2YMMA

Sulfate bound l-haloacid dehalogenase from a rhodobacteraceae family bacterium
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
225
structure length
225
Chain Sequence
SGILVFDVNETLLDLTSLSPLFERVFGDAKVLREWFPELILYSQTLTLTGLYRPFGEIAAAVFEMVAANHQAKVTPDDIAELKTRLTSMPAYPDVAPALTRLQDAGFRLVTLTNSAPSPAPSPLEKAGIASFFEAHLTVHSSQRFKPHPSVYDSTAETLGAKPEELCMIACHIWDTIGAQARGWRGGFVARPHNTPLTLAEVPQPDFIGRDMGELADQLIASLTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Marine Rhodobacteraceae L-Haloacid Dehalogenase Contains a Novel His/Glu Dyad that Could Activate the Catalytic Water.
pubmed doi rcsb
source organism Rhodobacteraceae
molecule tags Hydrolase
molecule keywords L-HALOACID DEHALOGENASE
total genus 92
structure length 225
sequence length 225
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2ymmA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2ymmA01
2P11A 1Z4NA 2EAUA 4JDPA 3SF0A 3HLTA 5AKYA 4IG4A 1ZD4A 3L8FA 2ODAA 2D2VA 4Y2QA 3PDWA 5AIAA 5AKKA 3OCUA 1RMYA 4MUMA 3N8GA 4RESA 4Y2PA 1XPJA 4IFTA 1VFPA 2W43A 2B1RA 5AKLA 3FM9A 2PQ0A 3DNPA 2IOFA 2FPXA 4XQ0A 4XPZA 2EATA 4EX6A 1ZS9A 4UW9A 4DWOA 4DFDA 3QUQA 3ZW7A 1L7OA 2DQSA 3VAYA 5AM1A 1Y8AA 1RKVA 2RARA 3KZXA 4OCZA 3DAOA 2I54A 3ZVLA 3N1UA 4HAIA 3AR9A 4HGRA 3OPXA 1VJRA 3PGLA 5ALXA 2FPUA 5AVYA 1U2SA 1L8OA 3L1VA 2P9JA 5AI9A 2NYVA 5AK3A 5AVQA 3L0BA 2I7DA 3QUTA 3IJ5A 3SMVA 4C4RA 1O03A 1RQNA 3QU9A 2HO4A 2ZG6A 4UMDA 1Z4JA 4BBJA 5ALQA 1QQ7A 3M9LA 2R8XA 5ALKA 3E84A 1YMQA 5AW0A 5IS2A 5FP0A 1J97A 2MSNA 2AUTA 3L0YA 4UM7A 5A3RA 4Y3UA 2HI0A 5T41A 3ED5A 1Z4KA 3RFUA 3QUBA 3NUQA 2O2XA 2OA0A 4BEWA 5AM4A 3KD3A 1Z5UA 2I6XA 5AW7A 4UAUA 4AP9A 4YIHA 4OD0A 2AMYA 2G80A 4Y2TA 2WF8A 5AW2A 3E81A 2CFTA 4UU1A 4UATA 3ZI4A 1LVHA 4KX3A 3N07A 4B6JA 3SHQA 3ONNA 5IT4A 4Y2JA 3IB6A 3E8MA 3U7HB 1Z4IA 1L8LA 5AVTA 2MU2A 1RPZA 4F71A 5AM0A 3KC2A 2YFYA 3ZWKA 2RAVA 5AK6A 4YIKA 1Z4OA 2GHQA 1RQLA 4NABA 3UMBA 4CF4A 3ZX5A 5ALPA 5AVZA 3QYPA 2G08A 1TA0A 2FPRA 4F72A 4KNVA 2HSZA 5AI6A 3A3YA 3BA6A 2HF2A 3ESQA 2W4MA 4NV0A 3W5AA 3QUCA 4Y2RA 3OCZA 5IT0A 3I6BA 3WKEA 2R8ZA 2Q4TA 5ALUA 4KN8A 1QQ5A 3WK5A 4OHFA 1U7OA 4UARA 3QU2A 1Z88A 3HYCA 2HHLA 3A1DA 3J7TA 4FYPA 5AVXA 4YCLA 3ZX4A 1RLTA 3I28A 4QJBA 1F5SA 4O8CA 3W5CA 2FUCA 2ZBDA 3FVVA 5ALEA 2P27A 3EWIA 4EX7A 4CF3A 4BKMA 2R8YA 1Z5GA 3OCYA 4QQFA 3GYGA 2ZBFA 1TJ3A 1L7NA 2R8EA 2C88A 3B9BA 2RB5A 2YMPA 2IOHA 3WK7A 5AK5A 2C9MA 1ZD3A 1NNLA 5ALHA 3B9RA 2NO4A 2GO7A 2IYEA 4YCMA 2JARA 3QLEA 4JB3A 2X4DA 3MPOA 3I76A 3A1CA 2HOQA 2BDEA 4CNQA 4I9FA 3U19A 5AHXA 3CNHA 2Q4RA 2JAWA 3L0CA 3U13A 4CE6A 4YH1A 1U02A 2OBBA 3FGOA 2IA5A 2B30A 2I34A 3K1ZA 3W5BA 3DDHA 1RDFA 5ALVA 1PW5A 5AKGA 3AR8A 5AESA 3ET4A 3R4CA 4GIBA 4DCCA 3NAMA 5AVRA 1RLOA 2G06A 4L6CA 3UMCA 2I33A 1Q92A 5AI5A 5AKJA 4UMVA 3NIWA 5AK4A 1XVIA 5AVWA 2B8EA 4FE3A 1SWWA 1T5SA 2CFRA 1ZRMA 5ALRA 2YMMA 3WK9A 1RKQA 2Q5EA 2RBKA 4BX0A 2CN1A 4NAVA 4Y2VA 5AVVA 3QX7A 1WVIA 3B8EA 3ZVNA 4NWIA 2G07A 2ZOSA 3PGVA 2B1QA 2YMQA 4NFLA 5ALFA 2YY6A 1Q91A 2MU1A 3FPBA 2C4NA 2YJ6A 1N8NA 3L8EA 3D6JA 5AVSA 3KOOA 4Y2UA 5ALYA 4UAVA 2C8KA 5A3SA 1ZD5A 1YJ5A 3UMGA 1Z4PX 5AI4A 3TLMA 3SKYA 4PNHA 2ZBEA 5ALGA 3FZQA 2FDRA 2GMWA 2HX1A 3OCWA 3L8GA 4CF5A 3M1YA 3UM9A 1KYTA 2O9JA 2HF7A 3AR5A 3U7FB 2B8JA 4HGQA 3WGUA 3BWVA 1XP5A 4UASA 3AR4A 2AGVA 1O08A 4J2TA 5ALLA 2WFAA 2FI1A 5ALWA 4YCNA 4G9BA 4BNDB 3WK8A 4HGNA 2WM8A 3L8HA 4BX3A 1RLMA 3QU5A 2G09A 1SU4A 2QYHA 3L1UA 5AM3A 3WK6A 1YDFA 3EF1A 4EENA 3WKCA 2JAUA 3R09A 4YGYA 4ZEVA 1CR6A 3SLRA 2GHTA 4BNDA 2YJ4A 3WKAA 4HGPA 4BX2A 3U7EB 4EELA 3KBBA 3IRUA 2FPSA 1NF2A 5AM5A 3W5DA 1S8OA 5ALJA 5ALTA 3QGMA 1K1EA 3L5KA 2EARA 2YJ3A 4KNWA 3RF6A 3ESRA 3E58A 3NASA 5AW6A 1AQ6A 1Z4QA 5AI8A 2HDOA 1YNSA 2HEGA 3MN1A 4AS2A 2WF7A 4UMFA 3FPSA 3DV9A 3N5KA 5E0OA 2W11A 5ALMA 1EK2A 3ZUPA 2BDUA 4J03A 2VKQA 3N28A 4KX5A 1CQZA 3A1EA 2P69A 5AICA 2AH5A 5AIBA 3I1YA 5AW3A 1YV9A 1TJ4A 4DW8A 2I55A 4GXTA 3MMZA 1RC8A 2WF5A 1IWOA 4XE5A 2G1AA 1ZD2P 5AKZA 5ALNA 2ZBGA 3ET5A 3OTQA 3PCTA 3OCVA 5AKIA 3QU4A 1QH9A 3QU7A 1TJ5A 2GFHA 3P96A 5AW1A 1RKUA 4OFZA 3EPRA 3L7YA 3AR3A 2YJ5A 3F9RA 2WF9A 2YBDA 2G0AA 4UM5A 1QYIA 1WZCA 3ZTYA 2WHEA 4G63A 2WF6A 2C8LA 5AKXA 5AW5A 3R9KA 1MH9A 1ZJJA 4I9GA 4H1WA 5ALZA 5AKEA 5AKHA 5ALSA 1RMQA 1X42A 2B0CA 5AVUA 4C4SA 2FUEA 3CZ4A 2FPWA 1EK1A 1RMTA 2YN4A 4HYTA 1FEZA 2CFSA 3AR2A 5AW4A 2FEAA 3OCXA 4UU0A 3QXGA 2OM6A 3U7GA 1TE2A 5AI0A 1U7PA 4Y2SA 1VJ5A 4KYTA 1RRCA 1L7MA 3SD7A 2YMLA 1QQ6A 1YS9A 4EZEA 1T5TA 4E88A 3ZVMA 3NANA 3WKDA 4ZEWA 2BY4A 1ZOLA 3WK4A 5AW8A 1NRWA 1J8DA 2PR7A 1SWVA 5AW9A 3ZU6A 3SKXA 1S2OA 4EEKA 4XOUA 4C4TA 1Z4MA 4Y2YA 1JUDA 1WPGA 2B82A 4L57A 1L7PA 1L6RA 4ZEXA 4AS3A 2JGAA 1ZRNA 4Y2XA 5ALDA 2ZXEA 2PKEA 3U26A 3KDPA 4RETA 4FFDA 4HGOA 3MC1A 1Z4LA 3AR6A 3NALA 3AR7A 4L6AA 3QNMA 5AM2A 1T9ZA 4UMEA 2HCFA 5JJBA 4MWOA 2JAOA 2OYCA 3S6JA 2IOFK 4BYGA 3NRJA 5ALOA 3WGVA 3ZWDA 1LTQA 5ALIA 2QLTA 3WKBA 3EF0A 4BEVA 1N9KA 1U2TA 1WR8A 3ZTWA 2NO5A 5A3QA
chains in the Genus database with same CATH superfamily
2YYSA 2AZXA 2AJBA 3I0ZA 4RSGA 2IZOA 5B7QA 4LS3A 5D84A 2KQUA 4K2HA 4L6IA 2QM0A 3PXXA 2C4UA 4HX2A 3RVDA 1OW3B 2FWBA 1MOPA 5SZHB 3NH6A 1G2QA 3L8FA 3EXAA 1J2NA 3S8EA 4Z3DA 3TVYA 1VJ0A 3ZYZA 2L19A 1Q0PA 2IU0A 2DOKA 3KB2A 2AW5A 2GCNA 2NVWA 2E55A 3L7LA 4L9SA 4U5XA 4AJHA 2O2ZA 1HOXA 1XPJA 4IR9A 1JG1A 3ETLA 1P77A 2IBMA 3DNPA 3K31A 2F8TA 1GDDA 1TM3E 3VCBA 3IT1A 4XPZA 5AMXA 2DXIA 4GDFA 1YSCA 3COPA 4TQSA 2CHVA 3GROA 4HNUA 4RTLA 1HDEA 1UPFA 5CHEA 1MJGM 4MQ6A 3AESA 3CG0A 3M81A 5F9FA 4ATNA 4HR7A 3ZNQA 1A7AA 1QH0A 3K4PA 3VJMA 4A73A 3UEOA 1F2TB 3IAS6 2IHBA 2NZ2A 3P0JA 4ARAA 2ADOA 2D7CA 2I1QA 1VKNA 2AOTB 2ERYA 2BFMA 5I7VA 5JIBA 4E0DA 2J7KA 1E64A 4LDPA 1NX9A 4P4LA 4EPXA 4NFHA 1CRXA 1PCXA 3R3ZA 2NVBA 3NHYA 2UUPA 1ZEJA 2KNJA 2EHDA 1L8OA 2CV0A 2QBYA 2P1DA 4RADA 3Q0TA 5J0RA 4JC8A 3ZV5A 4M0UA 2XMCA 1MENA 2Y1EA 4RUCA 3ZKWB 4BNFA 3K0HA 5JY1A 4OBEA 4JWTA 1FXWA 3IIIA 5FAKA 2BCQA 5JJCA 2HU5A 4IO1A 1K7SN 2YIDA 3NT2A 4CUKA 3KVRA 2YH2A 1ULBA 1CR1A 2ZXFA 1ADJA 3VAAA 2BFDB 5CYPA 9ATCA 4CEJB 4MITA 5A05A 4XGNA 5ALQA 4IWYA 1N6RA 3PJEA 1J0BA 5AJXA 4DOAA 1E9RA 7ICNA 4CM8B 5TS3A 2QLLA 1CUGA 3EULA 1H8ED 4DMFA 4F4HA 1BKYA 2GI4A 2ID9A 2W2PA 1C8KA 3GLGB 2O8FA 4B4VA 3L6OO 2YN2A 3L43A 2EERA 4OO3A 3DZIA 1H9CA 3ELWA 5A1TA 1X8XA 3T06B 4RQ7A 4EHKA 1M9NA 2PL3A 3RVRA 1VLMA 4DR7B 2I71A 1KEZA 4ZALA 2ETXA 3GOHA 1EFVA 1U90A 3E3NA 1WU8A 2ODQA 3GUCA 2I6XA 1T24A 2V7VA 3O74A 4HH0A 4UAUA 1E4EB 1IZ8A 1YTLA 1P7WA 2W6OA 2ZRFA 3HKEB 3PEVA 4B5LA 2DWUA 2G80A 1A5BB 4OHUA 4A27A 4BLQA 3IG8A 1H6DA 1P1RA 1YJCA 5IILA 1GSHA 2C7GA 3RVPA 1YQTA 3T4PA 3KQVA 4R40A 3L3FX 2Q7XA 4TMYA 1H2FA 4F56A 1V1RB 2PV7A 5DRYA 3FX2A 2XB6A 3QVKA 4NG5A 5HEKA 4F91B 3NPAA 1K6EA 2I7TA 1E9BA 1G18A 1I0IA 1Z33A 5CW1A 4BJ1A 2O05A 3TQIA 4OJ5A 1YZVA 4OYLA 1GL3A 3WIEA 5JAPA 3VOSA 2PKCA 4OQXA 4RFSA 4YIKA 3V8BA 4QPCA 3SWWA 2XNSA 4LE2A 2NX2A 5CLQA 1YBFA 4YMOA 4TVBA 1TVCA 5BY2A 5KJEA 4DSUA 1EKXA 5J63A 1A76A 1M6VA 4HUJA 5AFSA 1IY1A 2WU8A 1W6RA 1XZCA 3SFZA 3IFSA 3L0PA 1A50B 2HA5A 4XVRA 2JIRA 4GPEA 3B48A 4KYIB 3REQB 5A3JA 1J8QA 2I4TA 4MQFA 3B82A 4Z0TA 3SOPA 4Y2RA 2HJVA 2CMGA 3I4CA 2PWZA 3GG9A 3RNOA 2JEOA 4B3XA 1Y3CE 2YC4C 3I6BA 4WK4B 4J9KA 2HBYA 3ZDYB 4F2DA 2I6QA 4YBZA 3FE2A 2G76A 2NUTA 3AM5A 1COKA 3WY9A 2JHCA 5B7PA 1EFDN 3ACCA 1HG1A 3PC4A 4FK8A 4FYPA 2HOIA 3MWYW 2CT8A 4M7RA 1Z7EA 5FWYA 2GBLA 4ED8A 1T5DX 4JI6B 3ZJ4A 1S9HA 1WMDA 4B32A 3I73A 2CNOA 3SDBA 4QJBA 1C7JA 3VPFA 1H0HA 1G2IA 2WU1A 4ARUA 2A9PA 4ME6A 2UVPB 4ZT3A 1VLQA 1AGYA 2JJ2A 4IHQA 5E6RA 3VI3B 2COKA 3GMDA 3R3JA 3B51X 4NU5A 4PINA 3TOCA 3B0YA 1H0RA 4ZD6A 4EY4A 1BCSB 5IYZA 3K9FC 2VF7A 3Q7EA 1O6BA 1Q50A 2Z08A 2W2LD 3ZGYA 4HF7A 3TKAA 1MHTA 4YWJA 1P3JA 2BMDA 5FADA 4CMGA 3DLHA 4WERA 3LWMA 2YMPA 2IOHA 1FO4A 2C4MA 1A0PA 2VP6A 3A4TA 3HCDA 5J9FA 4CM9A 1Y98A 2HHCA 3IN5A 3VMFA 1DRGA 2H59A 1NVUQ 4JJZA 1X7HA 3K05A 4EZ6A 2ACKA 1I4DD 1KFEB 1MQAA 2F9LA 2WVJA 3CRRA 3D02A 3D6FA 5EP1A 4J07A 1O89A 5K4GA 4KQFA 2R97A 3BEDA 1QRUA 1D2EA 1UFVA 2BBTA 5BW8A 4PZOA 1WIWA 1GNVA 4MVJH 4F4IA 1LJ8A 5JCOA 3T3GA 4I9FA 4JI4B 3CC8A 4N0MA 1PV1A 4QQRA 5ILOA 1X7ZB 1W30A 4GQIA 4ZWNA 4KPUA 4RANA 4M1YA 1IZZA 4QWDA 3FWHA 5DG7A 5EXTA 2JI4A 4LXQA 3S27A 5J0SA 4A23A 4H1TA 5L9AA 1L5WA 3THWA 1N2XA 5ARCA 1HTWA 1QKIA 3OLVA 4PZYA 2ZJ6A 1HDXA 3F5AA 3AYXB 1VPTA 3R23A 4HUQB 4TYWA 2BLNA 1O95D 1RE0A 2QQ5A 3AUSA 2F48A 1BG6A 4RD4A 2BELA 4P86A 4AJEA 4EUSA 2DFPA 1VZ2A 1OHHA 1CJUC 1YO6A 3DDCA 4L4ZA 2MT9A 1VMIA 2R1TA 5C32A 4GIBA 3HCCA 3RQSA 1P1CA 5LP6B 1ZL0A 3GFBA 3BSFA 4MF8A 3UMCA 2X9NA 3NYIA 2HHWA 2AHOA 5A2GA 4IL5A 5AI5A 1VGQA 4JELA 5KPJA 3QK7A 3A9RA 1L4LA 1G38A 1LDNA 3NIWA 4W9NC 1V3QE 1SVMA 1K8RA 4JR1A 4XIYA 2O8EA 5BQFA 1JLKA 4JKYA 5ITVA 1XRRA 2F43B 1FXWF 1M1NA 4LZLA 3R5FA 4FMBB 1D8AA 5DTRA 1PS0A 2KZZA 2H18A 4RKQA 5KKCA 3KKKA 1O54A 4NBVA 5CNKA 5GGXA 1U2ZA 1TVEA 4KR9A 2AFIE 1PP4A 1COWD 4LZJA 1FS5A 1HL7A 1Z56C 3R3YA 4XQ9A 5JSFA 3KSZO 3GDHA 4I5FA 1V5FA 3FPBA 1ZI8A 2HA3A 2I2XB 1XCLA 1QORA 1XG5A 3NHJA 4DLUA 4Q05A 5AWFC 3VMMA 2IEIA 5K8TA 3KOOA 1X86B 1YZNA 1U0TA 2XSZA 3FVRA 5C1PA 3TUIC 1NJYA 4RY8A 3I4FA 3BCHA 1I3CA 2QZZA 5DIZA 1XZBA 8ICXA 4W8OA 3TLBA 2I3ZA 4M8NE 3N6VA 1XDUA 4IQUA 3QW4B 1TAGA 3D2CA 5LP6F 4EF6A 3RTGA 4WKPA 3VNBA 1UBGA 2ZBVA 3UM9A 1U2EA 4HI0E 5KHOC 3ZS8A 4EK9A 5KJCA 1Q57A 2IZ1A 2GESA 4JC4A 5DBFA 3W5IA 3NOQA 3RADC 3H7IA 1UPUA 9ICRA 3FMFA 4AF7A 1T8PA 2HHVA 3HLYA 5CDFA 3Q8KA 1TJPB 2D6FC 2XODA 1YCGA 1MO5A 3RH6A 2FRDA 2GN0A 3HVIA 3N0RA 3HUTA 1QFXA 5JD5A 2Q0XA 5H0IA 4PLPA 2AF4C 5LBIA 3CUEF 3MS2A 2GAFA 3PIRA 1YASA 2BVNA 1K97A 2AYXA 4UB1A 1EE1A 3L2OB 4TWBA 5CFQA 2WINI 4LDQA 4KTVE 3EHDA 3CXUA 3AP1A 4RT3A 4J43A 4NVRA 1Y6JA 4WJLA 4LZNA 1NLYA 5P21A 4ZCIA 5LU9A 2NP7A 1AKUA 4JP8A 3KYJB 4OAQA 4C0KA 3Q2KA 2ZIAA 3F8WA 4YP0A 1RLIA 2YHSA 5EC8A 5B53A 3ZGOA 4OGFA 4NZYA 3H9EO 4BFZA 5DKFA 4BNLA 3T7EA 3E7DA 4QWEA 5CM2Z 5DYNA 4D41A 3FCAA 1PLJA 1UAYA 1JI0A 2PX4A 4J3FA 4KGXA 4PLTA 4CPDA 5CR9A 4P7FA 2XUOA 4D81A 3IRUA 2HWXA 3LCCA 3OLQA 1JWBB 2J48A 4RF5A 3EGEA 4C87A 3GIKA 3TLGA 1VPLA 4US1R 1ZDMA 4AF6A 4ZOQI 5L4SA 4D4MA 1AQ6A 4NESA 5AI8A 1NDUA 3STWA 3Q3JB 1D8BA 3SR6A 4WVLA 1OBVA 2HHQA 5D3MA 3T1OA 1GV0A 1IPHA 1Q7RA 1UWVA 3F49S 3FNQA 3H2YA 4BNJA 4BVJA 3PNCA 1NUSA 1FVXA 1ZEMA 8ATCA 1W5AA 3TW8B 2XVXA 4X94A 4QVKA 4S05A 3UAZA 3AGQA 2EX1A 4B45A 3EVDA 4K87A 1AN9A 3EEQA 4W1QA 3ZUPA 2CVOA 1GQYA 2BDTA 3ZKAA 3BL6A 3D7LA 1QK3A 4F1KA 2H7XA 4O5EA 1VJDA 2O1EA 3P0FA 1H4QA 2QG6A 2DJ5A 4F6RB 1FFGA 1UBUS 4DOCA 3TFOA 5EJIA 5DTQA 4ZFNA 4OQLA 2RGDA 3M3DA 5IYZF 4DV7B 1LVGA 3EPIA 3AMZA 1P5FA 2O7VA 2Q0HA 2VPYA 2JVKA 4PCUA 5ITZA 1NOKA 3BD8A 4GXTA 4IGAA 4JLPA 3WB2A 1NW8A 2HV9A 1ZNXA 4ZO9A 4TV8F 3VR4D 1D8YA 3I52A 5F23A 1PUJA 2IYVA 4JJGA 4LF4B 3FZGA 1U0NA 3NETA 3ZYCA 4Z49A 3E1GA 3MXOA 1IWOA 1SVSA 1WSDA 1DCKA 2QUBA 3KVOA 4YRLA 1K9VF 2DBQA 2KYRA 4BNMA 4XR9A 4BX9C 4ND4A 4LRUA 1SKMA 3MWDB 2FYTA 2W55A 1MB9A 4OP2A 1MLDA 5B37A 5G4KB 2MYPA 2QRLA 4A9AA 2C7VA 4A1OA 4D82A 4U6NA 3QU7A 3Q8WA 4YP5A 2Y4NA 1P1BA 3UPUA 1OWNA 4FMCF 3X43A 1TDJA 3OD1A 4RFVA 5KX5F 4D2IA 3ANMA 1B0UA 5HIJA 1CIVA 4YR9A 4XVHA 4ALMA 1M0TA 4YASA 1W4BA 4X5OA 1NY5A 2YBDA 3EMKA 4FZJA 2L18A 1IDN1 3QXXA 3IQZA 2F77X 5GONB 1CJVC 3F73A 2XUKA 4AZ0A 4HWKA 3LA8A 1R6BX 2ZRJA 1WXWA 5CNMA 3BIFA 3GXOA 2VSFA 2NP6A 4USAA 1DRUA 1GUAA 2YNMC 5HUHA 4W5QA 1Z0AA 1JDSA 2A1UB 3Q7SA 5T67A 4JQYA 1QVWA 1X42A 1QIKA 1TL7C 4UCQA 2I0FA 2P4EA 2R9VA 3D6NB 3DYBA 2HIMA 2ZVJA 5IM4A 4RMIA 4KOEC 1KWKA 5T64A 1M2FA 1JZTA 3LW8A 1ADBA 4CMEC 2XCTB 5F73A 1Z38A 3FPLA 1EVEA 4I7EA 4AMVA 1N6NA 1DBPA 4FKBA 4CT5A 3AR2A 2L2QA 5LDHA 4DDVA 1FTYA 3WL5A 5CB4B 4HADA 5DB9A 4CLRB 1PGPA 4F5DA 1DGJA 4GLFA 4L16A 3M2TA 5C34B 1PZEA 2VVTA 4JVSB 4TL7A 1C2TA 4ZT7A 4C89A 5DBGA 4YUAA 4E4RA 1IXRC 1UM9B 2KW5A 1G8FA 4KAXA 4DV1B 2WIBA 3KZMA 4H7KA 1PDVA 3RAXA 1IB0A 4RO0A 4NARA 1L4MA 1JXMA 2WIDA 3HO6A 3JWGA 1XYYA 4FFNA 4RUAA 2PQ2A 2BH2A 5IXYA 5DHAA 4E88A 4FB4A 1JG2A 1MR3F 2W9CA 3QIVA 1VA4A 5BT8A 4HWOA 4JZYA 4AJOA 3K2IA 1KW4A 3PT9A 3J81j 2VJMA 4F6CA 4M04A 3VA7A 2QY6A 4HH4A 3B70A 3RBAA 3FG9A 5DGXA 2GZDA 2WG2A 4UVHA 3FYDA 3UJPA 5FORA 2PD3A 5EIOA 3A6HA 4C4PA 1VG8A 3IAXA 3UWMA 3ERCA 2CMDA 1I7SB 2VRNA 4IIUA 3LFHA 4C9BA 4I28A 2A0WA 4U6QA 1GRCA 5CD9A 2ZUDA 3H4VA 3VU8A 1M2JA 1XJWA 1HKHA 1Q19A 2B3TA 2HA6A 5GONA 2GEDA 1LK7A 2CK3A 2RFLA 2XGGA 4PANA 1USIA 10MHA 3MLBA 1M75A 1DZIA 4MKZA 3G9ZA 1NUTA 4LGCA 1CUZA 1ENOA 4QVGA 3W9BA 2BGTA 2JGAA 2IUTA 4QFMA 2FE9A 3UT5A 4GWLA 4DIKA 2AMVA 3DVRX 1M2GA 4GLXA 1K63A 3B13B 4TRJA 4CFSA 4QJFB 1N6PA 4JV0A 1WDTA 1H8HD 1D9XA 4U3JA 2JGFA 1KFTA 1GT91 1UBEA 3DAYA 5BN4A 1V16B 4RD3A 1P5JA 4DLYA 3OKAA 3RUPA 4K4HA 5IVKA 3WWZA 3U4DA 1NSYA 2EQBA 3IUPA 2O2YA 2C2MA 5FUMA 5JCOC 3OTOB 1L8AA 3AFIA 1S2MA 2WKSA 4NDAA 4P32A 3SYLA 2E4VA 1IY8A 1T0UA 2UAGA 1YBHA 1NULA 5J0OA 2YTUA 3M6WA 1V9SA 2CXSA 4L0DA 1Z5WA 5KSPA 1JI3A 4QHTA 4ZYXA 2G6TA 5GQSA 1RWNA 5EG5A 4JBHA 5FOVA 3W90A 5KVAA 2Q62A 2NU9B 4BEVA 2FSVC 2A0KA 3T9FA 2ODEA 4E5KA 3HCPA 1GR1A 1VKJA 1PEDA 5DT2A 2H2WA 2WAMA 3ZOKA 3B6MA 1Z8HA 1X1BA 5FNZA 4B34A 4MQMA 2VDRB 4OQMA 5B4TA 4PL2A 3D59A 2QOEA 4JLSA 4KTQA 3LAWA 1FYVA 2ODAA 2A4KA 3AYZB 4Q4JB 5D51S 2JVJA 3VVCA 3VZCA 2ESRA 1IY9A 4KQKA 2GM9A 3GN1A 1EEXB 4HAOA 1RMYA 4QQ8A 5EJ9A 1D5CA 2R66A 2Q45A 4GGMX 1W96A 3VM6A 4C14A 5K8UA 5KYXB 5JCPA 2PX0A 1AN0A 3ZI7A 4XCQA 1ZZGA 3X1WA 1QM5A 4OFBA 1B41A 4DIEA 1DCMA 3ICWA 2QK4A 2KIVA 3IIEA 3PRJA 5B1EA 5IH7A 5BYKA 1WY5A 2IY7A 2LYBA 4BVEA 4WXEA 3OGUA 5KHAA 4YRNA 1ORTA 4OP3A 2PJDA 4PC2A 3P9XA 3H0MB 3AMVA 4HDKB 1FP1D 4AG5A 4BZQA 3B7WA 1AQYA 4DRYA 1KJJA 3X1JA 2PX8A 1N6IA 2J0UB 6Q21A 2ALJA 4D74A 4LJKA 3BJRA 4N5DA 5EFOA 1G4AE 1WOMA 2NXCA 2FW1A 2OBLA 2PUHA 2FF7A 1V4NA 2ASVA 3DPSA 4M9SA 4JL8A 1QGUB 4I5IA 1EGHA 4N76A 2ZTLA 2F1JA 3NX4A 1PK1A 3W34A 3LPCA 2IS4A 1JQJC 5HQJA 1XRPA 2WC1A 4WLOA 3IAUA 3BFXA 1ZM3A 5EWMA 5AVYA 1RCFA 3PPVA 1EFKA 3TOZA 4TUQA 1E8NA 2BKAA 4L8GA 4FYJA 1KFSA 1G5PA 4KLDA 2IYPA 2PR2A 2BPCA 3CZ5A 4GECA 4XX0B 4YACA 3DBHA 4QHYA 4F4FA 3UMMA 4NULA 1A5SB 1I4EB 4QBHA 7ICKA 3NC4A 2JLRA 1JFFB 4B9LA 3ACBA 4KGDA 3GQCA 4B7AA 3G0IA 4D0RA 3I9JA 3CF2A 3A58B 3OOHA 1KH3A 2O7RA 3RSQA 3GW8A 4EG6A 4MEBA 3H5IA 1BW9A 4HQFA 3EMVA 3U0BA 4F4UA 4FGUA 4QREA 1SBCA 4CEIB 5AUQA 1GTVA 2Y0PA 3KPWA 3PGMA 5KFMA 3C3EA 3NDIA 1I10A 4YCSA 4CODB 3R9XA 3INRA 3P27A 5JVDF 3Q3CA 2BHRA 1I1OA 4NBTA 3H6HA 1JLLA 3PFNA 1UWKA 3F6CA 4TRMA 3TANA 5LOVF 3UYKA 1NDQA 1S8FA 4XYLA 3UMJA 4F21A 2JBHA 5A9SB 4Y6QA 2FMHA 3HKBB 1HDYA 4IMIB 3UXYA 1IN5A 5C80A 5SYAA 4RE6A 1WVGA 2EFYA 3N97B 3UFBA 2KEYA 2W5UA 3TNJA 4B6EA 5IABA 5KL8B 1S77D 2AJTA 2V1UA 5CX4A 1DPFA 1U0RA 1JHXA 2OPBA 2QZ9A 3D6HA 3IJPA 4NIMA 4PYNA 5KYUB 5KNDH 3MERA 1R0WA 3LLVA 2D0PB 4MCIA 5A9TA 1RPZA 3O8BA 3ASUA 3TGPA 3SZOA 3C3BA 4XWYA 2KFNA 1E7YA 2R2GA 3WMFA 4F2HA 1NJGA 2VP3A 4CMEA 4FC7A 5EWMB 1YI0A 2XT6A 2FMTA 1YDGA 2LKCA 2G08A 2IYQA 4XPIA 4FFOA 3EDYA 3U7QA 2HV8A 9ICFA 2C22A 4KBGA 1NPDA 2BFFA 2G40A 4KQWA 1NW6A 1RC0A 1O9HA 2BBOA 3E2MA 1M0EA 5E6UB 1MVLA 4JJIA 5CLGA 2X0IA 4YRTA 2RCYA 3HB5X 4LBWA 1XD9A 4EATA 1U8ZA 121PA 1EHCA 4WGGA 2QUHA 4AC9A 4RJTA 1EZZA 4RH3A 3D5TA 2VJ4A 3Q87B 3QVSA 1KETA 3F3MA 3KP1A 3OX3A 4TVSA 1YA8A 1YR2A 2D1YA 5GP1A 3ZCVA 3IBCA 1JA0A 4RTKA 8ICIA 1C3VA 1G20B 2AKAB 4KN8A 1HMYA 3OJWA 3UHPA 5KDOA 3AVTA 2A6PA 4F04A 2RMKA 5E9AA 3TW8A 4G2TA 5LBUA 3PC8C 2IL1A 1XTJA 3GZ4A 1CUSA 4Q9KA 3ZD6A 1RLTA 1YD7A 1THZA 4ZCSA 1F20A 4ARZB 7GPBA 1IBMB 1SC3A 3LPNA 4HEHA 4ED2A 1XEXB 1DQRA 1C1DB 3ENWA 5A6VA 3UMYA 1XQXA 2E7ZA 1KR5A 2GYVA 2HPVA 3N8NA 3QH4A 4IOJA 4P1ZA 2FPPA 4FI3C 5DX8A 2XXAB 7ICFA 1SXHA 1M5UA 1NQXA 2XMBA 1MC5A 2VHZA 4IJMA 3IL2A 4TTTS 1YWGO 2RJNA 1K4YA 3GDXA 5CVVA 4X7PA 1TCBA 5IM5A 3K70D 1Z36A 4F4WA 2PRIA 4LOIA 3FLMA 3ORHA 4NDNE 3B9BA 4GPZA 2I80A 2PN1A 3UC5A 4A3SA 3TAHA 1XD2B 4EJ6A 2EDUA 2QM3A 4YWHA 3TD2A 3WGZA 3WLEA 4RK4A 3Q7RA 3STYA 2GXQA 3F2BA 2WKRA 1NX6A 1NBOA 4HEA1 4YHBA 3JTEA 3ASVA 2H3HA 3PW2A 2AEJA 4TGLA 1GGKA 2JASA 2H5EA 4URUR 4OLBA 1I33A 1Y9JA 1TC1A 5J2DA 1ZETA 2P41A 3CX8A 3JSXA 3LQ4A 3PCRB 4X71A 4JX9A 1JAIA 4UD6A 4IS2A 2VPPA 3OM1A 3TN7A 1YB1A 5B3JA 2D5BA 2DQNB 2I9GA 2HJHA 3K20A 5H2FU 1SR8A 2IYWA 2R11A 4BMNA 1UDCA 3DZJA 1AUPA 1ZC3A 1E2EA 2J59A 1BD4A 1Z0SA 1Q3KA 3PQ4A 2ZIZA 1NKTA 4RD1A 1BNOA 2B30A 2Z09A 1ZGBA 2FN4A 4MVJM 4GX1A 3THOA 2IYSA 1CETA 3C7DB 1YONA 3DR5A 3D7KA 1R50A 5TEVA 2FP3A 4LRYA 3W5BA 4PN3A 2GEJA 1JAZA 3IUSA 2H8GA 1EWKA 1JQKA 2IHMA 3BS5A 2JEZA 4C0AC 2AFIA 5JZBA 1DGSA 2C42A 2ZRGA 2OCBA 1TVKA 3AR8A 3DW1X 3HRKA 5KU7A 3DP9A 3H3XA 4D8TA 2D1TA 2H4WA 5DF1A 3UGKA 2C58A 4M38A 2H2HA 3OESA 5GV8A 4OLHA 5GJWC 4PHDA 4J9PA 3H83A 3V4LA 3WB0A 1LI4A 3T7CA 2JGJA 3E70C 3ZNOA 4EGJA 4FM9A 4MGIR 3JARA 3TARA 3A4MA 1ZQNA 2QT0A 3BCRA 5ERGB 4FNMA 5ER9A 2BJHA 3BDVA 4IBOA 1IM4A 1WCWA 5BQ5A 3VYTB 5C51B 4FE3A 1K7CA 5HZMA 3SZRA 2VZ0A 3P9YA 2JZOA 3BTOA 3MS7A 1Z1VA 2YMMA 4AKHA 1V6AA 4P4MA 3MJVA 4B40A 4NAVA 4OA8A 5KQPA 4D4JA 3DD5A 2MA1A 2Y0BA 2K8AA 1XZJA 4XYEA 2E18A 3CSDA 2XYGA 1RAFA 4D9BA 3DAHA 2J4CA 5L3VA 5HG0A 1FNSA 2G8LA 3PQCA 4WCVA 3ZBPA 4KLGA 1H2RS 4N7RA 4DKJA 7ICEA 3PHJA 1ILEA 3KZ1E 4WUVA 4C3ZA 5LYJB 1F12A 1XJQA 2HRCA 4BN4A 3OECA 1GXSA 3SKYA 3MMSA 2A9QA 3KZOA 3G2MA 5JVDA 4GGPA 4PL1A 1AKWA 3EQ6A 2PL9A 3D6MA 3W1VA 3GEMA 1TLFA 2ZDQA 4E07A 2O7QA 4FCCA 5CRIA 5L4LA 1WDWB 4DS4A 3C8MA 4PH5A 5HFNA 2HW8A 1SCJA 2C29D 1JEAA 1M6HA 4P81A 1U48A 3LDFA 3GCGA 3JRNA 5FOUA 1X1RA 3ZU3A 5T7BA 1AA9A 1U5AA 3GJ3A 3WGUA 1QO9A 2PSHA 2Z3ZA 2GA8A 4BNXA 2P2YA 1ZIPA 4I6JA 1YBAA 3PFFA 5F3DA 2WJYA 4FD2A 1K8QA 1EDOA 1XJ0A 2HF9A 4HYKA 3HXPA 3N2IA 2QR2A 1NU8A 2WHPA 4BFWA 3O9ZA 1BFUA 3GWGA 3L8HA 4TSFD 2G77B 3T9EA 4A0GA 3ISDA 1A9SA 3IH5A 3CCFA 3IDQA 3OH8A 2VNSA 2DBZA 2V7QA 2OHJA 3A1UA 2VSXA 2WIJA 3SC4A 5F33A 4DYDA 1BS2A 1OI4A 1JQ3A 2QA5A 4QPJC 2YNMA 3FYUC 1O4WA 3RWBA 3UWOA 1JAHA 1Z26A 3L5OA 5HQ3A 1CBUA 3THYB 1WXEA 3RS9A 3ZOZA 3RANA 2FRVA 3WDSA 9ICQA 1PT9A 1XWIA 2RDJA 3PB3A 4GMDA 4R3NA 4AO8A 4ELUA 3W4IA 4F4CA 5JNTA 3DEFA 2R4QA 3RTBA 1Z17A 4G89A 3H4DA 1SY7A 5A0VA 3C24A 4QU9A 1AXRA 4TKMA 1NW7A 4IZHA 5IJWA 4D26A 3B9PA 3AL3A 2AGOA 3T5PA 4OI2A 2BCEA 3H0LB 1Q17A 5DKWA 3HBNA 1Z83A 3CLVA 1NG9A 3SENA 3NEAA 2QARA 1A96A 1P9OA 2HLHA 2VQ3A 4MHOA 2QKYA 2ZTSA 3UCEA 2VNHA 5JARA 1AU9A 2BF7A 1OXXK 2V4RA 4R0VA 3VSCA 2ZTHA 2WF7A 3RFVA 3DV9A 4PIPA 4O33A 3G1WA 2I22A 1GGEA 1HJPA 3U9LA 1ICEA 2J31A 4K03A 4TVOA 4DSLA 4J03A 3S4YA 3HM9A 4MA0A 1EUCB 5HIMA 3GP8A 4B31A 1G9TA 3GRFA 3LK6A 3EXG1 3O1JC 2MYTA 2PIAA 1UQRA 5GJVC 1AO0A 1ZMRA 5C1DA 1F7UA 4D46A 1ZJMA 3I04M 2PUFA 5CA1B 3KR1A 3UJNA 1TA9A 5I47A 1FUKA 2HMTA 3I1YA 3JYHA 1OX6A 1JROA 3CVWA 2ZR8A 4DDMA 4C3UA 4KUGA 3AB7A 5BW5A 3CRZA 4LWQA 3TRDA 4TURA 1F2UA 4BO1A 2C3YA 3KR9A 3RLFA 4NBSA 1QCDA 9ICLA 4K88A 1U1CA 3Q0EA 2ZWPA 2W7OA 3CZMA 3HHEA 1ISHA 5J59A 3FAKA 3E9MA 5KC8A 4EKIA 4XSVA 4DXDA 1HFEL 2RAPA 3W6OA 5HM8A 3HCBA 4MA4A 4MHVA 4ZHSA 4P53A 1N5XA 4NHEA 5C5JA 2QSUA 3KYDB 1UP7A 2QPLA 4EVSA 1FQKA 1KQNA 3HC7A 2ROQA 3O4JA 3OMWA 1XXHE 3KJQA 1BN7A 2FQYA 4XJVA 5LLDA 3RJMA 3E9RA 4AZ3B 3EPRA 4CM4A 4IHJA 3EQ7A 4LJXA 2GF0A 1MU0A 4WUTA 4OK6A 2PGOA 2V7UA 1WCV1 3F4LA 4UM5A 1NKVA 1Q20A 3HWTA 2EFEB 3JYNA 4ESHA 2WHEA 4HDMB 5IDYA 4AIRA 4TMVA 2FR1A 2E1FA 1RAHA 4YFVA 5EFZA 3A11A 4JC5A 4AP6A 2F8SA 3EQ8A 2X4IA 3RBDA 2WNSA 1RMQA 5EE0A 1UXKA 1OASA 4NDZA 1JR2A 2FW8A 5FKJA 4F8EA 1HSOA 1OTXA 1HV8A 1EM8B 1OGIA 1TM4E 5CT8A 4TQRA 4LVUA 1VDVA 1Y3BE 4KH1A 1O0CA 2FPGA 1ZGZA 1TIPA 1FEZA 2IE8A 1N5RA 2PS3A 2ZTUA 3CF6R 3CSUA 4R2WA 2Z6VA 1V8DA 2W2MA 2B4QA 2SBTA 1IXSB 2FNAA 2WZQA 5T4EA 1HO3A 1NOJA 4NK4A 2D2EA 2WSIA 1XU4A 1U9ZA 4J7AA 5GZ6A 2H4YA 3HU5A 4F3TA 1S0VA 3EF3A 1JEEA 2D3TA 3FVWA 5GONF 2FJ0A 4UEJA 3QYAA 1F2DA 1JHDA 2XX3A 4WZAE 4EZEA 1G3IA 2VXCA 1H42A 5TZVA 1Q7EA 3PJDA 1HNXB 2GPBA 4RAQA 4JYCA 2QB1A 2KK0A 7ICJA 2FPGB 2J3MA 3E9YA 1T0IA 2O8DB 1DKPA 2CK3D 3A7EA 4ZEWA 4H16A 1FYFA 3DMDA 1E1RA 4JUIA 4CJXA 3PD0A 5AW8A 1HE2A 2XGPA 2HCRA 3VPCA 4B7XA 2OBXA 3WLTA 1SWVA 4LXIA 1XPUA 3ZC3A 4N3GA 5B6IA 3G0HA 2G5IB 3GGOA 9ICPA 2AJQA 1O8BA 4CI0B 1CRLA 3T5CA 2WM3A 3VNAA 2E1EA 5C46F 1MBZA 5KYYB 1JHOA 1FNMA 2D1QA 1J06A 1QYVA 4FB5A 4B43A 3TLKA 2O59A 3O8OA 1WXGA 3WISA 1EIWA 2VF5X 4KRFA 1M83A 2B82A 4AKSA 1NNEA 3PLNA 3L40A 3MJTA 4CM8A 2WYVA 2QE6A 4E21A 5KTKA 2BGUA 5L7TA 2HU7A 1RXWA 1GAEO 3JAWA 2Y6UA 4MMYB 4YA6A 1KZ7B 3BTVA 3GLHA 3SF8B 3HMKA 2UVRA 4O1MA 3HK2A 1EUZA 2W54A 5J2UF 4HUTA 5JS7A 1YR7A 1U9CA 3SX4A 3O2NA 4NZ9A 3ZZ1A 5JSUA 4N3CA 4NBLA 1KFCB 2PT9A 4L5CA 2NPFA 1RWVA 1PWHA 4PNPA 4BKUA 4XUGB 3SHTA 4GR5A 4K7JA 4DSNA 4R8MA 1Y5LA 2V7XA 3AHDA 5HKLA 1UBRS 1OD6A 4M0PA 1KE1A 2Y0DA 3HR8A 2LD4A 1YB2A 1E2IA 3PY8A 2EC5A 2PD4A 2R1UA 3H4BA 2QAIA 3BREA 3GFOA 3OKPA 4JLNA 3CR3C 4MWOA 1RLJA 5DO9A 2RJ3A 2BMEA 1KEWA 5DSXA 2IC5A 2MMCA 1H05A 1SZHA 2VYVD 4GPBA 4UKDA 3GR6A 4UE6A 4CV3A 4YUWA 4W63A 4K9RA 3PE3A 5ECGC 4D3XA 1JJFA 4R8UA 1J39A 2EBWA 3C16C 1B2LA 1X7DA 2JLBA 1PFUA 1XMQB 5JYEA 1DOQA 8ICMA 2ES4A 2ZDGA 4CFYA 3ANTA 3RRYA 1NK7A 1E6UA 1HDCA 2W8KA 2P6OA 4I2EA 5KFKA 1G3MA 3K1AA 3LK7A 4LC0A 2NG1A 1SB3C 1GZSA 1XIVA 1JLHA 2O8NA 3E7XA 3N2EA 4MDHA 1ZD4A 1LA2A 1EVQA 2G4LA 2W7TA 2GKGA 3FPFA 2WKWA 5KOIA 1UDAA 3C8DA 3NVVA 4UBNA 2NV3A 3R7LA 3UCFA 5TLSA 3O4IA 5D2CA 4N8DA 2FMIA 4D8WA 3THYA 2AW3A 1AV6A 1LJLA 2I5PO 3Q8SB 1P73A 3HEAA 4B9EA 1IIBA 2VTKA 3PA8A 4NOJA 2JH7A 4D9EA 3OQHA 5B2EA 3FM9A 1FDRA 3GI1A 3N2KB 3QXSA 1NF3A 2FPXA 1ZHFA 4FD3A 1TOAA 2E48A 2OGZA 4HAUA 4KWEA 1WUIS 3ROKA 4OJOA 3SIWA 1T36A 3SZLA 1VCOA 1U28C 1KJZA 1X7GA 1FTQA 5KT3A 1CFZA 2JZNA 1UIMA 2Y1WA 3DHNA 1JSCA 3QLTA 5H16A 4YXWD 9GPBA 4OJNA 4RQ2A 2DQSA 2QD2A 1LDMA 3I6IA 2F3SA 4K81B 3EGXA 3ISJA 4ZVPA 2JLCA 2QROA 4DQVA 1QTMA 3V4SA 3R40A 3KZXA 4WVFA 4RQ8A 3QE9Y 4LF6B 1NURA 2DBVO 2XJ4A 3NBMA 4ZOHC 3BZBA 3A1FA 3IP8A 3BGVA 4ND5A 4MI9A 4PIVA 3V4FA 4DCOA 5F2EA 3WG9A 1E5VA 4ECQA 1C3XA 1XFAA 3K8OE 5MN4A 3KS9A 3JAMA 4EPWA 4EYIB 1QP8A 7ICQA 4RMNA 5AVJA 3RAFC 5JPDA 2HD4A 2HA4A 3PXAA 3K3PA 1U2SA 4Q34A 2ZIVB 1UA0A 1H94A 2XB9A 1V48A 3P9QA 5J2BA 3RJJA 2BAGA 2H06A 1NUHA 4HO1X 4LJRA 2AXEA 2WZCA 3IHKA 1E1YA 5AJHA 4YYEA 4DN6A 5JS1A 1U94A 1KK3A 4J7UA 5EZ5A 3HV2A 4PGYA 3FVQA 4IHJF 4Q7KA 3SCZA 1O6GA 2I4OA 5I9MA 4BFVA 3CYFA 5B3LA 1HNNA 2UV8A 4JP2A 8MHTA 2V7QD 2JLWA 5HP4A 3NVWA 4R8VA 1NZFA 1SC1A 3HWRA 4F3OA 5ANRB 4CCHA 3OY7A 1KFJB 4RK1A 3C8UA 4D3SA 4B9TA 3E48A 4WEOA 5FP0A 3ZU5A 5KFRA 1PJBA 2WE7A 4Y9TA 2G5PA 4UUAA 3SAJA 3K9QO 5KVCA 1JV2B 4P34A 3WNQA 3ED5A 3CS3A 3Q9UA 3ZDXB 1R1DA 3GBSA 2IHKA 4M4SA 1L3BA 1N2JA 1PNTA 1W0KA 2QAGC 1RYFA 4HAXA 4ZPJA 5BNFA 5TQ0B 2OA0A 4DDUA 1N2GA 3GIIA 3IODA 4RT2A 4BEWA 1K66A 5IANA 1C80A 4X63A 2XHEA 1QPGA 3IPYA 4EMTA 5GM1A 2H8KA 2J1LA 3ZHOA 2AMYA 3VR6D 4F86A 3CUVA 5KOJA 1RJGA 3JALA 1T1RA 5FTLA 4L0QA 1FFSA 1JQEA 2MYNA 2WF8A 2QHXA 1SMKA 3MFYA 4J0EA 4QC2A 4XX0A 5DWQA 1SIUA 3PUZA 4RQNA 2BFNA 3TQ1A 1DUSA 1EK6A 1RPJA 3BE4A 1ZMTA 3DFZA 4PQEA 3UXMA 4EP1A 5ED4A 3HJEA 1KA9H 1R9JA 3NU1A 2Q3BA 2Q5OA 4ZDJA 1S8NA 2YCBA 5IKPA 3UO8B 1PK1B 5K5EA 3OZGA 2MR5A 4IIJA 3LUDA 2OILA 1T2DA 2X5JO 3NBZC 4BFXA 4RTNA 1U4SA 2HRQA 3QWAA 2J5RA 1NKSA 1I1NA 5AUNB 4AN4A 4L85A 4MQEA 1UUFA 1Z08A 3RSFA 3U3JA 5IULC 2DJIA 5AK6A 1G7TA 3KZVA 3B9JA 3B60A 3PTZA 4LWPA 4AN0A 2HQOA 5DBCA 5ISMA 3IKJA 1VG1A 3OETA 4MUHA 2ARKA 3QYPA 4Q4JA 2YQ4A 3OX4A 4KUEA 4I4TF 3RAEC 5FJIA 2HSZA 2IPLA 5L1MA 4QTUB 1LV5A 2VH2A 3NFYA 5E3HA 1TVKB 4FQ8A 3FW1A 1L3CA 2OCEA 5KYXA 4QATA 3GLIA 1VPVA 2VAXA 3RJGA 2ZRNA 3QUCA 1WUKS 3TVDA 4YUZA 4LZOA 3HCEA 2E2WA 2WUVA 4ID9A 4IIJB 4UUQA 3AESB 2ZANA 1JJ7A 1XN4A 4Q8EA 4KO4S 4MCHA 1B93A 1PJRA 2JK0A 1WTAA 2W48A 1G5RA 2WU4A 4JJ6A 3GFFA 3N7UA 5CH5A 4YR2A 1WWVA 1OY1A 2XJ9A 3BMXA 2DKOA 4DJJA 2E5SA 5CJJA 3JWPA 3S2GA 1E0AA 4FBTA 3ZV7A 1STOA 1B3BA 1U7OA 2KS6A 3NWOA 1JIUA 1ZSNA 1Z88A 4UCWA 2V4QA 4P93A 3R76A 4YYZA 2IZ6A 1GR0A 2GN2A 2V7GA 3AZOA 5CT5A 4CUZA 5JNUA 1PKXA 2RHDA 4MQ5A 5ENDA 1G7RA 821PA 1X7YB 4LUCA 2CVZA 1K92A 2ISSD 2C2DA 4JYBA 2ZUUA 3WX0A 3FNEA 1MRSA 5L4NA 5TVGA 3OQNA 5IM4F 4H7JA 3A10A 3AUOA 1GCUA 1PS9A 2QXTA 3I6ZA 5DNAA 3V33A 8ICEA 4MUBA 1JEYA 1GITA 1KGDA 5TR9A 1JHZA 5BWMA 5BURA 2AHRA 4CF3A 4KQMA 4IFEA 2LPEA 2FW9A 5CT9A 5BPFA 4ECUA 1GTMA 1LDBA 4MW2A 4EQZA 1L7NA 1OFHA 1W4LA 4R0NA 1EVKA 4YVFA 3GGSA 1HE3A 3FLBA 2K87A 5CGZA 3WGJA 4MV5A 3C2LA 521PA 1KZ9A 1M1UA 3TOSA 1KFBB 4RVNA 5THXA 2VQSA 3NORA 4BMVA 1L7XA 2WKPA 2C1ZA 3WQSB 1UHUA 4DF8A 4FWBA 3WSTA 3K53A 1MO3A 2RHLA 1JEQB 3I9V1 5FR2A 4PXSA 1MO2A 2Y1JA 1F8FA 1Q2XA 1ZQPA 2H5JA 4NEQA 4YCMA 3GVIA 5LMCA 4R8KA 1J99A 2YV3A 3B89A 3A1CA 4KQ2A 4NH4A 3W5SA 5JQGB 3D81A 2Z3VA 2PA3A 3C5CA 5CBPA 2JKZA 5LSAA 2XKJE 3BJMA 3KYDA 3OIYA 1UBLS 2XY6A 5DHSA 1CY7A 3QVUA 1K06A 3T38A 1NMSA 4WXMA 2OAQ1 2BM8A 1VBKA 1KYVA 4ENRA 3AY0A 1CFJA 2C3PA 3BMQB 1JKJA 4ZODA 4EUNA 1LRJA 4RIFA 3S2ZA 5IMBA 4GXIA 4MIEA 1UINA 3RR2A 4IEIA 4CHGA 1JEQA 1OUQA 4BV3A 3O93A 3RVQA 3WL3A 1U2PA 1E3LA 3KT8A 5CA7A 3RJFA 2G70A 3O1IC 1Y5RA 4H7IA 3KTQA 3CYMA 4HGZA 4DCCA 2K89A 3QVOA 2H1OA 3UKJA 1XZEA 4R1PA 2JRCA 4KTTE 4ZU6X 5KFGA 2HK9A 2II6A 1E6LA 3FY4A 3E7PA 4G8CA 4EW3A 4H59A 1M8JA 3QKUA 3DWFA 3T99A 5DBHX 3HDJA 3ZY3A 2AK2A 1N7JA 1BVHA 3ZLVA 2EWMA 1YRWA 2ZIUA 1XVIA 1O97C 1BDIA 1MFPA 2AXQA 3M6MD 3NVKI 1E6KA 2OVBA 3ILSA 1T5SA 2XVZA 5LD2C 1V1JA 2GZ3A 3BVPA 3GVCA 2IBTA 5FWXA 3ZLJA 1YT3A 3C21A 2BFWA 2CLSA 3IBTA 2RBKA 4PRLA 1DK2A 2I6GA 2J5KA 4JXJA 1BX1A 3VVLA 1IN7A 3NT5A 4DLZA 4YXFA 2XVMA 5DHFA 1Y7PA 4A8JC 3RIGA 3AVVA 3B8EA 3FMGA 1KY5A 2J85A 1N2HA 3KOXA 3O8LA 1BPDA 4FCVA 1RBZA 3BWDD 1L7BA 3PC8A 4IV5A 4XVCA 1QRTA 3ZLBA 2CDCA 1X6IA 2B92A 2Q5LA 1C1HA 3WRWA 4AF8A 4BAGA 1N1GA 1VHWA 3FPCA 4GT1A 4KXYA 4EUEA 3DFKA 2Y1FA 2VK8A 3WRYC 1OVMA 4YK7A 2C00A 4HQKA 3TMAA 1CUXA 1JPVA 1KI4A 3LY7A 3J80A 5CVJA 2YWRA 2SKCA 1Z47A 3VYWA 2VNIA 4OHCA 2FZLA 2FAXA 4RM3A 1Z4PX 1GSIA 1WXIA 2F9MA 4QDUA 2ZBEA 2C4HA 3IR5A 4ZU1X 4AWBA 3SBOA 3NBQA 1A1VA 4ZC1A 2HZ7A 2HHSA 5DEIA 4YRKA 2WJJA 1TM5E 4N6GA 4BJ6A 1MQ9A 1JALA 5KTPA 2VJAA 1QGDA 3PSIA 3BD7A 4TMKA 4GX2A 4K9PA 1XRMA 3KKLA 3FDZB 4Y1RA 2CSXA 4NJMB 1XT6A 1UM8A 9MHTA 2O9JA 3IPRA 3P19A 4TQAA 4B6PA 5IEJA 3U7FB 4C4ZA 3ORFA 4PZ0A 3WR5A 3KETA 3BCSA 3CUWA 2WABA 4KR6A 1L7EA 3AR4A 1H4SA 4V0LA 1O08A 3UJ3X 1NXTA 2MCFA 2A1UA 4BFLA 4D9JA 2AU0A 3DYVA 3GUZA 5J2UB 1EX1A 1UJCA 2VOEA 3U48A 2H1RA 4ITUA 4MSUA 4K2AA 1W5TA 4CWAA 1COZA 3BX1A 2N9UA 2QYHA 1M5TA 2VJDA 1Q1GA 2PKXA 2AEFA 2QTNA 4R41A 5CJ2A 3SQDA 1DBIA 1YMVA 2HBKA 4G24A 1ESNA 5A7GA 3V6HA 5FOWA 1DC4A 3V7FA 4B6QA 2BPOA 1WQ4A 2PSJA 4ND1A 3DZBA 1W0JD 4TWIA 1X7ZA 3G88A 1C4KA 1VSQA 2CCGA 3ODGA 3JAKB 3IT2A 4MPJA 1ZSYA 5TMDA 5KOHA 4IXTA 4YGYA 3SC3A 1CR6A 2GHTA 2CJFA 2GCIA 2I1VB 4BN0A 1U0FA 3ZWWA 3U7EB 4R71A 1OKKD 3KBBA 4MI6A 1D2NA 3D7RA 4DZRA 2J46A 4E6PA 4BATA 3HO8A 1S8OA 5IJ0A 4CL8A 3PGA1 4U9IS 3VR1A 2ZVDA 2Q0SA 1H2YA 4MW7A 4ZV9A 1W8DA 3PW5A 3NASA 3SJUA 2Q1TA 2J9FB 3GDGA 1IXRA 4BX8A 3CGWA 5IINA 1C0PA 3DFUA 4V0OA 4IDHA 5A1JA 4DLSA 1HNWB 3MR5A 4RXTA 3KJXA 2PMZC 2QY9A 3MILA 2YVAA 3GPLA 3FC4A 2EANA 8ICVA 1ABFA 3FWKA 1Z15A 3AZPA 4EYOA 1X9HA 3FPSA 2R7MA 2ZS8A 1ZK2A 4GPAA 4HFRA 4A6EA 1VL6A 4N5HX 4PZPA 4ES6A 3LIPA 3P4UA 3TPCA 3VU9A 2J5XA 1LFAA 1CX9B 1XEFA 2H3QA 3N28A 1KGSA 1N2BA 2PFKA 3OIGA 4L3OA 4MR8B 5EXSA 3RUCA 3K9CA 4MYUA 3W05A 1N2CB 4MUNA 1XK7A 5F2KA 2O1SA 1DO0A 4HTFB 4KPEC 2QSZA 3HYLA 1PUZA 1U8CB 3V3KA 2VLBA 3NHWA 2UVDA 2I55A 4IVPA 1E7RA 4NU8X 3RAGA 1EUDB 1G66A 4M1WA 1J8YF 1CJKC 3PL5A 5IJZA 5GJBA 1QO0A 5CB0A 1U0GA 3AB3A 4QIHA 4PZ9A 4YUYA 2A0XA 3CRW1 4OB7A 5NULA 5AUOB 5KNBA 4DR5B 3ZGZA 1JE1A 1UM9A 5CT6A 5BWCA 1OLXA 1U6KA 2HWYA 1GL9B 3G23A 3UK6A 4RQ1A 2CNNA 2W2KA 2PLFA 1TQDA 4PBSA 5LUAA 4Z4GA 1CRPA 3R3SA 2JFFA 2PRJA 3QLVA 1YQWA 1F6DA 3WLOA 4ECTA 3DQZA 5DM4A 3HS3A 1X92A 1XZGA 2PBLA 1NJ6A 1VHJA 3K72B 4R2XA 5KKNB 1ZQLA 4J1TC 2KB0A 1ZBDA 2O3UA 2UYYA 3IQIX 3P96A 4KXUA 3GOQA 5JDIA 2IYNA 2HMUA 1I4OA 1YR1A 3BDPA 1ZIDA 4Y9SA 4WHMA 3SU8A 2GNAA 1JB9A 3M83A 1TO1E 2QS9A 2WJ4A 3T35A 2WTUA 3NP7A 2ZS7A 3BL8A 1BXKA 2XI4A 4WA8A 2O7NA 4QGGA 4XM2A 2BCJQ 4QUDA 5ERYA 1CY6A 1T2UA 1Q16A 5JD4A 4RTMA 3VTAA 5JAUA 5F98A 3R9KA 2DKNA 4GEGA 3UUGA 2ZXUA 2IIVA 2LTAA 4I9GA 3KPJA 4JLOA 1UOQA 4JBXA 2QI9C 4HPWA 1GU7A 1O5TA 4YCDA 1E3IA 2CYBA 2PBFA 1MPTA 4FLMA 4Q7QA 2R4UA 1EYZA 3H4MA 3HJNA 4NX2A 1IEVA 1W9MA 4W1RA 4EYGA 4H0NA 2A5FA 4DDWA 2ZU0C 4NCXA 1XD8A 4YJGB 3KQLA 2GZMA 1JKIA 4LK2A 1HA3A 2JZBB 5CLJA 1GP2A 2F9FA 3D9QX 4HAWA 2HR1A 3MAJA 1XDSA 3DS8A 3CEPB 4Q15A 2GBPA 3BZCA 2OWDA 4FUQA 4ARZA 2BR4A 1GFIA 2FSUA 2QJTA 3KB8A 4UBCA 3SM3A 2QG9A 2XYRA 4FOLA 5IJXA 1E1QA 2H16A 1COOA 3IEUA 1T8SA 3TAUA 3V80A 2PQ6A 1BX3A 4UXIA 5J2GA 3TACB 1BE8A 3EGIA 2AC4A 1DP4A 1NQOA 1ZOPA 3ORRA 1K68A 2GVNA 4GI5A 2FPMA 2D5CA 2VWPA 5LQSA 3S99A 3OJUA 1SG9A 4NL4H 4QRDA 3MCVA 4X91A 5HOEA 4U2FA 1YS4A 3KD2A 5IJAA 1ZI9A 2PXXA 4EH1A 3PZPA 3SS8A 4DDTA 1Q3VA 2BY4A 1ZOLA 1K7XB 3BRCA 3KT6A 4GPTA 4C7ZA 4Z9YA 1SURA 1DCTA 1UBCA 1SBYA 5GM2A 3LVVA 3CMCO 3RRZA 1FJHA 2Y6VA 3JQDA 4TXNA 3C7KA 5AW9A 5EA2A 4JV5B 1DSSG 3LCRA 3VZRA 3GL9A 3HZRA 1JP7A 1P4JA 3OEED 3OPYB 3DTTA 1JJIA 2YWJA 1PNVA 2XA9A 3LZ6A 4UHKA 2ONJA 1W87A 4EYQA 2NO7A 3TECE 2XUZA 3QRWA 5INTA 2NAFA 3ELDA 1P75A 2OB1A 3QE3A 1G9XA 3ZH2A 4UBLA 4C0WA 1CEQA 1WHTB 2XQKA 4EKNB 5HZKA 1JUDA 1SZCA 2GEUA 2NU7A 4LHWA 3X1DA 1E3WA 2QW1A 1KEPA 1ENYA 2DGDA 3ENKA 2ZI4A 2PFPA 5GMOA 1NJZA 1ZRNA 1ND5A 4GUAA 4RLHA 4NBNA 1U81A 4MWGA 1T91A 1CZRA 2ZWAA 2W9MA 3GRZA 4RJLA 2B7CA 4WTOA 1AB6A 4JHLA 4JI5B 1OLUB 1T3HA 1ZU4A 2CL7X 3K96A 4V24A 1GQQA 2EDCA 5DLPA 3O3MB 2P78A 4D43A 5JAIA 3KQOA 2R6ZA 3R9IA 4HDOB 2QAGB 2VRCD 1AH2A 4JI3B 1W0JA 1COWA 4HAYA 1P9WA 2R6AA 3DHVA 2BEUA 3I92A 3EIWA 5I4CA 4HLCA 5L3SA 3SC2B 5FULA 1JAYA 3NHRA 1Z5NA 2EZ4A 3E0XA 1GPAA 3S6JA 5LD2B 1I3OA 1ULUA 2ZAMA 3PENA 1BNPA 5TMBA 4JBWA 3NTLA 3RDPA 3ZDEA 4MEXA 3F1LA 1XMIA 3WKBA 4IZOA 3EF0A 2HBLA 1C81A 2WOOA 3UK1A 1Z34A 2LIVA 4OHRA 4GMFA 1NYTA 1E8DA 3GAFA 3T5BA 2NO5A 4DKXA 2IGTA 4B3FX 2W9BB 3SFTA 2PANA 3O4RA 2ALZA 5DI3A 3IP4B 3S55A 1KXZA 5JE8A 9ICNA 2GPAA 3E7FA 1GXSB 1L5QA 3LM8A 3N2NA 3WOHA 1V85A 1S76D 3IOEA 3ZDDA 2R6JA 3QELB 5EIXA 1X80A 2ZYGA 2ADFA 3U17A 3JY6A 2Q3EA 2XVTA 3WZLA 4D5EA 2DCUA 1MAAA 2FFRA 3II6X 2VSOA 3RJTA 1BCSA 1D1PA 1E6CA 1GGHA 2GBIA 2P4QA 2QZPA 3KQTA 4FGJA 4G1MB 4MUMA 4RD6A 4R8RA 4BKRA 4WEQA 4B2PA 4J0QA 3T5DA 3QWHA 1H6AA 5GOTA 3LJKA 2EF1A 3CLUD 3CV3A 1I6MA 3ANLA 2OP1A 4K46A 4DSJA 1NUQA 2NU7B 3I09A 5IAAA 3EXIB 1LKYA 1C5KA 2OXIA 1VG9B 3C6MA 1E9EA 1P31A 4LISA 4A2WA 4CV0A 3O0FA 1OROA 1SG0A 3Q11A 1ONNA 1J1ZA 2FX3A 1DT5A 2P2ZA 3QVLA 3COWA 4MWCA 3UJAA 1RYMA 4WWHA 4BNVA 3P9NA 4RX1A 2XDQB 1P4RA 2X8WA 2Y71A 4I1UA 4BWYA 3E3AA 4B3DA 3IQEA 1LF0A 1M2WA 3BQMB 3MCWA 4YP9A 2WSLA 4OCZA 1D4OA 1L4HA 1NAIA 3PNOA 5G53C 4RVFA 4IH4A 1DEHA 3NHMA 1N36B 3VGPA 3GIWA 3BS5B 4JI8B 3T3OA 2WT4A 4R66A 3OPXA 1VJRA 3H97A 3FJOA 3SKVA 5ICGA 1GYRA 2EBFX 3EXFA 3K8ZA 3TIVA 1KBUA 2FPUA 4D9IA 4TRNA 1O9GA 2N0SA 5LIRA 2O5EA 1UBNA 2AX3A 2CHGA 3G02A 1ZO8A 4RHCA 5D3KA 4BAZA 3E27A 5A06A 5C5IA 5CP8A 1Z7GA 9ICSA 2XCPA 1O7JA 1K08A 3KQPA 1GN9A 2R5WA 1Y3DE 2IV3A 3FF1A 3SMVA 3VHQA 4PPGA 1Z1BA 3X1XA 5I8PA 2CNDA 2IZ0A 4ML3A 3TM5A 5BMVB 3RSOA 4O4HF 3B3AA 2NVOA 3H0EA 2WNHA 2DUMA 3IUEA 4MRPA 5G3YA 2JEGA 3WDKA 5ALKA 1N0WA 3NUZA 2PKYX 4RD0A 4E30A 2AUTA 3IHQB 5LWHA 3EYAA 2C3MA 1DAOA 2YJTD 4WK6A 4Z99A 5C5CA 3TIIA 1G6OA 2OORA 4WY2A 3EQ9A 4C8NA 4WNYA 2HAEA 3NHSA 5T41A 3AHIA 4BLUA 5KYYA 4DM7A 4OQPA 3F2IA 4RH0A 1DQNA 2XMDA 4YRZA 2DPIA 1N5MA 3QF4A 2BL4A 4IAOA 4ADSG 3ED1A 1GLGA 2QM8A 3AJEA 1NK8A 1YJAA 1TK2A 4M0FA 1N7IA 1ONPA 5JLAA 1XKXA 5ESRA 1BJTA 4HEJA 4BDSA 4C3OB 2VDJA 3LQKA 1F2UB 5LZ7A 3ZK7A 3QWIA 5LQDA 3CU5A 1C1DA 5EEGA 3TZ6A 5E8JA 1GNSA 3MUEA 4Q3CA 1T4GA 1RAEA 3DLTA 4MUAA 1S5LU 5KFVA 4FYKA 5IT4A 1X9SA 4LOKA 1QH1B 1D0SA 1Z4IA 3ONDA 5AVTA 4OH7A 5COQA 2WOJA 3A0RB 1ZXIA 1O96B 5CT4A 7ICRA 2LDXA 4XSGA 3E8SA 3DD1A 3EZNA 5J3JA 3KC2A 4Q45A 2Q8NA 3EIQA 5KAIU 4OYHA 1NATA 5E4YA 4BDTA 1E9AA 2W4IA 3KZKA 4KPGA 1KVQA 4GWGA 4HVAA 1BEEA 4IY1A 2IH2A 5CFRA 1JPJA 1T1IA 4QU5A 3RRNA 1Y1TA 5LM3A 3QMWA 1L1QA 3A3YA 1TD1A 3NTVA 3MELA 3RR8A 1BXRB 1RHJA 5KINB 4NV0A 4P31A 4R01A 2VYQA 3LPAA 4G37A 4XA5A 4KLEA 2MR6A 2OQRA 4KSBA 4TSFA 4J0CA 5EJFA 2RDMA 3KUUA 4DCPA 4EYKA 4WKGA 4AXXA 2DETA 5D49A 1PR5A 4ZVTA 1PQPA 2R8ZA 3ZWCA 2PFQA 2GPTA 4L73A 4XLTA 5D1HA 1KOFA 1S3IA 4AW9A 4XDGA 3PR1A 5LYJA 1LPOA 3T0GA 4IO0A 3QU2A 3PDJA 4B3IA 3JPOA 3KSDO 2KHQA 3LKBA 4MVJP 4RHUA 4RY9A 2O5CA 2ZYRA 1C30A 4M9UA 1J6UA 1WCLA 1A0OA 2P3QA 3I28A 3FNRA 4JYZA 1CUAA 2I2AA 4F1JA 3QKRA 2ZZMA 4PCVA 4NLKA 2IHNA 4ZIRB 1P2DA 2PA0A 3H04A 1BAPA 4HGYA 3BICA 1XZHA 3N7RC 3FFAA 1DX6A 1QYCA 3NH9A 4K6GA 3ZBUA 5BSRA 1IN1A 3RARA 2IPOA 2R44A 2R8YA 1TYDE 1ZNYA 2VA9A 2XMZA 4L4SA 3INGA 5FWYB 4QQFA 4QX6A 3R7AA 3P7MA 2HHUA 3M9WA 5EQJB 3CLSD 1VRCA 2C88A 5LA6F 5LCXA 3ZUGA 4B2LA 4F9FA 3VO9A 4XWKA 3IE1A 5LMNB 3WK7A 2PKWA 4S1PA 4X0EA 1PF7E 4QYXA 5SY6A 3UAVA 4DSAA 1KEKA 2C9MA 3EIHA 1MX3A 2GA9A 4U39A 4GR9A 5KNBH 2EAOA 3MYYA 1OYVA 4OSEA 5C52B 2RQ5A 5KFBA 1VIMA 2E49A 3VTZA 4HL6A 2HIGA 1NAHA 2KJ8A 3BRWA 2XNKA 5HMMA 3I76A 2V58A 3JARB 3R3WA 4Q5IA 2R8GA 2BDEA 2CRXA 1NK9A 3JZFA 3RUEA 1P9NA 2A2ZA 2VXBA 4BWFB 3U13A 1HG0A 3HZOA 1FMTA 3G8DA 3PR5B 1Y8ZA 4JYPA 3UXOA 1QKKA 4DBZA 2YY5A 3BIWA 2Z9CA 3GLTA 2H4XA 1JRLA 4DVJA 5J43A 4LF5B 2QMEA 4LI0A 2VT6A 3NOVA 2BKLA 3KHTA 1KDZA 3ZXSA 1MB4A 5BV8A 1H4VB 2LCFA 3VZSA 1CY2A 3WWDA 5B58C 3ZHCA 1NQVA 3SGLA 1A8PA 1PKEA 1Q0ZA 1RQXA 2IEGA 3FLAA 1KQFA 5BN3A 1FXSA 1TRHA 2IUEA 1W36C 1OHHD 1JYEA 4YI5A 4RW0A 2R6CA 3JAKA 2W8BB 5KOHB 4QM6A 1K3TA 3RM3A 4CEIA 3M8SA 4M9JA 3UHJA 2ENUA 2IIPA 5EHGA 3FKQA 1LD3A 1RQ2A 4P80A 4FFWA 4QDKA 4FWTA 4CKBA 4L6CA 2JAQA 2KE7A 2I33A 1ZVKA 5KNCD 4RPIA 2C61A 2V8BA 1D4ZA 2YZGA 5AKJA 3I5MA 3R3VA 3KAPA 3U7RA 4DG5A 3OP1A 3ZY4A 1PDOA 4UMVA 2UXDB 4EJMA 4NCHA 3VYSB 2HADA 3BWXA 4Q4AB 2AJDA 3HR4A 1NVTA 3MGGA 4CCAA 4IQWA 1NBMA 3NEYA 6LDHA 3F5MA 2FR8C 4TT8A 2R25B 2HMAA 5AXDA 4L4UA 3DPIA 1FY2A 1IQPA 2AFHA 4JYMA 3PZRA 1IM8A 4MS4A 4TV9B 5FQNA 4K26A 3VR6H 2Z2XA 1GZ7A 3PGVA 3OM9A 2OLKA 1WB9A 4QGAA 1QKJA 4AXBA 1X19A 1E69A 1IEXA 2ZSHA 4JOQA 2F76X 4Q3OA 1AZWA 3V2IA 4QBFA 5JH7A 3D6JA 3ICVA 5DCWA 4AG3A 4BKMA 4BB9A 2C98A 2ZYHA 4UAVA 1GKUB 1V5IA 3TBHA 1KAMA 1SUFA 4IIEA 1U45A 2Q9CA 3TFQA 5KBYA 3DONA 3HY4A 3WBJA 4QOIA 3ZDRA 4PNHA 4BQEA 3JPPA 3GLUA 1DCFA 3AUJB 2BGNA 1T9AA 3HUFA 3M3HA 4NG4A 2VAPA 1Z6XA 1I7LA 3D0RA 3HCRA 1E79A 1QBKC 3QPAA 1P2BA 4TTRA 4W1SA 3ZHXA 4BP9A 3JWHA 2W03A 4P2GA 4PR0A 5BSUA 3CN7A 3KX2A 3MUFA 4UVEA 3K15A 1UOEA 3CLRC 1B22A 4BO7A 1RE1A 4LKOA 5IT9A 4MKIA 1SA0B 4PS1A 3BWVA 8ICQA 1DDOA 1XP5A 1XD2A 3FBWA 1VSBA 2Q28A 3BIXA 4H6PA 1HFKA 2AGVA 1BE1A 1YKSA 3SR3A 3BHMA 4MQLA 4I81A 2O2SA 1OZFA 2AA3A 2QX9A 1E4VA 4HGNA 4DMKA 1TVAA 2YDXA 2ZE5A 1VGRA 4WJZA 3ZGLA 5B3JC 3TAXA 5TC4A 2R68A 3B3GA 3LO5A 1L5LA 3DZKA 3TRHA 2G5TA 4EL5A 5C4GB 3KR2A 3LUAA 3RBVA 5BW4A 1BFDA 2FEPA 1I4LD 2OZVA 2BHTA 3L1HA 4NHOA 5HF9A 2P2SA 3AFGA 1W2WB 4UZFA 2P2GA 3P4XA 3ZLTA 2CNKA 1YI1A 2ZVQX 2VTBA 2YL2A 4JV1A 1QR2A 2WLTA 2P0EA 4LTDA 2H5XA 3BXOA 1X0VA 3SLRA 3UUFA 1BXGA 1KSFX 4CT0A 3B1WA 4G41A 2O8CA 3FPJA 1DZ3A 1MT0A 2NZWA 3A04A 3AONB 1OW5A 4URXR 3ONEA 3ZXXA 2UYCA 4BP8A 4RTSA 2PZKA 2C4TA 3AT1A 3MXTA 1FB5A 4UTOA 4Y0VA 1IOLA 1ACJA 3JTMA 3PYMA 4IDPA 1QIIA 2ZUEA 2UXBB 2VATA 1Z62A 2WJGA 1ECBA 2YWDA 4FDAA 2F55A 4JYAB 1P9RA 4RZ2A 1Y4DE 2OG1A 3MYRA 1YULA 2QNRA 1DWPA 4TSRA 1PQ4A 3I01M 4S04A 1S4QA 3E61A 4OQYA 1W94A 4R1MA 1ISRA 2VS1A 4J0HA 4JUFA 1NLFA 4KI7A 1I51A 2A1TS 3HCWA 1GFSA 5D1NA 2A57A 5DM60 4NJEB 4ZYUA 4ZVNA 2QRVB 4FFSA 4HNQA 3LWDA 1OH8A 2ZW9A 2H7CA 1VRWA 1VOTA 3V7KA 4OUDA 1PWXA 4DL7A 1YDHA 3DO6A 1JDBB 3TLCA 1E61A 2CMKA 5K3BA 1GEGA 4DRXB 2WB2A 2K8CB 1TT5B 1JG6A 3EW7A 5CA0A 3AGPA 3DHYA 2B4TO 5AIBA 3RFXA 4BXOA 1YJXA 5AJYA 1IG0A 1IUPA 1TJ4A 2EOAA 1VE5A 2FW0A 2QD4A 6NULA 2JGLA 3MMPA 4QUIA 2FZCA 3HCNA 3CBQA 3DW3X 4M2LA 4DMLA 2WAXA 1NJXA 1OZAA 1MB2A 2VK2A 4OKSA 4QG7A 4OMCA 2XMGA 3O4FA 4IJQA 5KG0A 2DR0A 1RYNA 2Z98A 3SFVA 1IDOA 1XVTA 4D3YA 3I9LA 3NQ41 4XE5A 8ABPA 1MB0A 4DS5A 3MF4A 2O8VA 5MN6A 3ET5A 2B1IA 2LBOA 2E4ZA 5A0TA 2HLNA 1ZITA 5TSDA 1J9GA 3K9LA 3FCCA 3ADKA 4QAJA 1BXGB 2JFZA 3DKVA 3LNTA 4FMCB 2EGUA 4AK9A 1Q1EA 2ODGA 2GFHA 2DR3A 2PRYA 1WZIA 2Q1WA 2JVIA 1NFRA 3DM5A 5TPZA 3PRHA 1NI3A 1RRPA 2CVPA 4KMMA 3SEQA 3STVA 3UAGA 5BV2P 2J9FA 8OHMA 4XCVA 2P4UA 2WYOA 1JDPA 3KXIA 4IXWA 2DUNA 1GGJA 1WZCA 2IU6A 3MD9A 3QYJA 2P5SA 4LBZA 1SIOA 3X1KA 4Y7DA 1C3OB 1FP2A 2G5GX 3F5SA 4IJUA 4ALLA 1KKUA 2ZYUX 2IW1A 3M5DA 5FWAA 4C2AA 3B5JA 3ZDFA 5JSQA 3RHSA 3UA3A 3EWAA 7ICOA 1RYYA 4ZI3A 7ICSA 5ALSA 1ORHA 2DT5A 3LUPA 3NVDA 5GTIU 3OIUA 2YRXA 4GL2A 4C4SA 1KO1A 3SJBA 3PPWA 4MB2A 4KREA 3NGMA 1ZLXA 1MQSA 4WN3A 2PO5A 3E53A 2WSSD 5FNVB 1I94B 1K5DA 3CM0A 5J8YC 1HT3A 1JSLA 5ABPA 4BTEA 2QTWB 5A3VA 4LMPA 2ZYTX 4UC0A 5MN5A 2Y9TA 5CM9C 3ZD9A 3ROMA 1DXOA 3SI8A 3O73A 1OA1A 1T6XA 1W46A 2WKQA 5DM0A 3GC6A 1TQ8A 1MGPA 2DCMA 3TCNA 5HJ7A 1H0SA 3LWLA 1UJ2A 4KE8A 4KYTA 3AERB 2QPAA 5HKKD 1ZLYA 1B2RA 2CXOA 3HU2A 3RIMA 3WFJA 5BOLA 2AX4A 1UXHA 4QA9A 2YXEA 2JJ2D 1WS6A 4O3FA 3NTQA 3A37A 2BQ3A 2MWMA 1TU3A 2QMUA 3EPKA 2P8JA 3WK4A 1DQPA 1FNNA 1Y1LA 4HAVA 4MRRA 4TV9A 4TTPA 1E3EA 3RVKA 1C8VB 2Q1UA 5K0JA 1ZMOA 4Z7QB 1XOIA 1RXCA 1YVEI 3ZG6A 4I2GA 3HNRA 2ZTCA 1JDNA 1ESCA 1FTWA 1XHEA 2AJ8A 3N4MB 2E0IA 2XTZA 3JWEA 1G42A 2REXB 2VDOB 4U9HS 1VSUA 2PSDA 1RI3A 4ENSA 5BUQA 1NN5A 2VF4X 3R0XA 2ZJ3A 5EUQB 1TO6A 1AKYA 4WAUA 1IVSA 3LZDA 4J0IA 4W5WA 5D5QA 1E94E 3BXPA 9ICVA 1JFVA 1XAIA 2W4QA 4IP0A 4PAGA 4Q9LA 2CJYA 1A27A 1L4UA 5E2IA 2PRKA 5EN4A 2IWRA 3HA3A 2RHMA 3DDOA 3ZZTA 4CUJA 1O8CA 1ZQXA 4DPLA 5JAHA 5BNIA 4X84A 5KNDD 2WMDA 3AJ9A 2NTEA 5F5XA 5F7XA 1GQFA 3BD6A 4G3XA 3NTUA 4RVHA 3THRA 4L5YA 3GJZA 2ZIWA 3MC1A 5D5PA 5CBKA 4HPJB 3FI0A 4BO8A 4DL2A 5BWBA 2X19A 4QUEA 4A7PA 4I1VA 1HTBA 3S1AB 4DFKA 1DAEA 1ECPA 1J5EB 3L6CA 1Q7BA 2QP3A 4F3NA 4NL9A 1Q0SA 4GYWA 2PUDA 2WMNB 1XC9A 2G5HB 2GD2A 2OMEA 5HM6A 1DLIA 1RRVA 3E7WA 4OOEA 1MC8A 2W2TA 1PZNA 1W44A 2JR5A 4QTTB 4XCXA 5C81A 1T0BA 5ALOA 1ADFA 2KG5A 3DDNA 1EBBA 1T4BA 4KN9S 4WZ6A 5HK9A 1ONSA 3EE6A 1E3TA 1ZFNA 2QLTA 1P80A 1SHUX 2OGUA 3D6UA 3MBIA 3MHPA 3OM8A 1UC9A 4FBMA 1QIHA 3V4PB 3RC7A 4DADA 5FTKA 5ADWA 1FS4A 3BHIA 3HKZF 5I5GA 5U4XA 1A7UA 1FPQA 2W6IA 4G26A 2CB0A 4FZ3A 3F9IA 1IFXA 1VE1A 4PLCA 3WO1A 2QJRA 5LLTA 3T1VA 1FP6A 2YX1A 3AW8A 1W52X 3T1QA 2Z2YA 4OKNA 4MGYR 2D2VA 2I7XA 4AKTA 2JV3A 1Z9BA 3P0IA 3SYKA 4UHDA 5DT9A 4CM7A 1KC1A 1NR1A 1FLAA 3LRXA 1IBCA 1ZWKA 2IDJA 4XDYA 3AHJA 4C1BA 3OOWA 2JHGA 5I4BA 4DO9A 2H63A 1PLKA 5EVCA 2CLIB 3UMFA 1UF9A 3PVZA 5HF6A 3WAKA 2VCEA 5ECWA 4HSGA 4HTAA 1FX0A 4PICA 5CA0F 1X70A 5TJ9A 1JFLA 2UDPA 1NIPA 1XQWA 2XXBA 4G8BA 4YLEA 5CVTA 1Q6YA 1RPLA 1OI2A 4IX1A 3JQQA 2XMPA 3QFHA 4J6FA 3RTVA 1WUYA 2QSYA 4ZJZA 3GA7A 3C29A 4IQ0A 4KSYA 4GF5A 3VAYA 3SI7A 3WJ7A 2QMOA 1Y8AA 2W6JA 1RQGA 3OLWA 4KH0A 4AICA 1ZUIA 4WCFB 1P0PA 3MGAA 4IHKA 2QXYA 5JBQA 4FT4A 4KQCA 4URVR 3VBCA 2Y05A 4BU1A 3T1YB 4HAIA 1E0DA 1CUYA 2GDZA 1ZISA 1DWUA 4LC9A 2ID7A 1UZNA 4KHPB 1P2VA 1E3MA 3BZWA 2A9KA 2QQFA 4HDQB 2EBUA 2DQYA 3GG2A 5JV5A 2SHKA 2ICAA 1JHUA 2BZSA 5AI9A 2V65A 5J2HA 4NM1A 1C0EA 1C1YA 2WIFA 1ARZA 4PZDA 4YQFA 1KU6A 4LQCA 5KFZA 2D8AA 3H5VA 3D7MA 3LY5A 3LBIA 5K03A 4C4RA 1HKUA 1GLVA 2XUDA 1JT2A 1XNJA 4KIFA 3UHOA 1OAAA 3DOJA 3UV6A 3HVRA 3C7TA 3IPXA 4L08A 3TB6A 4YCCA 8ICSA 2BQUA 4GM1A 2C2ZA 2FRXA 1FNCA 3BH0A 4I55B 4I2CA 3A06A 2NW6A 4PPQA 5A4AA 5AW0A 3NI2A 5ULLA 4HJXA 4HQNA 4Y3UA 4QNNA 1W5SA 3OOJA 3OE4A 4BLWA 1KARA 1E92A 4YMIA 3USZA 1PFYA 4J0DA 4QTYA 1G3RA 2HQSA 2WDZA 3KDAA 1CE8A 4LZWA 3NDBB 2ZRCA 1TYAE 2C97A 4BEJA 2VQEB 5CVDA 3CWCA 4Q3LA 4OJQA 4NENB 2XKAA 1I6KA 2HBJA 1VQ1A 1JHAA 3T5HA 3FYUA 1HDGO 1XKLA 3AY7A 1DAIA 2J0VA 1AQLA 1TJYA 2PUWA 3BS7A 1G8MA 4AFNA 1UZAA 3DYIA 4R9UC 4LX0A 4BNYA 5JD6A 3OFND 2R65A 3D2LA 2J3KA 5JDCC 3SV4A 221PA 1LKZA 5KNCH 3QX8A 3HY6A 2GJSA 3RC8A 3R2JA 3H11A 1V8OA 2OHIA 3HA7A 2Q6KA 4C8MA 1HE1C 4QEKA 3IILA 3N07A 3NV9A 4ENVA 1JMVA 1N5WA 5CVEA 2PIDA 3E8MA 4B0OA 2OCXA 3ORQA 1TCVA 5JTIA 3N8IA 4K6HA 4CCWA 5HW0A 4WBNF 4CEHA 2ZJ0A 2EG5A 2W22A 1RAAA 3U4QA 2ISOA 2DPHA 1M66A 5JAZA 4ZRDA 5B6PA 1L4KA 4Q82A 4ZTBA 3JR7A 3BULA 1ISJA 4ZZ0A 3GPBA 5IDXA 4CKBB 5LP1A 1F4VA 2CBXA 5I9IA 3H8JA 1PGOA 1A9PA 1EVYA 2O2GA 5DGDA 2HZBA 3MSCA 3DTYA 2X76A 3W3AH 3LGXA 4CCSA 1TEZA 2BSQA 1DAFA 2FPRA 4KNVA 2WHXA 1M2HA 4N47A 3WZ2A 3H18A 4BO2A 4EYEA 2C07A 4LNUB 3ZHRA 1CRZA 2FLWA 3Q8QB 1VLLA 5LZ2A 4TUSA 3CNEA 4XYGA 3GRAA 4JI2B 5AXAA 3OFVA 1KZ1A 4XD7D 4O9MA 1QHHB 3JYOA 4J0GA 4J4BA 4UQGA 1UEIA 1V1RA 2COEA 2EKDA 3LI2A 4DDKA 4TZ6A 1DTSA 3AVWA 1ZMBA 1U6JA 2OXCA 2HNAA 1H5UA 2XDQA 3E2EA 3C3WA 1BKDR 4Y9DA 3O21A 3UHFA 1P7CA 2MSWA 5AXBA 3BE5A 3OVMA 3ZWMA 1R5BA 1XPOA 1W47A 2FZEA 3U40A 1XSLA 4A26A 5HDQA 3INNA 3W3AD 3FPKA 3OOSA 1ZGAA 3M4NA 3H1FA 4IRMA 1XB2A 3BMCB 2OFWA 4ER6A 4DUYB 3P9KA 4B1FA 2KOBA 3F98A 5MDHA 3EQZA 1EDDA 2O3SA 3UB2A 3ME5A 1U4NA 4JAVC 1OAOA 5D5HA 5REQA 3CZ9A 1UT8A 1TA4A 1AUXA 1HY3A 2VRBA 4OXXA 3V1UA 3CUKA 3U60B 1PW7A 1TJ3A 3OZRA 2D1RA 4TLAA 2D3DA 4UPDA 3WBBA 1F3OA 4B46A 3AVOA 3ECAA 5JY6A 3L06A 2I4RA 2Y67A 3HDHA 5AK5A 2G36A 3ZWYA 1YZLA 5KFEA 3X2SA 4MMZB 4CEJA 2WD7B 1XXHB 4YNBA 4JK1A 3ZDCA 2AD5A 3TQSA 5HGJA 3RHTA 4S0ZA 5JCZA 3R7DA 4DAEA 2Q3LA 3JS5A 2NUAA 4CF6A 3NV7A 1I2DA 2A1JB 1AS3A 4GC9A 5EESA 4QOEA 5EKDA 3ZQKA 1AUQA 1KI9A 2FRDC 2HOQA 5DQIA 9ICMA 1DOAA 2H3EA 2IYOA 1TQ2A 1Z18A 2G6BA 1SOUA 4R9NA