1EK2A 1Z5GA 4C4RA 4Y2SA 5AM0A 2YMMA 2BY4A 2HF7A 4GIBA 4YGYA 5AVYA 2CN1A 3DAOA 4E88A 2YJ3A 4UAVA 2RARA 2G80A 1CQZA 1EK1A 3FPSA 3U19A 1U7PA 4EX7A 3L0BA 1Z4NA 4HGPA 4CF5A 3QU5A 3SLRA 1X42A 2AMYA 5AKJA 5AKIA 1RKVA 3SMVA 3ZWDA 2IYEA 2IOFA 3FVVA 5AW5A 2W4MA 2OA0A 1SU4A 2I55A 1ZS9A 2B1QA 2R8YA 4HGRA 3ZX4A 2GHTA 3WK4A 5ALDA 4FYPA 2HDOA 4Y2TA 2MU1A 5AVXA 2ZG6A 2FPRA 4CF4A 2FUEA 4AP9A 3I28A 1Z4IA 5ALEA 2OYCA 4XE5A 1WVIA 2YJ5A 3L8HA 1TJ3A 3EWIA 4L6CA 5ALHA 1Z4LA 4BYGA 4NV0A 5AW3A 3UM9A 3WKEA 1VJ5A 2HHLA 4ZEWA 3R09A 4EX6A 1NF2A 2FPXA 4NWIA 5AVRA 1T5SA 2PKEA 2JAUA 5ALOA 1LTQA 3U7EB 3A1DA 2MU2A 3WKBA 3I1YA 4EELA 3KOOA 2YY6A 3SD7A 4QQFA 4BEVA 4G63A 2Q4TA 5AI5A 4Y3UA 5AW0A 1FEZA 2JAWA 3ZU6A 3ET5A 2WHEA 5ALFA 3L0YA 4UATA 3ZW7A 4KX3A 1TJ4A 3OCWA 1JUDA 4HGOA 2Q4RA 5AESA 3AR3A 5AI4A 1KYTA 5ALNA 4Y2UA 5AM5A 4CE6A 5ALZA 1ZRMA 5AW8A 5AW2A 2JAOA 4JB3A 5ALMA 3HYCA 3KZXA 3ZX5A 1Q92A 1TE2A 1QQ6A 2WF8A 3WK7A 2I33A 3ED5A 2YMPA 4UARA 3I76A 4J2TA 4BNDB 1ZD4A 4BX3A 4AS3A 4AS2A 1RLTA 4UU0A 4MUMA 3ET4A 1RKQA 3J7TA 5ALJA 3ONNA 1L7OA 3SHQA 2GMWA 1N9KA 1RRCA 2WM8A 3I6BA 3U26A 3OTQA 3BWVA 2FI1A 3NRJA 3RFUA 2B8EA 3PCTA 2W11A 4EZEA 2P11A 4BBJA 2HI0A 1RKUA 2DQSA 3MMZA 4OD0A 3RF6A 3DDHA 1L8LA 5AVQA 4Y2YA 1WZCA 4XPZA 3GYGA 3ZTYA 1QQ7A 5AW6A 4BX0A 4Y2QA 5AM2A 3E81A 3L1VA 2P69A 2HEGA 3AR7A 3NAMA 4J03A 4NAVA 3W5AA 1L7MA 4UMVA 2B8JA 3PGLA 2W43A 1SWVA 2P9JA 3L8FA 3AR6A 3F9RA 1XVIA 5ALIA 2G07A 3D6JA 4CF3A 1Z88A 2IOFK 2AH5A 4UAUA 1LVHA 2HF2A 2Q5EA 3OCXA 5AICA 2WFAA 1Z5UA 3VAYA 3WK6A 3ZWKA 3OPXA 3AR8A 1S2OA 2C88A 5AW7A 3AR4A 3WKDA 4Y2XA 2B30A 2RB5A 3B8EA 3L5KA 3NIWA 5AKLA 2NO5A 2WF9A 2YMLA 3EPRA 2C8LA 2O9JA 4KYTA 2G1AA 2PR7A 5AKEA 2ZBEA 1CR6A 1J97A 3WGUA 4YCNA 4HGQA 1L6RA 4KNWA 2R8XA 3AR9A 5AVUA 1NRWA 2GO7A 4G9BA 2AGVA 4YCLA 5AIAA 3FGOA 3QX7A 3P96A 3WK8A 4Y2RA 3IJ5A 2OM6A 1Z4QA 2I54A 1RLMA 4HYTA 3M9LA 2FPWA 2YBDA 3N07A 4UU1A 5AKYA 4JDPA 1O08A 2GFHA 2GHQA 2OBBA 3QUCA 3SF0A 2I7DA 5JJBA 5ALRA 2QYHA 3EF1A 4IG4A 2IOHA 3SKXA 5A3QA 5ALVA 1U7OA 1O03A 5AVSA 5FP0A 5A3SA 3QUBA 3U13A 3ESQA 4Y2JA 2HCFA 3K1ZA 4NABA 5AI9A 5ALQA 3QYPA 3A1CA 2YN4A 4BEWA 5ALKA 3WK5A 1S8OA 2QLTA 3DV9A 2EATA 4UMDA 2JARA 4YIHA 4DCCA 3NASA 1TA0A 3U7FB 1T9ZA 3MN1A 4Y2PA 1U2TA 2O2XA 5AM4A 3EF0A 3OCVA 4RESA 1WPGA 4EENA 4UW9A 4OHFA 1Z4PX 1L7NA 2WF5A 1SWWA 4KX5A 5AVWA 2FPSA 2ODAA 4RETA 3DNPA 3M1YA 2B1RA 3N8GA 5AW1A 5ALLA 4YCMA 3FM9A 4HAIA 4XQ0A 4FE3A 1RPZA 3NALA 2WF7A 2AUTA 2HSZA 4C4SA 5AM3A 3FPBA 4PNHA 4YIKA 5ALTA 1U02A 2BDEA 4Y2VA 3ZTWA 5IS2A 1PW5A 4KNVA 5AVZA 4GXTA 3KDPA 3TLMA 5AI8A 4QJBA 4FFDA 5AK4A 5AVTA 3L7YA 3QUTA 5A3RA 1YJ5A 4O8CA 1J8DA 1QYIA 4UMFA 4BNDA 5AK3A 5ALGA 1NNLA 3OCZA 5AI0A 2B0CA 4IFTA 5ALPA 4MWOA 1Z4MA 4I9GA 5ALWA 3QU4A 2YFYA 2JGAA 2RAVA 2ZBGA 2ZBFA 4BKMA 3E84A 5AVVA 1YNSA 2WF6A 3QLEA 5AK5A 3QUQA 5ALYA 2HX1A 3ZVLA 3QU9A 5ALXA 3WKAA 1TJ5A 4H1WA 2D2VA 2EARA 5AM1A 1VJRA 3CNHA 3B9BA 5AKXA 2ZXEA 1RMYA 3QNMA 3AR5A 4HGNA 2FDRA 2G09A 2MSNA 2R8EA 5AK6A 2C9MA 2EAUA 1ZOLA 3W5BA 3CZ4A 5E0OA 3A1EA 3FZQA 3L0CA 3QGMA 3NANA 4XOUA 2NO4A 4C4TA 3L1UA 4F71A 1ZD2P 1WR8A 2I6XA 2C4NA 5AW4A 4L57A 2R8ZA 2FUCA 1YV9A 5IT0A 3UMBA 1QQ5A 3N1UA 2FPUA 4DWOA 2RBKA 1ZD3A 1YS9A 3AR2A 3ZVNA 2PQ0A 3QU7A 5AKKA 1Z4KA 1XP5A 5AIBA 2VKQA 3QXGA 3N28A 4B6JA 4EEKA 3L8GA 1N8NA 3ZUPA 3HLTA 4UM5A 2P27A
chains in the Genus database with same CATH superfamily
1Z4JA 5KI6A 4P7JA 2CDNA 5BN3B 1DQPA 3NO4A 2YN2A 4UE3S 3F8SA 2RHRA 4X1IB 4ZRDA 1PGPA 4D46A 2DU8A 3ISBA 4P4PA 1FXSA 4E22A 1LF5A 1SIBE 2ZIEA 1VJCA 4BQFA 4RQ0A 3MUEA 3I2YX 1JG6A 3K15A 4B7UA 5DLEA 5GIOE 4YFVA 4QUJA 2BDUA 2B34A 5KJEA 1E3WA 1Q15A 5AXCA 3WGQA 2IYFA 4EYEA 1ZJYA 8ICVA 5I9SA 4L8WB 3NHMA 1G20E 4BO9A 2H4JA 2KBEA 3GEGA 4E21A 2WNHA 1JXMA 1ICEA 3VYRB 2PS1A 2RG1A 1QF7A 3COJA 1PN3A 1RAFA 2W6JA 3QU5A 1K7SN 4XCVA 5CH8A 3M5DA 1DQZA 4EG0A 3SMVA 4YD1A 2Q5QA 2H29A 1BC5A 4L07A 5AW5A 5LYJF 4MWCA 1ZGHA 4L85A 2CSXA 2OYCA 4S2UA 2W90A 3OIUA 3TSZA 3SM9A 4AICA 3PV0A 2ECFA 4J2OA 3JD0A 3KOOA 5B1HA 1YUNA 3RS7A 2HRRA 4JT9A 2WHEA 3GPBA 1I80A 2PMZC 3D2LA 4X54A 5BXYA 3MABA 2D6FA 3ASZA 4MJ7A 3TLXA 3MBKA 1HUOA 2DY1A 4AMGA 1GITA 1SU7A 5J2KA 1BEUB 1P80A 3GFSA 3MW8A 3F6CA 1NP7A 2UVPB 5G53C 4EYIB 3RUAA 3CXUA 4JGGA 1ECFA 3EMKA 2J5BA 4PO3X 1Z06A 5JV5A 2RGNA 3WGIA 1BVHA 5IHXA 3GARA 4FKMA 3UAVA 2M32A 3ZE1B 3TJZA 2IK8A 5J2TB 3OTWA 1T3GA 3A28A 3IIKA 4I9HA 4MS3B 1WCIB 4J0FA 1THMA 2Y92A 2R751 3RG2A 4LEIA 1WS6A 2YZKA 3GJ7A 4R8UA 3NVVA 4YAKA 3T5DA 5DI3A 8ABPA 2UU9B 3MFQA 4EF6A 4B85A 1THGA 3KT6A 4N3AA 3QNWA 1KZYC 3FPKA 3SMQA 4GRIA 4FDAA 1ZVJA 2FMIA 5CVVA 1A96A 3OU2A 4QAQA 4G8JA 3TKLA 4DA0A 3NVMB 3VRHA 4OUDB 4MR8B 4TLEA 4Z7OB 3FCSB 3HKZC 3S44A 2XUHA 3EPHA 1X9MA 3K1ZA 2BONA 3RJFA 4PQEA 2CZQA 4CV3A 1TZMA 3OEEA 3HCNA 4WCFA 4KV9A 1WETA 3KKPA 1Y1LA 4BV2A 2GK3A 1EVIA 1F0YA 5KVSA 2B99A 4NE9A 1T34A 2KK0A 1TK3A 3RUEA 1TK9A 1JEQB 3MTGA 1V1RB 2AOVA 4EFKA 5TQ2B 5CPBA 5IC4A 3D8UA 3I53A 4AG6A 4KH1A 4MEAA 1E1YA 2DVMA 5FPHA 3X2EA 1YHNA 1HRDA 3EC2A 5JI2E 5TVGA 1PE0A 2VNHA 2PSDA 1G5RA 2AXPA 5J2IA 2K89A 2EJUA 3BH7A 2X22A 2FW1A 1XNQB 1EK5A 3QNUA 2K2QB 3LCRA 1CE8B 1DG3A 1QWOA 1SG9A 4ALNA 2O8DB 1Z28A 1LS6A 3OM8A 4N6NA 1KOJA 5T14A 5JZMA 1PJQA 1V16A 2FOIA 3BD8A 4G4SP 4YJ2B 2BMAA 1T24A 3R7WB 3VKVA 2QL5A 3TCNA 5DPMA 3PDIA 3E7XA 5LXTA 1JV2B 3EB9A 2POQX 8ICJA 4JEUA 3Q3IA 3OVMA 5FOWA 4DIKA 4ER0A 1GSAA 3VR4A 1E2BA 3RH4A 1NTOA 1GKKA 4NFLA 4QWBA 1TU0A 2C61A 3EXAA 4LZZA 4E30A 4DTIA 1DT5A 5EY5B 4YO7A 4ZVTA 2C58A 5SYNA 3LMKA 1KYZA 2KS6A 3TO5A 4ZT6A 3T4EA 3TZLA 3JPNA 4B9AA 4US9A 5K1ZA 4Z1OA 3Q7PA 1ENPA 4P3NA 2ET6A 1E3JA 1NVEA 4PLPA 2RAUA 3WGJA 3LI2A 4V0NA 4L9WA 5H5JA 1T0HB 4FMBB 3NOQA 1GARA 4EH1A 2IZZA 3NGMA 4HLUA 4R2LA 5E2AA 4PEVA 4ZZ3A 4H2DA 2GM5A 3TIVA 1DPFA 4YPFA 3TAHA 2FWNA 3D54D 3HP4A 3HHPA 1Y3BE 1NYTA 2XJ4A 2W9XA 3BJIC 4C3OB 4J6FA 1URJA 4Q45A 4URXR 3EVZA 4Q1VA 4FILA 4WEOA 3SZRA 2FPRA 2QSJA 1MO5A 1FYWA 3UPUA 3M4ZA 4NWIA 1HFJA 4IIHA 5FAXA 5B5SA 2PXHA 3JQAB 2KD1A 1OUQA 4QGAA 1R64A 4MUNA 4DABA 4KQFA 1OH7A 1HT1E 2WSSA 3DOUA 3IBSA 1VYTA 5KSWB 3HVKA 4M6WA 1OAAA 4J0HA 1Z74A 3WFJA 2VWQA 2Z95A 4QZBA 4DEXA 4I6GA 1Q1ZA 1NKVA 1OA1A 3MDCA 3C39A 1NJYA 5IVKA 4DMCA 1J5XA 3P9NA 3E3LA 3HCEA 2HJGA 3F97A 2FSVA 4YRLA 3S81A 4KQ6A 3LRXA 1UOEA 4XJXA 1BO6A 1M5UA 3A05A 4HDQB 3WXBA 1KDOA 1GGFA 3U60B 1UKEA 4L0MA 1TU4A 1JALA 3VH3A 5JASA 5CWRA 1U5BA 1Z33A 1WTCA 1KQPA 3SJAA 3O95A 4O3FA 2N42A 4YRFA 3PQCA 2DFTA 4V0SA 3IHWA 1BWPA 2G76A 5LWQA 5FUQA 4QEKA 2VJCA 3CNOA 4DPMA 1FXUA 2YWFA 5F51A 4PPFA 2O8CB 3PI7A 1SFRA 2F6RA 3QBEA 3KFLA 2QAIA 2V4UA 3UCXA 2E18A 4KXYA 1C0PA 1DEHA 1KH1A 4QBTA 3TK1A 5FORA 4J0QA 4OAQA 4XGIA 4M83A 4XJTA 2G7ZA 1A2QA 2HLDA 5PGMA 4X66B 5JEEA 2OVFA 1XNGA 3DO6A 2CCGA 5KFPA 4EITA 1QIJA 4GS5A 3LY8A 2ATLA 2I29A 2MSEB 5KT6A 4CDGA 3W4KA 1TX4B 2PG3A 2DKXA 4CDRA 5DP1A 3M8SA 3Q8LA 3CYMA 2TMYA 4WLNA 2WUFA 2ZI5A 2BMVA 4BFVA 2FY8A 3O73A 3O8QB 5ISMA 4ZQBA 3QG5A 4JOBA 2RE8A 2PVSA 3ICWA 1P3JA 1CJMA 4CR8A 2H92A 1K89A 5E6SA 2V8OA 3H04A 4R1PA 3BG5A 4E07A 1CS0A 4WVLA 4WY5A 2ZJ3A 3E8XA 3A04A 3D4PA 4ED0A 2MWMA 1V3TA 3JPSA 1VB3A 4JEHA 4TQRA 3OEED 1TW3A 4UB6U 5LJLA 1SO8A 1JIHA 2QMYA 3G2JA 4TVKA 5CHEA 1RYZA 3JVIA 1KEKA 2GZDA 2VHWA 4E4RA 1N5LA 1XCMA 3ZGXA 3NNDA 1P39A 4Q9IA 4EFDA 4HN2A 5DLYA 3RHFA 3LUDA 5G1PA 1CQJA 3KKAC 1PQWA 1PUZA 2O07A 2JJQA 3MELA 3L49A 5A4JA 4YX9A 1RPJA 2ZPAA 5CT8A 5LYJA 4AU1A 3O0TA 2ZTSA 5EERA 3DZDA 1LLFA 1Z1BA 4HQFA 4MQEB 1IXYA 4IFIA 2PFNA 3UT5B 2KVCA 2C84A 1C3LA 1Q3TA 2C2DA 3ESRA 1T3NA 2NTNA 2G6TA 3Q2OA 4EA6A 3UAGA 3JAKA 5JRZA 1U2SA 2QUHA 4Y2SA 3VR4D 2X9GA 2PSEA 1G63A 3V1KA 5G0VA 4Q1EA 2XY5A 3I0MA 3SSMA 3PD7A 1YZNA 1P4GA 1RXVA 3C21A 4YQZA 1UDRA 5CLLA 3QVKA 4B73A 2LCFA 3RFVA 3FMIA 4QJ3A 3WTCA 3KOXA 4FD2A 4C20A 1QZXA 4YPVA 2QRKA 4KVAA 3H87A 4F56A 4KRXA 1Z4LA 3D0OA 3UXYA 3WLMA 4LYJA 2FPXA 3LX6A 4KOAA 5EJGA 1SJ9A 3W8DA 2AS0A 4DCMA 4BPRA 2WE7A 3JQFA 2YY6A 2CVPA 4YVFA 5AMXA 4LJYA 3VZRA 4FEAA 1FNBA 1M10A 3K0AA 3MVEA 1ZN9A 3EA4A 2P9EA 5KINB 1SGGA 4YAWA 1H9CA 2BEWA 1YI0A 4UARA 3H16A 1GD1O 4EO4A 5JXIA 1LA2A 1ZBDA 1IONA 3K73O 3JU3A 3P7MA 3OZUA 3GIIA 2FMXA 2A67A 4XGRA 2QENA 3EPKA 3GFQA 4HFMA 3OKPA 4MUIA 3LOUA 3SDSA 2E89A 3R5FA 4WPGA 4O2AF 1BJRE 3E1KA 4ANFA 2ECQA 4IGEA 2QN1A 2W9MA 2HEGA 1KI8A 2IPMA 5EQFA 3UC9A 5KSPA 1XZBA 2P1ZA 2WSSD 4GLBA 2YH2A 2B4AA 5C8XA 3UAYA 3ICOA 2I7VA 1YFLA 6LDHA 3K16A 4RAOA 2B7BA 2ORWA 4EMTA 1P91A 1UPUA 4QFCA 4KN4A 4U2KA 3MJRA 5JWHA 1IY8A 3ZQJA 1Z00B 1WW8A 1CJVC 1WDLA 1XYYA 4Z4FA 3QPDA 4G9BA 8ICAA 1FFWA 1Z7EA 2JD0A 2VAPA 3LLUA 3VPAA 2JFPA 2XDAA 4MQBA 1UPAA 2LKYA 2I03A 3K92A 3BOSA 3PSPA 1P29A 2XB6A 1T3QA 3VR6H 4CU2A 3K1RB 3KLNA 1ZA2A 2C83A 4QEDA 4V38A 5EWLA 3TXAA 1OBCA 3F4BA 4U5XA 2AWNA 4HH4A 4NABA 3RFTA 2PT9A 3UPDA 3A1CA 1KQQA 4BJHB 2W0MA 1JJFA 1PVPA 1NK5A 1KBZA 1YBMA 4GKAA 4WUTA 2CE2X 2PRZA 2I87A 3HPOA 4WFKA 2B1RA 3P20A 3N8KA 4TS3A 3GGJA 3UGJA 1K8ZB 3SYZA 3WNQA 2P9CA 4H0FA 2VXYA 2VWPA 2H2HA 3QX3A 4ZQHA 4YC7A 2XSZA 2IX3A 4TUYB 2GKGA 2LCIA 3M6WA 3AY7A 2JGAA 3SI7A 1P6XA 4KOEC 3M9OB 1Q57A 3DSRA 3Q3EA 3S2GA 4PCUA 1ND6A 2D4AA 1YE3A 1G8FA 3OEYA 3KQSA 4L57A 3G1UA 4I4LA 4MKHA 4ATNA 3RSHA 1JKIA 5CCEA 3VMMA 3L7BA 3SFZA 3K20A 1MEJA 2RGCA 4KQWA 3ANXA 4EB0A 1M2VB 4RTLA 4YXWA 1MQAA 8OHMA 3F2VA 1RQ7A 5DSTA 2H4ZA 2IBMA 2H5XA 5C9ZA 1AU9A 5AHRA 3BULA 3N2KB 2EU8A 2J9GA 3OCUA 3ONWA 1T3SA 2GQ0A 4YALA 2C7GA 3EC1A 1KOFA 1DOAA 6NULA 1Z6TA 4FZRA 4HPJB 4ZARA 1UP4A 3AEKA 2AD1A 4ARZA 1K1SA 1PHRA 4RQUA 2B82A 3NLLA 4QODA 5D00A 3ZQKA 5KU1A 1C8BA 3ZDYB 1Y1PA 1Z13A 7ICFA 1MRSA 3L4JA 3LO8A 1I30A 5FXMA 4FCWA 2NPIA 3SC6A 3H1EA 1MSWD 1M67A 4KMSA 3JRWA 1YBVA 5E38A 1BDIA 2AN3A 3ILXA 1ORIA 1N8KA 1GZ7A 1QF9A 4OVKA 2J6CA 3H4MA 3EAQA 4FEYA 3JCZA 1YR8A 4TYYA 1T2VA 3ZHOA 4DV1B 2PUBA 1D3AA 1JSXA 1BAPA 1CUHA 3P0IA 4JLBA 2ZG6A 1XZKA 1NBAA 5H3LA 1CJUC 2O8BB 3R09A 3P9XA 2NUTA 2FHSA 1PP4A 1Y5NA 2GPSA 4MQ5A 3A06A 5K0LA 5AVKA 1AXGA 3X44A 1QP0A 4FJ2A 5BWLA 3JYNA 1P5FA 4J3NA 4CL2A 2Y9UA 5TQ0A 3AR3A 4KPYA 2Y1IA 4YMLA 4M9NA 2XTJA 4FNMA 1II0A 2FGJA 3UV3A 4DIFA 4O4HF 1TXGA 2J9ZB 4KPEC 3FMFA 3WWOA 4I29A 1KVUA 3DD5A 4ACBA 1N25A 2PUDA 1ZCBA 2F3QA 4J1TA 3B0YA 1L5GB 4EHIA 3T3HA 3T9EA 4M1WA 4R63A 2HV9A 5D86A 5U9CA 1KGDA 1ZRSA 4O33A 4BBZA 1H22A 1DADA 2NU9B 1ZCAA 4X61A 4Z49A 4FDLA 2WICA 2P40A 3S2SA 4KVGA 3R0XA 2D0OB 3O82A 2ORYA 4EYQA 3DW1X 5FNVB 3GBVA 5TGZA 2VQ6A 4W9RA 4DVJA 2QXTA 2H4HA 5D3ZA 3L0DA 4N6GA 4PTYA 2Q0QA 1C9EA 2G88A 4YRAA 3NHSA 4ER3A 3MWEB 2REBA 4XM1A 3QELB 3R40A 4DCVA 3MRTA 4GSKA 1UWLA 2KHZA 2QTRA 2PGLA 4AZ0A 3FYTA 4C05A 2ZRIA 2C0PA 2PUTA 2BBOA 1OFGA 1X1DA 3H75A 4MVXA 4E3ZA 1DK2A 1RG6A 4HYTA 4R8MA 4BLWA 3UQ2A 4EJSC 5C1IA 4EL5A 5EI5A 3LWDA 4X71A 3GDGA 2CMGA 4JY7A 4M4SA 3UKOA 3CN7A 3UKJA 2Q3BA 2V7QA 3GMDA 3FNIA 2R84A 3H86A 3DOOA 1CR0A 5IK2A 3LYHA 4UUBA 1C3VA 1HJPA 4MA4A 2P6MA 1UK8A 3NHPA 2INGX 3WBKA 2UYOA 4RPHA 4RMNA 1VKRA 3WR5A 3D64A 4NLCA 3A1SA 1FFXA 3FPBA 3HU2A 1CDDA 5ILGA 4DOBA 3ZV7A 3ZLTA 3SGLA 4H7EA 1Z7BA 3HKDB 1QYCA 5FPPA 5K6AC 1CRQA 4V03A 4EDFA 1Q74A 2C5FA 3EXIA 1BKDR 4U6PA 4QO7A 1MXFA 2I66A 1UJBA 3SNHA 4AJHA 5EQTA 2AZXA 5HILA 4Q3KA 1DKUA 2D3TA 1P4AA 1JMKC 4Z8XA 3D81A 2F3SA 2H9YA 4OJPA 1F7VA 2ZBUA 2WW8A 3PHGA 2I6FA 4X7RA 1ABBA 4B6QA 3A32A 1I2ZA 1H6AA 3AQ4A 5HQ3B 3AKYA 4JV2A 3UATA 2IHVA 3D7RA 4U3JA 1V11A 1TCVA 5KVAA 1EDDA 4J0CA 4BVKA 4CV2A 1W93A 3IVAA 2CFSA 1QIHA 1L7XA 3UHOA 4DQVA 7ICVA 5HHHA 4TKVA 4LNUB 1EJ6A 1QRDA 3ZVRA 4YAIA 4OCZA 4GLJA 4MUXA 1JKJB 4KAJA 3D7LA 3G2PA 1CB7A 3PEFA 3L0SA 1DWUA 1MFZA 4YR9A 4WERA 1RYYA 2PBZA 1ZZEA 2ZROA 3U7RA 1G3QA 4DL6A 5KL8B 4XVCA 3FFTA 3LS2A 1S97A 5DXJA 4DMGA 4EFMA 5KZMB 4OHXA 3OJOA 2DX7A 1XF1A 4WJKB 2CV0A 1NVXQ 2Y0PA 2O06A 4B9LA 4JOSA 2X0FA 1RYNA 2PFOA 3FN4A 3ZCQA 4LZJA 2GBFA 3SSNA 4JX9A 1DAOA 2BM9A 1I4EB 2YS6A 2B6HA 1PLJA 4RQ3A 1UC4B 7ICKA 2WWIA 4H1HA 5B6JA 3PA6A 4F4CA 5J0OA 4D9MA 5JFGA 1P3DA 2FFAA 2KV2A 2WIFA 1Q7BA 4IIJF 2PKEA 3Q3HA 2AUNA 2W6IA 4BIMA 3SXUA 4E33A 4O2AA 4RA9A 1DVRA 3OPNA 3CRRA 4OF4A 2X3FA 3LWZA 5LBTA 2CVQA 2N1BA 3HP7A 1H38A 4V02A 2FUG6 1UJ4A 1XWIA 4UUOA 1QIDA 4FZJA 3W6NA 4OI0A 3CIOA 3R3WA 2Y0CA 2BF7A 4UHDA 4IXNA 3OJSA 3I76A 4JZYA 2W2QA 5C0YA 4J16A 3U26A 1RC1A 2GLEA 3OEHA 3QHQA 2IYSA 4HJRA 3SR3A 5JPIA 5F76A 4RHFA 1WPRA 1C0LA 1Q16A 3OQIB 4NAVA 1L6NA 1VL2A 1O87A 3IA7A 1J0CA 4W5HA 3HJEA 3BK7A 1W35A 5J5CA 1TT7A 2W6MA 3LDFA 3F4KA 1YTUA 4KQXA 2A9PA 1KFDA 1DKPA 3MTQA 5BN4B 2Z9DA 1RPNA 1VL1A 5K8TA 2XITA 3H8MA 3KSMA 3PEVA 1KI6A 2FQYA 4EPXA 4DUGA 1MU0A 5ECDA 2FPMA 3H0EA 3IEPA 3QJGA 2LHTA 2E8OA 2WHPA 2Z6VA 2E4YA 8ICTA 5M5BA 1L7EA 2BCUA 3TOXA 5JZVA 1KY3A 1U2PA 3OT5A 4YMHA 3OUTA 1YT3A 5B3LA 4PGMA 1OROA 2BMWA 4BMCA 3FYDA 4I19A 2V4RA 1NXQA 1MAWA 5EP4A 1EWVA 4IIUA 4D56A 3FIJA 1JTFA 3BL8A 4ES6A 4KPFC 3HSYA 2XUGA 4XFDA 5KPDA 1GTJ1 4DLVA 1XTPA 2P6PA 4BB9A 2HFKA 2N1MA 3KAQA 4BQOA 3T6KA 4XR4A 1M6YA 2NZXA 3WLRA 1XVUA 4CW7A 1OWNA 3CRQA 3HQ4O 2CNOA 4O3NA 4K5QA 1SV4A 1EGQA 1QFZA 2KJ9A 3V4RA 1KTQA 2J3LA 1PD0A 1RYHA 4M9SA 3ZU5A 4V0ME 5EUCA 1QFYA 3DZBA 2I6TA 4K2AA 4B9NA 2ZPUA 4KXLA 3G79A 4QYWA 3A27A 4Q7LA 4D9JA 2WF6A 5F9NA 5BV7A 1GKYA 2D2VA 3SVZA 5KNBH 1DAIA 3DZHA 7ICSA 3B9BA 3H2KA 3IAUA 1B8OA 4MICA 4ERXA 3KEMA 5ETJA 9LDTA 2VTDA 3VU9B 4JJKA 5BRJA 1ZD2P 1I3MA 1WSWA 2YZNA 3E1SA 2FYTA 1SCAA 1HL3A 1ZX1A 2PQ0A 3EVFA 1GR1A 2BPCA 3PR4A 4DUPA 3OFSA 5FPQA 1G2QA 5J9FA 3IDSA 1ACLA 1XALA 4MR9A 4H7HA 4EWLA 2PNFA 1A50B 4JC4A 5MN5A 1KTIA 4Z4QA 4H3KB 4BMSA 2YFQA 2WWVD 2RHLA 1YMUA 3DM9B 4PPGA 1GQOA 2QX7A 2JGFA 3VJMA 4DLTA 1M6HA 3RRMA 2P9FA 2XKJE 4OJNA 1Z56C 4J0GA 4DLNA 3D59A 3DKVA 3UBMA 3BGSA 3E9MA 1M7GA 5J2EA 1T8RA 1QP8A 4TQSA 4JQCA 5CG1A 1L5NA 5KT3A 3AI1A 4QPZA 4L0CA 2JRCA 4YH1A 4DDHA 3MCAA 4PCAA 2CKMA 1HZZA 2H4FA 1XMQB 4ZYXA 3TI0A 2WSMA 4QRHA 3N0XA 4W7HA 1E4EA 4DE5A 4DO9A 2FRVA 3R41A 3RSFA 2QZ4A 4UTNA 1SVKA 3WOVA 4O4HA 2V3WA 4PS1A 3CXRA 1SBHA 2VSOA 2I55A 4F4JA 4IZOA 5AVXA 1QH8A 2OCAA 3EVTA 4HOYA 4RM2A 4B79A 3EWIA 2FFRA 4BN0A 5AK0A 5ABPA 3EEYA 3TQSA 1Y6QA 3N3AC 3N7SC 1TKRA 3H40A 1KTVA 1E0AA 5ALFA 1KSPA 1TM2A 3ZDQA 4UATA 1I14A 1OLUB 3M9NB 4Z4CA 5GJCA 4JMPA 4ECVA 3A11A 3AB3A 4BKUA 1CUEA 2RJNA 1ADBA 4RQBA 4IOJA 4KTQA 1CIPA 3AUAA 1QOPB 4QWWA 3GZFA 1N5DA 5KOIA 3RK4A 3H2ZA 4D4JA 2V55B 3HRDD 4XKJA 1SOVA 1RPTA 3IEMA 2FLNA 1L4KA 4J4BA 1E7MA 3O8OB 3WL6A 4KXWA 1T0JB 4C6RA 2W6ID 8ICUA 3LXXA 3DB1A 3LE8A 3NOXA 1M2NA 5JJCA 5E79U 4I2BA 2PV7A 4RVUA 4IIXA 1ZK0A 1C9KA 4WOKA 5ESWA 2NACA 2BP7A 1DJOA 2FOXA 1MO4A 2B7LA 2PZEA 4Z86A 1JI0A 3JXEA 4Y2HA 3DMTA 4EQ6A 5DGBA 3AOEC 4PZDA 3CRVA 1DIBA 2GYYA 4Y8VA 1CKEA 3D4BA 3I64A 1QDUA 3PFBA 4I5FA 5AIAA 1CNEA 1W8IA 4IR7A 4CQMB 1ZQDA 5GWXA 3QUCA 3SF0A 4Y7CA 4HTFB 4CM8B 4WV3A 3OX4A 4K26A 1VXOA 3LFTA 4Q3NA 1RJDA 3NI2A 3GDHA 4PC6A 2BM1A 3OBIA 3GLSA 4LV5B 3L0OA 1OLSA 1F60A 1ZOPA 3CF0A 1MG0A 3R8XA 1Q46A 1EXVA 1OBVA 4ED3A 2VJYA 2F48A 3X1JA 1P77A 5E2IA 6PFKA 3QSYA 1OCEA 4GX0A 2JFZA 3M1AA 4KSYA 3RC9A 4Z5XA 3AFIA 3AJDA 4DIBA 5BSEA 1J1UA 3PX2A 7ICIA 3VYWA 2EJTA 1P2BA 2WVHA 4C4ZA 2Q2OA 1MORA 3FPJA 3KSDO 2ZI7A 3EIOA 4JYZA 4F6LA 4Q4HB 3GRKA 2YJNA 2HZ7A 3HKBA 4H7FA 3T1TA 1O96B 4MW6A 3DMPA 4FDUA 1I1HA 2IV3A 3AL0B 3QVMA 1JN3A 1II9A 5HE9A 5AVJA 3L6BA 2XXAB 4EBCA 1XTUA 2ISOA 3GHYA 3EPGA 1SZPA 2J3JA 2RAFA 4IMRA 5BP7A 1JDVA 3JASA 1YS9A 4H1VA 5CCBA 1R88A 3M6AA 2VA3A 4HXEB 3R7NA 2VP0A 5CIYA 3GWGA 1K66A 2Z3ZA 3R3ZA 3AL3A 1XXHB 2WUVA 3VHXB 3D6TB 1EQUA 2PMCA 1GG8A 3BRQA 1TVMA 1XQYA 2PD4A 1W5AA 3FPGA 4HNGA 2QGFA 3ER6A 3FCOA 4A2PA 5DYTA 1GP2A 1Q1GA 1ULAA 3RVSA 4E4TA 1RQNA 5D87A 2BGIA 4K9SA 3UXOA 1TA9A 1NSFA 3WLJA 4CKXA 3PGA1 1VGVA 1UBGA 4V39A 4KE7A 4IIJA 2C96A 2Q1XA 4QUKA 3OIWA 1VG9B 4KFTA 4A7PA 1VHDA 3KIPA 1IAQA 2NRZA 3ZVKA 1P2TA 5A5VA 1JDZA 1PQYA 2HA6A 2IDMA 5J47A 2IEAA 4DLLA 4MXDA 1EHYA 3PVZA 1XSLA 4E88A 1QPZA 2IE8A 3D7MA 3SXJA 3WSVA 3RVKA 5F73A 4EKGA 3DOEA 2NW6A 4ZN6A 4XA5A 3ZOKA 2BFEB 2FMTA 4EBEA 4ZAGA 5JRTA 3PFHA 3FUVA 1CK4A 1DKQA 4RYDA 1OIXA 3NYRA 4PINA 1AUXA 3V8RA 3MPUA 5C32A 1VDVA 3KB8A 2H3HA 3LO5A 2PH5A 1L7RA 3EXEA 3UJ7A 1WSBA 4JKOA 5AI5A 3HDGA 5DI9A 4EB6B 4M9GA 4DQDA 3MWDB 4A15A 1E92A 3KAJA 3GRAA 3FHLA 3FUCA 5B53A 1CFJA 4AZVA 3CNQS 1JS1X 4Z0NA 5B6PA 3IUBA 1NYLA 2QTHA 4ESOA 2FDCA 1R9NA 4GMKA 3U4AA 4DQPA 3O3MB 4IHJB 4A91A 2KHVA 3TM5A 2FWIA 4DLYA 3SX4A 1HLFA 1MDFA 2E37A 1YQEA 4P93A 1Z35A 1DAFA 1QFMA 3T5CA 3RFUA 3H19A 2WMOB 1VMDA 5E4YA 4PANA 4HNQA 6AT1A 4PQGA 3T3FA 1JR6A 3QVSA 3TTTA 1NPDA 1Y3HA 4F86A 4IW3B 4DAEA 1CZUA 3DOJA 5I9TA 3MWYW 1C1YA 3O5AA 4V1CB 4N49A 4WZAA 1UEJA 3V8MA 3HRIA 2VA2A 3C3DA 3QA9A 4X8HA 4IV5A 2FR8A 4GPEA 2QRPA 2CNKA 1F2TA 5L51A 3WJAA 4FFLA 3GL9A 1NOIA 1VC2A 4MGYR 1XZDA 5LCXA 3CSSA 3L82B 5FF9A 4BO4A 9ICBA 2DECA 4EUKA 1SV0A 4YCLA 2GDJA 4DHWA 4G65A 1GRCA 3ZW9A 2HBMA 2ZTMA 4JA2A 2VA9A 3COWA 1L8QA 2VUSA 4IDOA 3OZCA 2BZFA 2X86A 5AJUA 2YB4A 2M2IA 4RVGA 3A2LA 5B3JC 2J0EA 3ZUGA 1LPSA 4UZFA 2R7AA 3HO6A 3DV9A 3IMEA 4K2HA 4LAFA 5DB7A 4RHEA 3TB4A 2FSPA 1QCZA 1GPH1 2OO5A 4CR6A 3PUHA 3AN1A 1URPA 4XCQA 3W6ZA 5JC8A 3FETA 3BAZA 2Q6IA 1N0VC 4I4IA 4TROA 3RSOA 2G9VA 3WGGA 1YB1A 3AESA 3MJVA 3OOHA 1Q1EA 3MK31 4IVPA 1DTSA 1KMHB 3L6RA 3JQBA 3CLTC 1BX0A 4TVBA 4KXFB 2B98A 3ME5A 2DCUA 4FUTA 2YWCA 2UVPA 1S3FA 4DYDA 1QPBA 4M9QA 1ZQPA 1GGVA 1T9HA 2CLDX 2V0GA 5J0WA 3Q8KA 3D6VA 1PZMA 1YL7A 3E9YA 2QLMA 3PXXA 1OI7A 1Y3DE 3CW2A 4KLLA 3ZNOA 3F53A 3EC7A 2OB1A 1QFJA 2VQDA 1LB2B 1IUNA 4JJ8A 3VOBA 2HB6A 1ZWLA 1GADO 1ZMRA 3FBGA 4L9AA 3FRIA 2HAEA 5BWOA 1QC5B 4R31A 2BGLA 2CXPA 3OQ6A 1XEXA 4M0CA 1MGPA 4ALKA 2W2VA 3CLRC 4DM4A 2M6LA 5CXQA 4AK9A 4L4UA 2IYAA 3JPQA 4IQTA 1AH2A 2ZIXA 4MW7A 4CCYB 1BMFA 3I3OA 1BVUA 1EKXA 4YRJA 1VLLA 1Z4OA 5DKFA 3IE0A 2OSVA 3HBLA 5C8YF 1FE8A 1WF3A 1LKYA 1FMLA 2VF4X 2WJGA 1KJWA 1Y1RA 1K75A 2J3HA 1NUTA 1GGKA 2L69A 2XTAA 3GROA 3JALB 4C3VA 3MPOA 2IUTA 1XD2A 2XUPA 3KXDA 3H9CA 3EGCA 2X42A 1KE2A 2CJWA 4ITVA 1YQGA 2R6HA 3NCHA 3PLNA 2RDJA 4LI0A 1R0CA 1OB5A 5KYXA 3RUHA 3K0SA 3V7LA 3WLEA 1PZXA 4JJ4A 4KDFA 5LB4A 2O8VA 1QCYA 1L4YA 1KS9A 2AVDA 2XQFA 4H16A 4OPMA 1CETA 3C98A 2UYHA 1N2JA 1PL0A 4TWAA 3U62A 3JQQA 4UFPA 1F2UB 5DX0A 1DGQA 4U2CA 1H4TA 3CNNA 4UBJA 4EVQA 2HKIA 1HQYE 3KYCB 3MQ2A 3CG4A 2YW9A 3HB0A 3JWHA 1UJNA 1UPHA 4G85A 4BEVA 1VPEA 3FYUA 2VLIA 1CE8A 4HWPA 3C7CB 5JZSA 3IO5A 1AK2A 1IG6A 2DPJA 2QK4A 3MRSA 3W77A 4F6RA 3JY6A 2Y0SF 1JR3E 4MEBA 2AEJA 3KQHA 1W5EA 1RYBA 1EINA 1XRMA 4W7SA 2UZ4A 2WIAA 3GOHA 1Z8FA 1IAVA 1VOTA 2OHJA 1KORA 1Z2PX 1FP7A 3C7TA 4N6OA 5JAHA 1SHLA 1ZH2A 3GLGE 4MRAA 4QBKA 2AMLA 4LJ5A 2GK7A 4B6FA 1I7QB 5KG0A 4YRZA 1WY7A 1C7EA 3LHKA 5DHFA 1GU7A 1NPYA 4UMVA 2FF7A 2ACWA 2XNJA 2DUNA 3C5VA 3TL2A 3GVCA 3E7FA 4EMBA 4RE6A 5KNDH 1ONBA 1RQXA 2GLTA 2B3DA 2XRFA 4ZI3A 4FJ1A 4ZZ1A 1XRQA 1PVQA 2QUKA 2F1OA 4FK8A 4FMDB 1LBEA 4AYBF 1HC7A 2EZ8A 3WGUA 3FBTA 4W5JA 2Q8PA 4WLVA 3N6VA 5JSZB 4ZO4A 4OHZA 3SBOA 1NDQA 2NXEA 7ICTA 2P4QA 2PPVA 3E4CA 3DTYA 2Y77A 1K7EB 1X7WB 3K1TA 4ZQCB 4J43A 5HUHA 3L7IA 2ZDGA 1P33A 2QRUA 4QBGB 4DDKA 2ODEA 1BEZA 4DV7B 3WICA 5G5HA 1GDDA 2VTBA 3EBLA 5I4IA 3B53X 4L7VA 1P9LA 4RSRA 3KQUA 4TMFA 1DT3A 5KYNA 2B2CA 2EQ5A 2KLBA 4P34A 5KUTA 2E8NA 1FCJA 4Q18A 4PNHA 2J0VA 5REQA 3AQFA 5IS2A 1I3KA 4R83A 3PJFA 3GPLA 3FNEA 2OMEA 5IBRA 3HA5A 2XWQA 3BJRA 3T3GA 5KG3A 3BF7A 3H2JA 1L3BA 3BGIA 3RKRA 3V8VA 5H02A 5EMNA 4N0MA 4PXYA 2YOGA 1O97C 4CZ2A 2EARA 3A9WA 5THQA 3RSSA 1YZYA 5GTHU 4RHUA 5IAGA 4CIVA 2AG6A 4RXTA 4QPDA 4YCCA 2C7PA 3PW7A 3QU7A 1A6SA 5SZIA 1OXTA 2FKAA 4IDQA 4NFHA 4TVSA 1T2UA 3DTVA 1TV9A 3ZY6A 1CQPA 4L4XA 4PNZA 2AG8A 2QU7A 3QW2A 2KZZA 2FTKE 2ON6A 1SQFA 4C7ZA 5EJ6A 4P4NA 4YRNA 1RDFA 2MR5A 4PHHA 4JASB 1C4XA 3DDNA 4WN9B 2YV4A 4YB8A 2FWAA 1ZQIA 2Z98A 3DOFA 2W6JD 4L5AA 1UP7A 4GX2A 3PUZA 4Q6WA 5AHXA 1F5SA 3OM0A 2C20A 2R11A 2BGJA 4NOMA 3BWCA 2W8LA 4WLUA 3PF8A 2VZ8A 2FPIA 3D5EA 4PLTA 1EWTA 3MDAA 1GSIA 2XMRA 1XN1A 2YMMA 5AQEA 4XTRA 2WUGA 2WYHA 2IYRA 3HI6A 1ID1A 3RF7A 1A8PA 2XVZA 2JGIA 4EX7A 3OFKA 4YYZA 1YE8A 2NXCA 2DJ5A 1R00A 5E8JA 4KE6A 1BMFD 3DCYA 2JH9A 4Q01A 3HZHA 4BMVA 4A2CA 3UICA 1EE2A 5KG4A 4XD7A 4F8EA 3O4FA 5TQVA 2Q1YA 5DDYA 5KFRA 1JFLA 2BHNA 2IUFA 2FXVA 2NYRA 3MTAA 1I4LD 2IZ1A 1N4DA 1Z7WA 4UNIA 1QIIA 3ELWA 2PTGA 1JUDA 3CWCA 1M2WA 3IPYA 1EXNA 2WZDA 4AD8A 3X1WA 1EVEA 3ONDA 2NSLA 2Q6VA 3CH6A 3QX8A 1FQKA 1BDBA 4D4MA 2F44A 4YDHB 2W8ZA 1Z5PA 5A5FA 2RMKA 1S2GA 2QVZX 3IOEA 2I4TA 1A9PA 2Y93A 1Z22A 1YAHA 4HWTA 3WB0A 1S2IA 1TO2E 1CP3A 5EMHA 3WLPA 3A9CA 4EW3A 4FE7A 5A06A 3QQPA 3U3ZA 2JG3A 5YASA 4W63A 1ITZA 1OZFA 3W2HA 3ZZMA 5BOVA 5C5IA 2C31A 8ICQA 2ZUUA 3DL2A 1V7QA 3LT4A 4G8BA 1ENYA 1N6KA 1M34A 3JPOA 4Y6RA 4YV0A 3V1UA 1L3TA 4KITB 2VK8A 3DAPA 1KFKB 3SK0A 1YVDA 2R8RA 5HJ7A 2Z5FA 1RWBA 4AZWA 4IIEA 3QPAA 4FYWA 1A9TA 3JYOA 3PD1A 1RLMA 3O21A 5EZ6B 5TPWB 1KBUA 2D2IA 2O7RA 4U7GA 3OLZA 4ZVUA 3ISCA 4J9UE 3ZIUA 4NTZA 1P44A 1NZBA 2W98A 1ZQLA 1G6OA 4OQQA 4H08A 4WTOA 3WJ7A 3GLFA 3FLMA 4N9WA 5EP3A 1NONA 4IH9A 2EAMA 1Y7HA 4FR5A 1RPZA 3F71A 3K0FB 3ROTA 5CHGA 4J7CA 2HSZA 5D8DA 4JK3A 4HRVA 4ZMRA 3EHDA 4RZ3A 3LQQA 3TKYA 2H1WA 3HCBA 2IC5A 1CW2B 1TVCA 5IEJA 1REQA 3AX6A 3UB4A 2JIOA 2RHOA 4TXHA 4L9SA 4PICA 2XGPA 4QU8A 3Q3CA 2E1FA 1GKIA 3T06B 3VPDA 4IDBA 1ZKMA 2ZKIA 5ADVA 4IL6U 3HWTA 2A1TS 2A0UA 1KFSA 5FT9A 4BZPA 5DGAA 2YIDA 1T8EA 5C8YA 2PBLA 4E7PA 1TK2A 2WJWA 3NZEA 2ID8A 1QIEA 2Y8EA 3SS7X 1GZVA 4EEKA 4NHOA 3K4PA 3ZUPA 2IODA 3C1AA 3OURA 5J2AA 2FW8A 4IYRA 4U8GA 2G5IB 3UMVA 2HQRA 3O0DA 1KSGA 1KEEB 3H7AA 1KIAA 5JRJA 1PV2A 3REQA 4ZAVA 2H59A 3N53A 1XQXA 4ED1A 1R5BA 4A6XA 4QSHA 3BT7A 1Q91A 2EKDA 1A7UA 3ETDA 5AR1A 4J8PA 3HO1A 2QQ5A 4WSOA 5B1SA 2PGOA 2JHPA 2J7KA 3VKFA 2I1QA 4A8JA 2JLRA 2XRMA 1UBFA 3DC2A 5IKOA 4CNQA 1YZ7A 1RMTA 1MX9A 1W19A 2ADOA 3SQDA 3GF4A 4MEYA 3CM0A 4DL7A 2CDRA 3EWAA 3DTVD 1F3OA 2P5TB 5GGXA 3Q8MA 3WFZA 4QZHA 2C0CA 4AWBA 3UCFA 1ZQWA 3UO8B 5FBKA 2V98A 4EW2A 5ULLA 2UZ1B 5I51A 2QGZA 3BMQB 3ZD9A 3PVXA 5ALDA 1R4MA 4X45A 4X6XA 3I28A 3DVLA 3FMGA 3HACA 1VHLA 3P4XA 5E6UA 5ESRA 5CXXA 2DR2A 4YV7A 3NIFB 2AN1A 4MTLA 1CEXA 3PJGA 3QVXA 5BUZA 4QZGA 4GMHA 4LJ6A 2XIDA 3U4DA 5BOMA 4BWYA 3L0YA 3MD0A 4AJJA 4N03A 1G291 4JLMA 2IH4A 4F11A 4UAYA 3WLQA 2FUG1 3F5FA 4EG6A 5C5EA 4M47A 2X8BA 4E94A 3RIEA 3D8RA 2BCEA 5IULC 1AV6A 2EJVA 4RK1A 3NRWA 1M2VA 1DBWA 2VL7A 3I12A 1GZ5A 1AKWA 2VBFA 2EHDA 2QRZA 4N8SA 2OAP1 3KFVA 3WAGA 1GUFA 3S2IA 4L22A 4JVOA 2OYSA 4Q19A 4JH0A 2OZPA 1OASA 3A1TA 4ZQIA 3N2KA 4M54A 2GM4A 4CMGA 3DQQA 4Y2QA 5AM2A 5JWOA 1KKXA 3NFRA 3IAEA 5TX7A 4JI0B 3DXZA 1SXIA 4WCVA 3P9YA 3D2NA 4N0PA 3C8DA 4LHVA 4G5FA 1EFVA 2PZFA 4HRXA 3ORFA 2HLDD 3BL5A 1E6LA 1Y5IA 3V7KA 3EPRA 3R6WA 2OAQ1 2BCQA 1J97A 5GADl 2ZYWX 4QTYA 4GZLA 3FF4A 2QARB 4CDNA 1BD4A 1GPYA 3WIVA 1DAKA 1XFAA 1KW4A 5CLGA 2KKPA 3OZAA 3FKJA 3TSYA 4D82A 1QGYA 1W581 3U9LA 3GEEA 5LFAA 3DG9A 3FOZA 4KR3A 3F6YA 4B6SA 2O8BA 5KFIA 2XTMA 5B55A 5BYKA 4BE4A 4B45A 2VJ4A 1RIIA 2PGIA 5T4BA 2PFSA 4WI1A 1JVSA 4CM3A 3B5JA 3O91A 4BMDA 5AVWA 2I8CA 2YWRA 5EZQA 1VKOA 4AKGA 3DEEA 1MNAA 1EXWA 4BB6A 3MR3A 1T2EA 5BUSA 3HR7A 2Y76A 4I55B 1VE1A 3VOAA 4GBMA 3AK4A 4Y9TA 3O4IA 4RAQA 1A9SA 3RT7A 3LDAA 2ZR0A 3WIEA 2X2OA 4G4JA 3ADKA 5FIUA 2NRTA 4LJ7A 3QU9A 1E4VA 1C30A 3W7BA 2VUHB 2PSJA 2WD7B 1RMYA 5CEEA 2X4IA 4KO3S 4MJ3A 5BQ5A 1KMCA 3QIAA 1AHHA 3Q3VA 3OIGA 1DC7A 1YZVA 3T7DA 3CUYA 4IDHA 3GEDA 1QSSA 2GJSA 4RY9A 3RC7A 3ZHSA 1YV9A 1XRNA 2FPGB 3P4UA 1U63A 1W73A 1ZH4A 4B6JA 1ZMBA 4LF8B 1XHLA 4RT3A 2ST1A 3AQEA 2AX4A 1MN8A 1U49A 3MHTA 1S4MA 1UJ2A 3MWEA 2HA4A 3QELA 2PUAA 4RPZA 5ERGB 3NVYA 1BCSB 3PNKA 1EVQA 2VNJA 4UBIA 5EEHA 3L4BA 5B2FA 3AUOA 1OT5A 4C6TB 3QXJA 2O2JA 3N5KA 3D1JA 2IYTA 5JYBA 4S1TA 1NNSA 4JBLA 1R0LA 2HNAA 2ZYVX 5CW2A 2BGUA 2PBFA 1ONNA 1QH9A 4I4CA 3O2NA 2REXB 3VR0A 1PJ8A 5DP2A 2R60A 3WGTA 4MW5A 4RS3A 2XKAA 4GF5A 4MX8A 2C7VA 2PAAA 4D3DA 3ABIA 4F5ZA 1STOA 4DJTA 1HG0A 5JS6A 3ZWDA 1OFUA 4URVR 3QSGA 1NW3A 3CKKA 3IV9A 4M0KA 4JR1A 2EKZA 4F93B 4YR0A 1KN5A 2GCEA 3A6PC 4BBAA 5AOBA 4MCAA 4NAHA 1CNMA 1L3IA 1MNQA 2O50A 1DIGA 2YYZA 1NAIA 2PGNA 2C7OA 3HTXA 4Q3OA 3OT1B 1LF0A 3O6VA 4IV0A 2X2EA 1VCOA 4FX2A 1TECE 4H0CA 1QFSA 4HR7A 1T6NA 2ZIVA 2JAOA 4CLOB 4YAFA 1TE2A 1TF2A 1OZHA 2BTQB 4PLCA 1NKBA 2NO7A 1EBFA 5DBCA 1QDEA 5DTRA 4JWNA 1J1ZA 2EJBA 5HQ3A 3VU0A 3ZNNA 5HJEA 1BZYA 2GBGA 1SC1A 5A0TA 1XK7A 3DGFC 3FCCA 2FCRA 2JGLA 5KYYB 2DKZA 4AXBA 4YRSA 4DIDA 4CMAA 2XGMA 3SR6A 2A9FA 3LD9A 4DR2B 4INJA 4MUBA 3GYGA 1X1CA 3WB1A 3EGXB 1T0PA 3E81A 3Q6MA 4MEJA 1JWLA 1UKBA 2R6ZA 4N5HX 4YMIA 1DINA 1V2GA 1ZUNB 3PFNA 4CEHA 1IM8A 3RBXA 1Y8RA 3DLHA 1X9IA 4DCOA 1OILA 1YXMA 1W88B 4NC9A 1FW8A 4DJAA 4G23A 1ZNYA 5HGJA 3SY8A 1P31A 2P5YA 1Q77A 2DLDA 5J8YA 1TZBA 4HFJA 4K9KA 2BRUC 3D3EA 5CA0B 3HPRA 1QCKA 3D9QX 4QO8A 4PO8A 4RY0A 4TL7A 2RGDA 4NNOA 3M4YA 3KLMX 3ZE8A 2WDZA 2HMAA 4HN4B 2ADFA 2H2WA 4O02B 2P9TA 2XSZD 1XWLA 1NN1A 2WOOA 1AN0A 2DWCA 1GTVA 4ZVPA 2ZYDA 2BHLA 3SSAA 2HR1A 4TMYA 3WI7A 5TGTA 1PEKE 9ICHA 4PHFA 3HBAA 4FWTA 4KLMA 2YNMC 2W6QA 4E0DA 1JIJA 2HHCA 1YE5A 1G5IA 4K9MA 2JZBB 3BTSA 5K3CA 2X0JA 3A3NA 2QN6A 4Q34A 5C35A 3H1PA 2BDEA 5KTSA 4KODA 1I3CA 2HHVA 2MSKA 2QTVA 4E08A 3N2EA 1RP1A 4QJIA 3QUTA 3GRZA 5ALGA 5HR5A 3LT0A 3PHCA 5U4QA 3KJZA 4L08A 5E1OA 4TKUA 3EDQA 5A02A 1X7DA 4FT4A 4YXWD 1VJRA 1CUIA 2NZ2A 4KAXA 2XE8A 2PGAA 4B7CA 4UNNA 2EAUA 1OWOA 2PAFA 4TKMA 3JTEA 4EL0A 4MJLA 3AH8A 4ZKEA 4EABA 2W04A 4BCCA 3DAFA 3HI4A 1SCUA 3TARA 1I0IA 5E3IA 4HAOA 3URMA 3D2QA 1JW9B 4HF7A 3VR3A 3A0UA 1QS0A 5IJAA 2YXLA 3N8NA 3TE6A 4S12A 4B4WA 5IBPA 4PLFA 4LBVA 5HEKA 4FDMA 1YQWA 3CEPB 1JQAA 3OZBA 2ZJ5A 3TANA 2LYAA 2D5AA 1Y7TA 2RGWA 1TW2A 1IULA 2QMUA 4DNXA 3S6JA 3OCYA 3RAXA 5CX1A 1EUZA 1Z83A 1FFUA 4IIDA 3PT9A 4C0LA 4LPKA 3IN5A 4NYJR 5DYNA 8ATCA 1BPZA 3KPVA 4N0DA 2ZCJA 3FE2A 1CEQA 2HU8A 1YRQA 3DBRA 3LUFA 3QBDA 3N3BC 1L5YA 2FX2A 3TIXB 4XGQA 3JPWA 3PQ7A 4KI7A 3TTWA 3RYFB 3M4JA 5I47A 1N1GA 5JCJA 3IMKA 5LBUA 3DMDA 1E9DA 5KT7A 3GIKA 3RJ5A 3SLRA 1X92A 4RENA 3F3YA 4Q21A 1A98A 3CEHA 4IRCA 2IOFA 1B0PA 1MB3A 3MTBA 3Q7IA 1XMXA 2VK2A 4ON9A 2YY7A 4DF4A 1LPMA 4EA9A 2WTUA 3DF9A 2FG5A 4CMHA 2Q6KA 1RZ3A 2H3ZA 1IOWA 2IVZA 2AEEA 5JSYA 4JUFA 5C7YA 3CW8X 4J4TA 4V1CI 4MUFA 1IHPA 1L1RA 2E7ZA 4QZFA 2KJ5A 1U45A 1NX9A 2HK9A 2ZTUA 4Q7KA 3WYDA 4FZ3A 4KH0A 2YZ7A 2IF0A 1XK6A 1SUFA 2OGZA 3GVPA 1AMOA 2EH9A 2XUJA 4C8OA 5LMUB 4KCGA 2YMPA 4W6ZA 4I2GA 4RVDA 4C3ZA 3EY9A 4XVUA 3GIDA 1XL1A 2IEGA 2NUAA 1JZTA 3UOGA 2XA1A 3RM3A 3FSEA 1JAZA 3DE4X 3THWA 3MGHA 2V7XA 1X1TA 2LIPA 4I5IA 3P1JA 3NH9A 3KVOA 2FMUA 4BFCA 1OIWA 3RUIA 4C78A 4J9RA 1QFXA 1DDGA 1OZAA 1DOZA 4LYYA 5KNCH 5IG2A 1L1EA 5A5DA 2BCVA 1NVBA 4WW0A 2XLCA 1AKQA 5T4HA 3AHJA 5T5QA 2VDJA 1EHCA 3NIWA 4CKEA 2V7QD 2AYYA 1EVJA 3Q8SB 3C3WA 3DF7A 5IK2D 1ZU5A 1KZHA 1FP4A 2IU0A 3U16A 4IGAA 2NV0A 1V7ZA 1G64A 4E5VA 4KTTE 5DHSA 1XAIA 1HEKA 4L51A 2E6UX 2Y1OA 2NGRA 2YDXA 2FKNA 3HDJA 3KZIU 3M9LA 1C7RA 2WWWA 3UNXA 3GCZA 4X3PA 3PG5A 1NLUA 2RGXA 1U2QA 4CEJB 4C06A 1E2KA 5CB8A 1AUQA 1D8AA 1CWUA 1JPJA 4JFRA 2JCXA 3C43A 3HNPA 1OXMA 1XO1A 1AB5A 1HF3A 3CR8A 4G0YA 2YYAA 3OIFA 1AB6A 4J90A 3KVVA 5J2TF 4RLSA 2ZW9A 2YICA 4BNHA 2EL9A 2GVNA 3QMWA 4MRPA 1TTHA 1A5ZA 5DQHA 1U7XA 3IVMA 5KCMA 5AYVA 2HWWA 3ZTWA 4Q15A 3B3AA 2RGUA 1MMFB 3TSWA 2V59A 3COSA 1WDWB 4S3MA 5ELMA 2EEZA 5KT2A 2CNNA 3HKEB 1ZK1A 4X1KB 4N7MA 1C7YA 4GSYA 3QUQA 2IVFA 2Q5LA 1UMCB 5D1HA 3CUWA 4PHDA 3M5CA 5KQRA 2Y71A 5F21A 3BA1A 1WSAA 4J9SA 3C6BA 3U4IA 1GUDA 2UZAA 1YONA 5DF1A 4HAUA 2VPPA 1G1MA 3WNVA 5H9VA 1CVRA 4LNAA 4L95C 5I4CA 1XJQA 3IULA 4AB1A 1SZJG 4LK3A 1LKZA 3HSSA 2VSNA 1Z6XA 2BZGA 1G59A 1XRPA 4MVJP 4BVEA 3DZ8A 3H9GA 1DBSA 5DQIA 4AJ1A 2I2CA 4W9NA 1Y9JA 3KZKA 4GNKA 4EYGA 4DL5A 4BMPB 4XSVA 3T95A 1E2JA 3I92A 1YI1A 1YS4A 2JJYA 4H4DA 3UV6A 2O7NA 2PX8A 1LZKA 1KWGA 1DJMA 5DM2A 5CNJA 2ADMA 4M99A 3AP2A 1SXHA 1C29B 1ZQSA 4EP1A 4FFBA 1OAOC 3ROQA 3KYDB 3FHCB 1TZ2A 1EK2A 2ZETA 3VR3D 3HV0A 3OX2A 5F77A 4FMDF 4TURA 2JEIA 4YJ2F 8ICXA 4IOLA 1PS9A 3NBKA 3V1LA 4Y7DA 3LHIA 4JQZA 1XC7A 1TUIA 5I8PA 2ESRA 2RHBA 4UBLA 5CDGA 2XT9A 2R6GA 4BTEA 3GZNB 2F1IA 4E2XA 3TQOA 4FCVA 1P7ZA 4Q4HA 4DB4A 4LKRA 5FBLB 3HJBA 2W37A 1WXDA 2XJ9A 2VPZA 2JAWA 2AN4A 3OEHD 4BUZA 1J0DA 4QXOA 1TM1E 1CRWG 4KIFA 1ACJA 5DNUA 3OD1A 5HBRA 3D8NA 5G3YA 4RPLA 3E70C 2QX4A 2C1EA 3B1ZA 4JT4A 4A2QA 5JCJD 3RVDA 3Q8QB 1IK6A 1K7CA 2PE5A 4I5EA 4OJOA 1GR0A 3PQDA 4QOIA 2KG5A 4IEIA 3M4NA 3F6PA 4NJEB 1XXHA 3OOSA 2ICAA 4FYIA 2DF8A 4ARUA 4DUGD 1PYGA 2CBXA 3MIZA 2JL1A 2B8TA 3DWIA 2D3DA 1JFVA 2R6FA 2YXEA 2VDOB 4G0VA 5CA1B 3B48A 3FOCA 2B37A 3FF1A 4ZEOA 4EZIA 1PHPA 2B8JA 4MUEA 1BN6A 2HTFA 1JECA 3KTQA 1R10A 1BYIA 4MARA 2PL9A 1Z5WA 3OIVA 1Q95A 1SKYB 5KSOA 1H4VB 2VUTA 3SJCA 2AB0A 1JHPA 3DFZA 1WXEA 4JR0A 1TU3A 2IL1A 3S2YA 3H2IA 2FF5A 2PD6A 1SXJE 3HM2A 4JVSB 4OK3A 3WWCA 2PX0A 2QTTA 1HYHA 1VJ1A 2UZ3A 4XFJA 1KLNA 3C4JA 5FQOA 1BHSA 1F4PA 1SKRA 1KMQA 1U7OA 2J5KA 1IB0A 2KE7A 4XI9A 3MT0A 4BEWA 2EATA 3TFQA 4F21A 5KMGB 4KIGA 1U2GA 3I01A 2IZ5A 3F6RA 4QX6A 4EGSA 1VPLA 3J81A 3U7QA 5IF3A 5B30A 4YIKA 7ICLA 2FP4A 2KIVA 4GXTA 2FMPA 3B5IA 3BUSA 3BZUA 4B31A 4XIGS 4KTVE 3FFBA 1QKIA 5FI3A 2A9KA 3VZBA 5JDIA 3O8DA 3TW6A 3IQDB 2GN4A 2C2WA 2A57A 2AV6A 3WKAA 1YFKA 4Q1DA 4OXNA 3STTA 4FYYA 2HUPA 1H2RS 3RAEC 2H08A 3FTDA 2C0QA 2ZSAA 4XYLA 1USKA 2VYNA 2VDLB 3MCWA 5B2EA 1EFLA 1FNCA 3SX0A 2CJPA 3IV7A 3ML1A 1KO7A 4CM4B 1LK7A 4O59O 4FDTA 2Q3DA 2ZZKA 2KN7A 1GUYA 2VIXA 3BQ2A 2X2FA 2X76A 4MVCA 5DBIA 1YZQA 2OHFA 3F1KA 5KEIA 4FZLA 1ZD8A 1PT5A 3RABA 3ZWVA 3U7GA 3SXPA 2L19A 2GJKA 4F45A 5J2HA 3PHIA 4C4OA 3SS8A 4RDIA 5A0VA 4F50A 2XCTB 4GD3Q 3ESDA 2F2AB 1V8ZA 1IZ9A 3C6QA 5JZ9A 2E5WA 1VE3A 4KLSA 2I2BA 5IW8A 1EP2B 2WPDA 4QFDA 2O2DA 4BDPA 3W4JA 4M1TA 5JALA 1QRAA 3LF1A 1NBHA 3QHPA 2PH3A 5BN3A 1QF6A 3WMWA 1XZAA 3MMPA 3H4DA 4X1IA 5AI6A 4JJFA 1N5MA 3FNQA 4UKDA 3G68A 1MH1A 4LJRA 4TV8B 4WINA 1Y88A 1FP6A 4S1WA 2AJDA 2R8KA 1BYUA 2J0SA 4JGBA 5CBPB 4BS9A 4DWIA 4F7DA 5LP6B 7ICRA 2DHQA 4GGPA 2ZJZA 1DX9A 3H42B 4R9UC 4NY8A 7MHTA 4Q43A 4KR6A 2J6UA 4PXSA 3PNQA 2RDIA 1E6MA 4XE5A 1KYYA 4V2UA 2V3VA 2SKCA 1LBSA 3OICA 4TUPA 1X19A 3V6LA 3BXHA 5ECGC 2IMWP 3VA7A 4LC0A 1U48A 2MTBA 4B0OA 1KFTA 3B1XA 4J9MA 1GT91 4F5QA 1YVEI 1WRBA 3C1YA 4L28A 5I9NA 2G1UA 3ZHQA 4F3KA 1J39A 7ADHA 3EIXA 4TM8A 3QA3E 3HDTA 3NNSA 5KO2A 3BMXA 3V4PB 1OVMA 3FWHA 1IIBA 1JWBB 4ND5A 3PZRA 2WEKA 2W55A 4BGDA 4HH3C 3FR7A 3NVDA 3FWPA 2GBIA 4PWZA 4HXFB 1TGVA 3B52X 1ZETA 2WWGA 3WGMA 1X94A 2P11A 3O93A 1T3HA 1PJZA 3G9TA 4KLFA 2XYPA 4JWKA 2HEIA 4X1YB 1ETHA 1QQTA 2VKTA 1XCJA 2E0IA 4EYHB 5J4VA 2W43A 4S0ZA 1COWA 2CWDA 2P2LA 3LU1A 3GD5A 1SUWA 4E32A 2QVXX 1GTRA 4ZVMA 4ZCSA 2OWOA 1C81A 3UA4A 1TVKB 2D5IA 2KTQA 2WUWE 3CP8A 1SCIA 1RWNA 3VVLA 3FHOA 2QTZA 1K2WA 3Q7TA 3HCFA 3PD0A 5J2TA 4C7OB 5G0UA 4YCNA 3N6XA 1JA0A 4MS3A 1WCIA 1X80B 4PLHA 4D41A 1JPNA 1OPXA 3CZPA 4ZYLA 2FRXA 1M5RA 4MIKA 2QMHA 2V7TA 4RQ2A 1HLDA 3BXZA 1HDGO 2EWMA 2GARA 2FUNB 2CD7A 4ZPJA 4H4CA 2ZR9A 4PGYA 4UNSA 1UFKA 3NJRA 3IBGA 1ZJZA 2ZWVA 4BO1A 1NRXA 2VWHA 2R1UA 1IMJA 5SY4A 1TA0A 2QPAA 4KXUA 3OC6A 1NV8A 3P0RA 4JP2A 1XVVA 3MM4A 1D8YA 5D4BA 4EKEA 2DPXA 3TLKA 1BNCA 2UV8A 1Z5VA 5JWRA 1HQKA 2EWVA 4OUDA 1Y6GA 4MR8A 1J8QA 4MQFB 4INOA 1XJ0A 3OQ1A 2GILA 3CVOA 4HB3A 1D7OA 2HDWA 1W1WA 2QRMA 1L4NA 2ZCUA 2V7VA 1E3QA 1J8DA 3QE9Y 2UXCB 1E99A 3TE7A 2ZBGA 4FYMA 1S01A 4MK4A 4G9GA 2VTKA 3ZE7A 5K4AA 3K09C 2PY6A 2ACVA 2NZWA 3BS5B 5CGQB 1TKDA 3RTBA 2Z8YA 2PKQP 1JEQA 1ZOLA 1V1RA 2Q0SA 4XOUA 1IG0A 1GNSA 5TQ2A 3DH0A 3H2BA 5DHPA 1C1XB 3FSJX 1E3SA 3CPJB 1L0BA 3ISJA 3O31A 2Q4OA 3IVRA 3AVQA 4US8A 3RJGA 1QTIA 4RHYA 3JR7A 3K1YA 4DMFA 3HDVA 3K96A 4DC0A 2O7VA 3EPJA 2BYTA 3V3TA 4AN1A 2Z1MA 3K9WA 4YFYA 3GWZA 2O8DA 3LXMA 4L5YA 2HWUA 2B8NA 1WHTB 1N0HA 4JBWA 5BPFA 1R7RA 4PZPA 3QENA 4YJ2A 3RNLA 2ZS7A 3R7WA 5EE0A 3VISA 1GZHB 2Z6UA 5K45A 3AEYA 5EINA 1JE0A 3Q2KA 2C8KA 3ZK9A 3E58A 3OZEA 2VYND 4TUYF 4RTJA 1R4ZA 3RADC 4RQTA 1QDLB 5HP4A 3IFSA 4RVFA 2XRZA 3MIIA 2P4UA 4BX2A 5J43A 2HPVA 2OWDA 1R8XA 4NDZA 8ICEA 2Z2XA 3TXYA 1MJGM 4WESB 1QR2A 2VJQA 3IP6A 2OGWA 1FUKA 5I7EA 4GEKA 2GI4A 1L7QA 2VZ9A 3GJYA 4ZGWA 3VDMA 4NU8X 3CUEF 5IVDA 1NWHA 2X13A 3WMRA 1UHUA 3IJPA 4MA0A 3IUYA 1E60A 1IRIA 4BRZA 4MRSA 3JQ8B 9ICFA 3M6FA 3OJWA 1ZR2A 1COOA 1YACA 5K0FA 3UV7A 4F5OA 2WPDD 2ZXIA 3PUWA 4TUQA 1HPLA 1UP6A 2WWRA 2RGGA 4UUAA 1SC6A 1W36B 1XZJA 4IILA 3O74A 3E5NA 2ZJ8A 1X2EA 4RMIA 4M21A 3ZW7A 2QUBA 3QEKA 3V3KA 1NE2A 4M0AA 5ALZA 5UKDA 3HT3A 4TTVA 2LDBA 3AU9A 2BPGA 5JBNA 3SZGA 4ARCA 1JHDA 3DV0B 2LYBA 1WD5A 4UB5A 4GBGA 4ABTA 4OHRA 3K8YA 4OJKA 1NUAA 2B92A 3JQAA 3G8CA 3U4QB 5B1DA 1V6AA 2Q3FA 1IXRC 2XQJA 2LUOA 4M1SA 2FZEA 3PWSA 1EMDA 4ZWNA 3SHTA 3MWLA 1QIMA 2RK4A 4D5EA 2IF2A 2J48A 5CFZA 3AR6A 3BSFA 3BGDA 5JAOA 3DPIA 5TJ9A 1BJTA 3TW4A 4CF3A 3AHFA 4JYMA 3ZXSA 3Q87B 1XQ9A 4HV4A 1D6JA 3GN1A 4BY9E 3ICEA 4A5OA 1ML4A 2B4KA 2GN6A 1MGOA 2LM4A 4R8KA 2QSYA 2IY8A 5FH9A 5L3RA 1G8MA 3CZQA 2O2EA 5LQJA 1Z6AA 4HDAA 1QUFA 1VMAA 2YV2A 1EG2A 2RBGA 3PQ8A 3ANNA 1GZUA 5D3MB 2ZWOA 4G0OA 4HFNA 3QTLA 1HDRA 1WCXA 5AVSA 3DPUA 4F5YA 4ENRA 5CCXA 2HSDA 1FTNA 4GKBA 1YB4A 4X65B 2F67A 4YCXA 1COWD 4ZCPA 3Q15C 4GPZA 4DT1B 2WWYA 5DISB 3ZEAA 1ECLA 4U4AA 3CLVA 1CX9B 3PX4A 1BPYA 4R16A 4DDVA 2O2XA 3TMAA 4DBLC 3ISTA 5A4IS 1RI4A 4M36A 2V7EA 4M3NA 1KSFX 3G2MA 2O8CA 2FPSA 2IKSA 1N6NA 1Q22A 1OXJA 4Z4IA 2O8NA 4KO4S 2RH9B 3WX0A 5AQ1A 4O3OA 5FNVF 4DLWA 4P08A 2F2TA 4IZIA 3C2MA 3H3JA 1YH3A 1PGQA 1P5JA 4N0EA 2FW7A 5GY7A 2QSZA 5K3EA 1T8WA 3GH3A 1L3CA 4DSOA 3PPYA 2VK4A 4P4TA 4NM1A 3FMVA 4NLBA 2H65A 2IOYA 3L77A 2G9ZA 3GIWA 3K0KA 4ZT5A 2H7YA 3OCCA 5G0SA 4PGQA 1K7YA 1SEPA 2D7JA 3LC0A 1KKMA 4EI7A 1FFYA 2FFQA 1KJYA 3MT9A 4FNGA 3O8QA 4BLVA 4HYYA 2BL4A 1Y1KE 2FX5A 8ICFA 1EDOA 1A8HA 3UFXB 5DE3A 2ZWIA 4JL6A 5ESXA 3U3MA 1Y1QA 4MZDA 4MINA 2P27A 2G63A 5CDFE 1C8LA 3MGAA 5L7YA 2HMYB 2DFNA 3SZ3A 1N7HA 2HSEA 1Z0SA 1XD8A 1G6Q1 3CEAA 5C31A 4O5KA 3KBBA 4IIYA 3UMCA 3R23A 3NETA 5DH9A 3KB2A 3OLQA 3I5MA 2PXCA 2OLKA 2H7CA 3LWLA 3TDMA 3INYA 3PE4A 5J2FA 1S2LA 4C6HA 3CZRA 3IX7A 2X6QA 3OOJA 5CM8B 4MF2A 1U28A 2BKUA 4YV2A 1N6OA 1VSVA 1DV2A 3L9WA 2VT3A 1S02A 1O8BA 3T9BA 2P78A 2WYVA 3IKJA 5AKHA 2V0NA 4L2IB 3LKVA 3E82A 2I6QA 1NJSA 1HO3A 3E3AA 4X6LA 4R7GA 2VHQA 1X13A 3GNSA 5KDOA 4OAOA 2JK1A 4ZIRB 2X77A 3N4MB 2AMFA 3C24A 2PMEA 1LRJA 2JBHA 4YMOA 4N5DA 5CA0F 5J40A 4N5LA 4MQEA 4WXEA 3QPVA 3SYTA 3P8ZA 2GZHA 4M9XA 4UVDA 2OA0A 3UT5A 1T7PA 3PXUA 1TZCA 2AA3A 3SDBA 2HSJA 4C0QC 3KOZA 4RK6A 4UHJA 5F64A 4Z7QB 2QYTA 1R2QA 2PUVA 1YVUA 3IDZA 4I1PA 4MS1B 1MJ5A 4ZYZA 1N2CE 1XZNA 3TACB 4DL3A 4S1OA 1SVWA 2FMSA 3BSYA 4YRMA 5K3AA 1TYAE 4QT4A 3T3PB 1PYDA 4C4XA 1O57A 5KWIA 2CYCA 2F55A 4RPJA 5BW5A 3PO4A 2UXDB 4I50B 4C0KA 4PZEA 2NTVA 4MFAA 1Z2EA 1FX0B 1U5AA 2WIDA 2AFHB 2J6TA 4MDHA 5M3BA 2PUGA 2C5AA 4MOWA 1MJHA 3GV5B 5J3JA 2FA9A 5ARCA 3ONVA 2RP5A 4C2BA 2HCJB 1J2RA 3S7TA 1GOTA 1VI2A 4HQRA 4BMYA 2F1JA 3DP7A 4NMLA 2JRLA 1QRRA 5CUQA 4QIWF 1KEEA 1NFQA 1F6DA 3DDHA 4TT3A 4U7TB 5AVQA 3A25A 1XRLA 3ZTYA 1XU4A 3REOA 4BX0A 2JAPA 1Q0RA 4NPAA 5JO9A 4UUNA 1M8PA 1Q7GA 3OZXA 3L8FA 2QE6A 2VJOA 1EXMA 2I6UA 3WGZA 2XUQA 3G6XA 1NOJA 1GPBA 4MW9A 2GN0A 4QGFA 1CQIB 2OH2A 1XTSA 3L07A 1FTWA 1DP4A 5DHTA 4HJXA 4IQ4A 2VJMB 1EUCB 1SOUA 3MYRA 3E7DA 3EG5A 4KLOA 2IIPA 4OMFG 2B5WA 2C8VA 2XYHA 3F46A 1M6VB 3HDYA 3QQ5A 3JQAD 1RJGA 2X15A 1D5WA 4E03A 3C0KA 5KJ1A 3PENA 1MO3A 2I7TA 4PCVA 1DFIA 1RW4A 1GL3A 4O1IA 3UKDA 4PGHA 3NHFA 3DKPA 4ZC1A 3MERA 4J75A 1P7YA 1G20B 2H18A 2OXOA 2REQB 1LU9A 4GVXA 1Z00A 4YIHA 4EA7A 1RWQA 1HFWA 3JWPA 3VNRA 4YXJA 4Y0VA 4RETA 3QUSA 3ZK8A 3UMRA 5FTJA 3KAKA 1YZ6A 1TM3E 3AXSA 1N3YA 4BAGA 4F0JA 1PZFA 3HJGA 5L9XA 4L6IA 2MSDB 2K4EA 1VYVA 3OTOB 4XX0B 2O8EB 3WYBA 3P26A 1NW4A 4QG7A 4Z0TA 3QLTA 3TX6A 1NRIA 1FUUA 9ICIA 1E6EA 1G6KA 1YNSA 1TLLA 3MFHA 1UQVA 1KI9A 1GWNA 2C9BA 2JEOA 3WLSA 5JROA 4YT8A 4LFCB 4LG1A 1QPGA 4HKTA 3SE0A 4HDNB 4JI2B 1H66A 4DL4A 1WEHA 2A59A 4TUYA 2DH6A 1G2PA 2JHDA 2NNLD 1QU2A 3I30X 4G5SA 4DZTA 5DIFA 2N9UA 3PTZA 4G2TA 2G0AA 4CNBA 4GBJA 4RGQA 1BPEA 4P3KA 1KZ9A 2QQ0A 1JI3A 1N9GB 2O2IA 1DFHA 4PZCA 1MA7A 2AOXA 3U09A 1B76A 1E7WA 4C21A 3ZQUA 4NJ8A 3JPPA 2C1XA 4QDXA 2DCMA 3C74A 2XUFA 3Q4GA 3VUFA 1KXJA 3NAQA 5EL0A 1T8YA 4ISCA 3LUHA 1IEQA 5LDHA 1ZN7A 1ULZA 2YWEA 1E66A 1U1IA 1W5TA 1U2DA 4XD7D 4IX1A 5F3DA 4M7OA 4PNEA 2YQ5A 2GOYA 3CN9A 1CPYA 4G07A 2VXBA 2W42A 4K6OA 5GZ6A 1ZMTA 2P3OA 3CCBA 4DC1A 2XCRB 4PIMA 5KB3A 2D6FC 3NVKI 4LWQA 4I5GA 4Q0MA 4UTVA 1AQIA 5JNWA 4TYWA 4J9OA 3AL2A 2X8AA 4M7PA 2H0QA 1FYFA 1HOTA 4A8PA 1T9DA 2GCOB 5D1NA 2ZTEA 4FFVA 1N0UA 4AMBA 1RWMA 4UD2A 3LQ2A 2A58A 1CUVA 5BT8A 2RGNC 3SDZA 4DUYB 3WE7A 2FWRA 3NWOA 1RS0A 3K70B 3CVWA 1UKCA 4NJMB 4RF2A 5IT9A 5K8LA 2GKOA 5GV7A 3EXG2 2ZIWB 1EX6A 4MGHA 3KPUA 3I5AA 3G1WA 5ALMA 1Q92A 2FJUA 1HT0A 4QVIA 3TB6A 5I9IA 2BUCA 3LX8A 3ZGOA 1XB2A 2F9LA 3EGEA 3Q9SA 4P81A 3LUKA 2BR4A 5FWDA 4U8HA 4KHPB 4DYHA 1WB6A 1Y9DA 2XCOA 1L7BA 3H65A 2WD8A 4DRXB 1I7DA 1VJDA 3NW9A 1UBTS 2J3IA 2OK7A 4KQKA 4KLAA 4JJEA 4LY6A 3A4LA 1V5WA 5LL6P 4Q44A 1GJRA 3PX3A 4WLEA 3LHFA 2XOKA 2JKZA 1G8GA 2WHXA 3DJFA 1X6VA 4DV5B 1SOMA 3TLAA 1ZIPA 1D1TA 1GZSA 4JNCA 2H8GA 4CEIB 1TF7A 5JSFA 5CT4A 4FYHA 3IEUA 1ENZA 4X20B 5BW6B 3BJEA 4B9MA 2Q5EA 3BKWA 3EJWA 3O2QB 2DRIA 3K5HA 2I6SA 4WCFC 4J9KA 3IR5A 2EYQA 1TC1A 3AFNA 1D1PA 3U9TA 2NU9A 1DPGA 5DM60 2W8KA 3EQZA 4QW8A 4C7KA 1R27A 4QDUA 5L8VA 2ZVPX 4WK2B 5JW6A 3ELUA 3HC7A 3IQEA 5FNVA 4Q1CA 4KK4A 4CM1A 4TT3D 1PK9A 1OA0A 2PV0A 3VCBA 1QONA 2H5IA 1C4KA 3G2LA 1HDCA 1WUJS 3KFUF 5C5DA 4HX2A 3LF2A 4C7VA 1L5HB 1PJTA 3ELBA 3QK7A 3GFPA 5L3SB 2KHQA 4D1YA 3HVIA 3KJQA 1ISMA 4I08A 3QPCA 2C4MA 4MVJI 1SWWA 4KX5A 2VNSA 4TTQA 4YR7A 2XYVA 4Z6FA 3NALA 3Q0EA 1XSEA 2JIDA 3NHUA 4G25A 4F5PA 4F9GA 5A3JA 4Y2VA 2ISSD 9ICMA 1C7QA 1JJIA 1XAGA 4JUIA 1YQUA 4MQLA 4ECEA 3RH0A 2GEJA 3O9ZA 2H5JA 2KP7A 2PFPA 1O0SA 1SK9A 2EQYA 3RIGA 1EUDB 1YDEA 3HNOA 4KIWA 4HEQA 4MVJG 4C03A 5J0SA 5A9SB 4TX1A 1C20A 2WWXA 2OYYA 1UMKA 4HGNA 4QW9A 5EUBA 3U61B 2YV3A 1MZPA 1QB7A 3RYIB 3TQHA 2G8LA 2IYYA 2J3QA 2JLWA 3HKDA 1H5QA 1HE4A 3BDPA 3GOQA 4Q3AA 5I7HA 4GLXA 5DTJA 4QXQA 3K71B 2VYQA 5G02A 1S2NA 4HLUC 2P6UA 1IBKB 4QUGA 1B2LA 2ES4A 1IFXA 4RTSA 1QVWA 1HORA 3K8QA 2CLFB 4BO3A 4UC0A 3VI3B 4FOLA 3B3QA 3N39C 2RJ3A 2UYCA 4GR5A 1KXZA 3C16C 1Q3HA 3ZY4A 4IJWA 2AKAB 5AKGA 5CVEA 3HN7A 2PS0A 5GINE 5CA0A 1EM6A 2OBXA 1Z12A 4DREA 3C1OA 3Q85A 2OFWA 4OXQA 3RC3A 2CFCA 3WP1B 5CA1F 5IIMA 3PMLA 1XTZA 4J9VA 3FDXA 4DSZA 2WV9A 2YV5A 1FY2A 1RMQA 1Q83A 4DG5A 3A2NA 2AN5A 3FTPA 5E7JA 4M7WA 3VR1A 3BEDA 1OREA 1IZ7A 2UDPA 1KFJB 5BQ3A 2OCDA 3LZCA 2IHMA 4IYJA 2DFLA 3MYYA 1KFBB 4LNUA 3C14C 2ZTDA 4KGXA 4BB0A 2G8NA 1E7RA 1SA0B 2X23A 3LLVA 2IEDA 3LQ4A 1N75A 4FBGA 1JKJA 1ST3A 3WL8A 4JBNA 5L1MA 3HFSA 4G1CA 3WDKA 3GI1A 4LQ4A 2NXWA 4WBNB 4M49A 1VIMA 1IBRA 3WKEA 4F4XA 2P62A 3B3JA 3QI7A 4FP9A 4MKZA 4JB2A 3A1DA 1CUFA 2R7KA 5I3ZA 5TISU 1BVSA 1DXYA 2EF0A 5DSZA 3DFKA 3TZEA 1E1LA 1AHIA 1VQ1A 1UKYA 4DQUA 1N5IA 3GEPA 1K6EA 5AESA 3A4NA 2XGOA 3BICA 5DWQA 1WPXA 4DZZA 2VRCA 2D1TA 2HXSA 4JXJA 1DUSA 3KZXA 5A0LA 1Z73A 4G37A 3VHRA 3WDSA 4BX3A 4FHEA 5HZMA 5IJWA 1H65A 1THZA 1CYDA 3E9EA 5G1OA 4CG3A 2F3RA 5HTKA 4DMMA 4FCCA 4BBJA 4LNHA 2HMSA 1ZW1A 1EEXB 1I7PA 1BTOA 4DSUA 1N5KA 3N87A 3W5UA 3KS9A 4C30A 4HFRA 1XSNA 1RPAA 4ZAWA 4BE9A 3KD2A 2VWGA 2BAGA 3HVHA 1HKHA 1ZUIA 2Z2IA 1E5TA 4DOAA 4ILEA 3GMSA 1ZI6A 1Z88A 1I9CA 2BMJA 1DCMA 1X1BA 3ZZUA 2O57A 1O7JA 3SAHA 3FFXA 5DBHX 2OCBA 4N12A 3W1VA 2ZB4A 4DR4B 5AW7A 4UE6A 1JR2A 3RIYA 1NK7A 2PA3A 3FWZA 5BWCA 1G16A 3OQIA 5DOZA 3TINA 5DTMA 2FWPA 3OE5A 4AY2A 5C8ZA 4W4TA 5GQSA 3LUCA 4L4ZA 2PMDA 4LRTB 3O8LA 2XB9A 4IHJF 2I7XA 1O03A 3SICE 2ZR7A 3QOYA 1GTL1 5BN4A 3AM5A 1JXLA 1X38A 3O9VA 3OSNA 3H5OA 3KO8A 4KWIA 2D5LA 4OHBA 5KOHB 4B9TA 2AXNA 4IG9A 3T35A 2WF5A 5KQSA 2VSQA 3QXXA 1QG2A 2V97A 1FU7A 2C3MA 2GBLA 1P0QA 3OUZA 3HYNA 2AG5A 221PA 1IBSA 1UKVY 2C98A 4FPXA 2EW2A 3BIXA 3VNVA 4EGQA 4GKVA 1NXSA 1WXIA 2CVOA 2WB1C 5DQGA 1XA0A 1P5HA