2YMLA

Native l-haloacid dehalogenase from a rhodobacteraceae family bacterium
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
228
structure length
228
Chain Sequence
PSRSGILVFDVNETLLDLTSLSPLFERVFGDAKVLREWFPELILYSQTLTLTGLYRPFGEIAAAVFEMVAANHQAKVTPDDIAELKTRLTSMPAYPDVAPALTRLQDAGFRLVTLTNSAPSPAPSPLEKAGIASFFEAHLTVHSSQRFKPHPSVYDSTAETLGAKPEELCMIACHIWDTIGAQARGWRGGFVARPHNTPLTLAEVPQPDFIGRDMGELADQLIASLTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Marine Rhodobacteraceae L-Haloacid Dehalogenase Contains a Novel His/Glu Dyad that Could Activate the Catalytic Water.
pubmed doi rcsb
source organism Rhodobacteraceae
molecule tags Hydrolase
molecule keywords L-HALOACID DEHALOGENASE
total genus 87
structure length 228
sequence length 228
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2ymlA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2ymlA01
3AR8A 3CZ4A 3MPOA 4DW8A 5AW6A 4EENA 3AR4A 4ZEWA 5AVWA 1SWWA 2AMYA 2VKQA 4NAVA 2FPWA 3PCTA 5AW1A 3U19A 5T41A 2JARA 4BEVA 2GHTA 3AR9A 2RB5A 3OPXA 3SD7A 3DAOA 3ZI4A 2O9JA 4UU0A 4JB3A 2FPUA 5ALWA 3M1YA 3DDHA 2YMLA 5ALOA 5IT0A 2BDUA 1T5TA 3FZQA 1O08A 1IWOA 2C9MA 2G0AA 5AKGA 3UM9A 1NRWA 5AK6A 4YIHA 3OCWA 5AI4A 3AR2A 5AW9A 4BNDA 3I6BA 5AKIA 1TJ3A 2IYEA 1WR8A 3KC2A 4G9BA 4XOUA 4AS2A 2R8XA 4UW9A 2O2XA 2G08A 3DV9A 3FM9A 3EF0A 1RC8A 5AW4A 3UMGA 1ZJJA 3D6JA 4KYTA 1Z4PX 4BNDB 2G06A 1Z5GA 2YJ6A 1KYTA 4BKMA 4XQ0A 3U7GA 4BX3A 5AI8A 3ZWKA 3MC1A 5AM2A 4EELA 1QQ7A 1U7OA 5AKJA 3PGLA 1ZD5A 5AVUA 2JAUA 1NNLA 2C4NA 3L8FA 3QYPA 5AW8A 2ZBFA 2I54A 5IT4A 1X42A 3EF1A 4UATA 2YFYA 5AVVA 1Z5UA 3OCZA 4UAUA 2WFAA 3NUQA 1Z4MA 5ALQA 2ZG6A 1ZD3A 4F72A 3IJ5A 2YJ4A 4NV0A 3HYCA 3QU2A 2OA0A 1L6RA 2YJ3A 5AVZA 1JUDA 3HLTA 1RMQA 2R8ZA 4MWOA 1ZRMA 4Y2QA 3R9KA 4UAVA 1TJ5A 2B1RA 2YMPA 1Z4QA 4GIBA 1XVIA 3FVVA 3WK8A 2YN4A 3TLMA 1WZCA 2EARA 4JDPA 3E81A 1YMQA 2GHQA 3ESQA 5ALPA 3KZXA 2CFSA 4Y2JA 2YBDA 4ZEVA 1VJRA 1XP5A 4Y2TA 5AI9A 2ODAA 2G1AA 4RETA 2HSZA 1RKVA 3QU5A 4C4RA 3NAMA 5ALLA 3NRJA 5ALVA 5ALNA 4EEKA 3OCXA 5ALIA 1Z88A 3QU9A 4HGQA 4UM7A 4QQFA 3QNMA 3UMCA 3NANA 5AVQA 5AIAA 5ALMA 4MUMA 5AK3A 3ZVLA 2PR7A 4Y3UA 3WK7A 1VJ5A 1CR6A 3ZTWA 4Y2UA 2GFHA 1ZD2P 3UMBA 3SKXA 3EWIA 4UMDA 4BBJA 2W4MA 2WHEA 1J97A 3KDPA 5ALEA 1S2OA 4KNWA 1EK2A 3ZW7A 5AVSA 2AGVA 1L7NA 3AR6A 2IA5A 4Y2SA 4OCZA 3E58A 3L1UA 2B0CA 2AUTA 1K1EA 3BWVA 2I7DA 3I1YA 3SF0A 3QX7A 2ZBEA 3QU7A 1WVIA 5A3QA 5ALSA 3CNHA 2I34A 3L0YA 4KX5A 4HGPA 1MH9A 1F5SA 3K1ZA 5AESA 2I6XA 5AK4A 4L57A 3P96A 3RFUA 2P69A 3U7HB 3B9RA 3SMVA 3WKDA 4Y2PA 2AH5A 2ZXEA 1ZD4A 1RPZA 1Q92A 5AW7A 4KX3A 4DWOA 2YMMA 3WGUA 4Y2XA 4L6CA 5AW5A 2OYCA 2FPXA 2W11A 5AKHA 3ED5A 1QQ6A 2C88A 5FP0A 3L8HA 3OCVA 2BDEA 1L8LA 3U7EB 5AVRA 1RLOA 2C8KA 1ZS9A 1TE2A 2ZOSA 3KBBA 3N8GA 4I9FA 1QYIA 2IOFK 5AW0A 5AKEA 5ALGA 2YMQA 3KOOA 5ALRA 4Y2VA 4HYTA 3WK6A 1RDFA 1L8OA 3F9RA 2I55A 1TJ4A 4UM5A 3NASA 5AM1A 3RF6A 3ZTYA 3ET4A 2ZBDA 1LTQA 4NWIA 1QH9A 5ALKA 1RMYA 5ALYA 4EX6A 3GYGA 3N5KA 2OM6A 3IRUA 3WKBA 4UU1A 2YY6A 1Z4OA 4OHFA 3WKAA 3L8EA 4OD0A 5AM0A 1RLTA 2G80A 3L5KA 3U26A 2QYHA 2IOFA 3E84A 3U13A 2WF8A 3QUBA 4C4SA 4ZEXA 4CE6A 4J03A 2FUEA 5AIBA 2B8EA 4Y2RA 1ZRNA 1U2TA 2GMWA 3FPBA 2C8LA 2Q4TA 5E0OA 4O8CA 2DQSA 3DNPA 2QLTA 3ZX4A 4E88A 1PW5A 4Y2YA 4PNHA 1NF2A 4XPZA 3WKEA 2G07A 2YJ5A 3I76A 3W5CA 4RESA 1T9ZA 3MN1A 5AK5A 3WKCA 1LVHA 1RKUA 5A3SA 1Z4KA 3ET5A 2JAWA 5AVYA 4IFTA 4HGRA 1L7MA 1YNSA 5AM5A 3ZX5A 3W5DA 1J8DA 1Y8AA 3WGVA 2FPSA 4CF4A 5ALJA 4C4TA 4UMVA 2HOQA 3NIWA 2IOHA 1Z4LA 5AW3A 4DCCA 1RMTA 2P9JA 3WK4A 2PQ0A 2X4DA 4OFZA 5AVXA 2Q5EA 1CQZA 1T5SA 2WF7A 2HDOA 3QUQA 2B82A 2MU1A 3ESRA 3WK9A 5A3RA 1ZOLA 4AP9A 2WF6A 2G09A 3R4CA 4FYPA 3SHQA 1N8NA 2CFTA 3BA6A 3QUCA 2D2VA 4NFLA 3EPRA 5AI0A 4CNQA 3L7YA 3ZU6A 3QXGA 2P27A 2MSNA 1TA0A 3PDWA 4I9GA 4F71A 3M9LA 2BY4A 3QU4A 4YCNA 2JGAA 3A1CA 4UMEA 4HGNA 2B8JA 3ZVNA 4FE3A 1YV9A 3B8EA 5AKZA 3L0CA 4J2TA 4QJBA 4YCMA 2CN1A 2W43A 5ALHA 1XPJA 1EK1A 3B9BA 1L7PA 4CF3A 1U02A 1VFPA 3L0BA 4KN8A 1RQNA 1Q91A 3OCUA 3S6JA 3ZVMA 5AKLA 4H1WA 5AM3A 2HCFA 3N1UA 2HX1A 1RLMA 2HI0A 5ALDA 2HHLA 2P11A 5AVTA 4XE5A 3L8GA 3N28A 4GXTA 4BX2A 5JJBA 2HF7A 1YS9A 5IS2A 1Z4JA 2B1QA 5AKKA 4YIKA 3OCYA 3AR3A 4UARA 5AHXA 1Z4NA 4EX7A 3E8MA 2JAOA 3R09A 5ALTA 3VAYA 2MU2A 3N07A 2NO5A 2FUCA 3PGVA 2I33A 3ZWDA 3KD3A 2RARA 2R8EA 3A3YA 3MMZA 1SWVA 3ZUPA 2HF2A 3QUTA 5ALUA 2OBBA 3NALA 4G63A 1RQLA 3A1DA 2NYVA 1U2SA 3FGOA 3SKYA 4B6JA 1SU4A 3AR5A 2Q4RA 2R8YA 4CF5A 2FPRA 1FEZA 2PKEA 5AICA 2ZBGA 4L6AA 4YCLA 3FPSA 2RBKA 4BX0A 3OTQA 3QGMA 5ALZA 4KNVA 4UMFA 1S8OA 3IB6A 1L7OA 4DFDA 5AW2A 5ALXA 2EAUA 4IG4A 4BYGA 5AI5A 4HGOA 1N9KA 4UASA 2CFRA 4YH1A 3I28A 3AR7A 2RAVA 3ONNA 3QLEA 4NABA 2FI1A 1AQ6A 1YDFA 2WF5A 4EZEA 1U7PA 2B30A 3U7FB 4FFDA 1QQ5A 5AKYA 1WPGA 2EATA 3W5BA 2FEAA 3WK5A 2GO7A 2WF9A 1Z4IA 3A1EA 1YJ5A 2WM8A 1RRCA 3W5AA 2HEGA 5AKXA 3J7TA 4YGYA 1O03A 4AS3A 5AM4A 3SLRA 4BEWA 4HAIA 5ALFA 2HO4A 3L1VA 1RKQA 5AI6A 2FDRA 2NO4A
chains in the Genus database with same CATH superfamily
1JWBB 2QN8A 3GJ6A 3LBAA 5CVCA 3FDZB 4F85A 5IVPA 1QORA 3PD1A 1QFZA 4BJ5A 5AW6A 4XDZA 3CGWA 4PYJA 3AMVA 2BUBA 1S1MA 2MSWA 4MUNA 3WLNA 4AZTA 2MR5A 4WY5A 1JHMA 1OASA 1XF1A 2RP5A 2V96A 3FETA 3OEHA 5AW1A 2JARA 1XNQB 3OE4A 3C14C 2FE4A 2RB5A 4UAYA 1HY3A 2G5CA 3TZKA 2IV3A 5EJ4A 3AF6A 3W34A 3WMGA 3RHTA 3JYPA 5AWFC 1NU8A 1UMCA 4O2AA 4YGXB 4BC0A 4OHCA 1NVFA 4M9ZA 1PLKA 3FZGA 3DMDA 5AUQA 3U6BA 5DN9A 3H1PA 4YQZA 2OFFA 1CUDA 3UW3A 3ZW9A 3HDYA 3Q1KA 4ZI5A 2C2MA 4JEMA 5GINE 3IQXA 4ARAA 2BTOA 1NU6A 1JVNA 1TQ6A 4KFTA 2R65A 4DJDC 4HDRA 1R7RA 2JRCA 1IWOA 2H57A 1U6IA 1KDPA 2NNLD 1IC6A 2QM3A 3GF4A 2OHGA 4P9NA 1XG5A 4HATA 5IN4A 5LA6B 1I32A 5CH3A 3THYA 3HR8A 1WYGA 1JFFB 4FMDF 1QR6A 2ISSD 4IXDA 4ZVVA 3V6KA 4RQ1A 1VGRA 1Y4ZA 3AR2A 3U81A 3HO8A 4M9GA 4LYGA 1UK7A 3ZE8A 1OLSA 1HDGO 4F8EA 3LHSA 4EFNA 1IN7A 4MP3A 2IYEA 5CX1B 1VBFA 4MWZA 1JNYA 4R05A 1V6SA 2W6OA 1N2JA 1AUVA 1POWA 1KJNA 2ARKA 2HZ7A 4BUJA 4DJAA 5ITVA 1R0RE 5L8VA 1ECCA 2COEA 1UINA 1SC4A 4ETMA 2DBYA 4O5KA 3ENZA 5EJ8A 2C4HA 1KYTA 2AFHB 1H6DA 2Y9MB 3VR4H 3ZJ5A 3FNRA 4HMQA 4N12A 5JCOC 4YP3A 2HN9A 3CSSA 4F4CA 4QWBA 3M6IA 2CDRA 4DVGA 2HRDA 4D9IA 4PGGA 1OXSC 4C7MA 3ACCA 1ZQDA 1MQ9A 1Z75A 2WSIA 2ZTVA 2WU1A 4KQWA 1C7EA 1QYVA 4OM8A 4WDQA 1BC5A 1P91A 1NNLA 3ADPA 2XY6A 2R96A 1G2OA 3IESA 3DF9A 1Y3BE 3SDSA 5JPIA 2AC2A 1X42A 3R7NA 4LOHA 3K6SB 1VCHA 4P33A 4YAOA 3ND6A 1UC8A 3VVMA 5JV5A 3S81A 3T5PA 5LBTA 3ROXA 4PL1A 1D0VA 8AT1A 8ICJA 5FADA 2ZG6A 3H97A 4HTFB 4R2XA 4NV0A 5EE9A 1VG0B 2HJVA 1VI6A 1LZKA 1R6UA 2Z8ZA 4B9TA 3SENA 4O0IA 1KZ1A 3EMKA 3QEOA 4N6NA 4HDNA 3MABA 3NOXA 5K3CA 1U8EA 4EJ2A 3HLTA 4KGVA 4DANA 2IY9A 3KYDB 1BMDA 1PEYA 3WSTA 2B1RA 4QU5A 4FFBA 5F78A 5CBPB 1EUQA 3WWYA 2J9FB 4WZ6A 3EXG1 3TLMA 4XUSA 4B6EA 2OGWA 4H0NA 5BOSB 4DAOA 2GN1A 4L75A 2WSYB 1WWUA 1TYBE 2CBZA 3E9RA 4RD0A 4TXJA 5G0WA 3BA1A 3T5MA 3VMMA 2C3OA 1SL1A 5ICFA 5CEHA 3OSNA 4BLUA 4X45A 3AZPA 2IBTA 4Q6WA 5F5NA 4B31A 1MJHA 4JJ7A 3TRJA 4GQAA 3DKVA 4DSOA 1SXJE 5B3JA 2GRJA 1J1IA 3I2IA 5MN5A 3WZ2A 4I2AA 2PJRA 3I04A 2QTNA 2C4KA 4D8UA 4XVQA 2PWBA 5B36A 1EVIA 2QVCA 2AEJA 2VZEA 3O91A 4MV5A 1L5SA 1USKA 2HU8A 4NAUA 4LC0A 3NU1A 3VPBA 5EUBA 1I7LA 1XZQA 2JCGA 3TOZA 4BNUA 1G17A 3AVUA 4M9LA 2I9KA 3D3QA 4G0OA 5HKAA 1N9GA 3HKZF 1PL7A 3PVCA 3V3TA 1JDBC 2YXDA 4LSMA 5JR3A 1UF9A 4DSLA 1JNXX 1QF7A 2AZTA 3BBLA 3PIRA 2CFOA 2PZMA 1NURA 4OH7A 2NVUB 1YK0A 2ZP1A 3O4RA 1A97A 2W90A 2XVMA 3CLKA 3O90A 3KXIA 3VKFA 1MRSA 2CNLA 4XWGA 1D7AA 5FWAA 2C9CA 2BCVA 1U8CB 3UMBA 3R24A 3ZE9A 2CMKA 1V16B 1FNDA 4ZQCB 5HZMA 1XEFA 3CPEA 5I9IA 2GN4A 3GXBA 4KMOA 2EJTA 3OH8A 2NYRA 5KKAA 1ZU5A 2I66A 4MUHA 1RIIA 1Z0AA 3BPSA 1TFUA 4M1ZA 1BCSA 1GPBA 4W5HA 5MGBA 1ED1A 4HRAA 5EKSA 1L5KA 4YO7A 1YR6A 3C8HA 1DX4A 3JQRA 2OKGA 2PZLA 4NAHA 4YA6A 3PXCX 5EFZA 2J4CA 3ZQKA 4B9EA 2WIJA 5AVSA 1P4GA 5CUQA 2W6JA 2IPOA 2Q8NA 3HJNA 3ROFA 3VR3D 1U5CA 3IE1A 4JWNA 2WSMA 1TM3E 4BCCA 4GLJA 2BZ0A 2YBEA 4MGIR 3SSMA 1QGUA 2GZ3A 3UWMA 3WGZA 1E3SA 3LRTA 1Y33E 3MMSA 4RT3A 3H8SA 2W6NA 3HYRA 5G53C 1KDHA 3T79A 1CZOA 4X20A 4WXMA 4ZOBA 3TL3A 3TNJA 4GE3A 3EFOA 2AUMA 4ALJA 4CIYA 4IR7A 4QYMA 3UMJA 3FRHA 3HNPA 1KRHA 1ZZEA 2WZQA 3GCDA 3KHKA 1KAEA 2V4QA 1IHYA 2BTQB 1SZHA 2I6XA 3AUJB 4JUCA 4OQFA 1SC3A 1KSFX 5J43A 3P96A 1AQIA 3OZEA 2CXUA 1ESEA 4C43A 2D0OB 4DF8A 1HUOA 2VH5R 4DL3A 3ANSA 3DFIA 2GASA 4GUDA 2PX5A 2ATIA 5KFNA 3DTTA 3QVJA 2YS6A 3RASA 3VR6A 1NQXA 4QDOA 1J8VA 1DQYA 2IYQA 1V39A 4M9NA 8ICBA 4FMBB 2VYQA 3AV0B 4HZGA 1PX0A 4RQBA 1OXVA 3WGTA 3TPCA 5FA6A 1E1QD 2IL1A 3RH0A 1IQ0A 4UDNA 3ZWCA 4OYRA 2OG2A 3T1YB 3CWQA 1JPUA 2Y1DA 3C3BA 4HAXA 2Z3WA 3RWMB 2JEIA 3WB1A 3AM4A 4CIAA 5JSHA 1RYDA 2AYYA 4PPFA 2FP4A 2WIFA 3C98A 1U9IC 3EAFA 3E05A 4Q9HA 1HK7A 1J24A 3JV7A 4BYMA 5D8DA 2OK8A 2CVOA 3E27A 1M1ZA 1G38A 2XXAA 3LC7O 2BMJA 1ZQWA 1LDMA 1LPMA 3UC9A 3R5FA 4F4HA 4DV1B 1GN8A 5B6JA 4B3IA 4I9FA 1RBQA 1OB5A 4NZMA 4X8MA 4DEYA 4RYLA 1NDQA 4MHVA 3KEQA 5JE8A 5ALRA 5KFWA 5MN4A 3TAQA 1AF4A 4HWRA 3VR6D 1KDTA 1Y8CA 2AOUA 2I55A 1SKYE 4J0IA 5DASA 3SNHA 4AG6A 1XEAA 1GLVA 1QWSA 4GMGA 3TOCA 3X2FA 3W04A 5FAKA 3PVSA 1QB8A 3CJTA 1J20A 2HSWA 3D3WB 3OFNA 2C3PA 4UBCA 2KEYA 2FW9A 2VHJA 3F4LA 1EPUA 3QEAZ 1IUOA 2DUMA 2XUQA 5AYVA 3CVYA 2O59A 1VXRA 1MR3F 3S8MA 3UAGA 3WVNA 2ZB4A 2ICAA 2WAXA 4AWAA 4Y0NA 1JLRA 4KQGA 1FQOA 3VI3B 4D2IA 4DA0A 3P7MA 2D3DA 3TI0A 3V97A 3A1WA 3KS9A 3Q6NA 2AW5A 3PGA1 4OD0A 4XZ3A 1P7WA 3R7AA 5HKOA 4DA4A 1KVSA 1QFYA 5K45A 2DH6A 2OQIA 3MK31 1I01A 1E61A 3OKPA 2GBPA 4KE7A 4Q02A 4EZ6A 2AA3A 5K09A 3ZVRA 4CE6A 3FYCA 5G0SA 2VK4A 4P7JA 4CHTA 4EVRA 3E18A 4YCCA 3R6GA 4P3KA 3THXA 2OZLA 2R44A 3OF3A 4OKSA 1EP2B 5DXJA 3SEQA 1EUZA 2Q7DA 3FPBA 2C8LA 3I45A 3FZNA 5JZ9A 3MAJA 5BR1A 3RJFA 3N74A 2Q6OA 4ZRNA 1UOEA 3ZE1B 4PPXA 3IP6A 1MA0A 4IIJF 4YP0A 3UWDA 2G9RA 3GROA 1L2TA 4O4IF 3IDZA 1T9HA 2ZUVA 1EQ2A 1R10A 4DSZA 4ZRMA 4TMWA 1TVAA 1X40A 4IIFA 2QE7A 3AB3A 2PANA 4QZBA 1BO6A 2FUNB 4EG0A 1L4KA 1P4AA 1Z7WA 1P2BA 1BS2A 4U0KA 4UVGA 4B34A 1WWVA 4IX1A 4O2AB 5KNLA 3K70B 1Q15A 5BSGA 3FLEA 5EGSA 2QB0B 4R69A 5F51A 3FPGA 1JIJA 3EZ7A 1EWTA 1UQUA 1V97A 2OV3A 3GJ0A 4JSTA 2JBAA 1JG7A 3HKEA 3CLSD 3BB1A 2XCPA 1DOHA 1Y82A 3QF4B 3UUFA 5FUXA 3ZHXA 4NCAA 4OXNA 1UJ2A 1XTIA 1MO2A 2PMZC 1S3IA 3T3PB 1JA9A 4NG5A 1ZQXA 2AEMA 4JL6A 2VT6A 1UDXA 2CWWA 2REXB 1SN7A 2W2PA 2DGZA 3HJCA 1OWNA 3TAXA 3TR6A 3WBJA 4D9HA 4YV7A 2RIRA 3U7QA 2WA1A 4MJXA 1IN6A 4BB5A 5FWNA 1G8PA 1LQ2A 1YUNA 2LDBA 3DHYA 3KAPA 3N7PD 4YMGA 5T5QA 1XRSB 4DJFC 5IU6A 4QGAA 3JTMA 2QAGA 1UPFA 4ELVA 2BGTA 3D6VA 3CH5A 5FKJA 4EYHB 3RS2A 3GV8B 2E5LB 2ET6A 1KQPA 3AXTA 1PCXA 1EKXA 2DUWA 1W5FA 2DTXA 1N8TA 2FPPA 3FPHA 1ZSNA 3CUTA 3K32A 4JX9A 4DMMA 1AHHA 5J40A 4BBAA 1N60A 7ADHA 3LXMA 1FLDA 1CQPA 3R5JA 4D3ZA 4KIUA 2CL5A 5EWJB 2FG7C 2CNWD 3KEFA 2L82A 3VI4B 2HJ9A 1U8XX 4W1PA 1KYVA 4RXMA 1ZI6A 3USES 2PUCA 1I2MA 1SC1A 1C8VB 8ICYA 1NK5A 3G68A 2H3FA 2DCUA 2RBEA 1Y5NA 3OZTA 2R84A 4UHHA 4ATNA 4CLOB 5FEMA 2DVMA 4BS9A 3BWMA 3KB8A 1JW9B 1FA9A 3K30A 2JAHA 3OTHA 3L6UA 1IL0A 5CR9A 4FEAA 2ETXA 2BHNA 4G6ZA 3Q15C 4HDOB 5AKZA 2ZJAA 4J2TA 4XI9A 3WQBA 4EVIA 4CKEA 821PA 4BGUA 4BNMA 5ALHA 3RJIA 2IZ0A 5H1YA 2HQRA 1V9PA 3H0EA 3B9BA 2QUAA 4XIGS 1P72A 4NEHB 4DM3A 3OTOB 1KAOA 4PFJA 1MAUA 2BFFB 4HDKB 2JASA 5J2IA 2QKYA 1VGQA 1RQGA 4LVUA 4YMIA 5CVJA 4A2WA 1F6DA 3V7WA 2C99A 3TTXA 4B4DA 3TFOA 2E4YA 1THZA 3A3KA 2C8VA 3G0DA 1BX3A 5FBZA 2PO5A 2VQ6A 3NVAA 1G7TA 4ZI3A 1KQFA 2HHAA 2VH2A 3ZDCA 4UVEA 4ZK6A 4NFYA 3PX0A 5DB8A 2W2QA 1DKOA 3IBGA 3ZD8A 1JXOA 4HTAA 1DBIA 2RGDA 4GZ5A 3U3OA 4E5VA 4EYKA 5ICMA 1RWXA 3KQSA 3FW1A 2KHQA 5JJBA 2OBYA 4PGXA 1QKKA 1JE1A 3CKYA 2HA7A 1OKKD 2WT9A 1YBVA 3KR9A 4EHAA 2ORYA 4WPGA 4JP5A 2VA2A 4JODA 5HDQA 3VPFA 2QPOA 1AXEA 3KPYA 2GAJA 3CH7A 3DLBA 4PIMA 1Q1QA 3FOEC 3HZHA 4EI9A 4X8HA 2XB9A 3VSAA 2CCKA 1RXSA 3PGVA 1ZRSA 5DM4A 1WB9A 4AICA 3KHLA 4LX8A 4DNFA 8ABPA 4JEHA 1NWCA 1U8YA 1FDVA 4CMBA 1ODFA 3ZUPA 3T9BA 1TVMA 3JWJA 4QL3A 5TGTA 1FQJA 3HO1A 2XTAA 4HNGA 4LRQA 3H6GA 2QTHA 4MEJA 4DV3B 4LKOA 5COBA 3QPCA 2J45A 5AJVB 2C9BA 1UMDB 2XQFA 4BAZA 4ZDKA 1F0NA 1CEEA 3PJEA 3RI3A 3E2PA 5LM3A 2EAPA 2FFQA 4KXQA 5CT4A 3T54A 2W42A 4JL8A 3ZCUA 4CF5A 5KFHA 2HJWA 3M5CA 1YB5A 4ENSA 4KMMA 4XRRA 4BNGA 4FTWA 4DMRA 4LJSA 1O0SA 2CSUA 1ZAYA 2NXNA 1TKCA 2EW2A 3EAQA 4R8UB 2P40A 3EBLA 3TZLA 3PA8A 1HOXA 1ORDA 2BRUC 3FD8A 3H4MA 4GOKA 5IF9A 3OTQA 2GWSA 4MDHA 3THXB 4RV5A 4IKEA 2Q7XA 4S1OA 3AOEC 5MFPA 2P30A 4HNTA 1T1JA 2ANBA 1TTPB 2X3YA 3C43A 1R6AA 4PNPA 4F2DA 4BAGA 2A3NA 1P45A 1Y6JA 1K06A 1OTYA 2VDMB 2AF4C 3L82B 1V8BA 4RF2A 1URPA 3NBMA 5C37A 2ZDHA 3D4PA 2QGNA 5HJ2A 5TSDA 3V1UA 3CU5A 4MDEA 2DJ5A 1FSSA 2IHUA 3NKFA 3OQNA 5FOXA 3PIDA 4E12A 4N41A 1DTSA 2HNKA 4YH1A 4UTRA 1LA2A 2JBHA 4LCJA 3UMRA 5IM4F 3F67A 1X7WA 3GC6A 2BP7A 2Q1TA 1RBYA 2EC5A 7ICEA 3HRIA 3AEZA 3EXG2 2D5CA 2VDRB 3DLIA 5DIFA 2VP4A 3JQQA 1RBZA 3IELA 2VEOA 3BHIA 1SNYA 1KJQA 2RHBA 3BD6A 2XRYA 4M8IA 4QECA 5EEGA 1J5EB 1RRCA 4UBJA 3UK2A 1ESMA 4LY0A 3ZN2A 1U9YA 4N54A 4ZTZB 4FMDB 3MS7A 2LIPA 4PWZA 3NRWA 4LA4A 4YGYA 4ZOCA 5K4AA 1AQNA 3RSQA 3ANYB 4GQIA 4BO7A 1UXKA 5K3OA 1FYWA 3HH8A 4RJJA 3KALA 3MTEA 2QLNA 4WT7A 1XPUA 1EXWA 4Q39A 2UUCB 1P74A 2X9LA 4AMZA 1NKCA 4Z5XA 5TF4A 5K8JB 4LPSA 2J87A 5G02A 2GHIA 3RABA 4B6GA 2F8TA 3GLFE 5ULLA 1G3UA 3LDGA 3W8FA 7MHTA 1DV1A 2AX3A 2NVUA 3OQVA 2QZSA 4Q7EA 1XBTA 1G98A 2H08A 3IMKA 4AY6A 3Q7RA 2ZAMA 4NEQA 2WB2A 1GZ5A 2ZI6A 4GEKA 4E1VA 2VI5A 4D96A 1PS9A 4AJ4A 4OHPA 5IABA 1IHXA 4EY4A 3C8UA 1U9ZA 3H5WA 3W9SA 1F6BA 3FCUB 1FU4A 1P29A 3IBYA 3OETA 3UKDA 2VIXA 1DU4A 2J32A 5IXSA 2YJGA 1I4OA 3T3DA 3T5LA 1B4DA 1NMSA 1V37A 1Z3CA 4I4TF 4N6OA 4DMHA 1WXWA 2OL4A 4MVJD 4ZMBA 3HVKA 4Q7KA 1Q7RA 1ZD9A 3HHEA 3FY4A 1VSUA 2X7JA 3QKRB 5CVDA 1V8ZA 3FX2A 4NH0A 4QZ8A 4PJ0U 5JHHB 1EMDA 2DR0A 3ENVA 3LXXA 2FLWA 1PV4A 1ZQMA 4W1QA 5LP6C 3EFOB 1HWYA 3FXAA 5DDIP 1J4AA 5SZKB 3VC1A 4BFWA 3FMFA 1R1DA 3DT8A 1OFIA 1KY3A 1WY7A 1EAYA 1HOTA 3P0JA 3NR2A 2P4HX 3MAAC 2GCOB 1L3CA 2XUIA 1BVUA 4I1RA 7ICRA 1K66A 3L7JA 3SXJA 1J0DA 3RBDA 1U9IA 1M2FA 4KVGA 3WIEA 1FYDA 2ASJA 1NR1A 5DCWA 3RBEA 1J39A 2XTNA 2EW1A 4HEA1 4KSBA 4G9BA 3N0XA 3LYHA 1YI1A 1MEEA 2QIOA 2DQZA 1T5HX 2HCRA 4DR6B 4FN5A 4FFLA 5L9AA 3I58A 1SKMA 2WUFA 3TRKA 3AVXA 1U7ZA 2XF8A 1V8PA 1N0WA 3LC0A 4NOKA 1JV2B 1QBKC 2XE6A 3AL0C 2PZEA 2ASLA 3GRZA 4OEHA 4RORA 3FH0A 5SY4A 1S8AA 2IXBA 3U7GA 1IZ0A 2DUJA 4HAOA 4LZAA 1JN3A 4PS0A 3T9EA 3V42A 4ZTUB 5B12A 1JMVA 4QM7A 1C1HA 4TVBA 1A6SA 1H3FA 1XXHE 2O3JA 3E9DA 4S12A 3THOA 3OZDA 3CNBA 3P0HA 4G8CA 2JCBA 2G8NA 2ONYA 3VHXB 1U04A 5AVUA 4MTLA 1E4VA 4NTZA 9ICHA 4X95A 2YVKA 3WWOA 5BMVA 1N2CB 2JIMA 1P6QA 2RJNA 5E7JA 5FPYA 3WYBA 3H42B 2NO7A 2IELA 3H40A 3JWPA 2CZQA 2XMPA 3BG5A 4PBTA 1NMEA 1XZBA 3P52A 4OB7A 1ZNQO 4AL4A 1N34B 2JGMA 5KTTA 4KMSA 1XWLA 2KFZA 1P1FA 4GM1A 2YJ4A 3TKYA 1C7RA 1C8KA 2XD9A 1D9ZA 2BKXA 2JKZA 3IHKA 2MYUA 4OB6A 5HQJA 3KOYA 2GSWA 4F3RA 2X3UA 3R7BA 1RMQA 1R5BA 2W3SA 1IXZA 1PFGA 2VJCA 3AP1A 3GH1A 2C2GA 3LYLA 4KWHA 4KR6A 1Z4QA 4EUEA 3COSA 3UQ0A 3AIMA 4YO8A 3UT5B 4PICA 2XAAA 2AHRA 4I2JA 2F3PA 1Z2AA 4GMKA 2RHGB 1M66A 3ZCQA 4EJMA 1GPJA 2K4MA 5B1HA 3NVWA 2YXPX 2AOXA 3NIBA 4HDRB 1ADBA 1HQDA 5ISMA 1XP5A 2C59A 1B22A 2H63A 4K6OA 4B83A 2AG5A 1IFXA 3U7QB 1MN8A 4QDJA 1C9JA 5IC5A 4Q45A 3VYTB 4XB2A 5ED0A 2CUZA 2Y1WA 1B0UA 2J08A 4PRZA 4GL2A 4YN3A 4BO5A 4BUCA 1YQTA 5ALVA 3KQPA 1CUWA 5E9QA 1IV8A 1D2CA 2PX4A 4LZWA 3N7SC 3OE1A 1Z88A 3ESDA 2VWGA 4HGQA 1R9MA 4NESA 2G5HB 1YU9A 4F04A 4PVDA 2ZB8A 2CV1A 3QNMA 1X9GA 4CMIA 3MCTA 2I2DA 3PQ5A 5J0QA 1W1UA 3CLSC 2IPLA 3D8SA 3X2SA 2XCOA 3KVOA 3ABOB 1QYXA 2BEUA 4YPFA 3WNDA 1EXVA 4RPIA 5KQSA 4HNAB 4YR2A 1NTRA 3NATA 4QICA 3T7DA 4DEVA 1T26A 2ODPA 3CRQA 3QOXA 2AG1A 5CDYA 4BUGA 5J9FA 1QR2A 4MF8A 3BGDA 2J5BA 1BU5A 4AJJA 3SAHA 4Y2UA 5B4TA 1KP3A 3GCGA 1RI4A 3EXFB 4HDKA 1K6MA 4AVYA 4AECA 2AU0A 2OAP1 4MKHA 2P2YA 1GJRA 3H4VA 5KNCD 1BA2A 2CXRA 4FYJA 3O2SB 4H7FA 5FOUA 3SQOA 3D31A 2QD1A 4P86A 1FIUA 4GSYA 1VPTA 2Z6AA 3HKZC 2Q07A 1MHPA 4JLJA 4NFSA 3TEJA 3USZA 3I9JA 4UJ3A 1XJQA 5HTKA 3EVAA 3A31A 3THWA 2YFHA 1K5DA 4YRDA 2GEKA 4QGHA 4C5AA 4O0MA 3RSLA 1UZAA 3NM5A 2FFHA 3NHSA 3SR4A 1W6UA 3JQFC 4ALLA 3FOCA 2ZQ5A 4ZD6A 4NECA 2I7DA 1JF8A 5DMXA 1PS8A 2O8FA 2JA1A 3GB9A 4NLBA 1V8DA 1ZCZA 3P26A 4OQZA 1PYOA 1Q95A 4U2DA 1PR1A 3OWOA 1AKTA 4HZUB 2WJJA 1YZYA 4UDYX 4DMGA 1A5AB 3N05A 5C1PA 4BPBA 4M1YA 4K6HA 4V0LA 4C20A 4GC9A 4IILA 4MR9A 4MW9A 4GX0A 3PJRA 3IDOA 4WBNB 2QMQA 3KKLA 2VC2B 5AESA 4PPNA 1ADGA 1QQAA 1NLFA 1COZA 1V3TA 2TSYB 2CPRA 3AETA 5L3RA 2D1FA 3MJCA 4E5YA 1I2CA 3NTLA 2GBFA 5K7SA 2AH5A 3ANLA 1BPEA 3LOUA 3ZHCA 3BMOB 4Z4FA 2ZJ8A 4S05A 3S2EA 3F6SA 1Q92A 3BJEA 5CIWA 2HV9A 1I2BA 3DHNA 4XIFA 3ZHTA 2IS4A 3WL5A 3HUDA 2QZ9A 1RYZA 3L0SA 2DKZA 5DKFA 3BULA 2JFNA 5K6TA 3H8WA 3I52A 2HRCA 1GD1O 3M83A 1FW8A 5KYUB 1E0KA 5DLDA 2DHCA 3L8HA 4M8SA 1NJXA 3IBSA 5MGNA 2M98A 4PZYA 1WF6A 2GHRA 2R7NA 3JALA 2BCGY 2J30A 2UVUA 3FCAA 4YUWA 1K92A 1WXQA 2X15A 1X70A 3IAAA 4D4JA 5JS7A 1ID1A 3S0JA 1FX0B 1WEKA 1CX9B 3UOWA 1T9CA 3CLUC 3DNFA 5EHGA 4CLEA 1G5RA 3SYLA 4E2ZA 4WVFA 4CCYA 1LGYA 1P5ZB 4NI5A 5AOBA 5IG2A 3SXUB 2QM7A 4C30A 2ZUDA 4K7JA 4Z49A 1M7HA 4HRYA 2Q27A 5EFOA 3COYA 4O4HA 5COQA 4QUJA 3JPQA 4HLUC 3HUFA 3DOEA 2GXSA 2Z5GA 2PFPA 1YAJA 4I28A 1NXXA 2V65A 3A4YA 5EZYF 2FQQA 4H77A 3ITDA 4P2GA 4MI6A 1THMA 1LV7A 4IBOA 4ZGBA 2LKYA 3R0IA 4G89A 1QGUB 2RK3A 2AQ0A 4E5UA 1NA5A 5DYGA 1E89A 3T99A 4QEDA 4XCVA 3VJMA 3FUWA 3KJFA 4DRXA 2QP9X 5ECWA 4C08A 3OQIA 5JBNA 1AV6A 1DL5A 4N7JA 3QBTA 4DCUA 4EUNA 1GA1A 1D1SA 1KO4A 2O8VA 3PNKA 1D0SA 3ND8A 5C5CA 3ZCVA 4C4SA 4ZEXA 4JU9A 4HEHA 4D3DA 8ATCA 5CDHA 2X7XA 4B2LA 1IJEA 1L1RA 3FWKA 1J49A 3LXRA 3HX0A 1A9QA 1AGPA 1UWKA 3L2OB 1DCTA 2PMWB 3MR5A 1VE5A 2L42A 4ZVNA 2QLTA 5I48A 1CP2A 4V02A 4BE9A 1ENPA 4MR9B 3QVXA 5B30A 1GTMA 4FHGA 4OI4A 3R41A 3LUAA 4PHHA 3P4XA 2XVTA 3WKEA 4EPWA 2JK0A 2HCBA 4B76A 3C85A 2C4VA 8ICOA 2P8JA 2PYIA 1WX1A 4PW0A 2FW6A 3GRYA 3PT9A 5F5XA 2PMEA 4A10A 4ZIRA 4DV4B 2QQFA 2A2ZA 2PUJA 4CMGA 1W36B 1EFPA 4QIHA 4RJTA 4RIFA 4J9KA 5LOVF 4ZGWA 5JJ5A 2VP5A 5M29A 1X7ZA 3DBRB 4QAJA 3I5XA 5JW6A 4Y0VA 4NCIA 2ZJFA 4IH1A 5F7OA 3BQMB 3P5SA 2JLSA 2XYGA 3QXXA 4JVNA 4G41A 3UWOA 3T0GA 3BS5B 4LFAB 4B6FA 2B69A 4R2MA 3UHFA 2W48A 4HGRA 5HE9A 3GPDG 3W5DA 4E21A 4EFMA 2OHVA 3SDZA 1ZH2A 2YNMA 4DG9A 2ZYSA 5F4ZA 3PD7A 2H2HA 2JEGA 4UMVA 3IEPA 5KQLA 2Y1OA 3DE4X 3HP1A 1Y1RA 3PRHA 7ICHA 4M6WB 4I55B 1SBYA 1LV8A 1R27A 4RSGA 3BZKA 3AU8A 3QQPA 4ECZA 1ESNA 2Y2UA 4P83A 1LLDA 5FWDA 2I9PA 5JCOA 1XSEA 4N49A 3ORFA 4OUKX 3JPYA 1L5HA 3VHLB 3MR3A 1CQZA 1YZ3A 1ZQOA 4YDHB 2OYRA 4R31A 4KOAA 3I30X 3LOQA 1QP8A 1EEXB 1X39A 3ESRA 2WLSA 3QJYA 1NNI1 2J3QA 1MU0A 2TMDA 1ZOLA 2ZE6A 4ZO7A 5FBWB 4GI2A 1PFYA 3PX3A 4LS3A 4WOPA 4ND1A 1HKHA 3WRYC 3G1UA 1F2UA 4FYPA 1GPNA 2PV0A 4IZIA 3DW3X 5TVKA 4EQ6A 3CN9A 4RU1A 2XR1A 4PGFA 3BFXA 4CRWB 5MHTA 4OFXA 5KREA 4ZAVA 1MA7A 1B15A 1FNSA 4FOTA 3TIIA 5K0BA 2HBRA 3O8OB 1VKOA 1W88B 4O1HA 3B6MA 3EUFA 4HOYA 5A4FS 3R0QA 4F60A 2G4LA 3EZ9A 2HR1A 2VK8A 4G0YA 3P32A 4FO6A 2FN4A 2H65A 4E94A 1VE3A 1E1RD 2WNHA 8LDHA 2BKLA 4DDWA 5C35A 1FK8A 4GOND 4WOKA 5LZ9A 3FNEA 1MFPA 2WWHA 3CPSA 3DAHA 1ZQEA 2EF1A 2HU2A 5F98A 4BL5A 4BVLA 4BLSA 1WWKA 3X1KA 1EVZA 3B1WA 1L4FA 3TL2A 4KN8A 2XUFA 4G0XA 5JATA 1IB6A 1NQWA 2PQMA 1Q57A 1Q6YA 2OFPA 3G0OA 3IPRA 3PVZA 1ZG3A 4TQSA 3AZQA 1KEKA 4B75A 4OJMX 4BNHA 5DG9A 4XLLA 2POQX 3K1TA 1PVQA 1YL6A 3LUFA 1DBVO 1GPWB 4KN7A 1U0LA 3GEBA 4P8RA 4GKJB 4V0QA 4YAEA 3OBBA 1V71A 1PR4A 2GO1A 3NUZA 4B6OA 1IUKA 3MRVA 2Q1YA 4YMLA 3GG9A 7ICNA 2NU7A 3SZOA 2GM4A 4AT1A 1IQUA 2ZM5A 1NPYA 3I23A 2DFKB 4IUYA 1KERA 1JFFA 1C3LA 2AJCA 2A67A 3N2ZB 2OG1A 3UICA 3LW7A 4DPKA 4Q3BA 3GGSA 1ILWA 4E70A 1W5AA 3CF2A 5JSYA 1E6KA 1GA6A 4HKTA 4NHEA 3CE6A 1J90A 3QOWA 3KB2A 3RYFA 1G20B 3RAJA 1Z5NA 4Q4AB 3OT1B 4KIJA 4YRCA 4EHIA 1EVKA 2E1RA 2ODEA 4P3NA 2XCTB 3RTDA 3PWZA 3M2PA 4FHZA 2F59A 1SWVA 2NU8B 3UXMA 1LZLA 3EFHA 1X80A 3F4BA 3RIXA 3SZUA 4WA8A 4Z1OA 2DG2A 3FG9A 4NMXB 2DKNA 1UM8A 2H54A 4FXOA 5KTKA 4C01A 5FFFA 3W5UA 2FPKA 5LXTB 2VAXA 2OQRA 2FHPA 4F2PA 5DEIA 1Y1LA 4HNRA 3TLCA 3TVDA 1PZNA 3QKSA 4B6JA 2YUIA 3CUSA 5ADUS 3A28A 5J0XA 1G8JA 4Z6CA 3AR5A 2GCOA 2Q4RA 3WY9A 1LNQA 1WDWB 2ID8A 3G7SA 4I1UA 5DHRA 2AJDA 5EIFA 1GPLA 1UBEA 3N5CA 4JA0A 5DNEA 5F73A 4GOMD 1PN3A 3D1VA 1M0TA 3Q8QB 3PX6A 1B6RA 2HCTA 2F43B 3C4JA 3KLNA 3Q6MA 3GAFA 1XAGA 2GJ8A 2HNBA 4RUKA 4RXUA 4YQEA 1G1MA 2HVIA 4X3PA 3O8OA 3R0VA 3T1NA 1BKDR 2I87A 2EEZA 3I6MA 4OHKA 2FRDA 1K3UB 2XBMA 1G9TA 2AFIB 4MDFA 3PUXA 1DPGA 2OGUA 1PTJC 5EJ2A 5BO5A 4DIMA 4DFDA 3HJTA 2BJHA 2ZAGA 2UVPB 4KXUA 5SZIA 5TS3A 5KSYA 2NN3C 4K0RA 4L0QA 2DMRA 5JNTA 1N9KA 3AKYA 3MLAA 1U7XA 4Q9AA 5M2QA 4CN8A 1NKSA 4BTLA 1OFHA 2DFDA 2DFPA 2C92A 3QLUA 3RTBA 4DQSA 1Z56C 4ENQA 1U8ZA 4Y6LA 5D7NA 5JSFA 2C00A 4KLSA 5B58T 1I94B 3QEMA 2B30A 1HEKA 3OEED 1FP4A 3PVXA 4R3NA 2GERA 4R40A 3O94A 2VJ4A 1UEJA 2GUGA 1U0TA 1VRVA 5CLQA 4U0JA 2RHDA 3VZCA 3KHGA 3ESYA 4DCSA 1AJEA 1DWUA 4KXYA 4Z8YA 1QP4A 5AHKA 3H5TA 4R65A 1OXXK 3C7CB 5KJ6A 1CETA 2G1PA 4BLQA 3ABIA 3K20A 4G0UA 1KIAA 1RRVA 1PVPA 1Z0FA 4UCWA 2DY1A 1O03A 4ECUA 3H84A 1R9NA 5I9SA 2PS3A 5JLJA 1J07A 4DVJA 1KMIY 1T9DA 2VUHB 3AF2A 4GI7A 1FL9A 1E8MA 4DG8A 1KAGA 2HMSA 3DVLA 1N6HA 1V5IA 5FR1A 4OBEA 4GGMX 4FS8A 1ULHA 5JTUA 4X5VA 1RWPA 5F9MA 1RRFA 3CZ4A 3D8HA 4YN4A 1HYHA 4JI3B 5DQHA 1C3JA 5CLFA 1OLXA 5JRTA 3IPCA 4DW8A 3EGDB 5DCYA 2BVNA 4LTDA 1JHOA 3DBHB 4OSEA 4EPXA 1ZQNA 5KDOA 3TQTA 3OIYA 3ANTA 2YVQA 4ECTA 1K7YA 2ENWA 2ZI9A 3H11A 2PLNA 1XDUA 3EH1A 3NVDA 3VJRA 3QFFA 1M33A 1WUJS 2OCAA 3L4JA 5CT8A 2ES4A 1L7QA 1C4XA 1QK5A 1QO9A 3IXMA 3NVMB 4QBTA 1U90A 5K2OA 2ZI7A 2OXOA 2X8JB 3W77A 2PXHA 1E96A 4H15A 3C1UA 4YDSA 1E1CB 4QC2A 1DAHA 3B8HA 4ZVQA 3WFJA 5D5PA 3WLOA 3Q7EA 4MGHA 3ZIUA 1XWFA 4CUJA 3JAMA 2JNWA 3DE6X 3I83A 2H4HA 3EWNA 5F9LA 5BSKA 2ZIAA 4UXHA 1NM5A 5EKDA 3ZCXA 2CUNA 5CYPA 5LQJA 4IX9A 3OI7A 4RKFA 3THVA 2A9VA 1EM8B 1NPDA 4X92A 4Y67A 4ZO4A 3RB3A 1UKEA 2XNKA 2G0TA 2Q3CA 3T7TA 4HB3A 2GKOA 4NXNB 3JWHA 5AKGA 4JP1A 5K0FA 1AY0A 1RYYA 3T38A 3RRGA 1H2BA 2VXYA 1DXSA 1D2EA 4M89A 3TRFA 2ZAIA 3ZBUA 3LUHA 3L7CA 5GJWC 3C6MA 5H3LA 4CU5A 4Y6OA 4C6HA 1EINA 2JLWA 2WFMA 1NHGA 2GVNA 4IXNA 4KLTA 3GEEA 4JS0A 5D3ZA 4BWFB 4HAWA 3WLEA 2OSVA 5TQ0B 1XZDA 3TAHA 4Q1BA 1RLIA 5BWMA 2DOKA 3V4FA 3GLIE 3RVLA 2WAQF 3SN6A 3KOXA 1T3QA 1P4JA 2V7TA 1PEDA 1PIWA 5JI3E 3NM4A 1W0JA 5FI5A 4J9RA 2CNWA 2QRKA 1ZJJA 3EY9A 4EM6A 1QPZA 1S2MA 2HXYA 2UUBB 4ID3A 2Q0ZX 1L5YA 2HLNA 2WFLB 3R75A 2E5SA 1SKWA 2A1TR 3S4YA 4EY5A 1ZMRA 3PFWO 4G85A 5DXFA 2AX4A 5J2EA 1R4MB 1VDMA 2QUKA 2WMNB 1BTOA 1IPHA 1YS1X 2A59A 1MB2A 2HBQA 4PBSA 3AOEA 4NLLA 4ZVOA 2C07A 3I1IA 1H69A 1COWD 2WD8A 2WHPB 2ZAYA 1Q0PA 4TUQA 5E6RA 4NBWA 5J8YC 1U5AA 3BE8A 3HU5A 1BXZA 2ZANA 3NPMA 4P36A 1KE1A 3DJYA 3CRVA 3QRWA 6PFKA 4LXIA 3OZFA 4HRVA 4PE5B 3TMAA 1Z8FA 3MJFA 1YQWA 2LUOA 2GYVA 3A9TA 5IYZB 4IFBA 3AM1A 5B1SA 3LQYA 3ZHUA 3A0BU 4EGJA 2YB4A 1XZNA 4UEOA 5EP3A 4U6SA 1CNMA 3E9EA 3H1BA 4NMLA 1WMBA 4OQXA 3UF0A 4MWOA 5EA2A 4BNWA 2C2OA 1TAMA 1XFAA 2ID9A 4UAVA 3F6EX 1QH1B 4FQ7A 2GPNA 4JVSB 4PQFA 1I1QB 4Q3KA 5EWMA 3WK8A 1CHDA 1RHKA 4IRMA 4U7JA 1P1JA 3NDIA 3S40A 1ZJ5A 5T14A 1NW9B 3JCZA 4JJ4A 2RHFA 2GHQA 2C2HA 1H2RS 2HOIA 1TRHA 2P9GA 1YIOA 3A70A 4MVJI 1CD5A 4WK4B 5CCDA 3HN2A 4LMRA 3GZFA 3H6HA 4O4JA 3H2JA 4PBRA 3UXOA 4UEWA 4C29A 2F8LA 2Z09A 4CVNA 1YRHA 1PDOA 3QOFA 3ZWPA 4G9EA 4EKDA 4OAOA 4TKLA 9ICSA 1CUZA 1T5IA 4TTTS 2IT1A 4RETA 2XXBA 4FNOA 4JITA 4WK2B 4BC1A 4EJSA 2KSOA 1W0KD 1XU4A 1JX4A 3VV2A 5H82A 1OXBB 4Q21A 3OP4A 1TZMA 5JH7A 5HQTA 4B48A 1KVTA 3HCDA 1XXHA 2LPEA 3DDWA 4TWAA 1PQWA 1CQWA 4Z0HO 3UENA 3HM2A 1EUYA 2J0QA 2FMFA 2WM2A 3CNEA 3D7NA 4LE1A 3UMCA 1QWOA 2JLAA 1UFQA 3BZWA 3VGJA 1UAGA 4EIWA 2XB8A 1V2GA 5EP4A 3C8DA 3RFCA 2A1JA 4J2HA 3N39C 4UEQA 4HH3C 3ETRA 1QVAA 1U1FA 2Z83A 3EIXA 5HS6A 2WJZB 3MGAA 4JWMA 4MP6A 4TSRA 2IYTA 5KT7A 2PBZA 4Y3UA 1SXPA 3C6XA 2WG0A 3V1TC 5L51A 1FJXA 1AN0A 1OZ0A 4O4JF 1FCJA 1TQDA 4AZVA 4YP7A 2GBLC 2AS0A 1RYFA 2D3WA 4ER7A 4JUFA 1TYEB 2HRQA 1LKYA 3LU1A 1SULA 4K3VA 2VRCD 3C74A 2VJNA 2NU9A 1HIWA 3GLTA 3HGMA 3VDQA 4CL8A 1O9GA 3ZDAA 1PE0A 4NL9C 4IWYA 1OR8A 3FBGA 4RE6A 1GTG1 4NBNA 2FZVA 1L5LA 3ONFA 5FO1A 1A4XA 3UJBA 3HBMA 3PHCA 3F2IA 4HLUA 5F2OA 4O4LB 3F2DA 3L1UA 1XQ9A 3M3HA 3VPHA 3SICE 4DKJA 1HMYA 2UZ4A 2BBTA 2R5NA 2Z1MA 3KLOA 3IURA 3VKHA 2A92A 4D3XA 4ZO6A 1ADYA 2VRWA 2JAQA 4BQOA 1WO8A 4DR7B 3KTFA 4GC5A 4EHHA 4TV9B 1CUYA 1IY8A 2R66A 2FSUA 4ZMSA 1AZLA 4NATA 5FAXA 4AF8A 1TIBA 2RHOA 2OFWA 3DXYA 1KHHA 3W1VA 2P6PA 2J0UB 2YHIB 2ZIVA 3C7DB 3D7LA 1LJ8A 1WQ4A 4KWTA 4MCAA 4NV1A 1YOVB 2QIPA 4IDDA 3H5IA 1THGA 4I2EA 2OO7A 1EP3B 1Y5LA 1RPZA 1CJSA 1EFHA 1TK3A 2CFCA 5HFNA 3C4VA 3WJ2A 1PKEA 2ACWA 4AQDA 1SQGA 2PQ6A 3H8JA 3E3LA 3HMQA 4JT9A 1ZQLA 4M83A 4GOJA 2XF2A 2PDAA 1T9GS 3CLVA 1PL6A 3GDWA 3Q0IA 1KQ3A 1TMOA 3EGVA 1L8LA 3CB4A 2PE5A 2YZMA 4HQFA 2FPLA 1W5BA 1EB9A 4FBLA 1ZS9A 3QVGA 4Y6RA 2K8CB 2JHCA 4F2HA 3G9ZA 4MAAA 3LKZA 2UYQA 4FOSA 2I0FA 5EPEA 3K0EA 2RKOA 4IOJA 1EX6A 5C53B 2FJPA 2IX9A 4YB8A 5LP6B 2L0XA 2RK6A 3D6TB 3M81A 4UB5A 4AX8A 4CT5A 1F8FA 3U4GA 3PC8C 1XP8A 2AT1A 1BQ3A 3DEIA 4OL9A 4R2KA 3EGEA 3GJTA 4NM1A 5DHUA 1V38A 3CZPA 3HEBA 4NQRA 3G9UA 1VJTA 3GT7A 3O8BA 3W06A 5IJ9A 2QLMA 1B7GO 2CLDX 5KPJA 3KKOA 3IT2A 5D51S 4DQRA 1D5WA 3IMEA 1RMYA 1NRIA 3N76A 4K9OA 3SEFA 4AJOA 4Q4AA 4YYZA 2OM6A 5CPBA 5E7IA 1NLYA 5C3UA 1M6HA 3M89A 4R8SA 1SBZA 4HXYA 1QVZA 5BMOA 1Q20A 1QF6A 3M1IA 2E1EA 1O77A 1MV8A 1TEHA 3S7TA 1ILEA 1RLTA 5J1TB 3WAKA 1KDOA 2IF2A 2IOFA 3GMDA 3VCBA 5ARBA 4JR2A 1UWLA 4MEBA 3AJEA 4G9GA 4EA7A 1QH8A 4R8VA 1GNPA 3B6ZA 5IDYA 3SPXA 3TI9A 2Q3BA 2GLXA 4FX5A 1ZD1A 2ATXA 2XYQA 3AG6A 3FPAA 3JRNA 4HLQB 3ZI0A 3NWBA 5IC4A 3GIDA 2PKXA 3LCRA 2X5OA 3VKWA 4QUGA 1YZ6A 1YB6A 4XSHA 1K2VN 3EDOA 9ICIA 2IITA 3HCRA 1YT3A 4AF6A 1XD8A 1RWVA 3BD9A 5K0ZA 1M2HA 4LRTB 3KCNA 1ZGCA 2O8CB 4ZV9A 1X1DA 5JZSA 4RESA 1T9ZA 3MJTA 4EG7A 3FCSB 4WDRA 3GPLA 1SV4A 9ICCA 4OHZA 1XLVA 4NS4A 3RAGA 5KIAA 5AK5A 4DIDA 3PEWA 3ZGYA 2YKGA 3TACB 4DBLE 1ZUWA 2W9CB 2XYVA 5EQFA 3WRYA 3P9IA 4A82A 4MVJH 4B3RB 2C2BA 1CZNA 3ROTA 5I51A 1KOGA 3D7KA 3E7XA 2GZ1A 3ET5A 4G86A 3TSOA 2AGQA 1CKEA 5BQ3A 4DLAA 3A1UA 4ZQHA 1BE0A 2GTHA 2F9LA 5AM5A 5THQA 4KQJA 1E4EA 5DLPA 3RTAA 1J8DA 3V2HA 4X6LA 4UPEA 2DH5A 1W36C 2RONA 3RRFA 4L02A 3QWFA 2V7PA 3DPIA 1YULA 3IDAA 1XEWX 2HDHA 1MQ2A 1KBZA 3BMNA 4R9SA 3SYMA 4B40A 1ZM2A 2IBMA 4PFQA 2BH9A 5LNK1 2BHSA 5EIHA 1JZSA 3ZGVA 2WMDA 3FMIA 3A2MA 3R0ZA 4XYEA 4I2NA 4R9UC 1QH0A 4CIWA 1MBZA 1LXCA 2PQ0A 2X41A 2W9CA 1QG6A 3AWIA 1A8UA 4G3IA 3D7MA 3D4IA 1XUOA 3TRDA 1I1NA 4RGVA 1XQ6A 3CISA 1N5IA 2G17A 1M2VB 5SZHB 4OUDA 3NBXX 5A5VA 3U60B 3L4BA 4HJXA 5DSZA 1GPYA 1G8SA 3LKVA 1JAZA 4RCVA 1U9CA 5EJ7A 2E8OA 2X58A 2MMCA 5IVKA 3CP8A 2QHXA 4B3JA 2C7RA 2O8DA 3CH6A 2J9ZB 2ERXA 1KS9A 2JF0A 2NADA 2Z5FA 3EIOA 3DULA 1MB9A 2P2GA 3GT0A 4IDBA 4Q0MA 4XYMA 3DCIA 3PDWA 3IB3A 4H3VA 3T1QA 3I37X 3PRYA 3QYFA 4NVRA 3H8VA 2QKQA 1SVKA 3UA4A 2X0NA 4UMEA 4DIKA 1QLHA 4ZCMA 1PZXA 1QCCA 1QQTA 2WNSA 4N03A 5G5GA 5KAIU 4NONA 4HNQA 4I81A 1HRKA 4I6GA 2XNDD 2CHEA 3FZEA 4KEAA 3O4HA 2QVZX 5F1KA 2V6JA 1W1WA 2QD4A 4ROTA 1Z6QA 1RWNA 4X63A 2GESA 3P2JA 3MB8A 1Z00B 1QCDA 2XMSA 2GTIA 3QFSA 4WI1A 4YS6A 1VFPA 3LKBA 2W8ZA 5A05A 1ZQVA 3S2YA 4H7KA 5JANA 5KQPA 5L4LA 1NOKA 2NVOA 4D1YA 5LOVB 1KIFA 2FJ0A 2K4EA 4NLKA 2J5QA 4M1WA 5AM3A 4GPIB 4CFSA 2QTCA 9ICNA 1RLMA 3PV0A 4PXAA 1II8A 2AFRA 3V1LA 4UOZA 4ZOHC 4Z0PA 1KRWA 3VO8A 1EQUA 2H7YA 2ZSKA 2P2NA 2V9WA 1WCV1 4OI1A 3ZDQA 3H9CA 5C8YF 3W5VA 4LZNA 4R6WA 521PA 4GXTA 2JD0A 1NK7A 2P9EA 3U1TA 2XPCA 1VHJA 4ZO9A 3KOWA 3F2BA 5BWLA 5J0PA 5ER9A 4UZFA 3DL7A 3NDPA 4M60A 4KLGA 3ETLA 1SV0C 1JEQA 1RI3A 3B1VA 3EB9A 3CR8A 3L41A 2LKCA 4HWGA 4XPIA 5ENVA 1TV9A 5ESDA 4AROA 2DPLA 1QK4A 1ND6A 2JAOA 1WCYA 3EZFA 4LC9A 2EGUA 3NHZA 4LXQA 4YJ3A 4J9SA 3C6ZA 4JYMA 1G20E 2AXTU 1XMIA 3CC8A 3QV1A 3CHYA 4P81A 3SJ7A 4BB9A 1YIAA 4IIBA 4C0BA 4F1WA 5ESRA 1RM4A 4IHQA 1VM6A 1YRLA 2PXXA 3MLEA 7ICIA 1JLHA 1KSJA 8ICIA 3TF5A 3PT5A 1NVVR 2R8EA 4ZU6X 3A3YA 3MTAA 4CZ2A 3O3CA 3KUKA 2DPIA 1A5TA 1DBSA 4H16A 4I2GA 2NGRA 4JQOA 4PX2A 2ZYDA 4F5WA 2QS9A 4XYGA 4LJYA 1QG4A 4C2AA 3UOAB 3SS7X 3LE8A 4G07A 1SOWA 2C5BA 3H87A 3V8RA 2D4AA 1FEZA 2GAFA 5FWXA 1ZZGA 5JWHA 1WXEA 1C7YA 4P4MA 1SXJD 1VYUA 1PWZA 4XJVA 5F76A 4LJRA 2EJBA 1ZCBA 4I8XA 1EBBA 2ZDGA 2UVVA 4Z7JA 3K70D 3DZJA 2GPAA 2I9GA 5KYUA 2CL0X 1VBKA 4JXKA 2JATA 2HU7A 3C1AA 4HD8A 1BPXA 2P0EA 4TWJA 4ALIA 3DTVB 5AQ1A 1A9OA 1A0PA 1Y8QA 3R7LA 5AI5A 3U62A 2H8GA 5B3LA 4LF4B 4QU8A 1N6KA 4AZ0B 2X8AA 3O0FA 1U0OC 3OMXA 4WLVA 3EX7C 1SUCA 1YQXA 4LYYA 1IJFA 1AO3A 3BJRA 3QXHA 3JQGA 4DR2B 4JMPA 5KPDA 1KI2A 1X1CA 2E18A 4BQFA 2P79A 1I3MA 2I8AA 3TE6A 1T8SA 1N2SA 3NGLA 5FNZA 3KJZA 3RV3A 1WW2A 4C03A 2D1YA 2GYWA 2QAGB 1QAMA 4GWKA 4G2TA 4FWIB 5KX5F 1RVDA 2F3NA 4RJLA 1LK0A 1Z47A 5CDFE 4JOCA 3A1EA 3ORQA 2BBOA 4AY2A 1U28A 4TMVA 2GA9A 4IJMA 3W5AA 2RAUA 3PEYA 3FYUB 8GPBA 3MUOA 2AEEA 4FEEA 1SD2A 1ZWKA 4E22A 1QHHB 3DTNA 1FNMA 2GXUA 3D1JA 3RKRA 1Y3AA 1UFKA 3JQAB 4AYWA 5IJWA 1HA3A 4DC0A 1PS0A 4OG2A 5T67A 4KTTE 3OM1A 1CRXA 2BUAA 1XEWY 3AVPA 5AOCA 3A8TA 4JB0A 3O4GA 3U16A 2VPWA 1GARA 2WSSD 3AR8A 4M1QA 1E77A 2OILA 1VSVA 2E85A 3ITNA 3RIHA 7ICSA 1TPZA 2NSJA 5JY6A 1G2QA 1BE6A 2D8CA 2OVFA 4RCZA 1W4CA 3LPMA 3AR4A 3FFBA 2F44A 1VB5A 1Z7EA 5GGYA 3EVTA 5HR7A 2NUTA 4JJKA 3RT1A 3COZA 3KYBA 3TW8A 5F3XB 2PX3A 3Q7TA 2VUSA 4ZVTA 4EHJA 1YCDA 1KH2A 4PHGA 4Q1EA 2XNJA 1ZYQA 2O2EA 3VO9A 1LBEA 4L5BA 4MFFA 1CZHA 2GR9A 2IIVA 1EX7A 4YRBA 2A1IA 4RPHA 1EM8A 5A9SA 1GEEA 2LTAA 2BW0A 2J3IA 2VHQA 4WZAE 1R50A 5BW4A 4ZI7B 1OD6A 1L0BA 4F2SA 2PSFA 2FMXA 3NAQA 3VDNB 2GLEA 2ZBQA 3FKJA 3TXAA 2HMVA 1YR2A 3BOSA 3UGQA 4Y1FA 2VTDA 9ICLA 1YFZA 2ORED 4LWPA 3EG5A 3STVA 3HKDB 4Z8XA 3JD2A 2XVXA 3T7EA 5JUWA 1JILA 2BGIA 2G82A 3X1JA 1GVHA 4DLGA 2O8BA 2CWDA 3DLCA 3M1LA 4JJFA 4PSKA 4PX3A 3C7AA 3FNGA 1DTWA 1JG3A 2VHUA 4X44A 1B4FA 2XIDA 3K1RB 1GAJA 2A0KA 2NLOA 1OREA 2POCA 2XX3A 3JQ9A 5CTJA 2QLLA 3EZ6A 4BOYA 2XV1A 3HVIA 3BEOA 2ALZA 4LOIA 5E6RB 4DLKA 4ZYWA 1ANKA 5ECDA 4ZVKA 4BDPA 3O4FA 2JHGA 4UW9A 3IUYA 4FSHA 5ITZB 3IT1A 4CKXA 3L49A 4P84A 2XEDA 2W6QA 1PBTA 3OA2A 5G3YA 4CEJB 2DBQA 1PQYA 2VUTA 3FUTA 3K53A 1UK6A 1Z8DA 1Q17A 1UJNA 2WJWA 1BNPA 5ERGB 5HBGA 1UPCA 3K1JA 3VBCA 3JD1A 4MRVA 2F62A 3SS9X 4FJ1A 4PO1A 5AM2A 3M4YA 4KMOB 2ZRKA 4INAA 1GAEO 3NV7A 4KKXB 4WXEA 5DNAA 4AZ0A 2VWQA 3QKRA 1P7PA 3MTGA 1YZQA 2REQA 5JI2E 3T6KA 1B43A 2AN9A 1VI5A 2HYDA 5BYAA 4YY3B 3W2TA 2BGJA 3GJYA 2Z95A 1SKRA 2W8LA 2H16A 1WLYA 3IP4B 2XY4A 3FB4A 4H4DA 4YCBA 5K0LA 1A5ZA 4CLDA 3L8FA 3BICA 1M1YA 3U1VA 1LNSA 1CUSA 5CNIA 4KPGA 1FFVA 2P9BA 4URYR 3VTAA 4YAJA 1TUBB 1GYRA 3LD9A 4FBTA 4B17A 4BCDA 3KUUA 2ZSIA 3CEAA 1WEHA 1Z6AA 1H9BA 3GUCA 1EX9A 4E5KA 3LF2A 3L6BA 4D44A 4MSUA 3AI7A 2RH9B 1IM2A 1ZRHA 3QPWA 4LG1A 4JT2A 3MUNA 3WDKA 1HE3A 1HBJA 4MITA 4D9JA 4GIBA 2GETA 1I7NA 1G19A 2ERCA 2GK6A 4R1NA 3L7OA 4PG7A 3IKVA 4RZXA 4A03A 2EP5A 5L40A 3IXLA 2WSBA 4NHOA 3EMBA 4QUEA 3R74A 1Y3DE 4G8BA 3KKPA 4QGFA 2EDUA 1YDGA 2CNBA 4TZ0A 1Q84A 1BMQA 1MUUA 3ITKA 4GZ3A 1VJRA 2XTJA 3CRRA 2ZIFA 4IEFB 1AUPA 4MR8A 5JD3A 3L18A 3TBHA 2Q4EA 4F3OA 4KBFA 1UZNA 5DG7A 2W2OA 2WWRA 1YA8A 3TCKA 1XAIA 1QIEA 3M4XA 2ZRMA 1KF0A 1KP2A 4XH9B 3U3MA 3K9BA 4HT3B 3GGCA 4IKOA 5B2ZA 1BXGB 1XQXA 1KMNA 3MWEA 2QORA 3ZYZA 2GJKA 2PKQO 1T4GA 2QARB 3B6KA 4KLMA 4US1R 4DFPA 4IF4A 5KU7A 4QO7A 4UM7A 3RC8A 3EA0A 3O73A 1HE1C 1ICEA 2XY7A 1XZEA 2QGFA 4Q93A 3CX3A 3TTTA 3VU3A 4KV7A 3JAKB 3NMUF 1KH3A 5CRIA 1WPXA 1P7DA 1EFTA 1L7XA 1W8DA 2N46A 2A0FA 3QBEA 1YQUA 2PXAA 4G0QA 4PQRA 5FBRB 5FPTA 1CE8A 1G8KA 4HR7A 1V7CA 3IJEB 1YR8A 3ONVA 4XFDA 3J81k 2FP3A 2IZ1A 3TFRA 2P2LA 4M9XA 1N7JA 1V8FA 4U02A 1EYZA 2K4IA 1EZ4A 4N76A 3OFJA 4U00A 5E9WA 2BSAA 4ZYYA 3C5FA 3WYGA 2DPGA 4EUFA 3OECA 4N40A 4XUEA 3RU3A 1ADCA 1H9AA 1REQB 4LHEA 3RKSA 2G1UA 3PYLA 2DFTA 4PEVA 2EP8A 1M10A 1WXDA 3EMVA 4FC7A 4UB3A 1HG0A 2JLQA 2PKRA 3M6UA 4GEGA 2Y1LA 4LHXA 4RA9A 1IMJA 3IKTA 1GM5A 1JRPA 3I6YA 3OCJA 4A8HA 2VRNA 3DGFC 3K0CA 5CH5A 4YV0A 2MUTB 1EU1A 2XWBF 3EG9A 3EBPA 5DGAA 4G23A 3C1ZA 2H51A 4PLWA 4REOA 4TSKA 4YLGA 5EERA 3A4MA 3PXEA 5K03A 1VYHA 2OHHA 3T5GA 2P41A 5KS2A 1B1AA 1O58A 2IXDA 4JYCA 2XB6A 3CN7A 5GONF 3PXGA 3T35A 3L93A 3Q8PB 4FW8A 4D8XA 4GM0A 2GNPA 2H2DA 1VFNA 4ZOAA 1N2EA 1AX9A 2DGDA 2RDJA 4E2XA 4XQ9A 4FYIA 2Y1GA 1SO8A 4K87A 4XB6B 3HE3A 4R8KA 2ECFA 1OX6A 1W44A 3K1ZA 2JHDA 1R5NA 5BNZA 3V8QA 3A6HA 3UN1A 3L02A 1VQ1A 3ER6A 2ZJ3A 1Y98A 3GU3A 3PC2A 4UUAA 5EAIA 4YUYA 3GDGA 2C98A 4KRFA 1UBUS 2E2WA 3E3AA 4O33A 3L40A 1SIOA 3WYNA 2BGKA 1Q46A 1E2MA 1MORA 2A1UB 2FDXA 3H19A 3TBKA 5BSWA 1F0YA 1FLNA 3A9UA 1H93A 1ZD8A 1HL7A 2R8OA 3WISA 4BMVA 2V5VA 1V2HE 3DLTA 1KSPA 3KHHA 1V4NA 3HWWA 4FYVA 4HDMB 4LRSB 5AW5A 4F38A 5KBYA 4M0CA 1IBSA 2HRRA 5B1DA 3COJA 4J3FA 4G1VA 3OZSA 4GBED 4NU0A 8ICFA 2QU7A 4MQEB 4UNQA 1C1DA 1XTVA 1JQBA 2HWKA 2PFNA 3DBLA 4PIVA 3IPLA 5I01A 4Z51A 5BNIA 2AR0A 3LGSA 1P5HA 3TZHA 4F91B 2B4AA 4IXTA 1J23A 1UBRS 4J0JA 5FUVA 2HB6A 1CR0A 1KOJA 3SGLA 1DK2A 4ETIA 3I1FA 1QRDA 4F1JA 2ZI5A 5EKUA 3QW4B 3UGKA 3WS7A 3C3CA 2PGAA 2Y0BA 1P0IA 1L1FA 3ILYA 5H3HA 3V2IA 3DT6A 1MJGM 4JSRA 2HIGA 3HPRA 3I39X 5EI5A 4C89A 3FVRA 4IIHA 5CLLA 3FTDA 3E7PA 3H3XA 9ICBA 5EKTA 1E1KA 3OX2A 4IFEA 1RAIA 3WBFA 5CW2A 4H1VA 1Z15A 4C4OA 3S5JA 5HUQA 2EX0A 3S29A 2YN2A 1KTQA 1SUFA 1HLGA 2ZRPA 5ALKA 1DBRA 2ZYAA 1REQA 3GFSA 1UBMS 2ODGA 3GYBA 1QH8B 4MYDA 1TUBA 5EEHA 3FAHA 4Q3OA 3Q9NA 2HHUA 4UXIA 3HDHA 3R40A 4QWCA 3OJXA 4TS9A 4A8TA 4ZVPA 1UP4A 2QLBA 1JEDA 4OHFA 1QS0B 5DP1A 3TYXA 3TW6A 1J0EA 1X19A 2Y05A 4N5MA 7MDHA 4J49A 3LGXA 2G80A 4CMEA 2J3KA 1UFVA 5FJIA 2XZTA 5ITZA 2E8PA 1V3QE 2O3SA 4M9HA 2BOVA 2IHNA 4GDFA 4DQIA 4CL2A 3B89A 4MB2A 4G24A 5CT6A 4P0TA 1JPVA 4WACA 5DPMA 3G82C 3ASVA 3SVZA 5DGTA 3R1IA 3LPAA 4C4AA 1RQ7A 1N57A 1ZMBA 3KEGA 1K7SN 4XPZA 2JC3A 1Y9JA 5EGNA 5KT4A 1OV4A 3QPUA 4WEOA 4PG8A 4MF2A 2VP2A 4R54A 4YD1A 4P4GA 2E21A 4TL6A 2QYOA 1GXSA 2ASEA 3OFVA 2X2PA 4ZU1X 3TIVA 1DCMA 4B84A 1KY5A 1VBNA 3OM0A 4L3OA 1L5HB 3HQ4O 2FWIA 3K96A 1J70A 1ZNYA 3N2YA 2JVKA 5A9SB 3FCOA 3B3AA 2FWRA 1EFVA 3WU2U 1DXHA 1U7HA 2YV2A 4TYNA 3OFND 2HLHA 2Y3IA 1DC3A 3UTDA 5I8WA 5K4HA 2J67A 5G3ZA 5BXYA 3A6FA 4QDUA 1SFRA 3HKDA 4XWWA 4QXQA 1MP0A 3DL4A 1JFLA 3BH6A 2V74B 4QFMA 4JGGA 2JI6A 2ZWOA 4IQFA 3RK1A 4B8WA 1KPHA 1RE1A 2J4DA 3D0RA 5FH9A 2XIQA 2KZZA 3E8SA 4NL4H 2A4KA 2VAPA 1WSAA 2CDBA 2CEKA 4GXRA 4G65A 5SY9A 3WXMA 2QA5A 4N48A 5B1IA 2FMIA 2HAEA 2BD0A 4BNXA 1IXRC 3D2BA 5TMDA 1YB7A 3PW4A 1D8YA 2BRUA 3KAJA 3HI6A 1FU8A 4A26A 4BDSA 5JAOA 2JIRA 4RJKA 4TUYA 4ESVA 1DRKA 5K5EA 5FI0B 1CV2A 4ZDJA 4JUBA 3GP8A 2QQ0A 2QRHA 3A32A 1NBME 2FV8A 2HV8A 2WP8J 3RVJA 2PFQA 2N47A 3KOMA 4S0ZA 4AB1A 4MKGA 5ES4B 1E0SA 3R4CA 4UTXA 2FSIA 3D3WA 1N8NA 1SUEA 3O8DA 4MKXA 3UQYS 8ICAA 1JR3A 1KTVA 3B48A 3BMCA 4COKA 4OJQA 2ISCA 1QLNA 1K27A 3MWLA 4HXEB 3PHBE 3PDIB 2RGNC 1G0NA 3KQQA 1F2TB 4Y7DA 1LLFA 3QU4A 4GS5A 2RD2A 4PLVA 5C0YA 4CV2A 3BQ9A 4QJFB 4XDGA 4XDHA 4HGNA 4AUMA 1C41A 1PSWA 3G9XA 4GWGA 2JEOA 2B3TA 5EP1A 5IANA 1UBGA 4XUDA 1KGDA 4A8PA 1U7DA 4N7BA 5IK2A 4JKIA 1JDNA 3X3HA 2KHVA 4NJEB 5DLQC 5K05A 4GFJA 2Z5VA 5TB5A 3WQQA 2VDNB 3RS5A 1F2VA 3WHLA 5EXEA 4JJEA 5CVEA 4Q37A 1VLMA 3SKVA 1K4YA 1X2EA 5AVOA 3GHYA 5EWFA 1U02A 1WDKA 1ZX1A 2P1ZA 1X7XB 1V45E 2HMTA 5BMVF 3BSWA 4ND5A 3T8YA 4N65A 4R64A 1FJ2A 3DWEX 4N01A 5HG0A 2WU3A 2P5YA 1SHZA 3SBOA 2HCFA 1CJVC 3FYSA 1RJWA 5D1HA 4D6XA 4DHWA 2VDQB 1R6XA 3PR5B 1JAIA 1KY4A 3PFGA 2BEWA 1NSYA 5KFVA 3ADKA 4JYPA 4M0FA 5FXMA 1ZQCA 1GLNA 5KJFA 1CY4A 1NLZA 2VJDA 2Q4BA 1KJ9A 4FYMA 1JLLA 1XQYA 1VPEA 4BX2A 4F84A 1YS9A 2OY0A 1N2IA 4PLYA 4TRMA 3F9IA 2QN1A 4IMJB 1QYCA 2FN9A 4BVGA 4GUAA 3WGLA 3WMFA 1Z0KA 1IEXA 4LYFA 3KLPX 1NUUA 4AMVA 5NLLA 1SB9A 1GL3A 4I9HA 2NNWB 2BZ1A 3EBOA 3KTAB 1Y6ZA 1QIMA 2WWGA 3UK0A 2AQ4A 2BFOA 1ZA1A 2J3EA 1NKTA 5ALTA 3MGHA 2Q5FA 2ZT7A 3GCZA 3NFRA 2EZYA 4AMBA 3LL4A 1IN8A 1MB4A 3S1SA 2BEUB 3GAZA 3EEIA 1J9GA 3MJDA 3QKWA 4OJKA 4EJ0A 1PFWA 3OUUA 1SBNE 4KQFA 4QYWA 5KSWB 1GT6A 4MIEA 3DDSA 4L0DA 3A4TA 1WDMA 3NHUA 4GVLA 4LF7B 1NG1A 4C7OA 4CYMA 3U09A 1FP6A 4MI1A 3JATB 4CQJA 2NUPB 2VSOA 3LFHA 4LHVA 1M54A 5L3VA 1NIPA 3HZZA 2KMDA 3KYJB 4BVEA 1TVEA 3IMFA 4M55A 1ZO8A 4JYZA 3F5MA 3F5EA 4TPKA 4E15A 1X0XA 3S28A 1RG6A 7ICUA 1F5NA 2UZ1B 3H86A 3WGJA 3OQ6A 1MNAA 3PJDA 5IBQA 4TYYA 3F7NA 3Q85A 5J2FA 1ZIOA 5KFRA 3DC7A 3B1ZA 4Y9RA 4A2PA 4KTQA 2AOWA 1FUUA 2V4UA 2X5KO 2HGZA 4GYKA 2ZBGA 1R8XA 3C6BA 1GZ4A 4YCLA 4TLCA 1W36D 4JLAA 2W6PA 3GA0A 4O0LA 4QYXA 5H16A 2I6GA 2A86A 4EEXA 1BDHA 2TRSB 1EHCA 5KFSA 4ETNA 4CKBA 2O8FB 2C0CA 2ATEA 5T3YA 4HVCA 4QOEA 4LZLA 3SEAA 1T3HA 4YPOA 5FNVF 3TGLA 1KAQA 3UPDA 4B3CA 5K8LA 4CXMA 1I1HA 4QZIA 2HA6A 1TIKA 1XQ1A 3MLBA 3WIUA 3VU9A 4C07A 4EO7A 5F21A 1WP4A 3EXAA 1PU2A 3HJBA 1XL1A 4PSAA 4QLAA 4RFVA 3VJLA 5JPCA 3F6PA 8OHMA 1R0SA 2DQKA 2JGRA 2QUJA 3SE0A 4YXFA 4UM8B 3R5SA 5LYYA 4MB0A 4BJ6A 4KN5A 3OQOA 3Q4GA 5IF3A 1MIOB 4Q4HA 1EWQA 5C7LO 1RYUA 3HM9A 2UYCA 1Q0ZA 4AF7A 4M9CA 2KVCA 3PW7A 3OEYA 5T4HA 1NW4A 5LWQA 3M6KA 2JGFA 1D6JA 4WY2A 3WK5A 3IDFA 1ZNZA 4MJ3A 1Z4IA 2FQWA 1A69A 2G67A 3H9UA 1M34A 1KL9A 3I4LA 4MIOA 2AG0A 5AUOB 3ND7A 3JVDA 4X20B 1GNQA 4L95C 1GPAA 2RCYA 3QLVC 4PGMA 4TTVA 4CKWA 1G6HA 4KSYA 4ZV4A 1XRLA 1XMQB 2LCFA 4V3CA 2P78A 2ZJ6A 3K6JA 1KFTA 3G2IA 3WRVA 3W3AA 1YUBA 1YCFA 4XEUA 3BCUA 2VHWA 2W71A 4DQUA 1KSGA 3ZCSA 1RKQA 3DFFA 2D2FA 5AI6A 1GNTA 2V3VA 3DYIA 5DWDA 2R9VA 1HUZA 2HHVA 2O7SA 1G3IA 3KOUA 1G5FA 1RM6C 3ELUA 3RH4A 3B13B 4YV2A 3LIIA 1YBAA 3MPOA 3SMQA 3MCUA 4Q9LA 3ZDFA 5F23A 5I9LA 2I65A 1OF1A 4GF5A 1HT1E 2D0DA 4ZKDA 1P2GA 1T1GA 4RL6A 4RANA 1A7KA 1XTQA 1MHTA 1HE5A 3QITA 4G5QA 1IMOA 3SBEA 5KTRA 2FSVC 3U48A 5C3MA 2CE2X 3LF1A 5E4TA 4MEAA 3EPJA 4G0WA 5IDVA 4EG8A 4RQMA 3OBIA 3TIXB 1OB2A 3ZI4A 4DF4A 1TLFA 4L4ZA 4W7HA 2CBGA 2HWYA 4BO3A 3RC3A 4KR9A 2JGDA 3RAEC 3R8FA 1BROA 4I4NA 4HN9A 3UCFA 5CDSA 3G6XA 4GPZA 4R9VA 4AUKA 3DDHA 1J5PA 1G7CA 1E2GA 4KAXA 2VJMB 1MEJA 3W3AD 2QW8A 1N78A 2H9AA 1E2NA 1SVUA 2ZJ5A 4KBGA 5FUMA 2GN2A 4FW9A 1ELOA 3DV0B 4DMUB 1O08A 5ELLA 1BG6A 2J1LA 4DMFA 5KAMA 4M0MA 4TTRA 5LOVA 3RSCA 4J4TA 3IEUA 3AM5A 1ECLA 3DONA 4RW0A 3BS4A 4P31A 3ECCA 3PX4A 3VNUA 3IG8A 1T5OA 2QDKA 2A0UA 4IH4A 4J07A 4LTMA 3JVIA 4D0RA 2ZIVB 1XYVA 4F1KA 2B78A 5HDBB 1WUTA 3KC2A 4KVAA 4M9JA 2GZRA 2WV9A 3CNLA 3MWJA 1JL3A 1NBAA 2IXEA 2R8XA 4LZGA 4EKNB 4WJLA 5J4LA 4DMKA 2RJ3A 3F6YA 4LDZA 2Q4OA 3OOSA 1L5VA 4NBTA 3OJ0A 3U7JA 3KQLA 3THYB 3QELB 3Q8XB 3AKDA 5AW4A 2ZTLA 1UFRA 2V7QD 4NC9A 2QG4A 2ZUBA 4XGQA 4RGBA 4D3FA 1Z4PX 4PVCA 5UKDA 2CBXA 2JK1A 3S5UA 2MHCA 5CAEA 2BJWA 3KFUF 1RZVA 3FI0A 3L1KA 4LJAA 1KDZA 3ZWKA 3R9WA 3TB6A 4KGDA 4L8WB 4N5NA 3ENKA 4JQCA 2D6FC 2VT2A 5JJLA 3IAEA 1IG6A 1O87A 2PH5A 3MJRA 1NKBA 4PZ9A 2TMKA 3LCMA 5HYVA 2WVGA 3B2EA 3H5AA 1NUPA 3O6VA 1HJPA 4Q01A 3FROA 1DG1G 2DFLA 4E51A 3PQ8A 3NHMA 1UPXA 3KZMA 2H4XA 1NUQA 2RKBA 3DB1A 1KO5A 3R5XA 2DLNA 4HPWA 4LYDA 2JKYA 5FIUA 4JLKA 1C50A 1T13A 3Q7IA 4C4YA 5LMZA 1QP0A 4O5CA 1X8XA 4JI8B 3DVQX 4P5EA 5LP1A 4B46A 1OU4A 5CIYA 3PSFA 3AF5A 3LLMA 5EXTA 4S2UA 4KVZA 8ICQA 2V0NA 1N5RA 1J2MA 3NJ8A 1A9TA 5IHXA 4I9NA 4OLFA 2OA0A 2YJ3A 4L85A 4L4XA 1JUDA 1P2SA 4JNCA 4DA6A 4E1BA 1G64A 1C0PA 3DR3A 1U4BA 4N3NA 1VLBA 2VS1A 2OXCA 4ZJYA 4B3SB 1P77A 1XVIA 3T7IA 1G21B 3ZG6A 1DAMA 1E7MA 2YRFA 4UBBA 1J9EA 3X1WA 4BO4A 3ZGZA 1GCUA 3FLBA 3HI4A 4L2IA 4J29A 4PGYA 1A72A 1P39A 2XVYA 1YMQA 3FJYA 4L8YA 4BJHB 5ALPA 1XCOA 1OZHA 2HCJB 3OKCA 2RLTA 3OJCA 4RHEA 4EQ6B 2HSGA 4NENA 4RTRA 3D2CA 1Z74A 4UDOA 5A2GA 3U7RA 5CX4A 1YS6A 2OCXA 2Z4TA 1LF0A 2R3SA 1KORA 2QPLA 3BK2A 1W2HA 4A8JA 1JHVA 2R6ZA 4HJRA 4AMYA 4JLUA 4X66B 2JGKA 1CY0A 3RR2A 2XUZA 5GJCA 4IRUB 4RK5A 1BVSA 1ZNWA 2FZEA 4JT8A 4MVXA 4P82A 2GRUA 3T7CA 2E37A 1E99A 1O9BA 4F5RA 4V03A 1E3QA 3VZRA 4ARSA 2VF2A 3QJGA 1DJMA 2BQUA 1TPYA 4D3SA 1B76A 2NX2A 3DMPA 1ZK3A 2W8BB 4KDCA 2JD1A 4XD7A 4Q4HB 1Y34E 5AVQA 4ZCQA 5HFJA 1F1JA 3RUAA 1JALA 2PGIA 1K1SA 4LBYA 2PSDA 5AHOA 2BH2A 4OA8A 3KQNA 2W2LD 1DQPA 3ZYCA 5KYVA 5KG0A 1QH1A 1RXYA 5A3VA 3W7AA 1T35A 4DNPA 1DUVG 4NBSA 4YRNA 2AN5A 2PR7A 3LC1O 3ED1A 5M5BA 1QC5A 2HMAA 1ZA2A 3TEMA 3Q3CA 2JD2A 1OWMA 1KQNA 3HXOA 4DT1B 1DEAA 5I8ZA 4W5NA 4XKJA 3OPYB 1KC1A 2QE6A 2DUUA 3T61A 2Q3EA 4K6FA 1YZKA 4JUDX 2PRSA 2O6KA 4U5XA 5E7QA 4DCGA 5HX7A 4N9WA 4XWOA 2A14A 1SA0B 1N6LA 4E7PA 1T0BA 1T9AA 5JNVA 4E5MA 1PNRA 2DXIA 4TV8A 2HZBA 3PSIA 1ZC3A 4J2OA 4I4CA 4ZTBA 1HEYA 2R8BA 3IG5A 3AC0A 3GFPA 1AQLA 2PUAA 1GZ7A 2VYVD 4F9GA 3K5PA 4DG5A 5LA6F 2GFQA 4YBZA 1OAAA 5EJIA 3RO7A 4PIPA 3UWPA 3AUXA 3H2SA 4DDHA 3ZVKA 4Y2SA 1RXEA 2Q99A 2X4LA 4D4KA 4M1TA 1P60A 4TWZA 5CFMA 4V1CB 1U98A 3AF4A 4H35A 1UKCA 5EE3A 3UFBA 1F3LA 2UDPA 4B4VA 3K0SA 4OLBA 3M6AA 3BFKA 1OA0A 3MFYA 1P7YA 3Q6IA 2ZT5A 4R2HA 2PTGA 5BPCA 2A9QA 2CFIA 3JYHA 4UVDA 4TTSA 2ZCUA 3WAGA 5A3QA 3RYIB 1CG6A 5EP2A 2X42A 3O0TA 4FDMA 5JC1A 3TTYA 2KIVA 2O23A 3LSYA 2GS9A 4JA2A 3QE0A 4NNJA 5E6SA 1YHZA 3OAAD 1NQOA 5TXGA 4ITVA 5I4CA 4PFSA 2HQOA 5J2KA 2ZXEA 2O7RA 3FPLA 3TD6A 1ICIA 4XSVA 2P6NA 4BNFA 5D3KA 4QWEA 1I6LA 3B12A 4QXPA 2QVLA 3O0DA 5KFLA 4AN1A 3JZMA 2X76A 1CQIA 2YMMA 1P0PA 1O94D 3KKZA 5HILA 1QU2A 2K8AA 1TAHA 1V1RA 4ASUD 4YDRA 4MK4A 3ZPXA 5T7BA 4MUKA 1ZONA 4MR7A 2ONJA 3HCCA 4JI5B 3QVTA 2H07A 2PX6A 9ICMA 4FS1A 3SHOA 5JS1A 4CQLA 4DL2A 5LFAA 2WD7A 2XSZD 1U99A 3V4PB 2YV4A 4HNHA 1T3ZA 3DOHA 4ZJUA 5DFAA 2DHEA 1U2GC 3PLRA 2ZOSA 4O29A 4RHFA 3AFIA 3RJTA 3DOIA 4C1BA 3CBQA 4D