2YMLA

Native l-haloacid dehalogenase from a rhodobacteraceae family bacterium
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
228
structure length
228
Chain Sequence
PSRSGILVFDVNETLLDLTSLSPLFERVFGDAKVLREWFPELILYSQTLTLTGLYRPFGEIAAAVFEMVAANHQAKVTPDDIAELKTRLTSMPAYPDVAPALTRLQDAGFRLVTLTNSAPSPAPSPLEKAGIASFFEAHLTVHSSQRFKPHPSVYDSTAETLGAKPEELCMIACHIWDTIGAQARGWRGGFVARPHNTPLTLAEVPQPDFIGRDMGELADQLIASLTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-HALOACID DEHALOGENASE
publication title Marine Rhodobacteraceae L-Haloacid Dehalogenase Contains a Novel His/Glu Dyad that Could Activate the Catalytic Water.
pubmed doi rcsb
source organism Rhodobacteraceae
molecule tags Hydrolase
total genus 87
structure length 228
sequence length 228
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2ymlA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2ymlA01
3A1DA 4EEKA 1Z4MA 5AK5A 3L8EA 4BKMA 5AM2A 1K1EA 4BBJA 3ZUPA 2YMLA 3FZQA 3ED5A 5AVTA 4FE3A 1Z4NA 3UMBA 3OCZA 4OCZA 3FPBA 2Q4TA 1EK1A 5AM5A 4YIKA 3A1EA 1WR8A 5AI4A 5AW8A 1L7OA 3U19A 4UASA 1Z88A 3R9KA 3QX7A 3QXGA 1U7OA 4KYTA 1U7PA 5AKHA 2R8XA 2CFTA 4NABA 2MU1A 3WK7A 2IOFK 2G1AA 4JDPA 3W5CA 3U13A 3E8MA 1N8NA 5AW9A 1Z4QA 3DNPA 3CNHA 3MMZA 3ZX4A 3N1UA 4Y2TA 4IFTA 1QQ6A 4UARA 3D6JA 5AW0A 4E88A 5AVZA 2B1QA 3EPRA 2RARA 4L6AA 5AVUA 3WKDA 1XPJA 5ALSA 1X42A 2AMYA 1YMQA 1SU4A 4AS3A 3PGVA 3N5KA 4JB3A 3L0BA 5AM1A 5AM0A 2P69A 2YJ3A 2P11A 5AKXA 2FPUA 3EWIA 4KN8A 4HGRA 2I54A 1QQ5A 2O9JA 1LTQA 1RKQA 1KYTA 4Y2QA 3AR2A 5ALFA 2EAUA 3AR4A 3NALA 2C9MA 4C4RA 1J97A 4YCLA 3WKEA 5A3SA 1WPGA 2HSZA 2HCFA 5ALGA 3ESRA 4ZEVA 5AW4A 4CF5A 2JGAA 1AQ6A 5ALLA 1YV9A 2W11A 3WKAA 5AIAA 2QYHA 3AR5A 4BEWA 3WGVA 2W4MA 3NUQA 4BNDB 1VFPA 1RLOA 1TE2A 2YN4A 1S2OA 4UMDA 2G06A 1ZRNA 4EENA 4J2TA 4KX3A 1ZJJA 3DV9A 3U26A 3L7YA 4KNVA 4UU1A 2GFHA 5AKLA 1L8OA 1RKVA 3OCXA 3QUTA 5AHXA 4KNWA 3WK8A 2B1RA 1U02A 5ALKA 4C4TA 3ET4A 1Z4KA 3VAYA 1ZOLA 2B82A 2YMMA 5AKYA 2ODAA 2FPRA 3NIWA 1YS9A 3ZWKA 2AH5A 4FYPA 2OM6A 4YGYA 2CN1A 2CFSA 4GIBA 3OCVA 5AW3A 4XE5A 5ALQA 2WM8A 5AKJA 2MSNA 3BA6A 4YIHA 5ALMA 2JAOA 4NV0A 4Y2SA 3U7GA 4BX2A 2WHEA 3TLMA 3QU7A 2YFYA 3KBBA 1L7NA 5E0OA 4HGOA 4Y2RA 5ALWA 3M1YA 5ALPA 3QU4A 3L8GA 3ZU6A 2HHLA 4XOUA 4BNDA 4BX0A 3CZ4A 4YCMA 4ZEWA 2EATA 2NYVA 4B6JA 4Y2UA 2ZOSA 5AVSA 2YJ5A 5ALJA 2FEAA 3ZX5A 3KC2A 3QLEA 3M9LA 3L1UA 1SWWA 1QH9A 2G0AA 4QQFA 3K1ZA 3RFUA 2ZBDA 1Z5GA 5AK3A 3L0YA 4FFDA 3WKBA 3KOOA 3AR3A 5AVRA 1RRCA 3PCTA 4MWOA 5AESA 3W5AA 2OA0A 3FPSA 2B0CA 3ZVNA 4AS2A 1T5TA 3OCYA 5AM3A 2Q4RA 4NWIA 2GO7A 3QU9A 3L5KA 4OD0A 5AI6A 1CR6A 4HYTA 4F72A 4Y2YA 3FGOA 3ZWDA 2C88A 2YBDA 1RKUA 5IT4A 2VKQA 4I9FA 5IS2A 3E84A 5AKGA 2WF9A 2HF7A 2C8LA 3IRUA 1RMQA 4YH1A 2WF7A 2FUCA 2ZBEA 3WK5A 4IG4A 5AICA 1ZD5A 4L6CA 3I1YA 5ALRA 1JUDA 4HGQA 4H1WA 1EK2A 4XQ0A 4UW9A 2RBKA 3ONNA 4EX7A 1IWOA 2FPSA 2AUTA 4BEVA 4RETA 1L6RA 3IJ5A 3J7TA 1NNLA 3ZVMA 2FDRA 3NANA 1YDFA 2RB5A 1RQLA 2P27A 1PW5A 3AR7A 1LVHA 1YJ5A 2RAVA 5AKEA 3N8GA 3B9BA 5AW7A 3BWVA 2MU2A 3NRJA 5AVYA 1Q91A 3U7HB 4DW8A 3PGLA 2I55A 3OCWA 1YNSA 3SF0A 2HF2A 1VJRA 4C4SA 3KDPA 1RLMA 2YJ4A 3SLRA 2O2XA 4O8CA 4UMEA 2I34A 5AW6A 5AKZA 1RPZA 1T9ZA 3AR9A 2W43A 5ALVA 3W5BA 3WKCA 3QUQA 3WK4A 4Y2PA 2GHTA 1QQ7A 4GXTA 3MPOA 3GYGA 1Z4JA 4YCNA 3OTQA 2IYEA 4UM7A 5AW5A 3ZTYA 5IT0A 2IOHA 2PKEA 5AI5A 2NO5A 3U7FB 4KX5A 3P96A 4BYGA 2C8KA 4HAIA 2BDEA 3A3YA 3L8FA 4CF3A 3R09A 3W5DA 2B8JA 4QJBA 2BY4A 4J03A 1ZS9A 5ALTA 2CFRA 4CF4A 2HOQA 3L0CA 1L7PA 3QUBA 5AW1A 5T41A 1SWVA 2C4NA 5AK6A 3N28A 3HYCA 2AGVA 2G09A 1FEZA 3OCUA 3NAMA 1TJ3A 3ZW7A 5FP0A 3DAOA 3SKYA 3ZVLA 4UAVA 1RC8A 2JAUA 4NAVA 1NF2A 5AW2A 2ZG6A 4OHFA 1TJ4A 3SMVA 5AVVA 5AK4A 5ALOA 5A3QA 2FUEA 2B8EA 3QUCA 3QNMA 4Y2VA 5ALYA 3U7EB 2EARA 3KZXA 4ZEXA 1N9KA 3I6BA 4DFDA 4OFZA 2R8ZA 2IOFA 2OYCA 1T5SA 4I9GA 2HX1A 3I28A 4EELA 5ALNA 3QU2A 2QLTA 4UU0A 4CE6A 1F5SA 4L57A 1TJ5A 3L1VA 3ET5A 3MC1A 2WF6A 4Y3UA 3SD7A 1RMTA 2JAWA 3UM9A 1RMYA 4G9BA 3ZTWA 4PNHA 4F71A 2BDUA 2FPWA 2IA5A 2Q5EA 2G80A 3ESQA 5AIBA 2FI1A 2GHQA 1Y8AA 1O08A 4UM5A 5ALIA 3F9RA 5AKIA 1XP5A 2YJ6A 4Y2XA 2GMWA 3I76A 1J8DA 1ZD3A 3QU5A 2DQSA 2D2VA 5AM4A 1RQNA 1Z4IA 2HDOA 4EX6A 3IB6A 3FVVA 2HO4A 4RESA 3UMGA 1VJ5A 1U2SA 3OPXA 1CQZA 1RDFA 1ZRMA 1WZCA 3S6JA 2YMQA 2PQ0A 4DCCA 2WFAA 5ALHA 2G08A 2R8EA 3HLTA 3SKXA 5AI9A 3FM9A 3B8EA 3EF0A 3DDHA 2X4DA 5AVWA 5ALDA 4G63A 4NFLA 4UATA 1Z5UA 1RLTA 2OBBA 4CNQA 2YY6A 3L8HA 2I33A 4HGPA 3WK6A 5AI0A 2G07A 2ZBFA 1ZD2P 1S8OA 5AI8A 2JARA 3E58A 3WGUA 3NASA 2HEGA 2WF8A 2ZXEA 3SHQA 4BX3A 4MUMA 2HI0A 3R4CA 3EF1A 2FPXA 5ALUA 1NRWA 3E81A 3B9RA 1L7MA 4HGNA 1TA0A 1Z4LA 3QGMA 4UAUA 4Y2JA 3AR6A 2PR7A 5JJBA 2R8YA 1Q92A 3AR8A 3UMCA 1QYIA 4EZEA 4UMFA 3RF6A 2B30A 1Z4PX 2I7DA 2P9JA 2WF5A 5A3RA 5AVQA 2I6XA 1MH9A 4XPZA 3QYPA 5AVXA 1WVIA 1L8LA 5ALXA 3WK9A 5AKKA 1ZD4A 2YMPA 4UMVA 3MN1A 3KD3A 3N07A 5ALEA 1U2TA 2ZBGA 3A1CA 1O03A 1Z4OA 2NO4A 4AP9A 3ZI4A 5ALZA 3PDWA 4DWOA 1XVIA
chains in the Genus database with same CATH superfamily
1I2MA 1X9GA 1ZAYA 2ADFA 2ZYTX 3L4KA 3TIVA 4NYJR 1YS4A 4OCZA 4Z3KA 1J2RA 3G85A 1VG1A 3ZK7A 4M86A 5IT5A 4PSDA 4Q3NA 4QU5A 1PNRA 2AXQA 4YJDA 2G1JA 4BB6A 4FNAA 4P4OA 3UUGA 5JO9A 2G1UA 4CKBB 3FBGA 2OMKA 2J9ZB 1T36B 1J49A 1DLIA 1EEHA 2RCYA 3FBWA 2ZAGA 3I92A 5DBEX 4XARA 5KFIA 3F8TA 1RJWA 4LF9B 1NVDA 2FSSA 3E5NA 1CW2B 1WMEA 4OHPA 2JLSA 3IQGX 5D86A 2JGAA 2E82A 3JQAA 3VTFA 3AUTA 4MV0A 4DFKA 4BEWA 4DIFA 4D9FA 3OQIA 4ND8A 3IQXA 1PVOA 3OLWA 4A2WA 4RTNA 2XDYA 4KX3A 1XZ8A 1KH1A 1JDBC 4GGOA 1RXCA 3O74A 2W4IA 4G0PA 3ZGOA 1NIJA 4PHEA 1P2UA 2PD6A 2VK4A 2EFDB 1FQJA 2C1XA 1MJGM 5DKFA 2XT0A 4ZEMA 4B6RA 4EKGA 1FYVA 3T4EA 2H2FA 3QVOA 2J9FA 5JRJA 4O1IA 3HBJA 1DX9A 3GJ4A 4K1XA 3FUUA 3KEOA 3PY8A 5TEVA 1O9HA 4MS4A 5AVOA 4PV7A 4C0AC 1XKTA 2YVKA 1E0JA 1E5QA 1MVLA 4D0GA 5CX1B 4YMWA 1DOHA 3QXJA 3K9QO 5B12A 5J0SA 5BXQC 4N39A 4I2NA 4RFVA 5AESA 5CDHA 3QF4B 3GGPA 4J0EA 4LKRA 3IL2A 4PCUA 1DQNA 5FL7D 2Z4TA 4QNRA 4C4AA 4Y2YA 2C2MA 2YICA 2FB9A 2UZ1A 1IHUA 4UNNA 3EEOA 5SICE 1YAJA 2WNSA 3RIGA 5IC4A 1UJ6A 3UMSA 3GVHA 5LQNA 4J49A 1N2JA 3RB0A 2GBIA 5I4KA 1EI9A 3JASB 2AC7A 2VLBA 5CJ7A 4KK4A 2VUSA 1VQ1A 3VZDA 3PX3A 2O05A 4RMJA 4QAQA 1YT5A 1FRZA 5F1KA 1BX3A 1B15A 1V47A 4DMMA 1JEAA 4DSOA 1Z4JA 5CT5A 3SEQA 5LZ7A 4I2GA 4JK3A 2VHEA 3O9MA 1NM5A 5AXAA 3ISDA 4HAIA 1CYEA 4CF3A 4IS2A 1XRLA 3PDIA 4N5NA 4RHFA 2WJJA 2I7VA 4LE2A 1Y5IA 3BXHA 3K16A 5ILQA 3IHLA 3R8FA 3SSMA 1HBJA 4ZO9A 5DTQA 1ZK3A 3GUYA 1N9KA 1E64A 1AZTA 3E8SA 4TTRA 1YZQA 1VG9B 4JUBA 3ETNA 5L4LA 2QLTA 3KZOA 4PVDA 1BPZA 1X1DA 1IEQA 4W7IA 2VDLB 4PNHA 4EJ6A 4RK5A 3GQVA 3GIMA 2QD4A 4DLZA 3OIDA 4AJEA 3N39C 1KDVA 3FVTA 4B79A 2BHLA 5TLSA 1L5KA 4OQ4A 1UBMS 2D5CA 1WNTA 1ICEA 2W3SA 4ZO6A 4RIFA 1NLYA 2Q49A 2F77X 1GNTA 3JWEA 4ITRC 1Y5NA 5ITVA 1DO8A 4E7PA 2DPIA 2NO6A 3PX6A 1RLTA 5JSFA 2CXRA 4WKBA 1ZLYA 3ZZ1A 1QK5A 2C94A 4MW4A 1V9SA 3BE4A 2HI0A 3W2TA 3RGWS 2WE7A 1TZKA 3Q9SA 1ZMOA 1N0UA 1BXZA 4KDCA 2JFQA 4E03A 3EH2A 2LD4A 3CX6A 3T9DA 2XCSB 1NMEA 2JHFA 2OK8A 2BH2A 1WDTA 5TQ0A 4OHZA 3NU1A 2JEIA 2V4QA 3CW9A 5ALZA 1FQKA 4HJRA 2W37A 2HT1A 2WRZA 2V5UA 4BS9A 5HS6A 4G85A 4ZYWA 2P62A 4Z4GA 2D6FC 1ADFA 4HLCA 4ZTZB 1GGFA 4GKVA 2I9KA 2WYUA 2RMKA 1TUGA 5KC9A 1O97C 3CXUA 3JSAA 5C4IA 2PEZA 1KFKB 4FCVA 1D1TA 3PW2A 4H7DA 2GPJA 2JCSA 1YZHA 4YWJA 3LVFO 5FWXB 3KHUA 2BCEA 4W5WA 3NWBA 3VNVA 1G3IA 1G5TA 3O7WA 3RS8A 1OXUA 1KZ7B 1GQRA 2B7LA 1OZAA 1SQGA 4BX9A 5JEEA 3B6EA 3GLIE 1CIJA 2QOEA 4OHYA 2KZMA 4PLHA 2B5OA 4U02A 2DVMA 2NO1A 4EW6A 4B7XA 2AMFA 3F3YA 4TQAA 4BNDB 5AJVB 4BWYA 4UBIA 2I3BA 1N1DA 2OCKA 1Z12A 1BC5A 4Q45A 2G06A 5L51A 1M66A 5CVUA 4NBUA 3LC0A 1UK8A 3H4VA 5CWRA 1X1AA 4TVKA 2UXDB 4U8HA 1PU2A 2FPRA 1NAIA 1Z2AA 1R0CA 1IVSA 2RC5A 3HA7A 1EP1B 1W4ZA 3MFYA 2BFFB 2HRDA 3U1VA 5FWYA 3M3PA 1Z17A 1U90A 4IWNA 2J9XB 4LJXA 4C6SA 1Q3TA 5IVKA 3KKOA 1X3LA 4I2AA 3IKMB 5FRDA 4XUEA 3PVZA 2X5XA 1E1RA 3LWBA 3OZWA 5BW4A 5DE3A 5CYPA 3F5AA 5CR0A 2C20A 3KOOA 1VHLA 5J1SB 4H59A 3ZI0A 3IIJA 2I1VB 3K2QA 5FB3A 4GRAA 2VANA 2DE0X 3HLKA 4B6GA 1JHRA 1VL5A 5ADWA 1JTVA 2AA3A 3VOTA 1QJCA 1BDIA 1RYSA 2J0SA 3IRUA 1ISFA 1JECA 2PLRA 1K7CA 5K0NA 2ZE5A 2J3JA 2WABA 4IIUA 4QXQA 2C7OA 3BQ9A 4D6YA 5JXGA 1FZQA 2OT3B 5CIQA 4YACA 4UQPA 5CYOA 5K0JA 4HGYA 1W8IA 5T4EA 1UDBA 4JIGA 4D56A 5FLXA 4DW8A 2L69A 4OREX 3QJYA 3REOA 4URVR 4FINA 1O77A 3OQ1A 4M1MA 1Z5WA 2MSKA 3Q11A 3LDAA 2L19A 3PNCA 2FEKA 2ECFA 3IKJA 3RG2A 1I4LD 1KZ6A 4RUKA 1B23P 2DT8A 3BKXA 5HW0A 4OI0A 1RQRA 1BX1A 1AT1A 4H17A 1VI6A 4IZ6A 1SC9A 1IN5A 1DKQA 4PINA 2CBGA 1RAGA 3JAKA 3ZHQA 2OC9A 4RDHA 2G17A 3T1OA 1P9LA 2APJA 4KXVA 2DR3A 3B7WA 3ZW9A 1KQGA 3DLCA 4QAJA 4RLFA 4DADA 1KRXA 3C45A 3UN1A 4O4LA 1ZNWA 5LU9A 2BGGA 1ZMRA 5EWMB 4DR3B 3ZW8A 2HLHA 5AT1A 1CP3A 3M2TA 2Q0QA 3TZCA 3CUSA 1DT3A 3B89A 1QSSA 1R9JA 1MZVA 3VR4H 4P7JA 2WJZB 1DIBA 3IUSA 2WFAA 4MB0A 1G3RA 4IQGA 4DWIA 4G63A 1R6XA 1Z5UA 4BNNA 4Z9XA 3I6MA 3DPSA 5IN4A 2EWMA 4BV3A 1BU5A 4NAHA 4GH5A 3B5JA 3UMRA 5J2JA 1XYGA 1T4GA 1RYBA 1T3LA 1HL7A 3LLSA 3ZWAA 1Q12A 2H16A 2XCAA 1TTQB 3KR1A 3M81A 4FHZA 1A97A 2KEYA 1GNLA 1ZW1A 2PSFA 1KOFA 2ODTX 1SXJB 2XCTB 1RXWA 5DM2A 2EV9A 1EESA 3C3CA 1TGVA 5AM2A 2Z3ZA 1L1EA 2GAIA 1R6TA 3SC3A 1QORA 3FCCA 1UBJS 4C0QC 1EFVB 5DZSA 1E59A 3ZZUA 1U2GC 1GZDA 3BJIC 3QNUA 3DWIA 3ZY6A 3RLFA 2IYUA 2ILTA 2AN5A 8ICOA 1ITZA 1W76A 4BMSA 5AW0A 1J0DA 2WZDA 4E51A 1Q0PA 5CHEA 5CJPA 5KTSA 2RG7A 1AHPA 3N5KA 4IXMA 2CXOA 4YYZA 2BH9A 5IAKA 2HA5A 1AKEA 1GZSA 1WDMA 2FMXA 1YRQA 2KM1A 3TKLA 2PSSA 5C7IO 1NQUA 1S5LU 4WY2A 3EXHA 2WILA 2O2HA 2I66A 2W11A 8ICIA 2QT1A 2LVBA 2BP7A 1NX6A 1PZEA 1FFWA 5JC1A 5C52B 2I87A 1M5TA 1X1QA 4B2YA 4ZI7B 4MO2A 1L8OA 3MBOA 5CCXA 4F4DA 4DAEA 1KVTA 5ERGB 3FF1A 3TE6A 3AEZA 2H5XA 4CM3A 4OH1A 2AD1A 4DFJA 2OFOA 3R7AA 1W5AA 4L4ZA 5LDHA 4K8RB 4QDXA 1BEUB 3DLTA 4FK8A 2V3VA 3CUYA 1DQZA 4HGZA 1XTTA 1Y3DE 2QL5A 2JDID 1GG5A 4U7GA 4EY4A 3E2EA 2FEOA 4B6JA 4X3PA 1KJ8A 1GILA 3M9LA 1SUSA 2JGDA 5KOJA 2CPRA 3EDYA 4MNTA 5GIPE 1BD4A 4O2BB 8ICTA 2IU4A 4TKUA 8ICRA 2ZPAA 3OPYB 4WN9A 1T9AA 4F4CA 1Y8CA 4Y9DA 4OEHA 1F0KA 4ZP1A 3V8EA 2B20A 3HUTA 3B2EA 3NBMA 3FZGA 1TM2A 3IPRA 3OMLA 1GQQA 2AQ0A 4IZOA 4YH1A 2F48A 1M2HA 4R8UA 1DADA 5B36A 3GPBA 5EUQB 1IL0A 1NJ1A 4O1MA 4GYWA 4N01A 3RVDA 2IVZA 5CM2Z 3VV2A 5A4DA 1X74A 5JSKA 1AGPA 2XZOA 2Y27A 4K9QA 3EARA 1ADJA 2VAPA 3VC1A 4IIJA 3CNNA 4L75A 4A15A 3I9MA 4Y2PA 2R2GA 2D8AA 1HM5A 3ON5A 1J5PA 2KZZA 4P82A 1LQTA 4B8YA 3CCFA 1BXRA 1X86B 4NLCA 3V4RA 3CU5A 3T5GA 1F5NA 4DQDA 3W77A 4HR7A 4OAPA 5EXXA 3QVVA 1WL8A 3NIDB 3LYHA 1RRFA 2VEDA 4RPYA 2XOKD 1OVMA 4C4ZA 1SVIA 2IPMA 5H82A 1JHOA 4EGQA 4JUCA 4Q3DA 2E4XA 2B34A 3RASA 4B9VA 4QDOA 4IR1A 3EXFA 4LCEA 4RXTA 1KEEA 3SZUA 2QU8A 3HEAA 3RNOA 4JN6B 1JFVA 4ND3A 2H3QA 4F38A 2X0IA 2WD9A 3A32A 5AQEA 4CM9D 3EPHA 5FUVA 1WB9A 1BKDR 1O08A 2WM3A 2R18A 4UNQA 1AKWA 4B35A 1NJGA 2AGQA 1TAMA 2QZPA 3AXTA 3OEEA 3NV9A 1YC5A 1U9IA 4UVIA 3F53A 2XYQA 4WINA 3E15A 2FN7A 3C15C 3QI7A 4LZZA 2DWPA 3W8NA 1O6BA 3DBRB 3HJNA 5ETJA 1P6QA 1VSQA 1DBPA 5IIJA 3TPZA 4TV8A 1TUEA 3KV1A 5LBIA 4LX0A 3ONEA 3FROA 2AS0A 3DD5A 1IHYA 1XAIA 2EANA 2YS7A 3RAJA 3IDFA 4TMZA 1RRMA 4YA6A 4DA7A 2VYNA 2WF5A 4ER6A 3ORFA 3RVOA 3V55A 2XW6A 1OZ0A 3T35A 2C9OA 4YFKA 4DWOA 4LBWA 4ZWNA 5SYAA 3WGNA 2VHTA 4GI3A 1VL2A 5ICGA 2E3TA 2GAOA 2QL6A 3C3YA 3GRYA 2WSBA 4R63A 1ATZA 1AZSC 4ZHQA 3ZY2A 2WV7A 3LGAA 3T1YB 4GPZA 4NONA 3UBMA 1H2YA 3QWFA 1BWSA 4LS3A 4PW0A 2EAMA 2ZIVA 2X9QA 4J1NA 2RGRA 2HXSA 3RABA 1KDHA 1NAHA 4ERXA 1GFSA 4QPPA 1ULUA 3KOYA 1PTJA 4NCAA 3JWPA 2Z09A 2BR3A 2W83A 5TRTA 2VDVE 1L5VA 1ZR4A 4EO9A 2GN9A 3QFFA 1P61B 4I81A 1YGYA 4MVJE 1VL0A 3TW0A 2D2EA 4NHOA 4ZOEA 3VVCA 3WGVA 1H2ZA 2JR5A 1WG8A 2DBRA 3WGZA 2P2CA 2JCXA 2ET6A 4FBMA 3HCEA 3V46A 4KODA 1VZ3A 4QM6A 1BGWA 1IG6A 2CXQA 4NLNA 4PO8A 1MEEA 5DASA 3RT1A 2KHZA 2JHGA 2B82A 1V1RA 3CS3A 1YJBA 3DWFA 5CW1A 1WY7A 3HVJA 3HU2A 4H4CA 5CA1F 4XCVA 4EOGA 3FIUA 5AHRA 1S4MA 5E0OA 2O5VA 4AY3A 3TADA 2QTWB 1JQEA 3K71B 5FOUA 3UA3A 1UBRS 4PC6A 1Z37A 4FMPA 5CHYA 4FMCB 1M6YA 1WOYA 3ABIA 2JL1A 1EIWA 3DT6A 2OHIA 3BK7A 3IT1A 2J45A 3HKBA 5I4BA 2P6RA 4OHKA 9ATCA 2BUCA 4KMMA 5FQOA 4RCYA 1LLDA 3HWRA 5EJ9A 2CLOB 4QA9A 3TOSA 3QF7A 1IUOA 4ND7A 5JCJD 1G64A 3L04A 1DAHA 1YI8A 1LS1A 1XTVA 3PEYA 4NZMA 5IS2A 2O2ZA 2GCOB 4X90A 4CV1A 4IOMA 1LTKA 4H08A 4GNRA 4MCIA 4K05A 3HB0A 1NC3A 3RJZA 2A9OA 3I1YA 2KKVA 1NYLA 1U0FA 4EPXA 1FLDA 3X2EA 1U94A 1WF6A 2XGJA 1HNZB 3HW8A 3CKKA 3OIWA 1OWMA 2BFCA 4DEVA 4XEUA 4CLOA 3GJ0A 3ZK8A 2XWSA 1V8ZA 1U2DA 4ZYXA 3LH5A 3PO4A 4C4SA 3EVBA 2VPTA 1U4OA 2XY7A 1SN7A 1ZH6A 4DA8A 2H5JA 4U3JA 1ONBA 1RPNA 3D5QA 3ASUA 5ELXA 2JHDA 1YBAA 3VSAA 5HWSA 5IZ4A 5C51B 1MC8A 4QODA 1GPNA 3P96A 2BTQA 4LSZA 2R7LA 3NYWA 4GBJA 3U81A 4O4HB 2BLLA 1ECFA 3T9AA 3I1JA 1U3GA 5YASA 4TPKA 5HHIA 4DCUA 3OQNA 5IF9A 3EVCA 3AU8A 4DLNA 2KSQA 2P7IA 1W47A 3AFHA 2Q3MA 4CR6A 3PKIA 4POOA 3FFXA 2GPYA 3TOZA 3QEJA 3UM9A 3WGIA 4H0NA 1E6LA 5ER6A 3G6WA 4FS8A 1JZTA 2QRUA 3LXUX 3J80A 1KS2A 5J63A 3BRCA 4FSDA 2ZXHA 1TV9A 2XB4A 2OB1A 4G5HA 4IZIA 2QF7A 2AQIA 4FGSA 2VH1A 1ZCFA 1FZTA 1VIYA 1J7KA 2BGLA 3MVEA 8GPBA 1ZQDA 1Z29A 3BSFA 3KJZA 3MR6A 1UDAA 4R2WA 2BZ1A 4CODB 1Q1NA 4PFJA 3RAXA 1TW3A 3AZPA 3EDRA 4EHAA 2NAPA 1XEXB 3SXPA 3T99A 3AY7A 5I01A 1XVTA 1MTZA 1ZMBA 4N6OA 1M8KA 5BV1A 3CNLA 1S8FA 1KEZA 1G7TA 1I7NA 3C7AA 2C7QA 3UJHA 1Q6ZA 5F7XA 5IWCA 2DFLA 3Q87B 3ZS9A 2WJYA 3R3JA 3IMCA 5GM2A 4UASA 1PS8A 3L06A 3AVTA 3KYIB 2ZUTA 3L0OA 3QEMB 2G1AA 4KLIA 3L9WA 3DHEA 1FNSA 3GB9A 2CK3A 3QWHA 3EXEB 3QEBZ 5F52A 4PCLA 4BECA 4Z6FA 3GYBA 1RJ9A 4WK4B 3L6BA 1DUSA 4M1SA 3H1TA 4G1UC 4WKOA 4F9GA 1WCV1 5IULC 3CPSA 4ZGGA 5FUMA 1ORVA 2WOJA 3AUUA 2BT4A 2HA4A 2I6FA 1BE1A 3M5CA 4JJKA 2Z04A 3DXYA 1VBKA 4BQOA 1LK5A 3URMA 2VPZA 4BO6A 3OQJA 1FRVA 5T3UA 3D6VA 5KTKA 4HRAA 3GQBB 4WXHA 3O2SB 1NATA 9ICFA 4EG3A 5ADUS 1BGVA 2XCIA 3T9CA 4LWZA 2EBFX 2VOJA 4NLGA 5KNDA 4UZFA 4AO6A 4AKSA 1AGYA 4KYIB 3PE4A 3D6NB 1DPGA 5TF0A 1C50A 2BEKA 4QBTA 3Q7PA 1XZPA 4K1LA 2VHXA 4V39A 5KFEA 3OX4A 1MB9A 1CUIA 5A9SA 3S2FA 3BICA 3KC2A 2W71A 5FOSA 4I46A 2VTKA 1PK7A 2IF0A 5IRCD 2IH4A 1H93A 4MYCA 3SZGA 2H9IA 5LC1A 3VSEA 4RF4A 3R41A 2XUJA 1RI4A 1URPA 1MB3A 2AJLI 1XTBA 3V4SA 3TNYA 3WMFA 1M83A 3HKZC 3NDJA 1K7FB 3AI2A 2IPXA 3GLKA 2ISPA 1UZLA 2QMYA 3G9UA 3MHPA 2R97A 2PX5A 3OEHD 2F90A 5EWLA 2BPCA 5EIXA 3TACB 1WXWA 2Y1FA 4BIMA 4ENRA 3OZCA 5EQDA 1Y81A 1HMPA 4DMFA 4ODIA 4CVNA 2DQKA 4B5KA 3AP3A 2B21A 1CQPA 3CX7A 5AW6A 1O3YA 4QU9A 4WN9B 1QCCA 3QV1A 3QUQA 4FLMA 1I10A 3LCVB 5CDTA 3THXA 3KU1A 1WCIA 4BN5A 3DVQX 3AK4A 5K8VA 3PR4A 3F8SA 5AI5A 3NOVA 1Z3EB 2XD4A 4F5NA 3A1NA 5JZBA 3JX9A 1XRNA 3P94A 4DCJA 1C1YA 3DZ8A 3BMCA 2ISSD 1TA4A 1G3QA 2PRKA 3DZIA 3S29A 4BGVA 3AERA 5AVVA 1DKLA 1J9EA 5IJ9B 3NBYC 4Q7MB 3DC7A 2J5KA 1JIJA 1VJDA 4TRMA 1RT9A 4OYRA 5B53A 2F9FA 1JMKC 3PPYA 3CF4A 3ZD9A 1GARA 1U0RA 1ZONA 1WUDA 3D7MA 1GTZA 2PKCA 1U9YA 2VYVD 3X3HA 3UKJA 3JD3A 1W30A 1OAAA 3AZOA 2IXEA 4TRRA 5BSFA 4MVJD 4N5LA 1M8FA 1NY5A 4LQLA 1YQUA 3DTYA 1BXRB 2OQVA 4B46A 1J24A 4DUGA 4M6WA 1I0ZA 4ZVNA 2PNFA 2O50A 2W5UA 3MCAA 4EKDA 3MGHA 2JPDA 1RDFA 1NZPA 1Q44A 1HZZA 4DLXA 4YMSA 3MBKA 1V7CA 3CV3A 4FNMA 4XJVA 1EVKA 2GTHA 1XQYA 2EAOA 1HE4A 4X41A 4MUKA 1KEEB 5JAPA 4I99A 1YR1A 3WLAA 1QYRA 3PGKA 1CQWA 3T94A 5LBTA 5DX8A 2VNIA 2ZJFA 2K2WA 5DLEA 2HLDD 4Z8YA 4RJTA 3WMGA 4M1KA 2K7ZA 1GL3A 2WVJA 1PGPA 4MFFA 2FWPA 7ICKA 4HQ6A 4YR0A 5CPFA 4GRDA 2J1LA 4DL7A 1XKLA 1KGDA 1ZCAA 4TVOA 4O5KA 2FQWA 3OIFA 3RARA 4R40A 5JZSA 3OCZA 1HOTA 3FFTA 1G2PA 3LYSA 4B4OA 4G4IA 2EJVA 3B7GA 4O3OA 1Z82A 4L4SA 2E5LB 4P08A 1WF3A 1QB8A 2Y0SC 3A1FA 2XVYA 1EAMA 1E0KA 4PGHA 3UV6A 1C1XA 4YN4A 1CY6A 1XPJA 5P8WA 1CF2O 5HRAA 2XNDD 1M7GA 3QLJA 3VZRA 4WDRA 3E9QA 2VPYA 4F3RA 1A9OA 1P5JA 3ZNPA 2Q7XA 3NHKA 5J5CA 3V1YA 4O0LA 5CD1A 2LYAA 1G3MA 5LYJB 3LVWA 2V55B 1NF8A 3O8LA 3Q2KA 5H3HA 5E6SB 4AZTA 4JQZA 3L1JA 1HG1A 2JJMA 1M6EX 4HV4A 2YZ2A 4DQXA 3IE0A 2HWUA 3PWTA 3WNDA 4WE3A 3R6GA 1LH0A 4YGXB 1JQAA 3NBFA 1G21A 3U7GA 4DMCA 3TRHA 3PPIA 4EHHA 1Z2OX 3S5UA 2HHLA 3D0KA 5DX1A 1G5IA 3AHHA 2MYNA 1XX6A 5EP3A 1BE6A 3K9FC 1LPOA 3Q3VA 3CNBA 3RU2A 4QOIA 3HKDA 3KKNA 1JB9A 1MQ2A 3W5AA 4UVGA 3UG7A 2HUNA 3SF8A 3H6HA 5BVHA 1JFFA 3NTVA 5CLJA 2TMYA 4XD7A 3RU7A 3PQFA 4LC0A 2IEAA 4UHDA 4PZLA 3OZAA 2D7JA 4DPMA 5CXUA 5I5EA 5AUNB 5IDWA 1SG9A 2X1VA 4TKZA 3LPLA 4WKPA 3K5PA 3ORQA 1IOVA 1WBDA 4PC7A 3E2IA 3P26A 3MTJA 3HO1A 2RQ5A 1JXEA 2VVTA 5F23A 3CT6A 4UVEA 1UEJA 1QHSA 2GWRA 4QO8A 3GFFA 4IO0A 3HKBB 3U7RA 1YVUA 5BQOA 1A8IA 2VHYA 2VEOA 3RBXA 2FXIA 5A6SB 1A8QA 4E09A 5LMNB 3RR8A 3EOZA 4Z2AA 4CI0B 4L28A 2B3TA 4C3OB 3UV3A 1K4MA 2PKEA 5KFZA 2E4AA 1DBWA 4DDTA 2HA6A 2YR0A 2JFPA 1CJUC 1GPYA 4OXRA 2Y9TA 3MT0A 3PDHA 3RLIA 2AFIB 2QD1A 4IDNA 3PQ7A 1RAAA 5EJ6A 3V97A 3AHGA 4ZQCB 5TQ2B 2YIMA 4HAZA 5K3SA 4CLOB 1YDWA 5B7GA 3G2QA 2ONKA 2GCIA 1CJBA 4Y67A 4ZDKA 3BAZA 7MDHA 2NRWA 3I4CA 1UK7A 3HKZF 3IERA 4QFCA 2QX6A 5BWLA 2NT3A 4FFRA 4U3JB 2QLFA 3F6EX 1TLLA 4YMTA 1QWOA 2VYCA 1U6JA 4OJ5A 1N77A 2BTQB 3L01A 4RX1A 2HBLA 1I14A 1XVUA 2DETA 1C4XA 1G5PA 4FYIA 2JLQA 5BYBA 2W6ID 3FM9A 4MDHA 5CT4A 2JLAA 2B9VA 2HT6A 5A62A 2AXPA 2FW1A 1ECCA 3IPCA 2AJQA 1JPUA 1RYZA 4YR2A 5B5EU 3WS7A 1J22A 1CJTC 3OWXA 4PHCA 4WXPA 4CCWA 3AU6A 1YS2X 3F5DA 5IVIA 3R0IA 5LKAA 5JJBA 3NV7A 4NIMA 1C3JA 2JHCA 1Z4PX 2HBRA 1D2HA 3RUHA 4D2IA 4BTVA 1BAPA 3GGOA 1NXPA 1A2QA 4JCCA 3FTPA 1JJBA 2JIPA 4WFKA 1RLUA 2WYIA 3WRVA 1ZM4A 5AVTA 3OX2A 5KAPA 1Q7BA 1JIQA 2H29A 5AKHA 3Q8PB 4B82A 3BRQA 4CIYA 4LJ8A 5EZ5A 1Z4QA 5G02A 2GO1A 4J0DA 4Q15A 1HH4A 3D6JA 3G88A 3C8HA 1M6WA 4YHHB 5J0PA 1AQYA 4GFDA 3KTAB 3FY4A 4C7XA 2KLHA 1BS2A 2W98A 5JS2A 2WDPA 3KTQA 4JLNA 3FFBA 4ID9A 1NPDA 1SXPA 1Z6PA 4LAFA 1KR2A 4I1IA 1AY0A 4YCDA 3DE6X 8ICSA 4UFOA 4AWAA 1Q7TA 1RLOA 3QX9A 3VC3A 4BMYA 5KJCA 3QTLA 5IKPA 4J2HA 4RD6A 2B69A 4ME6A 3LRXA 1CZRA 1L7AA 3DL2A 3MMSA 3TTYA 1SKRA 5AKYA 2ASEA 3NH9A 4I28A 4RFLA 4ZCIA 1SCNE 4X61A 2W6NA 1P0MA 2E4YA 3NAZA 4OXNA 4BEJA 4WV3A 1CHNA 3R20A 3R0QA 2CLCX 5TB5A 1I1OA 2A9VA 1ZU5A 4CF7A 4S04A 3LY9A 5A5VA 1OWNA 1T3TA 5LQKA 4ED9A 4NBKA 3RC2A 1LLUA 3ABZA 3IT2A 3L0YA 5REQA 1GY8A 4ENTA 2Y0SF 5AXDA 4S0ZA 3BIOA 2Z2JA 3JTEA 4YHBA 1RRGA 5HM6A 3TTWA 4LDZA 3UWPA 3K96A 3TARA 1HNWB 5DNEA 1W29A 4AYTA 1Y8RA 1V2HE 5JXJA 1UMBB 4TSFD 3RE1A 4UEKA 3ZLJA 3PDUA 1EJBA 2WJHA 3NDRA 1L7QA 8LDHA 5K0TA 4NH4A 3MJCA 3HVKA 4RCVA 2OB2A 4RQBA 2J3LA 2YTUA 3CSUA 2RHFA 1DXSA 4UDXX 4I0WB 4M9HA 3PNOA 3H5AA 5EMJA 2HSDA 1XF1A 5AVKA 3EXG2 4HO1X 5AKZA 2EDUA 1T91A 4GXTA 4RELA 1L6NA 4GKBA 3OTQA 2DKOA 3L2OB 1IN6A 4JFRA 1QMGA 2J5QA 3T5PA 3AX6A 3RV3A 2OXEA 5DNYB 1HC7A 3W5DA 1ZQ1C 3V34A 3JALB 3KKMA 2VT6A 1E6UA 3DZFA 1S2IA 2UZ4A 1BKSB 2ONZA 2Q2QA 2VK1A 1QGYA 2VCEA 1IPFA 5GMOA 3IDWA 1ZISA 2CVZA 1NF2A 4OHFA 5KTNA 4PBTA 4AUMA 1ADYA 1KE2A 1YZ7A 3QNMA 5EWLB 5IJWA 3S2IA 3TL3A 3ZYZA 4B0PA 4C7VA 4BOYA 2FW9A 3COJA 5JY1A 2VUIB 1U9LA 3GCXA 4EI2A 2FYTA 3RF9A 1CDZA 1TJ5A 1P9WA 3HGQA 2OQIA 4YRPA 4H6VA 1SD5A 1LEHA 3IEUA 2H1OA 3WQQA 3RS4A 4RADA 3V8BA 1Y8AA 5FUXA 2BFBA 3TNDA 2PRIA 3F9RA 4NHEA 1CP2A 1THZA 3SNKA 4TZKA 3RWBA 3N3BC 4MOWA 2A2ZA 5JOQA 1NUPA 4MRMB 1OXSC 1X40A 2PUVA 1HX7A 2AOVA 3NKLA 3BMCB 5JYBA 1P1JA 4JGIA 3X1KA 2F2TA 2QLMA 4L73A 9ICLA 2PGDA 1AKTA 4TSRA 1KP9A 1GWNA 3BXGA 1XCPA 3H05A 2X4GA 4U2BA 3IOBA 4DTCA 2PIDA 2R86A 4HFMA 4IH4A 4JJ6A 2GVZC 3HR7A 4UDOA 5DM60 2HSEA 1Y6FA 3BSSA 1G291 4G36A 5HEKA 3QKTA 5LZ8A 1PSWA 1NSTA 3RC1A 2UUPA 1UZUA 2YWDA 1YJXA 4QULA 1FSGA 1MORA 4MWGA 2IHKA 4N8DA 1COWA 3EW9A 1CWUA 2EKZA 5G2OA 2HMSA 4HDAA 2ATIA 3CR3C 3PW5A 4QLAA 4RE6A 1EFAA 4W63A 4ISBA 1G5FA 4LQCA 1RLIA 3BWDD 1E2MA 5FOXA 1ZGZA 4DRZA 4H0FA 4I2IA 3GJ6A 1MP0A 1GYRA 2EW8A 2VJNA 3HXQA 1AA6A 2QBYB 2HO5A 3RKUA 3KOMA 2IQ5A 3X1YA 5JO0A 1O5TA 3TOXA 3C6MA 1IEXA 3OEWA 1G66A 5KDOA 5DM70 1EX9A 3BYZA 3RUIA 5EE9A 3RSLA 4IGIA 1OF1A 3EVNA 5JYEA 5K4GA 5AW4A 4EM6A 1NK6A 4P81A 1FFGA 2O8VA 4WA8A 1IB6A 1O89A 3L4BC 3PFCA 1Y37A 1YA6A 2RHOA 5KL1B 4JMPA 4KNWA 1RHUA 4BGUA 8ICAA 1P8JA 3A28A 3HUEA 1Z4KA 2AWNA 3CRZA 3NIWA 5DXAA 1GP2A 1C1XB 2AMLA 4DQLA 1A9RA 3CUWA 4YJ2A 3FZYA 2G67A 2NQ2C 3AINA 2N47A 2XVTA 2A3NA 4URFA 4HEQA 3S28A 3VHQA 1X6JA 3PHIA 3LOQA 4Z8XA 2BSQA 1IY9A 3SZRA 2SKCA 4PAMA 4DLSA 1NDHA 1C9YA 4Y2UA 3NOOA 1ZQQA 3FYUB 4MQEB 4PGQA 3K4QA 3TRJA 1NXXA 1H8ED 6CHYA 4J94A 4TV9A 4YRRA 3BXOA 3ZVNA 4JP8A 1Y7IA 1WMFA 4PY2A 1QZ3A 1UPBA 1F2TA 3DZHA 3IBFA 2NZXA 4FZ3A 3DR3A 4W82A 2QLLA 3FWPA 1U8UA 1JDZA 1W49A 3CIFA 3CLSD 1YKSA 4IIEA 1KOGA 1U0EA 1ZETA 3LFUA 4BNWA 2IV7A 3G8YA 2GI4A 4D3FA 2XUAA 2Y92A 2D0DA 3RC7A 1S01A 4LGMA 1GEEA 2NSYA 1F4LA 4AKHA 1NZFA 4MGEA 5BV7A 4Q93A 4LNHA 1Q91A 4YP7A 3R3VA 1TW2A 1I6WA 3DL7A 3BHMA 5KYYA 3UB4A 1S7GA 1Q0SA 5J2CA 1DS6A 1QE5A 5FDFA 4Q34A 4TMTA 1Z74A 3EH1A 5KTTA 2DXIA 3SF8B 4XXHA 5BVHB 2JGNA 3E48A 4EKEA 3U7JA 2F59A 4DOBA 4TL7A 1DLJA 1IK6A 1F8FA 4A7PA 3SY8A 3ELBA 4GX1A 4ANFA 3CRVA 5P21A 2Z2XA 4L22A 3N2YA 4FIDA 3HCCA 1ODIA 5JMWA 3RUFA 3PGJA 1FMFA 1P0PA 4I6JA 4S2UA 4R83A 2D13A 3HBNA 3HL0A 5KNCD 1FDUA 5MGNA 4FGZA 2Q5EA 1Z35A 4QYXA 1WHTB 4NNOA 4ON9A 1B76A 1BX0A 3ZJTA 4GBGA 1Z7BA 1L4BA 4J1TC 1SR8A 4BQRA 3ZDYB 4YJ3B 3C28A 3CCCA 1W4CA 5KG5A 2JGJA 2N75A 1FNDA 1ULAA 5DP1A 2Q6OA 1WSWA 3H11A 2QWXA 5ALDA 3QFSA 3UB2A 2PMFA 4NBLA 2OL4A 3GDHA 4Q21A 2ZBFA 2RAFA 3D5TA 2XZPA 1YE3A 2JJQA 5CDYA 5BMVB 3TLAA 4F6RB 3HILA 1EMDA 1HF3A 3RJKA 3COZA 2C4TA 5DB8A 1V6CA 3IEMA 2O8CA 5HILA 2CKMA 3HEMA 3WDKA 1AS0A 1JT9A 3JVVA 5A4AA 4M9LA 3WZMA 2IKQA 3BAFA 1UDRA 2ZT5A 3Q9NA 4GE3A 3LXRA 2ZFUA 1ZQAA 5AOCA 4XGKA 1U48A 2UZIR 2OCPA 4MYHA 5L6LB 3PL1A 2MU1A 3VDXA 4RQAA 3IILA 1UMDA 2PUAA 4QFBA 2GX6A 2J4FA 4BNUA 1PLKA 2VJKA 3AEQB 1OLUA 3V7NA 2NU7B 4DGQA 2ZT8A 1COZA 5B57C 4D96A 2IZZA 1WUJS 5K0FA 2EBHX 4ZV9A 4I1YA 3MWLA 2F1RA 1N60A 2BPFA 3ETEA 3OA2A 3EGXB 3AJ8A 4GWKA 3ESRA 3OFJA 1YFLA 2O3SA 1YWGO 3GDFA 3F9CA 1IG3A 2EVWX 4EMTA 5CITA 4ZU6X 1LPSA 2A1TR 2HHUA 3DTVB 1SQ6A 1OGYA 3HPOA 3CEHA 5J29A 1XE3A 5A1TA 5DB7A 4GI5A 5EEGA 1Y3HA 1YF3A 3GIWA 2P2LA 3ZE8A 4NESA 5DVZA 3DLIA 3B1KA 4NDAA 2FJUA 3BXFA 4HNAA 2NADA 8ICNA 4FYHA 4I50B 2JIRA 1E61A 3V42A 2BEWA 5J2UF 1I2BA 2B9EA 1FP1D 1NIPA 8ICJA 2B35A 2Z8YM 2QP4A 2O8BB 5JLJA 3U2QA 4E4TA 1Y5MA 4PYIA 2B0CA 3ECCA 5KFKA 3AJAA 4GVPA 3HB5X 2C4MA 5SV2A 2JV3A 2YZGA 1PUJA 3CZCA 1BG6A 5CT8A 1NF9A 4BHTA 1DCFA 1NK8A 1FYEA 3SPXA 1QV6A 3NC1C 2VF2A 5EVJA 4UB2A 2YXLA 2ZRMA 4FS1A 3VC2A 2E4WA 3D7RA 2I4OA 3CJRA 1TMKA 4BLRA 4MQBA 3ZV4A 2P2GA 4EWLA 1JRPA 1ZD1A 4G5GA 3F2VA 4BO1A 1AS3A 1L5YA 1SXHA 3JRNA 1MUUA 1U9ZA 4PSCA 2P9HA 2ERCA 2I4LA 1RPTA 2IDZA 5EGNA 4YRNA 3TYXA 2KHQA 2H08A 4P4GA 1KGSA 3NTXA 1H1TA 3ZCXA 1JA0A 2B8JA 2PD4A 3R8CA 1HYEA 3KWLA 2AW3A 4IDHA 3ES9A 2BFOA 1DEXA 1PV2A 1KI3A 2VDUE 3I83A 4WWHA 2ORVA 5KTPA 2EGGA 4PGAA 4LXTA 3HJAA 4O4JB 4R7TA 5ALYA 3LP6A 4ICIA 4MIEA 4RPIA 3RBEA 4ZAFA 3CNEA 4QWWA 2D2FA 1CDEA 4AN1A 3O8OB 2W6OA 3OC0A 1HMYA 2P75A 2JGIA 1M54A 1WD5A 3Q6NA 1U28A 3X1XA 1BXKA 3PQ5A 1RZUA 2BGJA 1CDDA 1REQB 4F60A 4JX8A 4UTXA 1QKIA 3IVXA 4WA7A 1BEEA 3BF7A 4EEYA 1TZBA 5KFGA 4WJKB 1LLFA 1ZXIA 4C0KA 3UG6A 2C58A 1PNQA 5KPDA 4CEHB 4AUKA 1P7YA 3ZZNA 3LHDA 1D9XA 3LDUA 5D5QA 1B2LA 1UT6A 2X5KO 1RACA 1NLZA 2EERA 3NPAA 2EFJA 2CUKA 1U7TA 5EOZA 3DXFA 5HK9A 3F4LA 2PUBA 4Z86A 4E15A 2WQ7A 2RGNC 5CHGA 2XWBF 4I5GA 1M2VA 3NBZC 4FI3C 2WQ6A 2WWGA 4F3KA 4K9OA 9ICUA 1I3OA 2HJRA 3RYHA 2R7NA 3NBQA 2W58A 3VJMA 3BIXA 2RGXA 2D1YA 3C2LA 4AURA 1N6IA 1E1CA 2I0FA 5CH8A 3QVJA 4P5PA 3JQAB 4MJLA 1ZOIA 2BGTA 3OQIB 4ND8B 2E3JA 4FD3A 1KP3A 3P27A 3WYEA 5U4XA 4RQ3A 5AJWA 4AP6A 2A86A 1ZYQA 6NULA 3EMDA 4H3KB 5COAA 3ELDA 1YRAA 2JRZA 3V5NA 4JGBA 4I29A 4XIJA 3P19A 4R9VA 1X8JA 4Y2QA 4OJTA 2J9FB 4MRRA 1L4NA 1KLNA 2OCXA 4RGVA 5FJJA 5EP2A 4MA5A 4MS4B 3UPDA 2QZ9A 4ARZA 1LNQA 1ACJA 2V7GA 3NG1A 1YCGA 1DELA 1EBFA 4KL8S 2G8LA 1WRBA 9ICHA 1HOXA 1BDMA 1P18A 2HUPA 4WNAA 1VKZA 2Q2NA 1RQGA 2VDKB 3L9XA 1J42A 1XA0A 4XVQA 3HB9A 2QMQA 1KJWA 1SKYE 3ETGA 4PZZA 4E1AA 2UZ1B 2O8FA 4QUAA 3MOSA 2VCHA 4KE7A 2CXSA 5CFQA 2DUNA 1XDWA 3VKFA 2ZR7A 3WHPA 1K86A 4RQTA 1UOEA 1L6IA 4UE2A 2HK9A 4NRDA 4LJ6A 1BCRA 3FPGA 3SM3A 1G19A 3MSXA 5JAZA 1K5GA 1KERA 5J58A 4KG7A 2PLFA 3OD5A 4H1VA 5DOZA 5KAMA 1EQAA 3K09C 3NNNA 1OYVA 2CEKA 1C7ZA 2JZNA 2JEJA 4WCFA 3KJFA 3K9GA 4ZYZA 4YJ2B 1F14A 5KSPA 3JWHA 3T6KA 4HGQA 4MUFA 2O6HA 3PDIB 1U6KA 2QMUA 4F46A 2Y8EA 4TOIA 3LX4A 1IULA 1TECE 1SXDA 5AKEA 1ZRHA 1YO6A 3CLTD 4ZU3A 4Q4JA 1JWBB 3BWVA 1Y3IA 1I9CA 4QOEA 3E9CA 4C7KA 4QUDA 2Z57A 1TADA 3SQWA 5A2QA 5KTQA 1O8CA 2YYSA 3HZHA 1KQPA 2J32A 1A72A 4BZQA 3UEOA 4F5OA 4CGYA 1H2XA 5A1JA 2WVHA 2JLXA 4HZIA 5U4QA 4B9UA 4KLMA 4J03A 4BFSA 5IH3A 2Q6IA 3VC8A 1H9CA 3L4EA 2PO7A 3M3HA 3SYTA 1U7ZA 1JHUA 2HRCA 4DL2A 4JT8A 1QYVA 3I45A 4EY8A 2PKQO 5ALNA 4B3MB 5FPHA 4CGZA 4C29A 2NZJA 2R68A 4BFZA 3UFXA 3LS2A 4P36A 4J8PA 3IAS6 4MF2A 1NXWA 1YR7A 3HJGA 3FSGA 3REQA 2B61A 3ZEAA 1CQIA 1EFLA 4QHSA 2Z9CA 3HN2A 5KFBA 1IBLB 3WGYA 4OHCA 1PGJA 1C0IA 1WA5A 3KR9A 5TQ0B 1R0BA 3KVNA 1FUYB 2VQFB 4LZOA 1ZA1A 4IC9A 3DO5A 2R00C 3RVMA 2PR2A 1VL6A 3OKPA 3TNLA 4YRMA 2XXBA 1KKLA 1IXSB 3H9GA 3KUXA 2JFGA 1NN0A 4LFAB 5K20A 2IDJA 3GIDA 3UIEA 3JYLA 5JAQA 2ZXUA 2ZJ8A 4NKRA 1GG2A 1D5WA 3PKZA 2JFOA 1XC9A 1KW4A 1ZQFA 2IHZA 1VPDA 3ANYB 2HJWA 3H9CA 4HLDA 1S2DA 1W9MA 5KX5F 4Q82A 3SS8A 1YZ6A 1ZQBA 1CFZA 3A3OA 3A7EA 3BL5A 1BA2A 4J4BA 5KVVA 4DSJA 1S9HA 3KE9A 1NUQA 3SEFA 4MUIA 3F46A 1TKCA 3BIJA 1WYGA 4M9JA 2X13A 4TN5A 3SBOA 2XKAA 1R8QA 3C6KA 5C1DA 3WK7A 3W9BA 2XB2A 3ZE7A 1QCKA 4BQEA 2IHJA 2RBGA 1MN6A 2Q5FA 2GLEA 4ZRDA 1L1RA 1TZJA 1RRPA 3I05A 3M4YA 1IDOA 3MRVA 4O4IF 3OPVA 4M0KA 4OIFA 3PGVA 5J5AA 3VO1A 4NP6A 4JGGA 2X1LA 3Q3EA 1XVAA 3KT6A 3DAYA 1F0NA 5KUTA 2O8CB 3P9ZA 3R76A 1SHLA 3K9WA 1B6RA 2IS2A 4P2HA 1GITA 3SFTA 3H2SA 5FWYB 4AY6A 4OJLA 1N2SA 2ZI7A 4D45A 1NG1A 3ENKA 1BHJA 2W2VA 3O2QB 2O7RA 4F21A 2HB6A 1UJNA 4YRIA 2NQTA 4PG8A 4GLFA 5B37A 5FORA 3FRIA 3U09A 2YV2A 5E4JA 5IZCC 2P4QA 4FI3F 1OFHA 3A05A 5CMLA 5G0VA 4YX9A 1VL8A 1W5EA 5J0OA 4DCVA 5C9ZA 4KKXB 3R9WA 1RXUA 4CV0A 1JEYA 4QLBA 3G6YA 4YXJA 1HO3A 3HU1A 4Q9JA 2Q4EA 1Z16A 3O4RA 1TD1A 2PD3A 3T5BA 5IYZA 5AVRA 2V0NA 4MIKA 4I8DA 3FPLA 3P4UA 1T8PA 2FDCA 9ICJA 2GLTA 5FO0A 5JW6A 2LBOA 1J9GA 1XXHE 4OD0A 4IXTA 1CR6A 4B48A 2RKOA 3ZWDA 4UHHA 3ND8A 1G1AA 4ARVA 1TI7A 3P2JA 2QG9A 3PQEA 4XKJA 2AX4A 3WHIA 5IVPA 3KQSA 3I61A 4M8IA 2IOQA 4UHBA 1VLJA 2IYTA 4A10A 4AJLA 2IYSA 2Y76A 1P9RA 4MV1A 4LDNA 1M1YA 1RQLA 1YJ5A 3JAKB 4FHCA 2BEWB 3LWLA 2RGAA 3TAXA 1VJRA 3SLRA 1U1FA 5G1PA 3RTDA 4JBXA 1XMPA 4CMHA 2C00A 1P2BA 2GARA 2RIPA 3C85A 3VZBA 4UJ5A 3DKRA 1OROA 1CJSA 2XF8A 4O4LB 4FXPA 1XMQB 1OKKA 4HDMA 1JU4A 2UXCB 5TXGA 2JBAA 1N1EA 4GR5A 2HU8A 2Z9BA 1VLMA 3TQ1A 5BQXA 4E5PA 4R5MA 4ZVPA 3GT0A 1YR2A 1EUQA 2F3QA 4TWAA 4H77A 3L02A 3UWKA 2P8JA 4IDQA 3LHSA 4K9RA 5BQPA 3HJBA 4ILKA 1JBKA 1ATIA 1I7PA 1ZXBA 3JS5A 2IY7A 3EY9A 1XA3A 2PSEA 4DLKA 1M2FA 1SL0A 2WHYA 2D2XA 1V9CA 1BA3A 1GCAA 1G7SA 3PNBA 1T4CA 3Q9UA 4LE1A 4A92A 4OGLA 1RYHA 3CRMA 1YZKA 2P5SA 4GGPA 1D3AA 4E1BA 4RTKA 1HE3A 2OWDA 2WUWE 5HNKA 4R6WA 1KBQA 3JYPA 3I23A 2G08A 3PGXA 4G0NA 3SAHA 2QN8A 1QIKA 5EZQA 3OD1A 5IH7A 1KEKA 4RZIA 1J5XA 3HXOA 2VDJA 1SC1A 5LM3A 2FW6A 2PFQA 4IH1A 2JLRA 2JGLA 4LG1A 5EINA 4DILA 2KICA 4D42A 3NNSA 2YDYA 3FMIA 4MXDA 2IHVA 3IVAA 1NQTA 3G13A 4X97A 1XAGA 5AD1A 1B14A 3JQFC 2O4UX 1IN4A 3G8CA 2XCUA 2V9ZA 3NRBA 3KD3A 2W90A 1MX1A 4MLPA 1G2OA 2SKDA 1XZIA 3B6KA 1UMCA 5CH3A 4TUQA 1SC6A 4JYCA 1YDEA 1EGAA 4ENUA 1DIAA 3TZ6A 1T5LA 3EXHB 2DJIA 2XI4A 4FJ0A 1MABA 5BRJA 3HWWA 2HZBA 3FWKA 1ULTA 2BP7B 3JZIA 3G68A 4IFTA 2BR0A 3L6CA 3RREA 1Q17A 3EPRA 2FR0A 3H2GA 4B85A 2I9PA 1NOKA 4GZ3A 2R8BA 4MX8A 3FCXA 3HCAA 3ZH9B 3SEAA 2PMKA 1M2VB 1ZQUA 4QIHA 1SV0C 3AR4A 1PNVA 1ZU4A 3BFKA 4Q37A 2N42A 4LXUA 2KVSA 3BJEA 2QJRA 4N82A 3PX2A 2QGZA 3LWZA 1U1EA 4ZVMA 4FGKA 2OGSA 4RPHA 3L6UA 2JGDB 5KOJB 4A2PA 4L07A 4TKUB 2O7VA 1UFOA 5F3RA 2F8TA 2HIHA 3A2NA 1MO5A 2I7XA 4HH3C 1H6DA 1Q5PA 5AOVA 4I4TA 2OFFA 1XXLA 3ER6A 2C2ZA 3ZD7A 5KHAA 3WP0A 4QDUA 4UFNA 4PHPA 2OEHA 4C20A 4D97A 4R8UB 3EXAA 2VUHB 5IAEA 4G81A 2FXVA 2QLBA 4MEXA 2NSLA 4Z49A 1JJFA 4G4SO 5DWQA 5KYTA 1X1RA 3ZBPA 2WFMA 2QXUA 1Z9BA 3USCS 4FN4A 4ZVQA 4PPGA 4RSMA 2F17A 4JI6B 1KSFX 3NYRA 1K3TA 1KRPA 3QSGA 1PI3A 5BSEA 2GRJA 3VPDA 1CZOA 5BW8A 3QHPA 2VSYA 4IIJB 4HDKA 2V7QD 2BL4A 1N3BA 1KJIA 5CLHA 3DJYA 5KTOA 3NGLA 4NYJQ 3A0HU 2QY6A 4YUYA 3MWDA 5IXSA 3AJRA 3PR3A 2PKWA 3ITKA 2Q3JA 1PZXA 5CLLA 1XEWY 2O8FB 1OZFA 4X5VA 4KR6A 4CG1A 4EO4A 1E66A 4R5HA 4Q9NA 4LRSB 4F5PA 5C1OA 1NNI1 4C4XA 2A1AA 3RIXA 2OLKA 1XCMA 5C81A 2PO5A 4I2JA 2BBOA 3EXFB 2W9BA 1IWBB 4P34A 3IQHX 1GAJA 3WGLA 1E69A 1RXIA 3D8UA 2OR3A 3RHTA 4GXKA 4PVCA 4KMOA 1GFZA 4P4LA 1WSBA 2RONA 1LKZA 1UWLA 1X7DA 1YK0A 3UFBA 2KJ8A 4QJFB 2LDBA 1MAUA 2Q0XA 4NATA 4DL9A 3LBFA 1TCAA 4U9UA 3ZVRA 1TPZA 4M46A 1MN8A 1SRRA 4AP5A 5KQMA 3QPCA 2ZRKA 3PSIA 3CB4A 1LC0A 2CDCA 3G82C 1FP7A 1KQNA 2MMGA 4TV8B 4DYHA 5F3XB 2JLCA 1IZYA 3V6JA 4RK1A 4A91A 2BMAA 2WA1A 4G0OA 1E2FA 4RD4A 4GX5A 4OJNA 1V1MA 4HT3B 5K05A 4NNPA 3DW1X 3HQ4O 5AUPB 4UB6U 1VJ0A 2HWXA 2QUKA 1D1PA 3ZR4B 2WHRA 3OFVA 1FYDA 1AGNA 1PV4A 2YINC 1G8MA 3TIGA 3JZAA 2QDKA 9GPBA 4UTPA 1B00A 3GRVA 5HMLA 1N8TA 4XSHA 4XIIA 2ZYHA 2CLFB 5DBOA 2PU5A 3JQ6A 3QELA 4ZHQB 3RC9A 1DOZA 2HPZA 4MQ5A 4S12A 3AKCA 4EG6A 2ZIVB 3BZKA 5J2GA 2VHJA 2PX3A 1CY0A 5LQAA 2AG6A 4D0LB 3CCBA 4ZCQA 5KT5A 2H1FA 1U2TA 4ZQFA 3T7DA 2OV2A 1JDJA 4L8FA 3FB1A 5TT1A 4OLHA 5G1OA 2CSXA 3VSBA 3PJDA 2R1UA 3SN6A 1JTEA 3NETA 3RG8A 1UKAA 1YZTA 4TUPA 1NNUA 4M9GA 2XMBA 1YDGA 3SS9X 1K4YA 2CNNA 3O5AA 2RARA 3K0FA 3IQDB 5IM4A 1EQ2A 1XTZA 3HMQA 1ETHA 2K4EA 4RCZA 1WJGA 4O3MA 2CHUA 1V1RB 1TIBA 1CJCA 2G9ZA 2XMDA 2GZHA 2A84A 2C8VA 5KTYA 4TQ9A 2Q3EA 3PFGA 2BC9A 3ZNQA 5GPBA 1UFVA 5EC8A 3W2EA 4NX2A 3W0LB 5CA0A 1E9VA 2OOSA 2I5HA 1M2KA 4F5YA 3WAKA 4KMUA 5AK0A 3GRPA 5J0WA 4RSRA 4WK6A 3OQOA 2F1OA 1G55A 5ALKA 3ET4A 1RAEA 1PWHA 1K8XB 1IHPA 1USVA 2OGTA 2VSQA 5GONA 1PNOA 3RFAA 3F7TA 4KBYA 2LW7A 3E7FA 2PZEA 1PDVA 4JNCA 5F64A 2DECA 2XUGA 1NI3A 4NDNE 1UPCA 4DIBA 4DQPA 2NV6A 3E7PA 1UPAA 3KOWA 4JD5A 1T9HA 3NP7A 3G23A 1LPNA 1ILWA 1RXEA 4N0EA 4Q8FA 1ZKMA 5DV9A 3GFRA 1VSBA 2Y1WA 4B6PA 3LU1A 2DAPA 4NOKA 2BFCB 2WKPA 4H7PA 3ZG6A 3AT1A 4OM8A 4F97A 2JIBA 1D6NA 1UXKA 6GPBA 3T7EA 2V7PA 3UGKA 3IV9A 3HXMA 1LXCA 3OF2A 2H1RA 3HO6A 2ZXFA 3NAGA 4JS0A 3HSKA 3D1LA 2C9ZA 1XWIA 4EX7A 2JNWA 4I55A 3C5GA 2MT9A 1O2DA 2GFQA 3CG4A 2PYDA 9ICKA 3A6LA 2DKZA 2FDRA 4BRSA 3LZCA 3ABQB 4KGDA 1EK6A 5J0QA 2CCJA 1T1IA 2ZPTX 5DK6A 3PGLA 4ZYLA 2WKWA 3PX4A 1JN3A 4MKGA 4M1QA 1FRFS 3ZD6A 1GPJA 2K8BB 1S8AA 4YN3A 1UM8A 3V4VB 1S97A 1T43A 2JI8A 1ZNXA 4D82A 3V4LA 2QVLA 2AOXA 4H1TA 2R5WA 2AZ4A 3LDGA 5TS2A 4Z7NB 2RRDA 9ICAA 1HRKA 1T0IA 3O8CA 2R6HA 2WMOB 4W9MC 3KB8A 2G09A 2UU9B 1T6YA 2JI4A 3D8SA 3R7BA 3AOEC 3ZCVA 2J9YB 1R8YA 4L76A 1SKQA 4ZU1X 3BHJA 3OTHA 2R96A 3AUXA 4HWRA 1M1YB 4BNLA 4UPVA 4EY7A 3D4BA 2IZ1A 5D84A 1T8EA 5SYMA 3WZ2A 1E96A 3ICXA 4O02B 3RYFA 2ZUVA 5K7SA 2WLTA 4OVKA 4CIAA 4QKQA 4FT4A 1H0RA 1EVJA 3ZCUA 1NFRA 2QJWA 3W04A 2JBAB 4R2HA 1XN1A 5EPOA 4EX6A 3IB6A 2Q9CA 3FOZA 1XIVA 3JQ8A 3KJGA 4XUCA 3WRXC 9ICGA 1S89A 1XMSA 2ZJ3A 1RWPA 4V0RA 4F8RA 3OLXA 3VMMA 2G07A 3CRXA 3PO5A 4Q9HA 2H3HA 1WPQA 1AMUA 4RA6A 4JWTA 2GEKA 5JISA 1Q92A 3AR8A 4Q3AA 4W5JA 3HS3A 5B55A 4PLFA 3ELWA 1T4CB 2GNAA 1ORHA 3M6VA 4XPZA 4JUFA 1RJ9B 1VMEA 1SPBS 3JU3A 1U47A 1TL7C 1ZK1A 1HQDA 1PEDA 2GJ9A 1KJJA 1GGNA 1C7YA 2XMGA 3SS7X 2QRMA 4TTSA 1GAXA 2BIFA 1YQTA 3CRQA 2EOAA 5JSYA 4M37A 3QBJA 2JH7A 5G0UA 1PUIA 5JFOA 4ZQBA 3ECSA 1L5OA 5T67A 5EWJA 2DOKA 4P3NA 1TUBA 5TJ9A 1I5EA 1PDOA 3ZX4A 3RANA 3IPXA 5EUBA 3DNMA 4ENWA 3GX1A 121PA 1EWQA 1RTKA 1GGVA 1Q83A 2Z1NA 4O1HA 4C5BA 4XGIA 5IKEA 5J2AA 1GIAA 4GQIA 4FGJA 3O84A 4QJ5A 1JSRA 3U4AA 3QPVA 1G0NA 4KQFA 2PSHA 1XLTC 1A7KA 1MO6A 4IQ4A 2YWHA 2E5SA 3OOHA 2AR9A 4H4EA 1TIKA 4YP9A 3PFNA 3AVVA 3SAFA 5A9SB 1C4KA 5L40A 3N0WA 1KEJA 1Z68A 3L46A 3WIEA 3AWDA 1GCGA 5IIIA 3L5OA 2N3ZA 3FGZA 1PR2A 2OHOA 3ER9A 1NJ8A 2WJPA 3ORYA 4TTTS 4U9IS 3PEFA 2XJ4A 4TWBA 3H86A 4JBIA 1ZQOA 2A5LA 2D7CA 4GDMA 2C03A 2FK8A 1ZLXA 3KFVA 3TBFA 2NRZA 3DMRA 4X20A 1UBOS 5KQGA 1NQVA 4J16A 2VYFA 3KT8A 2WKQA 4V0MA 4FFWA 3U4DA 4NZPA 1WVGA 2XGSA 3PXXA 3K70B 1RRCA 3H9UA 5HS4A 1CPYA 3BGDA 4M0DA 3RCBA 1HETA 5FWDA 1L5GB 2QD3A 2K60A 2C5HA 3PS9A 1U4NA 1KO7A 4XVRA 5IM5A 4DKXA 4HEHA 1RKUA 1XPOA 4BFVA 5AKGA 1YKGA 3THXB 4A8JC 1WCIB 1NVWQ 4JQYA 4PC1A 3WL3A 4DR6B 1TYZA 4F4HA 1ACMA 1E0DA 4JJZA 4D9JA 4I4TB 2O8DA 4IMRA 5ALRA 1HDRA 5JTIA 4YLGA 3HV0A 2HGSA 2J67A 1H3FA 2WBLC 2Y1EA 1VFNA 3HB7A 1PEKE 5DMXA 2QGNA 1XEFA 4QECA 3AERB 4Q66C 2R8HA 2PL5A 2XD9A 3WKCA 1ELOA 2IITA 1XZQA 4R8RA 1GL9B 1UQRA 2JBHA 3NORA 3SDZA 2BCSA 4BYGA 4B75A 2IYOA 5I51A 3R5JA 4P7GA 3USES 1JXAA 1O0BA 3SYKA 4LJ4A 6Q21A 4G0QA 1WKVA 2ZJYA 4XSVA 5GZ6A 5KFOA 4M6WB 3FD8A 5DGHA 1TO1E 3OLYA 2V65A 2CL6X 2DPMA 2PWYA 2V45A 4TQGA 1J8VA 4MUAA 5JH7A 4IGKA 3ET5A 1ULBA 1H2HA 3PEUA 1L5NA 2MYUA 5CURA 5CLIA 5J2TF 1VJGA 1K8YB 4UTOA 4M9UA 2W9BB 1YR6A 5JZMA 5C53B 4G97A 5B7NA 3O1JC 1ZQKA 4L85A 1P2GA 2V8BA 3WLOA 4KFCA 1YE8A 1YE5A 1GG9A 3BIWA 4NCKA 4K9KA 1OX4A 1E9DA 2A8YA 4S1NA 3VVBA 4CF6A 2IEYA 3L1IA 4X91A 1O9GA 5IBRA 1QTRA 3ND5A 4DV4B 2EIHA 1GQOA 3AVQA 3EYWA 4CW7A 5BSHA 4PONA 4AO7A 4BX3A 3E9RA 3KOXA 3BJMA 5FNVA 4GLLA 3GY0A 4O3QA 4EYIB 3CKMA 4Q5IA 1BE8A 1E3JA 3NATA 3ZY3A 3RTBA 3UMCA 2I03A 1QIFA 3GEIA 1E4EA 1H2BA 3TGPA 3OOWA 3ROTA 2I6XA 5MHTA 3MXOA 4JOSA 5A0VA 2VWHA 4F8JA 1LB1B 1V1MB 1N7HA 4LRQA 3GFVA 3L8EA 5H2FU 5KREA 1NJ2A 3LO5A 3FPBA 1PJRA 1FP6A 3MHTA 4UUPA 4ECRA 4ZO8A 1H69A 5EJFA 1S0MA 1HDXA 4MV4A 1O54A 5KNDH 5H5JA 3MMNA 3TANA 5AJZA 3KJNA 4NMWA 5FOVA 1S0VA 4QRHA 4NYMR 2OM2A 1UK9A 3ZTTA 4I1RA 4KWHA 2AK2A 1D2EA 3LMKA 2HHAA 5AWFC 1G21B 4IOLA 2C54A 2O3RA 4OHWA 3BRWD 4BCCA 3TVYA 2BM0A 4RFSA 4DG5A 1GR1A 1T2CA 4KNVA 5D5PA 1XAJA 2OV1A 4GMFA 3QLVC 3T7RA 5EE1A 1B26A 1AVTA 3HKDB 3D3WA 3DL4A 1GZ5A 2GLXA 3WLMA 2HVHA 3OH8A 3GFQA 1JFFB 2VN8A 3LBHA 4JLJA 5LA6F 2PGOA 1MSWD 3PUWA 4YT8A 2JFNA 2NT4A 3THVA 4PRLA 2YXEA 4J0JA 7REQA 3V1KA 1CUWA 4HZGA 4DFMA 4QFMA 1QH9A 1ZD9A 2Q41A 2HK8A 3QH4A 1WEHA 3RAEC 1YZFA 5FV4A 2DKNA 1PWEA 2IYXA 4C22A 2HOFA 3K72B 4G89A 1A1SA 3QHQA 4BLTA 1T3SA 5L6MB 4TS1A 3EIHA 3JQEA 1MA7A 3QQPA 2EFGA 2XVZA 1JAXA 2BF4A 1K5DA 2ZSUA 3HDHA 4KZKA 2WSYB 1LY1A 3GRKA 2Q29A 1SOAA 2YZKA 2GZ2A 4ASUD 4BEVA 3FTNA 2NN3C 4GLJA 1NU8A 3RS2A 4LDAA 2GR9A 4CEIA 4C0LA 5KPJA 5I9MA 3FXAA 3UXEA 4JLMA 5K51A 4PIMA 2DF8A 3WL4A 5JNRA 1U04A 3CEPB 3COYA 3P1JA 3T5AA 4H3SA 4ACOA 4AF6A 5CFMA 3LLVA 3MMPA 1A0OA 1PF7E 4F84A 5ALTA 3Q7SA 2XAUA 3T3NA 2CUNA 2ZRBA 1PQPA 3O8RA 4RDIA 4HX9A 2O0JA 3IGFA 2NSDA 1JDUA 2FNAA 1E1YA 2EWVA 1T0BA 5HF6A 2F44A 1Q21A 2VTBA 3AHJA 1RI3A 5FA6A 3Q8MA 4BRUA 3HG7A 2EIXA 5AMXA 1ZXXA 2X23A 1EJ6A 2VZLA 1RJEA 3K3PA 2QAGA 2LTAA 3BD7A 2V59A 4OJKA 3TJZA 3KIPA 1XNSA 3W9SA 2ZDQA 3RUEA 4FR0A 1ZD3A 3ZGZA 2DWCA 4BNVA 2AVDA 5D6OA 3SHWA 4KLTA 2SNIE 4ESVA 4E21A 2R8PA 1IZ7A 4M8NE 3UC9A 3DE7X 4DCCA 3C16C 3EF0A 2XT9A 5IW8A 3RROA 4DCTA 1KMQA 4BXOA 2VO1A 2I33A 1G6HA 3HFJA 3M8KA 5LQSA 1N7GA 2CLHB 4CWAA 2HU5A 4LGVA 4JXKA 4BN0A 1PFUA 2CWWA 4OQZA 4MUMA 3F67A 3P2KA 1X15A 1AZWA 1R16A 1UBNA 1EWYA 3OJEA 1KOJA 2D62A 3NEPX 2QJOA 3EEQA 2R85A 3RHSA 4QSHA 1QH0A 1YQGA 4D74A 1XR3A 2FVXA 1V11A 4LMBA 1JG4A 4OXXA 2FSVC 4YAEA 2HU2A 5E38A 5JZVA 3PXCX 4FNOA 5FYDA 1CRWG 3IVGA 5KL8B 3AETA 1OAKA 4OJYA 2VS1A 3I1FA 2AF3C 3NBUA 2NZYA 2XTNA 4NMLA 3IUJA 2DUMA 1NP7A 1K0FA 4PC3A 1YBVA 3N0XA 4LHYA 2RDJA 3G0HA 1GKLA 2R8XA 4KHPB 2OE2A 1DP4A 3OIYA 1RYFA 1JH8A 4XIYA 4OBWA 5EKSA 1AB5A 3HB4X 3L93A 5LQJA 1FNNA 4XJTA 5AVUA 1JYEA 4RQ5A 3LKBA 3BXPA 3ZI7A 1Z34A 2B6NA 1MMFB 2KIWA 1K7SN 1NPTO 1PS0A 3O2JA 1U0HC 3GLFE 1DQRA 3DMGA 4JKIA 3M6WA 2GKOA 1C3OA 1SM4A 1MAVA 1AO3A 3G5TA 3IALA 1RI5A 4YAWA 3IOYA 5AXBA 4WMLA 3SSAA 1XU7A 1QP8A 4KV7A 4YDRA 2H1CA 2KLBA 2FMSA 4LGYA 3OZTA 3CIOA 5REQB 1JWAB 3MBYA 5LYYA 4RZ3A 4MS1A 3CLRD 3MD0A 2A1TS 4QG3A 2D5AA 2JAQA 1EFTA 2YUIA 2I67A 1PQYA 1T8TA 4BN4A 2WM8A 4TURA 4B2LA 1USUA 1PVQA 4IRDA 1Y8RB 4G5QA 3RT9A 5ALPA 3PNLA 3D3JA 4D9HA 4G0YA 4DL6A 3M4NA 5LLDA 4ECQA 2XZDA 4UD2A 2WC1A 1XSNA 4WSOA 1PTKA 3OJ0A 1BXGA 1Z38A 1Z2EA 4Z3OA 1N8KA 1IM8A 2R7KA 4OOEA 4QDTA 5EJAA 3ZPXA 1W2GA 3D2QA 3ER8A 1PYOA 4CN8A 2FN3A 2A0FA 3P32A 3E84A 4CIVA 5KYXA 1I36A 2QUBA 1A98A 3K2BA 5CLFA 1IEWA 1RCUA 3OZIA 4O25A 1ZCBA 2QPOA 3D2AA 1YD7A 4OB7A 1U1DA 1XROA 3EDOA 2NZVG 2BKEA 3C29A 3OZVA 2HPHA 3KJXA 1K97A 2ODBA 4OQYA 4IGFA 3P9SA 1DEAA 2D5LA 3AG5A 4PX9A 1PGQA 5JBIA 2HF2A 4M1EA 2GXQA 1P33A 2BTOA 2QUJA 4PANA 4ELUA 3NS1A 5IKOA 4KC0A 1SVOA 2ISOA 4J3JA 1QFXA 2IOHA 3ESBA 4R9UC 3SYRA 3R9IA 1JIKA 3H2KA 2X9GA 1U0OC 7ICHA 1LW6E 1PV1A 2BFBB 3G59A 3NIBA 3OOSA 3NHRA 4W1PA 4XLTA 3G6KA 4OGFA 3RFXA 4ELTA 5FKJA 2AU0A 1V48A 1GL7A 3EGWA 4RF2A 2RBEA 1U63A 1GSHA 4NXZA 1XMXA 3UT0A 3STTA 3OHAA 3ZKWA 3W5HA 5JBQA 2YV3A 3D6HA 5I4IA 1AN9A 3FNRA 5D5HA 9ICCA 1Z19A 5LQCA 1W4BA 2C84A 4RV9A 3TCKA 1I4TD 4I08A 5BOVA 3HKCA 3CVVA 2I8LA 1HKUA 1Z56C 1IBMB 1O8BA 2IOYA 4MRNA 3BGOS 5G40A 5HCUA 3ZLVA 1PFQA 1YFZA 1V38A 3ZWWA 5K9ZA 1VE5A 5LQRA 1EM6A 4CCSA 3FOCA 5KDLA 2FQQA 3W9UA 2P41A 4ZT6A 2QMEA 3STUA 3TPFA 3HN6A 3TAUA 4BWGA 2WF8A 3NDIA 1SVUA 3R4CA 5JH7B 4B9TA 4QUGA 4WLOA 5BRAA 4MYDA 2IBKA 5IUNC 1QC5A 3LI2A 5F9FA 3QGMA 2EDCA 3C14C 1X94A 3WAJA 5EJ2A 3EZYA 7ICFA 1YQ9A 4KIJA 1F51E 3FAKA 4IIBA 7ICNA 4IJWA 3LQQA 1PKXA 3L0DA 4LRUA 4AJHA 4B17A 2HR1A 4J75A 1XTJA 2UZAA 3FDFA 4FWIB 1UDCA 4FOLA 4S1VA 6LDHA 4CFYA 3FVRA 2SECE 1ZQIA 1SZJG 1K7EB 4G23A 5JADA 1U2PA 1RM5A 2PUHA 3CNOA 1SUCA 2ZB2A 3HWX1 5C0OE 1QHYA 3JSXA 4G8CA 3SYZA 2XUKA 2C59A 1YVPA 3HDQA 3LHFA 3GRUA 3ZQ6A 5SZKB 3PC8A 4UUMA 3R3ZA 4A03A 1RJFA 3X2SA 3OU7A 3IYLW 1AM4D 4YREA 4KQXA 2FG5A 2JDIA 1T13A 2VCYA 1AO0A 3SJUA 5L1LA 3B0XA 2FV8A 1IAVA 2R47A 1QP4A 3FJYA 4D26A 2HWYA 4PYJA 3QG5A 3T7JA 3NEAA 7GPBA 4F3CA 4EVIA 1NQ5A 4KDEA 1N75A 1N25A 3VPGA 2EP7A 4EG7A 6AT1A 4LJLA 4D79A 3KM0A 2UYHA 2PU7A 4U9HS 3WGJA 1VHWA 3UUEA 4TV9B 2JG3A 4GX0A 2UYCA 4B3RB 4IHJF 1JU9A 2ODAA 1T1JA 5LQMA 1XRMA 3ZBUA 1GHTA 3CVXA 3FKQA 1F2TB 1U6IA 4BMVA 1MIOA 5EUCA 3W6NA 3JQ7A 3KBBA 1JHPA 3AIOA 4HGOA 1JL3A 5L1IA 3QU4A 1DV2A 3HUDA 5C4MA 1R5JA 4QYTA 1FVOA 1OBVA 3U3XA 3GLQA 3NBXX 1N3YA 5K0CA 3OJUA 3WMWA 5KIAA 5DHRA 4ZARA 4ZMSA 1SJ9A 4KVFA 1KSHA 1P45A 4EZ6A 1L4HA 4RFSB 1WUKS 5BSRA 3B6MA 4K6GA 1VHQA 2FRXA 1Y9AA 3GEBA 5KVCA 2NX2A 1SCUA 5KYYB 4HYTA 5DOVA 1EQUA 3UK7A 2L2QA 5KFRA 3D3WB 2HF7A 3LQYA 2Y66A 1GPAA 4WK2B 4IIHA 4JHXA 3DPIA 4AQ7A 3UCXA 3DMDA 3H5IA 3K9CA 4ZYUA 2FPSA 3ANNA 2CFIA 5FADA 4CMEA 5H4HA 4KWCA 3SIXA 4P53A 3G2JA 1PW5A 4MW7A 1FW6A 4PPQA 1QCZA 2PT9A 4KTQA 1A5SB 4N47A 3CF0A 3DLHA 2YASA 3STYA 2BI8A 5CG2A 1SU8A 4TTIA 5HKKA 4L9WA 4JV0A 4LWQA 2IS6A 3FLEA 1USWA 1V3TA 1BH2A 1C9DB 2C29D 1L7PA 4ENVA 3EUAA 1O9BA 1XFDA 4IYJA 3WMXA 4LXQA 4ER0A 1QRAA 2P9ZA 1QPZA 5AW2A 3WBFA 3VI3B 2QB0A 2HMTA 2DHRA 3UUWA 2FLVA 1JJVA 1C3EA 2PWAA 3KHGA 4MGZR 1FXWF 3H11B 8ICPA 3AHFA 4HP8A 1G8YA 2FE1A 3TWOA 2IYLD 2HHVA 1NBAA 1WU8A 3JD4A 1GCUA 2PS0A 2ZBRA 4YVZA 2VZ8A 3PF8A 4JAVC 5ICFA 3O4GA 2PMEA 3QNWA 2PKRA 2GSDA 3BL6A 4M88A 2PFPA 3KB1A 2D2VA 1QHIA 2I6SA 2JLUA 4KI7A 2Q3HA 4F91B 3K20A 2DYKA 4BLOA 3WTBA 5EIBD 1BMQA 3O03A 1Q1GA 3VV3A 2DQYA 3E22A 3E58A 5GV7A 4I3FA 5HFJA 2A5DA 1U3VA 4DSFA 5EXTA 3SQLA 2QAGB 3TFOA 5K4HA 1PD1A 4D8WA 1XJ0A 1UMDB 2ZB3A 3ETCA 4RIIA 1JMYA 2A0UA 2GN2A 1MD9A 4OAOA 2VXOA 1PX0A 1ZQCA 1SVMA 3CVUA 2DPJA 2W54A 2XKBA 2F8KA 1OLUB 2CLSA 5DHAA 1TM3E 4RENA 1ZZGA 1KH2A 1SKMA 5CFRA 2BD0A 1R4NA 1J4AA 3D2NA 1E7SA 2IPLA 5DM0A 5EXPA 4FFSA 2ATCA 1CBUA 2NV2B 5KHLB 3QX7A 3E5HA 4BXOB 5INTA 3A6DA 2P9CA 4HNVA 3BD8A 1X87A 1XOIA 1HSOA 9ICQA 2W7OA 1Y1LA 1TRKA 1KI8A 4PXSA 4QJ3A 3C4QA 4GOOD 1N34B 2WUVA 3U9LA 4K9SA 2VDOB 1XF9A 1JHMA 2P9QA 2GWHA 3Q8XB 4WESA 4EUEA 3L3BA 5TEWA 1LSSA 4N65A 1LSOA 5A3JA 2AL7A 2C4UA 4BRWA 2EH9A 5KFUA 4AI6A 4JKOA 4P0TA 3AETB 3KEMA 4YRZA 4HNAB 2XYGA 4OL9A 3H97A 3I8OA 1PQ4A 3DOEA 2V7BA 4K6KA 4UXIA 2GILA 2ZYIA 3L7YA 5D85A 1ZK4A 2VHUA 4TUYF 3N2EA 5AHXA 3B52X 5JCJA 2W7PA 3BSWA 1Q84A 3W5VA 4DM4A 3AY3A 5CDFE 4NCIA 2QPAA 1TQ8A 4RV5A 4C0WA 4KCGA 1EXVA 1C5KA 1DFGA 4DMRA 3LSTA 3OURA 2H17A 1PK1A 3BCUA 2NU8A 3GLGE 3K94A 3U44A 1XVLA 2IMWP 5ITWA 4PLTA 3I0ZA 4D4LA 4WAUA 3L8MA 3FPHA 1N5OX 4HBZA 1E2JA 1T2DA 1Y80A 3GAZA 1A5TA 2JA1A 2BONA 2R1TA 4GI2A 3IO3A 2TMGA 2DGZA 2BGUA 1ISRA 3ICEA 1J8QA 2NU6A 3UJNA 2J6SA 5IASA 4LI3X 4RNMA 3PR1A 1XRSB 3UJPA 4IIDA 5IC6A 1PVPA 4A26A 2BQ3A 1EHYA 1DAOA 3AB3A 4JWNA 3KHLA 2QTCA 3C3PA 4RWEA 4ABYA 2J3QA 3X44A 3D81A 3QBDA 5GJBA 5JALA 3JZFA 2YWXA 3R40A 3PIRA 2FLLA 1T34A 1HL3A 4JLVA 3NRZA 1QE0A 4ZREA 3A9UA 1B4DA 4PHTA 3JD1A 2H3ZA 3TIIA 4Z9AA 5LOVA 4IVNA 5A4IS 1BXGB 4DDMA 4QGGA 1PG5A 3UJDA 1OB2A 3G49A 2O19A 2HA2A 2R87A 4MKIA 5EI5A 3N28A 1XTRA 2HY7A 1QVVA 3LYUA 2HHSA 3NAMA 3P0HA 4Z54A 3ZW7A 3RV4A 3UPQA 1RC8A 4BE7B 3BWBA 2HJGA 4XOIA 5DTEA 4WNCA 2E0IA 4FEEA 5F73A 2ZT6A 1U98A 4YD1A 4TZ0A 1HWYA 1IM5A 1BPXA 3TUJC 1Z39A 4QZAA 1RWOA 2IQIA 4RNDB 3T41A 5HVNA 5F4BA 4JI4B 4HAXA 3HN7A 5IKMA 2CL0X 4BJ1A 4Y7CA 2B92A 4EUKA 1VKNA 4D9NA 3QU5A 2QW1A 2IYNA 3HY4A 5E9WA 4FYYA 3GL9A 3S70A 3K4GA 2VDNB 4C0BA 3OPXA 1X66A 1I4DD 4H6WA 5GV8A 5LBUA 3H8MA 3R5FA 4N49A 1Y48E 3FCOA 4JC0A 3RYHB 1JHQA 3C5HA 1ZK0A 5CGQB 1SXQA 1QZXA 4GPAA 5DGAA 3RIYA 1EJ2A 3OTGA 4F5EA 3NRWA 1AUVA 2IUTA 4US8A 1RHKA 3LUAA 1E1CB 4HGNA 1JYFA 3ZKWB 1IJKA 3ESCA 4Q02A 1EUCA 2RHJA 4XTRA 2A0YA 3QLUC 1X8LA 1LKYA 1A4IA 3NIGB 1ZD4A 1XQVA 4I4NA 4EAQA