2YMLA

Native l-haloacid dehalogenase from a rhodobacteraceae family bacterium
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
228
structure length
228
Chain Sequence
b'PSRSGILVFDVNETLLDLTSLSPLFERVFGDAKVLREWFPELILYSQTLTLTGLYRPFGEIAAAVFEMVAANHQAKVTPDDIAELKTRLTSMPAYPDVAPALTRLQDAGFRLVTLTNSAPSPAPSPLEKAGIASFFEAHLTVHSSQRFKPHPSVYDSTAETLGAKPEELCMIACHIWDTIGAQARGWRGGFVARPHNTPLTLAEVPQPDFIGRDMGELADQLIASLTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-HALOACID DEHALOGENASE
publication title Marine Rhodobacteraceae L-Haloacid Dehalogenase Contains a Novel His/Glu Dyad that Could Activate the Catalytic Water.
pubmed doi rcsb
source organism Rhodobacteraceae
molecule tags Hydrolase
total genus 87
structure length 228
sequence length 228
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2ymlA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2ymlA01
2AH5A 3W5DA 2WF6A 3MMZA 5AK3A 1Z4PX 1SU4A 2BDUA 5AK4A 4BKMA 2FPRA 2PQ0A 3ZUPA 2YFYA 4QQFA 1T9ZA 3ZVLA 4KX5A 4BBJA 2VKQA 2RARA 5AKJA 2G80A 4UM5A 5ALMA 1TJ3A 1ZJJA 2WF5A 2WF7A 4FFDA 2I54A 2G09A 2P69A 4G63A 3U7EB 3R9KA 2R8ZA 1Q91A 2WM8A 5ALLA 5ALOA 2HO4A 5ALFA 3KD3A 2MSNA 3SD7A 4C4RA 1WZCA 5AI9A 4O8CA 3DDHA 3AR5A 4IG4A 4YH1A 4BX0A 5JJBA 1TJ4A 2B1RA 1F5SA 3BA6A 4UMFA 3QGMA 5AW5A 1QQ5A 1L6RA 2NO4A 5ALTA 3WGUA 3OCVA 1O03A 5AVXA 3MC1A 5IT4A 5A3RA 1RMYA 1JUDA 2GMWA 3SF0A 1L8OA 1XPJA 4FYPA 2JARA 2R8XA 5IS2A 5AKZA 4I9FA 1Q92A 1T5SA 3AR2A 2HX1A 2FI1A 3OCYA 5AI8A 4KN8A 4Y2UA 4UMEA 3IRUA 5AVWA 5ALVA 1RKVA 1S2OA 3I1YA 4OCZA 1L7NA 3ONNA 3NANA 5AKHA 2RB5A 2GFHA 4UU1A 1AQ6A 1VFPA 1ZD3A 3QUTA 4HGNA 2I34A 4EX6A 3U7HB 2W11A 5AIAA 3A1EA 1RQLA 1LVHA 1YDFA 4AP9A 2BDEA 4NABA 4DWOA 1QQ7A 2HEGA 5AW4A 3PDWA 3MPOA 1ZD4A 1TJ5A 3KBBA 3AR8A 4CE6A 2HOQA 1FEZA 3SKYA 3W5CA 3OCWA 3VAYA 5AW7A 3N28A 2QLTA 2ZBGA 3E81A 4ZEXA 3W5AA 1IWOA 3MN1A 3F9RA 2YJ5A 1CR6A 1U7OA 5AVTA 4Y2PA 1MH9A 3AR4A 4HAIA 3RF6A 2I33A 2YMMA 2YJ3A 3R09A 3N8GA 4Y2VA 5ALJA 1RKQA 5T41A 1CQZA 5AKKA 5ALKA 4BX3A 4KNWA 2EATA 3SLRA 3QUBA 5AM2A 4KX3A 5AM1A 3OCZA 1L8LA 4CF5A 1YNSA 2AGVA 4CF4A 2C9MA 2JGAA 1U2TA 5ALXA 5AKXA 1RKUA 1SWVA 2R8YA 5AVRA 3J7TA 5ALDA 5IT0A 4HGRA 3ET5A 2DQSA 4C4SA 1Z4NA 2AUTA 2X4DA 5ALHA 3U19A 1Z88A 4BYGA 4UASA 3UMGA 4UATA 3BWVA 2W43A 3ZI4A 2G06A 1YMQA 3WKDA 5ALSA 1QH9A 2FPUA 1ZRNA 2FPXA 3AR6A 2G0AA 3AR9A 3QU5A 3B9BA 3UMBA 4C4TA 3L8GA 1Z4LA 1L7OA 1PW5A 5AM0A 3PGVA 3ZVMA 1ZS9A 4L57A 5A3QA 3KOOA 1NRWA 2B30A 3FPSA 4UAUA 2ZBFA 3ZU6A 3QU4A 2YMQA 2OM6A 3WKBA 2OBBA 3ZWKA 5AVVA 1NNLA 2C4NA 3FGOA 4OFZA 3QLEA 4XE5A 5AW1A 2W4MA 4OHFA 1ZD2P 3P96A 4DW8A 4JB3A 3GYGA 1N9KA 1EK1A 3D6JA 1TE2A 3A1DA 1J8DA 5AW6A 3E58A 3WKAA 4JDPA 3NALA 4E88A 2HCFA 5AM3A 1X42A 3FVVA 3IB6A 1Z5GA 3PGLA 4ZEVA 3WK8A 2CFRA 4Y2YA 5AW3A 2WFAA 2ZG6A 5AK5A 5AHXA 4GXTA 5ALGA 3OCXA 4G9BA 3I28A 1KYTA 1Z4KA 3OCUA 3ZWDA 3OTQA 3IJ5A 2FPSA 2IA5A 3W5BA 2JAWA 3ET4A 2G08A 3EF0A 2ZBDA 2C88A 4F72A 3L0CA 1WVIA 4NAVA 3L1VA 1Z5UA 5ALYA 2ZBEA 2WF8A 2HDOA 3ZVNA 2ODAA 5AKLA 4BNDB 3A1CA 5AKYA 3E84A 3L0BA 4DCCA 5ALZA 2I55A 3NAMA 1ZOLA 4YCMA 4UU0A 4MWOA 1SWWA 4EZEA 4Y3UA 5AICA 1RMQA 5AIBA 3QX7A 5AI5A 2B82A 4BNDA 2WF9A 4PNHA 2JAOA 3L0YA 5ALRA 3K1ZA 2IOFK 4RESA 4B6JA 2R8EA 4J2TA 1RLMA 2I7DA 3L8HA 2FPWA 3DNPA 3WK6A 1L7PA 4YIHA 3DV9A 5AESA 1U02A 2JAUA 2O2XA 4FE3A 2AMYA 2CFTA 3QNMA 2O9JA 3HYCA 2PR7A 4XPZA 3UM9A 4XOUA 1Z4MA 2HI0A 4EX7A 3WGVA 4MUMA 4BEVA 4NFLA 4BX2A 3WKEA 4OD0A 3NIWA 3WK5A 4F71A 3CZ4A 5ALUA 4Y2SA 2PKEA 2RBKA 4XQ0A 5AW0A 3U7GA 2GO7A 5AI0A 5ALQA 2YY6A 3S6JA 1TA0A 3AR7A 3OPXA 4J03A 2EAUA 2P9JA 3L1UA 4UMDA 2FEAA 3WK4A 3QYPA 3U26A 1LTQA 3WKCA 5AW8A 1U7PA 4QJBA 4Y2RA 5AKGA 2MU1A 4EEKA 3E8MA 5AVYA 2BY4A 1VJRA 3UMCA 1RPZA 1YS9A 2WHEA 5AM4A 4I9GA 2B8EA 1YJ5A 2QYHA 3N07A 2CN1A 4UM7A 1RLOA 1Z4OA 3ZTWA 1ZRMA 1RMTA 2B8JA 2YMPA 3M9LA 1WPGA 1EK2A 3QU2A 3L8EA 4AS2A 4H1WA 4HGQA 1XVIA 2FUEA 2I6XA 1L7MA 4YCLA 2HF2A 2G1AA 4YGYA 4Y2XA 1XP5A 3B9RA 4GIBA 3I6BA 3EWIA 5AW9A 4HGOA 2HHLA 4Y2TA 1NF2A 1N8NA 2ZXEA 3QU7A 1RQNA 3QUCA 4YCNA 1QYIA 3ZX4A 4AS3A 1U2SA 3R4CA 1WR8A 4BEWA 4NWIA 4ZEWA 2IOFA 3N1UA 2ZOSA 5ALWA 3NRJA 1RRCA 2FUCA 4RETA 2Q4RA 5AVUA 4UMVA 2YMLA 4EENA 2EARA 3ZTYA 4KNVA 3A3YA 4DFDA 5ALPA 3I76A 3N5KA 2RAVA 2NYVA 1J97A 4EELA 3EF1A 2B1QA 2NO5A 3CNHA 5AK6A 3ESRA 4HGPA 3DAOA 1VJ5A 3QUQA 5AKIA 5AKEA 3TLMA 3L8FA 2B0CA 1RC8A 5ALNA 3FM9A 5AI6A 5ALEA 2YJ6A 3AR3A 4NV0A 2IYEA 2HSZA 2YN4A 2G07A 2Q4TA 3KDPA 1Z4JA 2GHTA 2CFSA 3ZX5A 2YBDA 3U13A 2GHQA 3L5KA 2IOHA 1QQ6A 3WK9A 5A3SA 4Y2JA 4UARA 1RDFA 3ZW7A 5AVSA 4CF3A 1T5TA 3EPRA 5AW2A 1O08A 1K1EA 3NASA 5E0OA 2FDRA 3L7YA 1RLTA 5AVZA 5AI4A 3RFUA 3SKXA 4KYTA 3FZQA 2MU2A 3HLTA 3ESQA 3M1YA 4YIKA 3QU9A 5AM5A 4IFTA 4HYTA 3U7FB 2P27A 4L6CA 1YV9A 4UW9A 2YJ4A 4Y2QA 2C8LA 1S8OA 5AVQA 5ALIA 3FPBA 3KZXA 2OYCA 5FP0A 3ED5A 3SHQA 1ZD5A 2Q5EA 3SMVA 3KC2A 2HF7A 3QXGA 2OA0A 2P11A 4CNQA 3B8EA 4L6AA 3WK7A 1Z4IA 3PCTA 2D2VA 3NUQA 1Z4QA 1Y8AA 2C8KA 4UAVA
chains in the Genus database with same CATH superfamily
3HKEA 4LN1A 5K0SA 5GINE 2P6PA 4ECVA 5D7NA 3TKYA 3K32A 1TT5A 2I8AA 5BNFA 4C22A 1ABFA 3I5UA 4ZDWA 2R8JA 3U9SA 3IDAA 3D5EA 3DE4X 4J6EA 4HRXA 1YDEA 1ICIA 1SHJA 4LGCA 3LGSA 1QRTA 1FFHA 1J0AA 4DLWA 1OIXA 3WRYA 3RR2A 4WCFA 4G5SA 2EKZA 2ZBRA 2WABA 5AKZA 1I2BA 2LM4A 2P2SA 5ALVA 2PUFA 1R7RA 1PVDA 3IUJA 1XO1A 3HJGA 4FFVA 1JYSA 1VB5A 3B12A 3IAEA 2F8SA 4NY1A 3PGKA 1HT0A 5FOWA 2I1WA 1N5LA 4GSKA 4EFNA 2O2IA 4C0SA 3GPLA 4A16A 4IEFB 2J5BA 3O03A 4F6RB 3EDCA 3IALA 1FDRA 1VHJA 1I0ZA 4LJYA 2BONA 4P31A 4PIMA 1ZNQO 3CG4A 3CRQA 3I92A 5GGXA 4HCJA 4L0CA 4Q4JB 4LDPA 1X92A 2ZTLA 5J2TA 1YTLA 1VFNA 1JJAA 3CF0A 2PXXA 2GNOA 4JFAA 3OOWA 1AQJA 1D6MA 5LXTF 3OWOA 4L16A 8ICXA 2ATCA 4CM4B 3D7MA 4O08A 1GY8A 3RROA 6PFKA 2VYQA 3WS7A 4CTJA 1NNLA 4FQ7A 5CB8A 2F55A 3M9WA 4C21A 3C2QA 5B55A 1KETA 1XLTA 2NV0A 3PXAA 2YCLA 3S44A 3BQ2A 2VH2A 3W7VA 2WKRA 5IDWA 4HB3A 4MDFA 4TS4A 4REMA 1CDEA 2B20A 4ECZA 3ZVNA 1JQEA 4M3NA 1ZI8A 5EUCA 1S01A 4BCDA 4OJNA 4QZIA 2CNBA 3TD2A 1EVZA 4DV4B 3N75A 4BVGA 3RAJA 4E4TA 4ECXA 3BHMA 4MINA 3EF3A 4WBNF 1C30A 2ZR0A 4HH4A 1PFUA 3ISDA 2CMKA 2APJA 2XF8A 4KBYA 3V7JA 2QQGA 4X65B 4WNYA 2XHZA 4U9UA 3WMFA 3S1AB 2CXOA 1R37A 1OZGA 1F0YA 3CM0A 3DEAA 4CMGA 3H5TA 1W4RA 4DAEA 2JAHA 2WAYA 3PX0A 4BN5A 1GFZA 3IESA 4Z6KA 2QRZA 2Z0MA 1FNDA 4AZTA 4O5EA 1NG1A 3GLIE 4JVNA 2W9XA 1U9YA 3EGXB 1SULA 1UODA 4NLBA 1E58A 3GYBA 3QXSA 1Z0KA 4G2NA 1WBJB 4JIGA 2OB1A 4BRSA 1P4AA 1BVSA 3ZHVA 3LQYA 1K6EA 4D5EA 1IV8A 5IF9A 2W04A 2G6TA 3S2FA 1HPLA 3FOFC 1NJWA 1X0VA 3ID6C 4WADA 1A8PA 4Y2XA 1P72A 2GTIA 1K4KA 5L7WA 2FF5A 3CVXA 2WFLA 4KE9A 3VR0A 3CV3A 1V25A 5EIHA 4LDZA 1ZK3A 4INAA 4HUQA 3K4HA 4Y1EA 1N8KA 4RETA 1C1YA 2PZLA 4G3XA 5FWNA 4KNVA 4MWZA 1YT5A 4WCFC 2A9RA 3JALA 2V1UA 1GYQA 4OQLA 3P5BA 5MGNA 4B9LA 3EEYA 4X8HA 5KT2A 2ZRFA 2H54A 2P4HX 4FBGA 1I6WA 2ZE5A 1PG2A 5JECA 2LM1A 4KN4A 3CNLA 3I12A 3OX3A 4ZZ3A 5KCMA 4GEGA 3E48A 1NXOA 3P2YA 4DJEC 3C5WP 4D3YA 4AY4A 2ZZKA 3V1UA 2CNLA 1TU4A 3DKIA 3LGXA 4RCVA 3UV7A 4R81A 1LK7A 4MK4A 2HM7A 4IDQA 4Z9YA 2F3SA 2WAOA 4GBMA 5AYVA 2C57A 5FULA 3H2HA 1G21A 3Q6NA 1OZ0A 2IYUA 2QPTA 3MMZA 5CRXA 3LDUA 4M9XA 2H11A 3F6BX 2RHCA 4RVCA 4Q7MB 2WD9A 7ICKA 5JNRA 4XB6B 1ND6A 2GH1A 4H31A 3Q6MA 3IEXA 1UMCB 3NVKI 4HLQB 1XLTC 1NZFA 1D2AA 1N78A 2AEEA 1M1YE 3UMMA 3Q8SB 4AQYB 1E2FA 4ERNA 5DT2A 5BW4A 2OXIA 1J1ZA 1N6HA 2NSYA 3EASA 4AN4A 4QSMA 2XUPA 1EE9A 4LG1A 2YOFA 3EIXA 5CYOA 3MJCA 3Q3GE 2REQA 2XE6A 4C80A 3CRRA 1EA5A 1AO0A 2QNBA 4CDGA 4OSEA 1YL5A 3GZNB 1QIDA 3WGNA 3IX7A 5CH5A 3MGVA 3PKIA 1HRKA 4BZPA 2CLKB 2KKVA 1FU8A 1HZZA 1AZSC 2A94A 5GQSA 3D6NB 1UEJA 2HR1A 4ZO6A 4UVDA 1J2TA 5FI1B 4PLVA 3TS1A 3OCCA 1LSOA 4N1AA 1AXRA 1N3YA 5B53A 2P75A 3IVAA 5G0UA 4R1PA 1ODSA 3THVA 9ICXA 1G59A 4BQNA 2VJDA 4TLCA 5CMLA 3KYBA 4PR3A 2WJJA 4DEZA 3NJRA 2XOKD 2KYRA 3MAJA 4ZDIA 2CD9A 3CN9A 5KQGA 1A27A 2XMQA 3WKBA 5T8KA 4YJ2F 1ZJZA 2JGMA 4AT1A 4JB3A 1T9GR 2HHJA 3TE6A 1DQZA 5DWVA 4FX2A 4BV9A 2GRJA 3WKAA 1IEQA 4GX5A 3COYA 1RYEA 4C1NA 4P7FA 3H75A 121PA 1ABEA 4HK4A 5AK5A 2F1HA 4NR0A 3Q2OA 2YY5A 4TLMB 1AF7A 3N0RA 1ILWA 4TPKA 1JDSA 4P0PA 1LQTA 1DX6A 2PWAA 3AEQA 3PXCX 1PK1B 1O94A 3GVHA 1ATIA 4G23A 2M9NA 4M7RA 4UVHA 2I03A 4KQ6A 3OEHA 1XSEA 2I3GA 1W2WB 5IFLA 1QXSA 2GF0A 2JPDA 3O0TA 1QK3A 1DC6A 4L3VA 3UA3A 1RVV1 3RANA 1WNTA 5ITSA 3QLVA 1N2JA 2HU8A 2P9TA 2EZYA 3I01A 3IEUA 4YJGB 2G7MC 1TCBA 2IYFA 3AF2A 1Q74A 1NBHA 3THRA 2XVYA 3PA8A 4JV1A 1EFAA 3WL6A 1O5TA 1X8JA 5E4FA 2XOEA 2XDYA 1OXBB 1N3BA 4FONA 3RQIA 5IBRA 4C0LA 1G5HA 3U26A 3IHQB 5FXMA 2KE7A 5A0TA 4X24A 2WHEA 4MPDA 1G8JA 2ZRMA 4GR9A 1QU3A 2C29D 4IO0A 1BYIA 3H8SA 1SEPA 3PQ8A 3AH8A 3B1XA 2WKQA 3BTUA 3RKUA 3BMCB 2ZWMA 2CXQA 4KQEA 4TV9B 4RPLA 3KO8A 5DLQC 2HBJA 5DK4A 2K8BB 1SVIA 3PWTA 1CZUA 2VA3A 1UKAA 5EIBD 2IYXA 3E0QA 3N7TA 1HE4A 4DSZA 5H3CA 4Q1BA 5IC5A 4UVEA 2PRKA 3QEMA 1Z4JA 5DYYA 2IRWA 3DBOB 5F1PA 2JKVA 3CRZA 1WZEA 1V85A 1SUWA 1K1EA 1SIOA 1U11A 1QOPB 2F3PA 2WMDA 1GD1O 3PFWO 2Z6AA 4HQKA 4DSUA 1U2GA 4RQ3A 621PA 3AV3A 3LNTA 4Q21A 2GN0A 2PYIA 3ABIA 2J4CA 1YV9A 1N7JA 3GLFE 1TCCA 3B7GA 3ZWXA 2VUTA 2F1JA 2ZFUA 3VZQA 4E7OA 2GN4A 4RS4A 2J3IA 3FGNA 4U6SA 2FZGA 4XFKA 1EP1B 4L02A 1W0KA 3ASUA 4X8MA 3RNOA 1HYHA 2HLDA 3K9QO 1L5FA 2GESA 4XDGA 1UK9A 4IDBA 4ZYLA 2WU0A 1MA3A 1Y5LA 1PUZA 3FDXA 3BXXA 4ZTZB 4TMZA 5DULA 3VNQA 2GBLA 4JP8A 4NZYA 4YWHA 4OPMA 3AFGA 3DV0B 3DTYA 4XVQA 5LKRA 3BXOA 3IOYA 3S8EA 3JVUA 3OJCA 3K9BA 3DFMA 4AG3A 1T15A 3WI7A 3E9NA 4UU1A 1TM5E 2XDQB 4LYYA 4O1MA 2NRWA 1O94C 3LLCA 1JHYA 4NCXA 3OLCX 2P5UA 4QNRA 5IHPA 3D6FA 3NBFA 1KY4A 3O7WA 3N7AA 3STYA 3ZWCA 2XNJA 3QLVC 1RKQA 2IYOA 3U39A 3T1NA 1H0SA 2VJLA 5C4GB 1HX7A 1W96A 4RKYA 4G36A 5LC1A 2Q5CA 3IG8A 4HQ0A 4Y1FA 5F3WB 3UMGA 2NPOA 3RBAA 3BWVA 4I6JA 4LCJA 5EJ9A 1ZBDA 2J6TA 2YC4C 1O97C 3LQ2A 1L7OA 3LFTA 1PW5A 3BMNB 3DE7X 4B75A 2REXB 1EX9A 4J0JA 1KXJA 4U7HA 1ST3A 4JBIA 1X2EA 2WJVA 3VV3A 4B6EA 1EP2B 4JMUA 4CKZA 5CHGA 3V8VA 4JYZA 5B4VA 1AK2A 1WHTA 3EMVA 3QI7A 1R8SA 4CUKA 1G20E 1JKMA 4HNAB 1YACA 3TIFA 3HB0A 2Z1MA 3UPQA 2VH1A 1Z15A 1JDVA 4M99A 1EXWA 1Y6ZA 4A26A 1KARA 1WXHA 1SUEA 4DRXA 2OGZA 4JQOA 1MUUA 1G17A 5IHXA 5EFZA 2H7XA 3EZGA 1MQ8B 3KHHA 4MGYR 2C9OA 1AV6A 1MFPA 4IVPA 4RYDA 1WMDA 5G0SA 4YP1A 1R6BX 3QWIA 3TANA 3WGYA 1CXZA 3REFA 2ANBA 3ORQA 2XNHA 3HXKA 1IY2A 1KH1A 3V8RA 5IABA 1QYRA 1U2GC 2VDKB 2QQEA 3ZDDA 2H16A 2GO7A 5AI0A 1BDBA 1DLJA 1E69A 4Q1FA 5J2UF 4ZCIA 4M2LA 3A36A 1COKA 2YQZA 4HAZA 3GXBA 3B52X 5AW8A 3F71A 3T5DA 3ZE9A 5IH7A 4JC8A 1RP7A 2LR0A 2PL1A 2KJQA 2II6A 3MOIA 4GMXA 4Q3KA 2DGZA 2DPGA 3AOEA 2O5EA 2PT9A 1CE8B 4WZAA 3KOXA 3K5HA 4UULA 3MWLA 3QUCA 2R47A 4IGEA 4R5MA 1QYIA 1MVNA 1CB7A 5JG7A 4R41A 1DINA 3KHSA 2GBLC 2J67A 1HH4A 4Z4IA 5F77A 5GVRA 4YAJA 3SQXA 2ODGA 1BIFA 4HQRA 1ZISA 3GGCA 3PC4A 3SG0A 4B0PA 2Q2NA 3R3UA 4CLHA 5HR5A 4HKTA 3R41A 4CQMB 4RXMA 4BC1A 4PAGA 4DV3B 4UVIA 5KX5A 4GVXA 4EJMA 4N3BA 3UWMA 3LUGA 3U9LA 3ZWOA 4ME6A 1PLLA 5JCOC 3ZNOA 1DBPA 1QGUA 1PJ4A 1CZLA 4IHQA 1REQA 1ZIPA 2QROA 1EWKA 3MBOA 3WLLA 5HUQA 1TC2A 1I51A 1JU3A 3U1BA 1LDMA 1SUCA 5ALIA 5T64A 2Z08A 4CEHA 2R1TA 3WSTA 2DQ4A 3FLMA 1W36D 1FDUA 1BD4A 3KZMA 5FI5A 2GPWA 1SC1A 3TD6A 4PPNA 3HR7A 1N6LA 4QDKA 1L5WA 3UF0A 1QHEA 4P08A 5LNK1 4UHHA 1D8LA 2NUTB 4Z2AA 1G0OA 4EY4A 4K8OA 3ZCSA 1ZN2A 3JPWA 2R7KA 1XRQA 4HVCA 1VJCA 1JSLA 1SGWA 3V46A 1M2JA 3Q0TA 3VYRB 4QZEA 3C2LA 1XHEA 4OOEA 2EZ4A 3AEKB 4B32A 3GLHE 1N2XA 4MSUA 3TTYA 3VNAA 4IC9A 1O9BA 1AZTA 2IITA 4NMLA 4RNOA 1NKSA 1W88B 3LT5A 3HBJA 4MROA 1QRUA 1ZY2A 2PBRA 4X5VA 3AGPA 7ICMA 3E2EA 1IJBA 3GUCA 2ZIVA 2PWYA 1TVKA 7ICGA 1WMEA 2ZQYA 3TM4A 1SCBA 4J76A 4F5RA 1YWGO 1IRIA 2YHBA 3GUUA 5FBZA 4Q4DA 5BN5B 3BH6A 4X9XA 3ZTTA 4I14A 3RF6A 1QDUA 2K5UA 4OXNA 2XR1A 2PVCA 1LB1B 4X94A 3BERA 2IH4A 4MVXA 2VP4A 1U2TA 2Z4RA 3KSZO 3ETDA 4ND8B 4RTKA 7ICFA 1NXTA 4IS7A 4A82A 3RK4A 2GZMA 1FFVA 3IKMB 2RHGB 2CL0X 3QF7A 3F2DA 5FOQA 5JWHA 6REQB 1H0RA 1H9AA 3TI0A 3AKCA 4BAUA 4WV3A 4G5FA 2X0DA 2ALJA 4PCLA 4D43A 2C7PA 3M6FA 4ACAA 2FMIA 5KYKA 1NQTA 3O8DA 5LSAA 1LDBA 3AOEC 3MRTA 3VKHA 1MJNA 5DE3A 5IAJA 3WSVA 1T3QA 2R6ZA 2E4UA 1DXYA 4JR2A 4OHWA 1J1UA 3EX7C 2JIBA 1WVIA 3WSWA 3NHJA 5AKYA 5AVOA 2AZDA 2HWWA 5FADA 4EL0A 1DC7A 1XVUA 2E7ZA 1HDIA 2ZIZA 3INTA 3TZQA 3AY3A 1SRRA 3ZZUA 2HQRA 2VTEA 5T4BA 3WAKA 4PZ0A 5KNBA 1U02A 2JAUA 1KJ8A 3TB4A 4NFSA 3VPXA 5F7OA 3C74A 4MKFA 1DJPA 2XGJA 3HRHA 4OFBA 2D2XA 4TKVB 1RADA 3BKWA 5DHSA 2HW8A 3W2GA 3GQBA 2CVZA 1ZITA 2YVAA 4CN8A 8OHMA 4IXDA 4Q47A 5MDHA 2P9JA 1N5DA 5FX2A 4RMHA 5ELXA 1OWNA 2BEVA 3BRSA 5TPWB 4BMNA 3ZXUB 1K7XB 3CVJA 5DYGA 5CJ7A 3N6XA 4IUCS 2O0HA 2QYHA 4QRDA 2HQSA 3NPAA 3RIGA 4CFSA 4CMHA 5EINA 4R3NA 3DEHA 3AVVA 2VRCD 3ASZA 3N70A 4WZBE 1OWOA 1WO8A 2V7PA 2VJAA 4JCOA 3P9ZA 1K06A 1N33B 5DDIP 2B4AA 1O1YA 1GU7A 3SJUA 1YSCA 1J99A 2QVYX 2Q4RA 2A58A 4IMRA 2W71A 3A8TA 1NHWA 2J6BA 1J56A 1RZUA 1TYDE 1A04A 3O9ZA 5ICMA 2FLPA 4L4YA 2YUIA 1J06A 5TV2A 4M7OA 5AI6A 4O02B 4JBLA 3JWJA 1KVQA 2O0KA 1UDXA 3KEMA 4RHUA 2CFSA 3B8HA 3N9IA 3WGKA 1DPGA 4JLUA 2EAOA 1CZKA 5AVSA 1LU9A 2Q1SA 4PZLA 2FN4A 1H0HA 4NDAA 1TD1A 1XQXA 3OHPA 4RIHA 3ZCQA 2C42A 1L4HA 3WC4A 1TOAA 8ICKA 3QUSA 3GV7B 4U0JA 1D2RA 4U9IS 3EMDA 2XB8A 4F4UA 1BW9A 4HZUB 1FW8A 1NSTA 3ANYB 2JFBA 3K35A 3HUTA 4DSKA 2FDCA 2FPRA 3PNPA 1OI3A 5MFZA 2QSYA 5JCXA 1ZQYA 5IIIA 4E4RA 4BQPA 4OMFG 4JI7B 1PL7A 2UYGA 4TTAA 3EHDA 4PZ9A 1F14A 5KWEA 3R9XA 5IBCA 2FSUA 2P9ZA 3LKVA 3FNFA 2XCIA 2ETXA 1G3QA 1OC4A 3H6HA 3V4OA 1XEXA 2PSJA 3ANSA 3BCSA 3VPFA 4DQUA 2R6DA 3ZU3A 2QBYA 3LDAA 3C70A 4HH1A 3SK0A 2JARA 3W3ZB 2LCIA 5HQTA 4ITUA 4YI3A 2XKBA 3G2MA 5SV2A 2Y4OA 5C7OO 4M38A 2JKYA 5JE8A 2F6RA 2QR5A 1VKZA 5E7IA 2WSMA 3W5UA 3WADA 4MZDA 3JYQA 3U7HB 3T1YB 2IXTA 1XTJA 3AVOA 1KQQA 3IDSA 2AC7A 2NZWA 1IM8A 5FPYA 4HXGA 3LK6A 1WUYA 2EBWA 4QHYA 3PJGA 1V47A 2XRYA 1LUAA 2VK1A 1NAHA 2CK3A 3O47A 3N0VA 1L1RA 4ZAYA 4ZQGA 2FXVA 3EOZA 3N8GA 5TR9A 1XSLA 5EESA 1TUBA 1L8LA 4ZICA 1YBMA 1E99A 1XNSA 4DB2A 3F6CA 5LB4A 4K6FA 4L9SA 1T7PA 3LDGA 2H1HA 1KI8A 3QW2A 1KKMA 4LQLA 2AXTU 2Z9CA 3KSRA 5EE1A 4ECUA 3C3XA 3P27A 1SCJA 2UVPA 3I72A 2IP1A 2IUSA 4ZOCA 1UDWA 4QBHA 4ZZIA 5BRNA 3TX2A 2X15A 2NQ2C 3C8ZA 2V98A 4UCWA 4I5FA 1X9HA 4EZ6A 3GNSA 3OKCA 2H6EA 2P5YA 3F73A 3TSOA 4F2GA 3MYYA 1NBAA 1I4WA 5DU2A 2C1XA 1H1DA 3SJCA 1FQJA 1M2GA 1ACJA 2IXDA 2NUAB 4YRTA 4BLPA 5AKLA 2IUYA 3K2IA 2W3RA 2M6KA 1HORA 1MR3F 3H11B 1Z5PA 4PZAA 1XRMA 1JALA 1MV5A 1EFTA 3DNPA 1R16A 3QYAA 4BFXA 1FTQA 4G5OA 1ODIA 4L95C 3IQGX 2GBPA 2H1LA 4A2QA 2Q2QA 2O4UX 4ECRA 4DQIA 3RTCA 4M1ZA 3BHIA 2AMVA 4F11A 4RF3A 1NZBA 1SKAA 3RTVA 1YFZA 2F17A 4OJKA 3ANLA 3G2IA 4D8TA 1VPEA 4QOIA 2BBOA 3EGVA 1UUFA 3EPPA 4DIUA 4INPA 1FL9A 3HJTA 1U7PA 2J3DA 2H85A 1GAEO 2EV9A 3H5IA 4ELVA 3PX7A 5KG4A 1Y4AE 2MYTA 3N05A 5SZIA 2PI5A 1GTRA 4IJKA 3STUA 4P0TA 1VCNA 2IHUA 3ZIAD 2OC4A 3L0OA 2TMDA 4EB3A 2Y1FA 4XVRA 2XMZA 3VM6A 4LJ9A 4FB5A 1CUIA 5L3ZA 2RH4A 5E8RA 1I4LD 2AVNA 4JSTA 3RV3A 2I2WA 2VHTA 3ZJYA 4LK3A 3EFEA 1Z00A 1YA8A 3GRYA 2VJNA 1V41E 4DAOA 2I6GA 2B0CA 2RH9B 5JYEA 4Q3OA 4EPWA 4LE2A 2BYTA 3SDSA 4KOEC 5KFAA 1DL5A 5F78A 3BILA 3C21A 3GRRA 4PFQA 2OCEA 4L6IA 4A0RA 1NKTA 2GR9A 5LP6F 1J2JA 4HNTA 3F3MA 1YIOA 5DXAA 4DSOA 1EINA 2ISSD 3O2SB 3QVLA 2G4VA 4TUYB 1NBOA 2UUAB 1U99A 1IYZA 3GGSA 4JK1A 5BSEA 1KEEA 3TZ6A 4LQDA 1YDGA 4EG6A 3FCUB 1LKYA 2H63A 1UCVA 3WISA 4ZO8A 2DM6A 3DKRA 2WF6A 2XF2A 2BD0A 3A06A 5CYFA 2E3JA 1ZQ9A 3S2IA 1P74A 1QH8B 1NJ2A 3TQHA 1GXSB 4K03A 1FY2A 2PUGA 1QYCA 5KHLB 3OCJA 4MQBA 2FUKA 2GD6A 1M6EX 1E3WA 1Y9JA 3BIWA 1YQGA 3V1YA 4F5ZA 4IH4A 2YOHA 1KO1A 4LISA 2Z09A 3MJHA 2PJDA 4DS3A 2DG2A 4K7JA 3NTLA 1G7CA 3U6BA 3S2ZA 3NEPX 2OBMA 4OIMA 1A9TA 3BZCA 1DKRA 4E5KA 2HF9A 3L93A 3T0GA 3IO5A 1I9GA 2ZR8A 3NOXA 4Z7QB 1N1GA 3L92A 1PQYA 3PNLA 1VIVA 3FYUA 3UQYS 3N53A 3GMTA 5L1MA 3ZV3A 3ENZA 3ZVKA 3ZGOA 5F98A 4GM1A 2Z2XA 1HETA 3FCSB 3SQIA 1E0DA 3PQ7A 3HFSA 1UBEA 5FWXA 3EFHA 1N9GB 2PH1A 3QUBA 5ADHA 4HSGA 1SUBA 2C99A 1EJBA 1DEKA 4ZO4A 1IIRA 1EFPA 1BDHA 2F43A 2X8BA 2CDBA 2DUNA 4QVIA 4AFNA 2JFVA 1P8JA 5FJIA 4C7BA 4UUBA 4FGJA 3B36A 4DQQA 4QW9A 1KNXA 4EUFA 1BEEA 1JHXA 1X19A 1Y1RA 3EW7A 2SBTA 3OOHA 4WW0A 1I1NA 1H5QA 9ICQA 5BMVF 1LDYA 3HNOA 4N0PA 4ZQFA 4YR7A 3NTUA 4HEA1 4I1RA 1ZCZA 1AHIA 3L02A 2DVMA 1UK7A 2W90A 1VI6A 2ZCUA 3OCXA 1CY8A 3G2NA 5TT1A 2DT5A 1PL0A 2O8EA 1SZHA 3HBFA 4B2LA 4N7MA 4F9EA 4Q9HA 2QNIA 1H4QA 3KD2A 3ODGA 2C2YA 5K3AA 5M34A 1P1BA 1ZVMA 4JMPA 1ESNA 1E61A 2ZUTA 3K0FB 1NFRA 4DSEA 4IRDA 5IVIA 4O3FA 4BNDA 4QWWA 3UJNA 1JEQA 5KNBH 1W52X 5A6SB 2P78A 3F6YA 4DMGA 5LL6P 4O4LF 3NIBA 2H3HA 1CUHA 4RGYA 1FP2A 3KVRA 2FCRA 2HBRA 5KOHA 4WXMA 3A9UA 3SJZA 3HT3A 5LUBA 3HVUA 4X92A 2D0PB 1ECWA 4EA9A 2TMYA 2CGEA 4DEVA 5FFMA 4EA8A 4I9GA 1QG2A 4UBJA 4ZHQA 3WMXA 3HMQA 3WIBA 2FPOA 4HLCA 2QTMA 3NYWA 2M98A 1C3LA 1CS4C 2ZJ7A 5GONB 1YZ6A 1S9HA 3AX6A 4WDQA 3JAWB 2FDXA 1NF9A 1S3FA 3KYIB 2PLAA 3B0XA 3VH1A 1KI9A 3WQRA 5J1TB 5I7RA 5JQWA 1D8TA 2D1SA 1LI4A 5FHRA 3D7SA 4KIFA 1DGQA 3HDGA 4OXQA 3E5MA 3NM4A 4F04A 1WZIA 4EY7A 1X14A 4Z2YA 3RVSA 4GC7A 4IDHA 5IAAA 5ILOA 4H60A 2PXIA 3WLPA 3HB7A 3R7BA 3FYUC 4XWKA 1QIGA 4Q34A 4FYHA 5G0WA 1HV8A 3BT7A 3DP9A 4QT4A 4NIMA 1K6IA 1UJBA 1XZKA 2JLCA 3DUWA 4JIMA 3HXTA 4YUWA 3CLUD 2FLWA 3TAUA 1VXRA 1PJTA 1DLIA 1E1DA 3HY3A 4YVFA 1W59A 2GSDA 2DQZA 4WJZA 4TRNA 2ILVA 5HFNA 721PA 1KAMA 4GZLA 4FFOA 4KVFA 1NRXA 2XUKA 1TO6A 3H0RB 1RZVA 3K0BA 1E2GA 5KFZA 5BSKA 1XLWA 3CGWA 3E4CA 3FHJA 3QBTA 2Z98A 5CLIA 3BD6A 3D6AA 3U61B 4QDXA 2DWCA 4DUGD 1YQ9A 3K8QA 1C20A 3GFPA 3NBAA 4UMFA 4F4JA 4TTIA 1NJGA 1KK3A 4E12A 2NG1A 2PKQP 3AZQA 2P5SA 5D7BA 1IOWA 2CFCA 4UQPA 2XCUA 2NRVA 3PFCA 3VH3A 2GVNA 2WWWA 5EJAA 5E9AA 2GZSA 2HHCA 3K9CA 3FPGA 3WBBA 2EZZA 2PR2A 4GHWA 3AK4A 2XE8A 3S81A 5DB4A 1VE5A 9ICGA 4YS6A 4ZJPA 5ULLA 2CXYA 4CTOA 4UTPA 3RQSA 1MVOA 1YDFA 3A4YA 3ND7A 1V45E 1HFJA 5KHAA 3JYOA 2ATIA 3CTMA 1PNRA 2XWBF 1T43A 2V0CA 3AOGA 3DHEA 1Q17A 2OCKA 3TNFA 5HX7A 3QEJA 2MSWA 2YJ5A 2GHIA 4ZCMA 4NE7A 5H7XA 1OFUX 1KE2A 5ECDA 2NU9B 4OYLA 5AM2A 1GPMA 4HPWA 3LVVA 1QGAA 5BVHA 1Z6ZA 3PU6A 3MWFA 4BECA 4XWGA 2HMSA 3VR4A 4GT1A 3GQVA 1W25A 3A3KA 8ICZA 4X45A 2OOSA 1KDOA 5A7FA 4CDNA 1G3MA 3MWDA 2EAMA 1B23P 2EBHX 3BQNB 2FOLA 5D01A 2D0OB 2RHLA 3U0VA 1EMDA 2HMUA 5F51A 1MVLA 1HLFA 2ASEA 5DYTA 3KQYA 3BTOA 3V7FA 2FZWA 3QF4B 2AJDA 3SXJA 3V7LA 3TXYA 3AU8A 5DEOA 3DWGA 1I24A 2OXTA 3OJWA 3GCXA 3ESYA 2YYAA 1RKBA 2OZEA 4JDPA 3T5BA 1L4GA 3ONFA 4GPIB 3ZS8A 5CBPB 1NW7A 3EXG1 3VU9B 4PGGA 1K9VF 3N74A 3P9SA 4OLBA 1OA1A 3IJ5A 1EXMA 2FPIB 3GLUA 2WHQA 3PRJA 3MILA 5JO9A 4HBGA 4PFKA 3ZBUA 1GYPA 3HKDA 4F3CA 1E9EA 3VDNB 4OY3A 3V4VB 1RYZA 1V5GA 1XRPA 1WBDA 3NTRA 1B8NA 2XUFA 5EZ6B 2PO7A 4LYJA 5CPFA 4JY7A 5EWJA 3O8QA 3W8EA 3UM9A 2WMOB 1JG7A 4M8IA 2NQTA 1TQDA 4OATA 1CZNA 2VYND 4R54A 1ODJA 3D5TA 2NZUG 2ZIWA 4OXYA 4ZI5A 4HUTA 4WKNA 2FP4B 5AW0A 2QL6A 4M87A 4CKBA 2ZSEA 1AY0A 3UC9A 1U0RA 3I9OA 3L49A 1JG4A 4EKDA 4BUGA 4C05A 2ZLBA 1H42A 2ZJ1A 1ACLA 5AOCA 5FL3A 3TNJA 1YS9A 3DBVO 3RC1A 3I52A 4N0EA 3VI4B 2HBLA 1QONA 1RBMA 3X1DA 4WY2A 4LHVA 1A98A 2NU6B 1QUFA 5IXJA 1DV1A 3W2HA 4Y2TA 2R8OA 3W2IA 1UBOS 1JXQA 3ICPA 3O74A 1Q0PA 3GRPA 1NJ1A 3HPQA 1RRCA 5F35A 1XRLA 4JR1A 4MULA 5KFFA 4AZ3B 1UHUA 3DAOA 1NMYA 3SXPA 4DIBA 3GLTA 3SEIA 2AU0A 2C58A 3ZH2A 1K6MA 5E1MA 4BFWA 3LC0A 4W5WA 1L3IA 2FZ4A 4ZCSA 3VSEA 4IZIA 5IJ9B 1ZMXA 3KQVA 4V0LA 2CRXA 1JSZA 4JOBA 3PV8A 2WSIA 4Z4QA 4EDFA 3L8YA 4E0BA 2C5HA 4DL6A 2AJCA 1M1UA 1E60A 2JHCA 1MW8X 2QF7A 3SAFA 4NJEA 3FOAA 1ZCJA 3WYGA 4QUKA 3M5PA 4IQ4A 1I3MA 1L8AA 4HYYA 1N6PA 3E9CA 1JHAA 1R4NB 1Z4IA 5HK8A 4X93A 3WYEA 1BNPA 5AK4A 4XQ8A 3NDRA 4D5GA 2PEYA 3TUJC 1SVWA 2W5UA 1HTBA 3DHYA 2NW6A 4QG7A 2WF5A 2OEPA 2QRPA 1MMFB 3R9KA 1IUKA 4ZJYA 3OSPA 3SZ3A 4UQLA 1W93A 2CCGA 3PQ6A 5EZQA 2OBXA 1MXHA 5ALTA 3VX3A 4JBGA 1A97A 1THGA 1XQ6A 3DDSA 3TLZA 2EG5A 1N2IA 1RMYA 1OCEA 1AOXA 3FBGA 4LGYA 1Q1NA 2QT0A 2ZPTX 3LZDA 4ARUA 4Q9NA 3LYUA 1WU8A 1NULA 1W87A 4U63A 5LKAA 3I1YA 3EODA 3PX6A 5JFOA 1UADA 3ZOZA 5IW8A 4CL2A 1C1DB 2DFKB 2GBIA 3F1LA 4LZNA 2P3QA 4IY1A 2ID8A 2NSHA 1KBUA 4XTCS 4PG8A 2H3VA 4U5XA 2FW8A 1RM0A 2Q3EA 3IDFA 2ESEA 3NDIA 4TXMA 3DPIA 4PYLA 4LOHA 3R3WA 3H9BA 4AZWA 4DMUB 3IM1A 1QIKA 4RLHA 3MAAC 4AKHA 3KKQA 2NU7B 4TKUB 4W5OA 1COWD 2CB0A 3QVXA 2VHQA 4XD2A 4C4YA 3FNHA 2BKVA 2TMKA 2VRWA 3JR7A 4R2XA 1KYIA 4GLOA 2JIPA 5KFNA 4ZH4A 2I2FA 4A1FA 2I78A 2IW1A 2WAQF 4WNAA 3HKZF 5I7FA 4BLRA 4F50A 3CNQS 4R8RA 3EEQA 5CA0B 2PRIA 4EHNA 4YAWA 1TO2E 3MS4A 1U45A 1PUXA 4DIMA 2X1HA 3QV2A 2JEJA 3WRYC 1C3VA 4TXLA 4MF8A 3H99A 6AT1A 3W6OA 1JT2A 1KVSA 1LF5A 1NAIA 4EZEA 2OCYC 3KQTA 2RDIA 2LDBA 4OJQA 1G1MA 3IO3A 3VJKA 3STWA 4YIHA 3F8SA 3DV9A 1SUDA 1Z2OX 2DUMA 4NK4A 2W8BA 4RUKA 3H8WA 3G2KA 1SL0A 1FDSA 2NV2B 2HSEA 5CP8A 5HIKA 2VP9A 3DLAA 3KYCB 4OQNA 2V0NA 3D4IA 5F64A 2OC9A 2A2ZA 4WY5A 4JITA 1Y1SA 2X2OA 4GL4A 2I4IA 4JLWA 1QFJA 4PLFA 4WZBA 1ECCA 1ORHA 2OLJA 2XYVA 5TJHA 4QYXA 2AJ8A 1YJXA 5KFXA 5F21A 4N82A 4CEJA 1YHZA 2VJ4A 5KAIU 2XC9A 5AR1A 5GJVC 3IAHA 2WWFA 4KFCA 4ZT2A 4Q37A 5KYUA 4MB0A 5K8JB 3AXTA 4KMUA 5AVJA 1L4EA 3PFFA 1DBRA 1VI2A 3NFRA 1QP0A 3NVZA 3F9IA 2OGWA 3E2MA 1KPGA 3AI1A 3NHZA 3KFUF 4EO7A 2BH2A 3ZWVA 5KU1A 2QI9C 3QA9A 3IBCA 1QIEA 2JGJA 3H8MA 1JT9A 5B7QA 2BTQB 3O2QB 4R1QA 3RB3A 3DZCA 1RPLA 4OMCA 4BFVA 4AP6A 3ZEAA 3RJEA 4MVJF 2QZPA 3ZE6A 3ZQ4A 4EENA 3ZTYA 4BIIA 3JYNA 1SHKA 1G8AA 1FYWA 1MC1A 4QWBA 3R7FA 3R8XA 3PUKA 4E08A 1LV8A 1KI6A 5ALNA 3B38A 4DOCA 2Z8XA 3L0DA 1QE5A 3KIPA 1WSBA 1CQJA 3TZCA 3L6RA 2O7VA 2KP7A 4D7AA 1Z13A 4H1UA 3AUJB 3LXRA 5AW2A 1C8KA 4AG5A 3WDKA 2ZVPX 1AG9A 1ZINA 1CEZA 3TW0A 4AF6A 4Q82A 1SA0A 3OQJA 4UHCA 3D8BA 1RYMA 5JXWA 5DXJA 1Y6QA 3UK2A 2XVAA 1NBMD 2KLHA 3SZOA 1II8B 4WXYB 4MQFA 3BK1A 3RARA 3MFHA 2X7HA 3HR4A 4NY8A 2EYUA 1YUMA 5L3SA 3LVQE 5JS7A 4F4HA 3HBLA 1EGAA 4IPTA 1Q7CA 1GR1A 3GIMA 3KZIU 3CKLA 5KO2A 3K72B 1Z2NX 3THXA 2F8KA 2C0PA 5J4KA 3OKPA 4JL6A 4Y7CA 2XB2A 5A9RA 4B4WA 2TS1A 3GPIA 1U31A 1ZGJA 4PQGA 2J30A 2WE8A 1WIWA 3DXXA 4R4JA 4TWRA 3PY8A 4BFCA 3N7PD 1PG0A 4CR8A 3U44A 1H4TA 1FS5A 2FSPA 1DKNA 4M1WA 3X3HA 1SOMA 1UFVA 2UZ1B 3OIDA 4CM9D 4PHGA 3LLMA 2IBSA 1FS6A 1PTKA 2X19A 2J08A 4JUAA 2IELA 4C01A 5HIMA 4FD3A 1XF1A 2GTPA 5IYZB 2H4FA 1LLFA 5HK9A 2EFDB 3AMVA 4I2CA 5BR7A 1RWBA 4GPZA 3MCTA 2YN2A 2CL7X 1I7PA 4RE5A 4IINA 1DV2A 1F0MA 1WTCA 4UOQA 1S8NA 5LOVB 3JYPA 3ZQJA 3LQKA 1PR1A 4HZIA 3C5CA 4BJQA 4XEHA 2YXDA 5DWDA 4FK8A 3GI1A 2WSYB 4DXHA 4KPFC 1CP3A 4YQFA 3ZD6A 3HEBA 1JAYA 7REQA 2JFQA 2VHZA 3EXHB 3JQEA 4US8A 6Q21A 1P6UA 1KOGA 1WL8A 2NVBA 3GQCA 4U7TB 1JIHA 3B1KA 2CDAA 3GVIA 1C7YA 1JQ3A 4NJ8A 3MJSA 3ULKA 4ZTUB 2Y1IA 3HA5A 3V97A 1IATA 2QT1A 3OHSX 5M5BA 3F7TA 1Z8HA 3TCNA 4YMLA 3OOEA 1IUPA 4DDHA 2YW2A 3NT2A 1X80A 1EUYA 1VIYA 1DAFA 3QOYA 4L51A 4CV2A 1LI7A 2C9DA 3GEEA 3RU7A 3LXXA 3ETEA 1ZOSA 1IXKA 3DOUA 1X8KA 2BF4A 1L8XA 3DE0X 4HRVA 4DQPA 2H08A 3OFKA 4QBFA 3GRVA 2CNWA 5DOZA 4AY5A 4RSGA 1OFGA 5BQPA 2ERXA 2AMYA 1C4KA 2OCLA 2WKWA 2NXWA 4NE9A 3TJMA 1E98A 1G6KA 1UBMS 1MX9A 3TADA 1YJAA 2QSUA 4X20A 4QOFA 4D9KA 3JTEA 1HZZC 4GGOA 3K6RA 1SXHA 2MSLA 1LBQA 1ECGA 4E1VA 1JJBA 2VJOA 3MAGA 1P7YA 3NW9A 5LMZA 3K0AA 4BS9A 2GARA 5IKOA 4Q3CA 3M3HA 5C4IA 3MFQA 5EQDA 3OZSA 2YCBA 4Q9DA 4IGAA 3O4HA 1S1MA 5KAPA 5HZMA 4TMXA 3D7LA 1Z2DA 3AM9A 3FNBA 3ONEA 2A57A 5A9TA 1A8HA 2CDRA 4NAUA 2JGIA 2UVUA 4MVJP 2WHPA 3AWDA 4KTTE 3W3AD 2VJMA 3AF5A 2P2LA 5T8KC 4Q1CA 3MFIA 4PR0A 4FYJA 4IXNA 4O3SA 1MO3A 3Q85A 2WA1A 4MIYA 3A6EA 1G8SA 3EXIA 4LHXA 1II0A 4KTQA 2A9KA 2RFLA 1JR2A 3OQ1A 4P4GA 1Y89A 1NONA 3D6UA 2BBSA 4WCVA 2O2HA 4GLBA 1F8YA 3CYFA 4D82A 3M3PA 3Q88A 5FLKA 4O3MA 4WY8A 5ESXA 1YF3A 4JOCA 3KDPA 5IASA 4DF3A 3IEVA 4WN9A 2VYVD 1FYEA 4QYTA 3OEWA 3FN4A 3ITEA 5D46A 1AKYA 3T3MB 2AJTA 2HIGA 2WUFA 1RZRA 3O1IC 4WVLA 1WSAA 4ECAA 3QY9A 5IDVA 5I3CA 1FSGA 3IS3A 1SJ9A 5DYWA 1U4SA 2V65A 1TAQA 4DWIA 5FNVB 4UTNA 4Q4AB 4CFZA 2XA2A 1D8BA 1P33A 3SM9A 3ZXYA 1VDMA 3BF7A 3I6MA 1E4OA 1E79A 3TAHA 4EW1A 1P9OA 5BP7A 2PCJA 3RC3A 3TMKA 4B9MA 1XNGA 2ES6A 2GXUA 2JA2A 2VTVA 3BC1A 1MOSA 1KAGA 3CO5A 2C3UA 3QG1A 5G1NA 4KMRA 4EFLA 4QU0A 5JQGB 2JBHA 1IULA 1RSZA 4ISCA 1NF3A 3WLFA 3RTEA 1J2YA 4TTSA 3FD8A 1IM5A 5CA1F 3QKRB 1U0TA 2CZCA 4NBVA 3VGJA 1F4PA 4KXQA 1SXQA 4A8HA 1NOJA 3HXLA 2I6QA 3OFVA 4QULA 1NUSA 4USAA 4LC9A 4XGRA 5CEFA 4JXZA 4O2BA 3HP4A 5IINA 3RCBA 1JMYA 4EL5A 4ZP1A 3U48A 1UK6A 4ZWNA 1QP7A 1TMOA 1XKQA 1MG0A 1YOVB 4B3SB 1K7EB 2QVCA 4D9EA 2PMFA 1BWPA 2AG1A 4I4LA 3V8MA 4MCHA 3Q7TA 1OBVA 1EFRD 1HT1E 1JI3A 3N4MB 2Z2IA 4EM6A 1R9GA 1XTBA 3LHKA 1NK6A 4DJJA 3TADC 2IUFA 2ZJ2A 3EZ5A 1M6VA 3EH1A 2P0AA 4NU5A 3DT8A 2WNSA 5DI3B 2QB1A 5CK4A 1GRVA 1TK9A 2QX7A 4J29A 1UH5A 3H40A 4RK4A 4FOPA 2YXLA 3Q2KA 1Z45A 4WNCA 3U4QB 3LSTA 3HKCB 1Z2EA 5TZVA 1S2IA 2C4NA 3OLXA 1WMFA 2HHVA 5B1DA 4Z1OA 4BMOB 4N3NA 2WB2A 3FTQA 1W0JD 3AFIA 2MYUA 4K6CA 4YAFA 1NW4A 4ZIRA 2QD3A 5AM3A 1Y8ZA 3OAAA 3NHPA 1CQXA 3M5DA 5DP2A 2YC2C 2IWRA 1NOKA 1KYTA 4JHLA 3OIFA 4MUGA 2OEHA 2HPVA 4EOGA 3IBGA 3B20A 2Z43A 3HRDD 1I1OA 2JZCA 6GPBA 1XI2A 4KKXB 2P3SA 2ZBQA 1TEZA 4IH1A 3MSXA 4B6FA 3O8NA 1U2PA 4I4TB 2JLSA 1YVPA 3OPYI 4QO7A 4YCSA 5D3KA 5CVDA 2D1QA 2X0FA 3MTGA 4Q18A 1YR9A 4BMXA 2VANA 4Z8XA 5E9QA 1NNUA 4CL0A 1L5HB 4WBSA 3D8HA 3M6ZA 1O8BA 5EXTA 3PXUA 4OUDA 1Z0UA 1LPBB 2NOAA 3CLSC 1TVMA 1EEXB 3R7WB 1OV6A 2WD7B 4D0GA 5C8XA 1OH6A 2GO1A 3Q3JB 1DIAA 2YHIB 1SQ5A 2DQKA 4U7CA 1TIBA 5EHGA 1KZ9A 4HGQA 1XVIA 5I8WA 2XTNA 4JELA 2BUBA 1UJ4A 3QXCA 4AYWA 1JRPA 4X1IA 5FOVA 1WR8A 4GNRA 2W6IA 4AULA 2LPEA 1T5HX 2W6PA 5MN6A 5KG5A 1XXHE 4XIGS 4YAEA 1J00A 1K63A 2XLCA 3QPVA 2QRJA 5CB4F 1P44A 3PX2A 1NP7A 2WOOA 5K3SA 4LI0A 3IE1A 2ZWPA 1JEDA 2DWPA 4KO3S 2B1IA 1L6NA 5TQ2B 1MAUA 2QRVA 4JBWA 3FOZA 5PNTA 4MS4B 2F9FA 3VVBA 2FA9A 4MUKA 3DL7A 3MSCA 1WXIA 1GUZA 3EXG2 1L5VA 1W85B 5LZ2A 5AJYA 3RLFA 4QZCA 4FDMA 4OHRA 2HSGA 3SHQA 5AOVA 5DGCA 3T9CA 2Q5EA 2OZLA 4DG5A 3QLUA 2LDXA 3NT4A 4GMDA 3W05A 4WRRA 3AUYA 2XVMA 3O82A 3OPVA 4RZQA 4ER7A 3ZDQA 5EQJB 3JQ8A 1ONBA 3DSRA 2N1BA 1BNOA 4GOXA 1ELOA 5CWRA 3WAGA 3VFDA 2P69A 4AURA 3AV0B 1Z56C 1WXDA 1LJLA 3JVIA 5FWYA 4LA4A 4NYMQ 1T8YA 3LHSA 3LWMA 3C24A 3DDHA 5A62A 1DAEA 3OFJA 2OG1A 1XPRA 5SY9A 4DA6A 3FFBA 4HS4A 4F9TA 2DY1A 3ESZA 5DV9A 3AJ8A 1EHIA 1KJZA 4AZ0A 4PC3A 5CJPA 2YIJA 1FTYA 5IANA 1CY0A 1CUXA 2XNDA 1LI5A 2X0NA 1QMGA 3U09A 5JZBA 4KLIA 2BOVA 2LYBA 1L3SA 3E53A 3GVPA 5CFMA 1KFCB 5BWBA 1U1FA 2FQXA 4NBLA 4WKBA 4OLJA 3ZOKA 2ZJZA 1V5WA 2Y1OA 5EHXA 3JPPA 5HOQA 2PX8A 3W77A 1YB5A 1VOTA 2CHVA 2GCOB 3V8QA 1H8HA 5DNYB 1E18A 5FPHA 2OBYA 1L2TA 3VSBA 5K8TA 1T36B 1AA9A 3TG2A 3CNEA 4GLLA 4FCWA 4POOA 1JX4A 2NNWB 4ZCRA 1FXUA 1Y9AA 4YR0A 3G8BA 1DWPA 5GP1A 3ZVMA 2AFHB 3STVA 4M9ZA 4DV0B 4ED3A 3MGGA 2KKPA 1U8FO 4OJYA 5FKJA 4PSUA 4GYKA 2E4WA 3RRJA 1A7JA 1MO4A 1RYSA 3QG5A 4ZI7A 3UJDA 4QWAA 1HDRA 3I9NA 2RLTA 3GGDA 1SV4A 2EEPA 4NAVA 5D5QA 2C2RA 3HCRA 3NDJA 1KFKB 1SZCA 4WA8A 2EEZA 3AJAA 4FS1A 2BZFA 2QY6A 1LPNA 4ECQA 2LHTA 3BIOA 3UZUA 3F9CA 3RRYA 4BZXA 4LOKA 1QKJA 1I0IA 4HQOA 4C9BA 1SCUA 1WVGA 3DVSX 1M3SA 2VDWA 4KAXA 2XWSA 1AXEA 2A30A 1J7KA 1QH0A 4YJHB 3V6KA 5TGTA 4AX8A 2QN3A 1LCIA 1H4VB 2Q29A 3O4VA 1R8QA 1Z35A 3GPBA 4ALNA 2Q5QA 4W9RA 4E32A 5D3ZA 1C7RA 3QLUC 4UB3A 4U5QA 2OBNA 4BTVA 2PUAA 3PW7A 4YP6A 3A26A 3UJCA 1EM8A 4C7KA 1ZC4A 4FFPA 1Y1QA 3EQZA 2MSCB 1OB2A 4AJ4A 5EMKA 2JD1A 4KLMA 3A58B 4RVFA 2Q2OA 1DADA 2OWDA 4UOEA 2PJRA 4A6DA 5FPTA 1XRJA 1XP5A 1BPXA 4J7AA 4HDNA 1JXAA 1JROA 1FUUA 1HQCA 2AK2A 4MR7B 1J42A 3JQAB 3EPKA 2NNLD 2QTVB 3ZWQA 5KNIA 4RPIA 4P4SA 3MJTA 2GNPA 3KKKA 4ZRMA 3ENQA 2G5GX 4I46A 1NLZA 1CUWA 1RQ7A 4B8YA 4HMOA 1HNWB 3FM9A 4CGZA 1UT6A 3S55A 4UTVA 4HPXB 3TLAA 2ZT7A 2NVUB 2YBDA 2GHQA 4OJ6A 4TKMA 2OYSA 1RDFA 1GPWB 1E2HA 4RMIA 1XEWX 4IJ5A 1WETA 5TDHA 3A2KA 1DFGA 4B9UA 4LF6B 3O26A 1JDNA 9ICMA 3DG9A 2DPLA 2LBPA 1WBBA 5C5JA 4HX9A 4PHCA 4YDQA 3PW4A 2R87A 3OQNA 5E3HA 1GGNA 1T4CA 3KVOA 4GKJB 2EHDA 3R3JA 1LLUA 4IILA 5F2NA 3C3JA 4DWJA 3QXGA 3TVTA 1SXDA 2PBFA 2EFEB 3AB8A 4MVJG 1OVGA 3ECSA 5GV7A 4BKUA 1X9MA 4YP9A 3DOFA 2VSOA 3IAUA 2ILTA 1RJ9A 3A25A 2I71A 2JFYA 3IBTA 3DOJA 4GL2A 3ETCA 2QZZA 4WKGA 3O8OB 5DYNA 3IFSA 4F1JA 3GEIA 2WJIA 4QUIA 4AO7A 1B6RA 2BV3A 1DTWB 2PMZC 4KSCA 3JY6A 4ZAVA 3UGTA 2PMWB 3VOBA 3GLGB 3NHUA 4RZHA 2HB6A 1EGQA 3D1VA 4Q24A 3E35A 4Q66C 1RQRA 2EBFX 1Z7WA 2XGOA 4F6LA 4NCBA 1SOAA 2GK7A 3DXFA 4F5YA 3H86A 1Q22A 1QM5A 4ILEA 1PEAA 1X77A 3I64A 3C5EA 5F2OA 2QMUA 4J9LA 2VTDA 2H1SA 4EW2A 1K8QA 2ZGVA 3HKBA 3GLIA 4HJRA 2JLQA 3DEZA 3VHXB 4KLQA 4Y0NA 3TZHA 3N28A 2DQYA 1BMFA 3GDHA 2W2OA 3MLEA 4C8OA 4U3JA 9GPBA 3L4BA 4TT3A 2Q9UA 3WIOA 1AN9A 2E1FA 2BCJQ 2CHUA 1FYXA 5DGAA 4AUMA 3F4KA 4CQMD 1UKBA 2PRSA 1HI9A 4Q15A 1NRIA 3HJCA 5JNWA 2V6GA 1L3BA 4OMUA 4Q9JA 1M34E 4TKLA 3LH5A 3AW8A 2F1KA 3HCBA 1BROA 2GKSA 3NLLA 2AF3C 1Z33A 2ZJAA 1HNZB 2DR2A 1FO4A 3CZ5A 3K15A 3DZIA 3UG7A 4LUCA 3LC7O 3O1LA 1C9JA 1KR5A 7MDHA 1VMEA 2AA3A 5AW1A 3VR3A 2KWIA 4H9GA 1NXPA 1LS6A 1NJXA 4OU5A 4CM8A 3A9RA 4NAHA 4D57A 2WSSA 2XI9A 4EY6A 1GTL1 1GLVA 1GT91 2PJUA 3RSHA 3DNMA 2BISA 2JBAA 1ZJWA 4FZ5A 2P0YA 4XUDA 4HBZA 2FAXA 1ZM2A 4X7MA 3G89A 2DKXA 2NZ2A 4C6TB 3MJ4A 2R7NA 4C8KA 4L4ZA 3A14A 3RHFA 2D3WA 3ELWA 3KWFA 1WTAA 2GBCA 5TF4A 4L9WA 1EDBA 1JKXA 4BX2A 4ESOA 2F3UA 5L1JA 1XJCA 1XBTA 3GZJA 4W5QA 2P9CA 4Y6PA 3LS2A 3SLKA 4COKA 3K96A 4QATA 4AECA 2XUAA 3WHLA 4GBGA 5CH8A 5TX7A 4FEAA 1NC1A 4BMYA 4X1KA 4Z3DA 1FPQA 4LXQA 1ECPA 4DJFC 5I9NA 2NWQA 3ZKWB 5DNCA 4LF9B 1E9VA 1M1YA 4XSVA 4RXTA 1PFKA 5INTA 2G70A 4Z8YA 4DSFA 2QRQA 1NA5A 3G7NA 2NRTA 2W9CA 3IIEA 5J2DA 1VDVA 5JANA 4RKQA 1R0ZA 4V0NA 1D9FA 2A0YA 2ZEJA 3WICA 4UJ3A 5I9SA 3QX3A 4OX9B 3DZJA 3RUIA 4ZVNA 4X0EA 1QTMA 1F8FA 4BCCA 5BN4B 3HDQA 5KFTA 3FFXA 3GARA 1Z29A 5EI5A 3ZGXA 2GYVA 2N3ZA 2Z4TA 1RRMA 1AKRA 4CCYA 4RX1A 1KF0A 4C04A 2P4EA 3BBPA 3LPMA 2VDVE 2W9MA 4PQFA 3C7AA 5MN4A 2P35A 1GZ6A 3IP3A 3L4BC 3UJ7A 2TSYB 3OQVA 2XUQA 1V1RA 3ME5A 2PWPA 3MCZA 2D7CA 5AK3A 4EI8A 4KHPB 1U2QA 2UUCB 2I9GA 1BHO1 1WCV1 1MU0A 3CR3C 3KXKA 3PJFA 1S1CA 1CI4A 2Y9MB 3VYWA 4Q6WA 2E3TA 2H5EA 4YCDA 2JDIA 1L6RA 4UUAA 4P4PA 3RT7A 3ZU5A 2BE9A 1V9SA 2A19A 4U7DA 1CHDA 1ZJYA 1FTNA 2ZRNA 4RAQA 1PT8A 4V0SA 4MJ3A 2CLMB 2RHJA 4EIWA 3HUEA 2QQ5A 3M6KA 1R6XA 5CXUA 1P1JA 4GPEA 5L3RA 3O91A 4RV5A 3Q15C 4YMGA 1P77A 1DE0A 5EXDA 3Q72A 5BRAA 1ZRHA 4GWKA 2ZPUA 4QIWF 4GC9A 1Y63A 1ZU5A 4M9HA 3V4PB 4BO8A 1BCSB 1RXSA 2KMDA 2ZBGA 4UBCA 5JROA 4LZGA 1NHGA 4NBSA 4FB4A 4Q8FA 5EIFA 1E2KA 1ML3A 2I33A 3RSLA 1VYVA 4X5OA 2VIXA 3EBOA 3ZZNA 1DAMA 4O4JA 4OK3A 4I1YA 5AKXA 1T9CA 4BWGA 1TQ8A 1GGFA 4NSNA 2VTBB 4G9EA 4B4OA 1SKQA 1U3VA 2ZB8A 4KGXA 3RJTA 5B7PA 3B9BA 1BXGB 2E8MA 4R68A 4XYBA 5JZVA 3H9JA 3W6PA 3BD7A 4NS1A 4HDRB 2D74A 1MB4A 4QWMA 1VJ0A 3RVOA 3KE9A 1W5AA 3NC1C 2UUBB 5JAUA 1OBOA 3DEIA 2NT4A 4NZNA 3A1DA 1RBZA 4ARZA 3DVAA 1VMDA 1JBEA 1ZH0A 1RLIA 1X1SA 1A7KA 3BMOB 2P62A 1YZTA 1YIAA 4FTWA 3EG5A 4OHPA 3C3WA 3ETHA 5KOIA 4QOHA 2BMDA 5T14A 3HG7A 4HOYA 2V97A 3GLFA 3A9VA 3QX7A 4MHOA 1UBLS 3PEWA 1XDUA 3V1LA 5KYWA 2O9JA 1CIVA 3BCUA 1Q1GA 1XCJA 2WWIA 3VDQA 2OYYA 4CCSA 2YIMA 1NI5A 2YV1A 2VSFA 5KFRA 4KYIB 1IIPA 2AWOA 3MDAA 4FFRA 1WXXA 3OJXA 5LUAA 2E21A 2FV8A 2BH9A 2CC2A 1KORA 3A1WA 4TTPA 3N07A 3KR2A 3HO6A 2QX4A 3ZTWA 2F8MA 1ZLYA 2PGAA 4O4IB 5D87A 3RUAA 5LNK6 3VZBA 2DFTA 4GOMD 4QFMA 2PANA 1GUYA 1E0AA 1ISRA 5LZ7A 1JNXX 5G4LA 1GG2A 1V11B 3TL2A 4RS3A 4JODA 4XR9A 1V39A 1K5DA 5BNIA 3V1MA 5EHNA 1JFFA 3KHLA 1PK8A 4B35A 3QZ8A 4UB6U 1Q1EA 2XRZA 4IMPA 4YD1A 1KI2A 3LQRA 3P4UA 2E6UX 4WVFA 2EU8A 4TUYF 4PSKA 4RQ5A 2Q6OA 2WMNB 2W22A 3L40A 2IU6A 3U62A 3I53A 1FP4A 4J9UE 4MI9A 3WQSB 1XZFA 3TQTA 4I1IA 2TMGA 2GN2A 3P0RA 3FHCB 2YRFA 5E2BA 3A28A 2PGLA 1H65A 1A8SA 2P67A 4CFYA 4JKYA 4Q93A 1X7GA 2B34A 4JYMA 4YIKA 2CZQA 4MEBA 4OUKX 4S04A 1GFWA 1JQDA 4QEZA 5K8UA 2DGDA 2YJ4A 3Q8LA 1JLMA 4DFPA 1LF0A 1VSUA 5TEVA 1KZ1A 4NC9A 2Z95A 1P1FA 1Z4PX 4IQGA 5HRCA 1ZQHA 3ORFA 2A88A 3U6KA 3K1JA 4BBZA 1R10A 2ZZMA 3VR6A 3WFIA 1G20A 2WF7A 3EYZA 4R1SA 4IJVA 2YOGA 4ELTA 1K7YA 2GI4A 3W34A 1HJPA 2ADMA 5JZMA 1YRHA 4DQLA 4B2YA 2Z83A 1QDLB 2A78A 3HL0A 4N5HX 9ICPA 3SV3A 2LIPA 3Q9UA 4O5CA 2BSXA 3IJRA 5AJZA 4MEYA 3MQ2A 5HRAA 3P19A 4D4IA 1KPIA 2H92A 4OVKA 4YC7A 5BSFA 2BFEA 4PLTA 1ED1A 4JUFA 4H6PA 4LY6A 1HF3A 2JIZA 1JJVA 1JFTA 1PEYA 4UHDA 2ISQA 3VR1A 2HBKA 5LN1A 4IHJB 4Q01A 3ZPXA 4D9JA 1NYTA 4PJ0U 3LUPA 4DUYB 4ROSA 1WA5A 4URXR 1T91A 2IKSA 5CW1A 1V7CA 1KOJA 4G65A 1KY5A 2SECE 3C7TA 2YVKA 2CSUA 4KNYA 3HUUA 2VOEA 4R2WA 3JWPA 5HWSA 1EFDN 3E81A 1JIQA 3O3MB 4PO1A 4X8OA 3G23A 4AP5A 3DM5A 3QBJA 1O6BA 2HUNA 2Q6LA 4D97A 2WP0A 5LYJF 1ISJA 4YNBA 4MV9A 4D25A 4M1YA 2IU3A 2GCNA 2LTAA 3NKLA 3WLSA 3ROKA 1SWVA 1OBHA 1XSNA 4FFWA 3GIDA 1LVGA 2MRLA 5KYXA 3FOEC 1XU9A 1U0LA 3I0MA 4C3OB 4GFJA 3GJ4A 3BRWD 3GWGA 1UAGA 1ZQIA 3ZZ1A 3RSQA 1C1HA 2AMLA 4X62B 4GKKB 3PHIA 4H7FA 2Q62A 3TMYA 5HM6A 4JP1A 3PKZA 1ZDMA 3PGVA 4YUYA 1V26A 3JPSA 2Q5LA 3RS0A 3ZU6A 1OLSA 3U1TA 2OBBA 4RTRA 3QE3A 3WWCA 4I50F 3FLBA 4IVRA 3S7TA 4JGGA 4Q6BA 1CEYA 5FNZA 5C3UA 1G19A 4JXKA 3EUAA 4GXTA 3ZY5A 4G9BA 4XD7D 3QVTA 1V5FA 1FVHA 4PC1A 1EXDA 4IFIA 2R79A 2AZ4A 1T2EA 4YECA 3PW5A 2HU2A 1QHHA 2X5OA 3KU4A 3RIEA 1R6UA 1U0OC 3UAXA 5FORA 2QYOA 3D7NA 1S3GA 2X1LA 3IPCA 2BJVA 3CEPB 2WT4A 1ECFA 3T6KA 3ETJA 1E6WA 4EUSA 1PJLA 1LH0A 3W1EA 4J16A 4PO3X 2O8FB 2XMDA 2V0GA 5KDOA 2KFZA 3FRHA 4HEJA 3NORA 1DX9A 3BSWA 5LJLA 4WTOA 1M5TA 4GPAA 5K51A 3JD1A 3HV2A 3VYSB 1M7GA 5D49A 1IH8A 3QYPA 2AOXA 3GBSA 7ICJA 4ZOBA 5BYJA 5IEBA 2DECA 1O8CA 2W3SA 1QGZA 3GLHA 1TF5A 1IN8A 4XDYA 4G67A 4UZFA 2W98A 1O6ZA 5JNLA 4QPJC 2ZSAA 4MDHA 3L6BA 5EHZA 1OFUA 2HL6A 2O8CA 2V7TA 3GCDA 1SCNE 7MHTA 2VBIA 4NONA 3U3XA 2QTCA 5E8JA 3L0SA 2VNAA 1P2DA 3QLJA 3CCBA 4ZV4A 1A9QA 3PPYA 3DCIA 1GKYA 3N87A 3DFFA 3QFRA 4F3RA 4HWPA 2BEWB 3VR2A 5TISU 2G36A 1Q7RA 3EUB2 2O8DB 4LXGA 1RM4A 3SHFA 2BFCB 2GA9A 4BNIA 3GJ3A 2B36A 2MUTA 1VP9A 4P93A 5JXGA 1UOQA 2YWJA 1U7HA 1V2GA 2Y0CA 1U7UA 3U13A 2JEYA 2VHJA 5A3SA 2NAFA 2VSXA 3PNMA 2B92A 2OXEA 1SL1A 1I6MA 4PLPA 4BOYA 1DBIA 4BMSA 3U5ZB 1DT5A 1M2OA 2KIVA 1A9ZA 4R3WA 2JJYA 4M7WA 4CZ2A 1YONA 4BO0A 3IURA 1XSPA 1NMQA 2C03A 1DQRA 3EZYA 3V6LA 4CLOA 1JA9A 4IR9A 2FG7C 2PZGA 5LMCA 4J0HA 1FYFA 2JIMA 5EWLB 2CLHB 2JJQA 3VU8A 3D3EA 3ZVLA 3NETA 1Y80A 3HTXA 5DM1A 3NRBA 3TLYA 5CB6A 3QPDA 3B7WA 1TZJA 1A2QA 4BCBA 4YJ3A 1NSYA 4AF8A 1Q2XA 2FPLA 3N2EA 1BE8A 4DDTA 8ABPA 5TPZA 4DNPA 1SBYA 1MB0A 3O8BA 3KJFA 3B2EA 4B34A 1SUSA 3EZFA 1DU4A 2LKCA 1GQFA 2E6KA 5CM2Z 2AB0A 3ZD9A 1S2OA 5JMWA 1KAQA 1FK8A 4QJ4A 3T5JA 1Q0LA 1AB6A 3OUUA 2Q6IA 2DBVO 4V02A 4WA7A 2QQ0A 5AW4A 2HLNA 3PA6A 1BFUA 1Q7TA 1SIWA 4WK0B 4RQTA 3IOCA 2F76X 2AJLI 1FBNA 2GYUA 4KLAA 5KG1A 2GPTA 1GN8A 2YZ2A 1ZO8A 4MVJM 2YJ3A 1QSLA 4J16C 4KX3A 1PZMA 3OP4A 3KQLA 4DV5B 5KT7A 3H97A 3QUAA 2KJ8A 1JSRA 2CDNA 5DG7A 4FSDA 2JJ2A 2DTDA 3OX1A 3F90A 5K8LA 3OQHA 1T6YA 4P4OA 1P7DA 2IODA 1DQYA 3RRZA 3GPCA 2XECA 2R5NA 2Y2UA 1SC6A 4RPZA 4KTVE 4YT2A 2PS3A 3FPSA 2ZBFA 2QPLA 2YX1A 3V2UA 4LVSA 4ER6A 1T2UA 4M60A 3O73A 3FJOA 1J1IA 1U7DA 4YMNA 2X4GA 3REQB 3ER9A 3G59A 1EVEA 1B00A 5DWQA 3EQ7A 4IAOA 4KPUB 1P2BA 1Q14A 1Z83A 3KYDB 1X42A 1WULS 2FWIA 3PR2B 2Y2VA 4KQFA 2ZRBA 4X1YA 4MV0A 4D3SA 3DLPX 1U1GA 1L5LA 4V0RA 3ZCVA 1GQQA 4Z1MA 3FUCA 1GOTA 1IBCA 1UZAA 1UFRA 1T2VA 1SK8A 4FS2A 2I55A 5DTQA 5SICE 4HWGA 4O0LA 3UAZA 2N0SA 3BXEA 3QE0A 3ICCA 3C6YA 1L3UA 4PNHA 2QLJA 1UMDA 3K1ZA 3CSDA 4C7OA 1SVNA 2OL4A 2FF7A 1C8BA 1PBNA 1F2TA 4C0BA 1X2IA 3OICA 2WTXA 3LQ1A 1RAIA 3BJIC 3LUCA 1PE0A 4FLFA 1A8IA 3WKEA 1II9A 4LJRA 3CZ4A 4HTFB 3RRGA 2AN5A 1TA0A 1HT3A 1S76D 4S12A 4G1UC 4MQEB 4WOPA 1RP1A 4QZDA 1IZ8A 3S2EA 4D0LB 1B16A 1TMGE 3WLAA 5HW0A 3W0LB 4X7PA 4NF2A 5CFLA 4J1NA 1CUJA 4DCTA 3PIDA 3CURA 1CX9B 1OYWA 2C5FA 1HMPA 2VQEB 5FTLA 5AW9A 1UM9B 4HTAA 3TSZA 2DR3A 4A23A 2ZXEA 3F74A 4CHGA 5K3FA 3TQCA 4XIIA 4I5DA 1GKIA 3PPVA 4ABYA 2YQ5A 4MYDA 4XPIB 3TW8B 1RD4A 3CX6A 3PC8A 3NHYA 1UEIA 5FPPA 3VHQA 4DO9A 2HOFA 4ZRNA 3HRKA 5IM4F 1OAAA 4W7IA 3EB9A 5FYQA 3PCRB 4QLAA 2GHTA 3DBLB 2C5SA 2GXAA 4IOKA 3ZYZA 4JLDA 2PMCA 4QFDA 2WPDA 1FX0A 3T1OA 4MW1A 3DEKA 3DEEA 2AJQA 4RMNA 4D8WA 1O6CA 5HMLA 1D1TA 2Z2KA 2EYQA 4XDHA 1SKUA 5CDFE 1ADBA 5HHTA 3VR4H 1ATZA 4Y1RB 4DA8A 5BOSB 1E4EB 3EZLA 2IV3A 2BR5A 2FJ0A 5JMPA 3IIJA 3MQ4A 3M2TA 3RC8A 2FE9A 4V03A 5KT3A 3FCYA 4PBTA 4PNEA 4GPBA 1PR3A 4DLSA 5C2JB 1VLLA 2BHSA 2YWFA 1MQ9A 2Q5JA 1XRRA 4BMPB 1MEOA 4DLVA 2GEUA 2V4QA 1QC5B 4D4MA 4XARA 3JPYA 4HEA6 4DNQA 2V3CC 2QARB 2XT6A 4Z0TA 2QDXA 3UXOA 4G9GA 2R8XA 4QBGB 5A03A 4QD3A 4EGJA 4W63A 3VZSA 2NYRA 5AI8A 2M1XA 2AI2A 1E1NA 2ONJA 4OCZA 1OYOA 3ONNA 1GZSA 3UQ2A 1JTFA 1L6IA 2G63A 4NK5A 1FUEA 4EQ6A 5AOAA 3MBKA 1UKVY 2IU4A 3ER8A 3PDWA 2EFGA 5K3CA 3AR8A 4M88A 2ZREA 5ED0A 1PJSA 3W5CA 2RHHA 1M34A 3F3YA 1QJ4A 3G8YA 4BX9A 1ECLA 2Y9UA 4JYBA 2OV8A 3AR4A 3TQQA 1DUIA 3L05A 2BPOA 1F7UA 2Q5FA 2OHFA 1OR8A 2QG9A 1KH3A 3GAAA 3ZZMA 1XVAA 2G5CA 1P61B 2G40A 4HFJA 2YVUA 4YYZA 3R0XA 5L4LA 1CJTC 4Q7KA 1XEWY 3E61A 2J9FB 2VNIA 1A4IA 2QORA 1QH9A 2ZYGA 1PFYA 1U1DA 2HA5A 3AR9A 1CQIB 3H5WA 2VPWA 2W6QA 2BIFA 1PT7A 5KWIA 4NBKA 1U0FA 5D00A 1CD5A 2JH9A 1HE3A 4OFZA 3R5XA 3P9KA 4DG8A 3OT5A 3AJDA 1I14A 4PE5B 4P33A 5I7HA 4DSNA 3RWMB 3KQKA 4X3OA 2OTCA 4ASUD 5FL7D 4N9WA 1MC5A 1R0RE 3MGAA 4UAYA 2QWXA 2VAVA 5EJ2A 3IMGA 1BWSA 1C2YA 5JCJD 3PC8C 1WAMA 1IQ0A 2C4WA 1HYBA 3HLYA 2LI6A 4G86A 8AT1A 5L8VA 2PXHA 3OHMA 4G1MB 2QUAA 1TTPB 3LFUA 2J09A 1X38A 3ACDA 2H29A 4OIFA 4RVGA 1VBNA 5DSXA 3LUHA 2IW3A 2AYXA 2JJMA 1GNLA 4BLUA 1J2RA 3FRJA 4QGHA 1DG3A 4KQHA 1YR7A 1J5PA 2MOKA 4LQCA 4J9RA 4QO8A 3MG9A 4XTRA 3VOSA 5AWFC 2P30A 4M9CA 4Y2SA 3TK1A 3V7NA 4BWMA 3MR6A 4YLGA 1PN3A 4ZVUA 4JDUA 3H65A 3RI3A 3L1UA 1N2CE 2C94A 2HVHA 3OP1A 1SXJB 2UVQA 4ZU3A 1JU4A 5I51A 4EPRA 5LA6B 4BWJA 3X1KA 3X1XA 1DEOA 1Y6GA 1LRKA 4QIHA 1TXGA 1VSBA 1ZRMA 3K7EA 3QU2A 3ND5A 5JYCA 2V3WA 3GFVA 5FQNA 5EMJA 3JATA 3EOAI 3DDUA 4DKXA 1BGXT 1ULTA 1K5GA 2ZETA 1UQTA 5JATA 1YS4A 1RWKA 5ALWA 3PPXA 3N8IA 2BCQA 2X8WA 4CKWB 1INLA 2EG9A 2HPHA 1XAGA 1FZQA 3UXYA 4IOLA 4ZVQA 1TECE 4IKOA 1BD3A 3KQPA 1JFVA 3THOA 4NJMA 2PLWA 5B1SA 3JPOA 1NNSA 5SYMA 3KPYA 1LDNA 4H6WA 4W1QA 2NTEA 2QT9A 4JJZA 3VAZA 2C3OA 5BV8A 3V9PA 3CH5A 4M8SA 2K7ZA 2Q8QA 2WIGA 4Q1EA 3UJ9A 2VO1A 5CAEB 3DMNA 5E38A 1B8OA 4TWIA 4BX9C 3T5AA 1KSGA 1D6JA 1SVSA 3LBIA 1I3LA 3OPQA 4HLDA 4I29A 4CL8A 4AD8A 2JAWA 4ZXFA 3SSMA 1MTOA 3F6EX 2ZJ5A 3NBYC 2A5DA 2J5XA 1EVYA 2QB0A 2OH2A 5BNWA 4KLDA 2WFMA 4HI0E 3V48A 4GUDA 4NLLA 1IUOA 2J45A 3MIZA 1CT9A 3OA2A 4ZC8A 1NUUA 1VG8A 4PH5A 3L9XA 3KJIA 2Q1UA 4RTJA 4P2HA 1GSAA 3FOWA 1FFDA 1T10A 2JFHA 3ILSA 3EZNA 3G5LA 3SHWA 1V4NA 3COJA 2DUYA 4ENTA 1VTKA 4LMPA 2QVLA 5LQKA 3ASVA 1A5SB 3CZ9A 2E8NA 1MOZA 2Y0SF 2AGQA 1VE7A 1QMPA 4JNKA 1I6KA 4O9MA 2WG2A 3F5DA 4BE4A 1GPUA 4W7SA 2QUIA 5KG0A 4DKJA 4YV2A 1WABA 2DC1A 4DLPA 3DHWC 2R4QA 2WYWA 4N48A 3FWNA 3B1JA 2WJ3A 1HY3A 3OCWA 1VL1A 2IIVA 4MEJA 3E4DA 1Q1ZA 1W8DA 5DBHX 1QHYA 4ZZ2A 1TLLA 1JQJC 1NNEA 4RD6A 4ZRDA 4MHTA 3CJRA 3TBHA 1XNQB 2QN9A 3NTQA 3ES9A 4DOAA 2M0NA 4UE6A 1E3QA 3FPFA 4HAXA 5CTAA 3ED1A 4RELA 3QKSB 2X4DA 4ER0A 4OLFA 2E8OA 2P2CA 3KWMA 5EE3A 1K7SN 3PBKA 5JRJA 1RRFA 1ZN7A 1T6NA 4TV9F 1ZESA 1QGDA 5C8YB 3QLEA 5A0LA 3DE5X 4LJ6A 1IOZA 1EK1A 3HFJA 3SZ2A 2WIAA 4KR9A 3RS9A 2OHIA 1TEXA 3TR6A 4YPVA 3NAQA 4JUZA 1HSOA 4RFVA 3PXDA 1U8EA 5K6TA 4EBBA 2Z30A 8MHTA 1MV8A 1JRLA 1XK7A 2ZUFA 4F72A 3HCCA 4YRJA 3TECE 1BOOA 2QK4A 4ZODA 4TLLB 5JAZA 4YAIA 1ZUWA 2ZM5A 4YQEA 5A4FS 4UZSA 3IQHX 2H5JA 4R7TA 4EK9A 5HCUA 4GXRA 3WMGA 2H2HA 2P7HA 3I62A 4Z0HO 5JSUA 1T1JA 3FNQA 3KOWA 3MR5A 4AY3A 2FPWA 3PR3A 3PEFA 3UH1A 4V0QA 1T5DX 4INJA 4RW0A 2CXNA 1Z4MA 5C1PA 2I2DA 2K87A 1NRJB 1B6TA 2V96A 5IDXA 2IZZA 3BWMA 1ADCA 5BNTA 5FHQA 3FTCA 4H6VA 1TQHA 3CX3A 2O2JA 1QG4A 3C45A 2WU1A 2QMHA 3C7KA 1T2NA 5B12A 4BU0A 5JFGA 2EQAA 2HSJA 2GPYA 4X6XA 3DULA 4IIHA 4Z5XA 1RLOA 2ETVA 3FMFA 4P58A 4UM8B 4GDMA 1HDGO 2FJ6A 4RK7A 1XDDA 4PHFA 1FJHA 3P71T 1AK9A 2PUTA 1P0QA 2NSJA 2X8LA 4HADA 1XZDA 1I7SB 3T35A 4PAWA 1G5TA 1QHFA 5CR9A 3NWPA 2RHBA 2ZS8A 1DFHA 3PFBA 3BQ7A 4LE0A 1WLSA 4ECTA 4EG1A 4P5DA 3IVRA 4ND3A 4C78A 4B47A 1VHTA 2RCYA 5HUHA 1JN0A 4KIUA 3IBYA 3OM8A 4GOOD 1UDRA 1E1CA 4RF4A 5KFEA 1DG9A 1HZJA 4OLHA 1RJDA 1Y9DA 3LXMA 1ZCFA 3STTA 1GIAA 2K6GA 1Z47A 4QLOA 2JBWA 3O4IA 3D3WA 3QH4A 3L7YA 3WHIA 1ZQBA 3T54A 2DPYA 3WMRA 4FHFA 4JEHA 1RXVA 4MUBA 3NGLA 4JP5A 5G3YA 5B5SA 5KFWA 3N59A 3VBCA 2QHXA 1PU2A 3HKEB 3EQ9A 4C06A 4N5LA 2OLEA 4LXUA 2D06A 4HDSA 1D4ZA 4NKRA 3MB5A 3HB5X 1TT5B 3NTXA 4P34A 3K1YA 1W49A 3MUEA 2UU9B 3UWOA 3IAS1 1MCZA 4O0IA 3GA7A 3T5GA 2X86A 2IYTA 4D8XA 1OJ7A 4QQRA 4G0WA 1EE1A 2I62A 2RAPA 3HXQA 3RODA 2J9RA 1ISSA 1WZCA 5J40A 4WCFB 3RVJA 4EZ9A 2ZSFA 2EANA 1XZIA 3M7DA 3BA6A 1F0PA 1ND5A 5EGNA 1FVFA 3I9V1 3MC1A 3WRXA 4JN6B 8ICRA 3ETRA 2Q6KA 4B6SA 3EVNA 2J0VA 2Z3ZA 3KELA 2QTTA 1WY5A 3LCMA 2ISOA 2C2EA 1W5TA 4UQOA 3H1PA 1X1AA 3T1QA 8ICJA 4CDMA 1Z0FA 5JTUA 3ZWBA 4IVNA 3SM3A 1XZBA 1ZXXA 5HGJA 1CJUC 1H8EA 5K1ZA 1KWKA 3FMPB 4KG7A 2OFPA 4FZRA 1P3Y1 1AS2A 3DMHA 3DL4A 1GU1A 2AEMA 2RKOA 4FYXA 2KN7A 2PIAA 1ZRSA 4OH1A 3R09A 1IC6A 3OD5A 4UBOA 4FYYA 3PJEA 2PWBA 3NKVA 4YUAA 1YNSA 1ADFA 5J2TB 4QYSA 3PWZA 3PE3A 1LSJA 4ES6A 2IS2A 1I80A 3D8RA 1AQNA 2JMGA 4L72A 1ZKDA 1RHJA 4E94A 3OJEA 2BFPA 1W73A 1JFSA 1K88A 3ZWKA 2HU5A 4YLYA 4XYLA 4AWBA 1LNQA 2F3QA 4EPYA 1FSFA 1Y1LA 2ZYTX 2GASA 5AW6A 1PSZA 4K9QA 3GIIA 4B73A 1SXJD 1KY2A 1LNSA 4EB6A 3RBZA 2GZDA 1USWA 1ITZA 3HXOA 4MVJI 2IZ6A 1OFTA 2YIVX 1C30B 4EFDA 1XDBA 2VYCA 1NDUA 4BO7A 2TECE 1SWWA 2W03A 3QX9A 4MLZA 2HDWA 1E2EA 2BHNA 3L0PA 1L7VC