2YMMA

Sulfate bound l-haloacid dehalogenase from a rhodobacteraceae family bacterium
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
225
structure length
225
Chain Sequence
SGILVFDVNETLLDLTSLSPLFERVFGDAKVLREWFPELILYSQTLTLTGLYRPFGEIAAAVFEMVAANHQAKVTPDDIAELKTRLTSMPAYPDVAPALTRLQDAGFRLVTLTNSAPSPAPSPLEKAGIASFFEAHLTVHSSQRFKPHPSVYDSTAETLGAKPEELCMIACHIWDTIGAQARGWRGGFVARPHNTPLTLAEVPQPDFIGRDMGELADQLIASLTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-HALOACID DEHALOGENASE
publication title Marine Rhodobacteraceae L-Haloacid Dehalogenase Contains a Novel His/Glu Dyad that Could Activate the Catalytic Water.
pubmed doi rcsb
source organism Rhodobacteraceae
molecule tags Hydrolase
total genus 92
structure length 225
sequence length 225
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2ymmA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2ymmA01
5AM2A 4G63A 5ALGA 2QYHA 2HO4A 1FEZA 2MU2A 2YMMA 2W11A 5AKLA 1YDFA 2WM8A 1RMYA 3R9KA 4UMEA 1O03A 2WF9A 3CNHA 4BNDB 3W5AA 5AI5A 2PKEA 4UAVA 2OM6A 4EELA 5AK4A 1RQLA 5AW7A 3QX7A 3A1CA 2GMWA 3I1YA 2WF5A 1X42A 4Y2VA 3HLTA 4PNHA 3AR6A 1Z5GA 4BEWA 3L0CA 3KDPA 2BY4A 4HGNA 1ZRNA 3KZXA 2I34A 1VJ5A 2FUEA 5AKJA 3L8HA 3L1VA 1N9KA 4FYPA 5AVUA 5ALEA 5AVZA 3SMVA 5AKEA 3L7YA 5E0OA 2ZXEA 5AK6A 3AR7A 1RKVA 2G08A 3KC2A 3N07A 3U7FB 4UAUA 5ALKA 1RLMA 2NO4A 2G09A 3QUCA 5AI9A 2G07A 2ZG6A 1RLTA 3OCZA 4MUMA 5AW6A 4EX6A 5AVTA 2G1AA 4L57A 5AW8A 4KNWA 4ZEXA 2I54A 4GXTA 1QQ5A 3IB6A 4EZEA 4EEKA 3I6BA 4KX5A 3FVVA 4OFZA 3WK4A 4UATA 4CNQA 3UM9A 4Y2XA 4C4SA 3OPXA 2DQSA 2HF2A 3HYCA 4IFTA 5ALTA 2FPWA 1KYTA 5JJBA 1WR8A 2W4MA 2FUCA 5AKHA 5AI4A 1L7OA 2BDEA 1Y8AA 4CF4A 2P69A 1J8DA 3L8EA 2CFSA 3QLEA 3IRUA 1RDFA 2B8JA 1AQ6A 1Q92A 1T5TA 4DFDA 2JAUA 3J7TA 4UMFA 2FPSA 2IOHA 3DAOA 2GO7A 3L0BA 3NIWA 5AM0A 1QYIA 3SLRA 4Y2RA 3QUBA 5ALSA 2AUTA 4KX3A 3M1YA 4KN8A 5ALJA 4UM5A 1ZD5A 3AR9A 2I33A 2HHLA 3ZX5A 3SHQA 2R8EA 1NRWA 3AR2A 1RMTA 1Z4NA 2ODAA 4Y2QA 2HF7A 4UMVA 3WKEA 2RAVA 2ZBDA 4YIKA 1S8OA 4HGOA 2PR7A 4HGPA 3ZVNA 3U26A 1T9ZA 2Q5EA 1ZRMA 3WKAA 1CQZA 3NUQA 2JARA 4FFDA 4JB3A 2P27A 2YFYA 3L0YA 3WK5A 1NNLA 2P9JA 3NASA 2ZOSA 3ET5A 4IG4A 5AW1A 4KYTA 5A3RA 2B82A 2O2XA 3L8FA 4MWOA 3WKCA 3FGOA 2R8ZA 4YH1A 1XPJA 1Z4PX 3ZTWA 4EENA 2EARA 3EPRA 1Z4JA 5IT0A 3RF6A 4BNDA 1F5SA 4XPZA 5AM3A 2CN1A 3NAMA 2YMPA 4UW9A 5AW0A 5AHXA 3UMBA 5ALMA 5AVVA 3R4CA 3E84A 2B1RA 2HSZA 2R8XA 5AICA 5ALRA 1MH9A 2WF7A 5AESA 4UMDA 3WK7A 2FDRA 1N8NA 3D6JA 1ZS9A 4JDPA 2YJ5A 5AKKA 5ALUA 1ZD3A 1YV9A 1YNSA 3WGVA 3I28A 5AIBA 5ALHA 4XOUA 4O8CA 2C8LA 1WPGA 3NALA 4CE6A 3B9RA 3B8EA 2ZBGA 3AR5A 3ZWKA 2X4DA 1L7NA 1Z88A 3QGMA 3NANA 5AI6A 4NFLA 2IYEA 4UU1A 4FE3A 2HCFA 5ALZA 2OYCA 1QQ7A 1ZD4A 5AKGA 4NWIA 4BX0A 4F71A 3ZUPA 1RMQA 1Q91A 4YCNA 3QUQA 1EK1A 2OBBA 2B0CA 3QYPA 5AW5A 3MC1A 2GHQA 3P96A 1LVHA 1Z4IA 5ALFA 2JAOA 3MMZA 1SWWA 3FZQA 4AS3A 3OCUA 4H1WA 2I6XA 1RC8A 4Y2TA 5AKIA 2Q4RA 3DDHA 5AM4A 3L8GA 1XVIA 5ALQA 2ZBEA 3L1UA 4BKMA 1TJ5A 4YGYA 2WF8A 3RFUA 4NV0A 3KD3A 3EF1A 4I9FA 4C4RA 5ALLA 5AK5A 1YMQA 4Y2PA 3BWVA 1T5SA 3ESQA 3ZI4A 3FPSA 5ALPA 2HI0A 3PCTA 2WHEA 3S6JA 3QU5A 3A1DA 4ZEVA 3A3YA 3N5KA 3L5KA 1TA0A 1L8LA 3U13A 2CFRA 5AW2A 2EATA 3U7HB 2HDOA 1Z4OA 1TJ3A 2I55A 1U7PA 2MU1A 3W5CA 5ALNA 4HYTA 3E81A 3WK9A 3A1EA 1U2TA 1PW5A 3K1ZA 3DV9A 2CFTA 1NF2A 1VJRA 3BA6A 2G80A 3QXGA 3PDWA 3SF0A 1RQNA 1Z5UA 3NRJA 1QQ6A 2GFHA 5IT4A 5AVQA 4DCCA 2QLTA 3ONNA 2PQ0A 2YN4A 3FM9A 3WGUA 2IA5A 1QH9A 4HGRA 3U19A 5ALDA 3WKBA 4AS2A 4BX3A 1XP5A 4B6JA 3QU7A 3M9LA 1U2SA 4E88A 2C88A 2O9JA 2IOFK 2FEAA 1Z4KA 1ZJJA 5ALWA 2B30A 2RBKA 4L6AA 3I76A 3OCWA 1CR6A 3ESRA 2B1QA 5FP0A 1WZCA 5AW3A 5AVSA 3EWIA 3WKDA 2YJ4A 1EK2A 3ZTYA 3UMCA 4BYGA 2R8YA 4OD0A 4HAIA 5ALIA 1TJ4A 4DW8A 4Y2YA 4DWOA 5AKZA 3AR3A 1U7OA 3OCXA 1ZD2P 3OTQA 4YCMA 3ZU6A 5AM1A 2AMYA 3N28A 2Q4TA 2D2VA 2HX1A 3KOOA 3SKYA 4L6CA 2YMLA 2RB5A 5AVYA 1Z4QA 4F72A 2NYVA 2FPRA 2IOFA 4QQFA 4UARA 3R09A 2FI1A 4EX7A 3N1UA 3AR8A 2RARA 2OA0A 3TLMA 4OCZA 3QUTA 4KNVA 2C4NA 4I9GA 3ED5A 1L8OA 5AW9A 3DNPA 4J03A 3E8MA 1RKQA 1K1EA 1YJ5A 3ET4A 1LTQA 3CZ4A 3N8GA 4Y3UA 3QU2A 3QU4A 4XQ0A 2FPXA 2JAWA 4UU0A 1RKUA 5AIAA 4ZEWA 2I7DA 4UASA 2P11A 3IJ5A 1O08A 2NO5A 5AVRA 4C4TA 4RESA 3ZWDA 5AKXA 1L6RA 2FPUA 4Y2UA 3SKXA 4BEVA 3U7GA 2JGAA 5ALVA 2GHTA 5AKYA 3ZX4A 5AM5A 2VKQA 4RETA 1S2OA 1IWOA 2YMQA 3MN1A 3WK8A 5AW4A 3B9BA 1YS9A 2AGVA 2EAUA 3ZVMA 2HOQA 1SU4A 4BX2A 3OCYA 3UMGA 2C8KA 3QNMA 1Z4LA 2YJ3A 5A3SA 4Y2JA 3MPOA 1RRCA 1VFPA 2ZBFA 1Z4MA 1SWVA 1U02A 4BBJA 4YCLA 3OCVA 5T41A 4NABA 2HEGA 5AI8A 3ZVLA 1TE2A 5ALYA 2YY6A 4HGQA 3KBBA 4Y2SA 4AP9A 2MSNA 4XE5A 4QJBA 3QU9A 5IS2A 5AI0A 3GYGA 1J97A 3AR4A 3FPBA 3U7EB 4YIHA 5AK3A 3VAYA 2BDUA 2W43A 2YBDA 3W5DA 4CF5A 1ZOLA 4GIBA 5AVXA 5ALOA 1JUDA 3F9RA 2YJ6A 3WK6A 1L7PA 5AVWA 4J2TA 1RPZA 2WFAA 5A3QA 3EF0A 4UM7A 2WF6A 1RLOA 3PGLA 5ALXA 4CF3A 4OHFA 2B8EA 2G06A 3W5BA 3PGVA 3ZW7A 1L7MA 1WVIA 2C9MA 2G0AA 3E58A 4G9BA 3SD7A 2AH5A 4NAVA
chains in the Genus database with same CATH superfamily
3CRZA 4KIWA 1SN7A 3H2HA 1BCRB 3BWEA 3GFSA 2R7MA 4IDDA 3ABSB 2IHZA 3QVMA 1CP3A 1RM4A 1I2AA 4I2EA 2XD4A 1JT2A 2P6OA 3I1FA 3RRYA 3NTVA 1C7JA 3SC4A 3U9LA 4JJGA 1LRLA 2HREA 2CDRA 3KE9A 2ZJ5A 1QG0A 1OA1A 3NEAA 3ME5A 5KNDD 4FONA 3WL4A 4LFAB 3TZHA 3AOEC 2IEDA 4POAA 4EA7A 2IW3A 4PU0A 1NRJB 2GXUA 5EAIA 1EZ1A 4QBIA 4CL3A 1DT5A 1MBZA 5J0QA 3QA3E 3K16A 1OBOA 1L8XA 3ZVRA 3KNZA 5HW0A 5CT4A 4ND1A 1OF1A 5ELLA 1VDVA 1XS9D 1DV1A 2A5FA 2QYTA 1ZH4A 3C3BA 5D1HA 4H7IA 5LU9A 2NRZA 4B0PA 4RHEA 5HIJA 4BX8A 5IC6A 1UBSB 2Q5EA 2AMJA 1L9XA 4QYIA 2LNDA 4TRJA 3U7QA 2Y66A 1DRWA 1PJCA 2GF2A 4RTRA 1KMNA 4XPZA 1DQNA 2WSSD 4YYZA 1JKMA 2KMLA 4YUZA 3I9JA 5F2EA 3R0XA 2WKPA 1PV2A 4GP6A 2ACWA 3AUAA 3C43A 3INGA 3AYXB 5CG1A 5EUMA 4M04A 2QUKA 4BKOA 4Y0NA 3RB0A 4FFPA 3M6UA 2NVUB 1HTWA 4CEIA 2O2IA 4FQ7A 2CDAA 3TLCA 2HHCA 4RK5A 4PPQA 2HCRA 2QX6A 4C9BA 5J0WA 3JVEA 1Z06A 1DBSA 4MQBA 4H59A 1ZC3A 2G0NA 5CEEA 1QLNA 2WI8A 4URHA 2NG1A 3PSFA 1N2EA 2FH5B 2NSDA 1XZMA 1M8KA 3EQ8A 1Y88A 1RC1A 4N8SA 2K6GA 3UXMA 8OHMA 4US8A 1TAHA 4LUCA 2F1KA 4HDKB 5AK5A 2O1SA 1KMQA 3EGXB 4IWNA 4QBTA 4AUMA 2GCEA 2ZUUA 2J3JA 4HVLA 5KTNA 3TXXA 3CW2A 4BFUA 2VEDA 5TT0A 2JAQA 1A9TA 4ARIA 5FI0B 5CLGA 3TQTA 2VPZA 4QUKA 2JD0A 8ICKA 3IYLW 3OKAA 1IU9A 1VSVA 5CBPB 1IUPA 3IM1A 3C29A 2HQRA 1D8AA 4EUNA 3F53A 1VYHA 3SAFA 4L5YA 4HLDA 2I5PO 1Z5NA 4P3YA 5DKWA 1L4LA 4H7EA 4HT3B 2O2ZA 1VRWA 1O95A 4KPUB 4CKZA 1M0TA 4OQMA 1COWD 3WNVA 3A0BU 1G8KA 1U63A 3RYIA 4N5LA 3O2JA 1XIVA 4EUEA 3U5ZB 3R77A 4DJAA 3OJFA 3ZZTA 3QE2A 1SHZA 1IOVA 3KVRA 1SB8A 1WIWA 4RFSA 4R2LA 3I58A 4V38A 3TSYA 4KK3A 1IXRC 1TVKA 5KBYA 5FUXA 4Z0HO 1DKPA 3O0TA 3HVKA 3ZWDA 3CH4B 4LTDA 4G36A 4L4RA 4CLDA 3H9QA 2QTVA 4BQNA 1UC8A 2HBYA 3H97A 3GA0A 3TOZA 1P1BA 5LQDA 3C8DA 2C9BA 3N76A 3PPYA 4PXAA 4MULA 3QYFA 7ICEA 4QAJA 2FPOA 3FGZA 2X8AA 1QBKC 2X42A 1B2LA 4UQPA 1TLTA 1YDMA 2MSNA 5H80A 3LCMA 4UZSA 4OXQA 3E03A 4YTEA 1A9PA 4KKVA 4XJXA 1Z00A 4X63A 2MWMA 4DADA 1JG1A 3CVJA 3P1JA 3PW5A 4BNUA 4MZXA 4JT9A 3DF9A 1YVDA 1MORA 4F85A 4IOJA 1O6CA 4KGVA 5KKNB 5TEVA 1GUFA 1AC5A 3FPHA 2A9RA 5IJWA 2G0AA 4MRRA 4MUBA 4DMUB 3RIHA 4KTQA 4XUEA 1O03A 1LLCA 3QSGA 4IQ0A 5I8ZA 3W05A 5C5EA 2HF8A 3LSTA 4QWDA 2GD6A 5BSHA 5DYIA 4KE7A 4QJIA 2GQ0A 1ZZGA 4E46A 1SQSA 4FFWA 4DJEC 1IG6A 2CKDA 1N7GA 3L8HA 1K5OA 4D42A 1N9KA 5ALEA 2Y0SC 3FHLA 4CGYA 1C29B 1WMFA 4FD2A 1EUDA 3O6VA 1RLTA 2OD2A 4J0JA 3JCZA 3G5LA 2XUZA 1ECLA 4L8GA 2QRQA 4OI2A 1N62A 2BFFB 4RANA 1SURA 1CZKA 3HJUA 4PW0A 4I1OA 1GVNB 2JIBA 1VGRA 4HFRA 3CA8A 1CQPA 5DYYA 2OENG 5DTIA 2BFWA 1G42A 1EEHA 3B36A 1NJSA 2YV3A 2LGJA 1ENPA 3GN2A 3T5AA 4H0CA 2JVIA 3RVDA 1NBWB 5KFOA 1SBTA 4XRHA 9MHTA 2WIDA 1P4RA 2XXAB 2P9JA 1D9ZA 4R2XA 2ZPUA 4PLPA 1PEAA 2JZBB 1JFSA 3EC7A 4MQ4A 1YB4A 4IX1A 1SK9A 1J1IA 4BNWA 3OPYI 1I7QB 2QA5A 3PUWA 4AZTA 5HIMA 4A6EA 3GFGA 3BCUA 2Q3CA 4J43A 1GQRA 4X60A 1G6HA 5B5EU 2QL7A 3V4VB 4RJTA 4L4UA 4JT2A 4PC6A 1P2SA 2FMQA 3D3WB 3D2NA 3PLAE 2WFLB 3P96A 1CZUA 3RGGA 3GFPA 1QK3A 3S1AB 3D8RA 1JVNA 3R20A 4OYYA 5LJIA 1IVYA 3SC3A 1EMDA 4UHFA 3GIMA 2OH2A 1YRHA 4LYDA 5KJCA 4CNBA 3IHQB 4PLYA 3KZKA 3DFFA 3AM4A 2JFQA 4NE9A 3DTNA 2EC5A 2DGZA 4C3ZA 1JLHA 3PHBE 3KUUA 4QJ4A 4R9UC 5A1TA 3U13A 2QN8A 2DPLA 3O90A 5TPZA 5MFZA 4ZVVA 2JRLA 1LW6E 4GP9A 4IDEA 3NVWA 1JAXA 2OVFA 1CX9B 1XU9A 4UTPA 3UUFA 5B58C 3Q9NA 4PLGA 2VANA 2H1LA 2Q6TA 4S1VA 1SUFA 2O5EA 3ZLUA 1ONOA 1VXOA 3ESRA 1I51A 2A94A 2AOUA 4A8JB 4JJAA 2FY8A 1RRKA 2FZKA 5EZYB 2AJCA 4KO1S 3C5VA 3AN1A 3FW1A 1X94A 5KNBD 4QIWC 1C3LA 2XKAA 2BKXA 4MUEA 4BVAA 4BE7B 4QO7A 1DPFA 2BFNA 5FOUA 2C7BA 3TN7A 3RUHA 1WQ1R 2I6UA 2HBMA 2W55A 1JIVA 1LBHA 1QTRA 2H1OA 3R5KA 1JJBA 1V7PC 3VR4H 1SA0A 4MTCA 4A9AA 3HILA 2NO5A 1PTJC 4GP7A 4WKCA 1ZMOA 5CG2A 1L5LA 2C96A 3PZPA 5E8JA 1HY3A 5JS6A 1YZKA 5JATA 3CF4G 1N0IA 4JI0B 1Z08A 5CBKA 2O2SA 1ZOIA 3DE3X 4GEKA 3KAKA 5CLQA 2FUG6 2IXEA 3PRHA 1FXSA 1DXYA 3D02A 1NGSA 2V96A 2EWMA 2XVXA 4DWIA 1EX1A 4XE5A 2PPVA 3K1TA 2A59A 1G7CA 3KQTA 5KTSA 3I0MA 3BIFA 1RPTA 4CF5A 3IX7A 1AT1A 2O2DA 4OOEA 4YO8A 1ZD1A 3EDCA 2ISSD 4M1OA 3LTEA 2H85A 2FCRA 3V1NA 1JIIA 3MTGA 1A82A 1OJLA 5KT2A 5AK0A 2FEOA 2HLPA 2FSVA 2I6QA 3BJYA 4RK7A 2RHWA 2OLEA 2P3OA 3PD1A 3KYJB 5A1JA 4MUKA 4PZOA 1Z0IA 2HC9A 2I80A 5ALGA 3V1KA 4OH1A 4R84A 3RVJA 1YZHA 4DQRA 2JIZD 3ILYA 4ENQA 3JRWA 1UWKA 1JEQA 3A1CA 2O06A 2WLSA 1QXSA 2YZMA 1QHSA 1GV0A 2CL5A 1MC4A 1G38A 1CUHA 3QVGA 2FFBA 2D2XA 3IUQA 4NBRA 3FE2A 5TS3A 1ZQAA 1MMFB 4JL6A 3IIEA 2XMSA 2OECA 3VPGA 3PT5A 1NBMA 1S5PA 3IP3A 2M1XA 4ECRA 5LMZA 4L6IA 5KI6A 2PLWA 3L6EA 3ID6C 5ICEA 2WWYA 1JIXA 1G64A 1H6CA 3D7NA 4IL5A 1CVRA 2UVUA 2W4MA 3IPYA 2R7KA 2PMZC 4BCBA 3QH4A 4I50B 1Y1QA 4CIDA 3AFOA 2EKDA 5JQGB 3HUUA 4EFKA 1A0OA 4Z9XA 2FEMA 2AL7A 3JQ7B 4ONEA 4R1OA 4FOPA 4L8LA 4KFSA 1PK8A 3RBAA 1BIFA 3LC7O 2BEUA 4P4LA 1KEJA 1YDWA 4FGKA 1G2OA 5HHTA 3O74A 1H3FA 4LGMA 2FLVA 5A04A 3G49A 2YL2A 1WDWB 4D97A 1BCSB 2XLCA 4JB3A 4M0FA 1EI9A 4KEAA 3JQ8B 3EY9A 1RBQA 3MLAA 1PT7A 2OLKA 5EPEA 3IP1A 5K6AC 4PO9A 5ETJA 4JX9A 1NUPA 3BWMA 1NW5A 5FR2A 3M9NB 4O33A 3GZJA 1ESZA 3QW4B 2IV2X 1KETA 2LMRA 3JXEA 2CLHB 4OHRA 1QGUB 1RBYA 3PRYA 3SIPA 3D2QA 3EVGA 1KMMA 1OFTA 1EJ2A 3AP3A 5CX4A 3B12A 4BLPA 5ER9A 2VHQA 2DHEA 3A2NA 1W4ZA 3GX1A 3L4BA 3ZHCA 2CFCA 3LFHA 5DULA 4LJ4A 3G6YA 4QXAA 4KN9S 2O8VA 4X1KB 4A6PA 1QFYA 2BKLA 2XUIA 2O7NA 2C3UA 1ZQHA 5KREA 3SXUA 3E48A 4Y9TA 4CLOA 2VJBA 3BWVA 4QG3A 2YV1A 2JJ2D 4EI7A 1VCMA 2XYQA 5C0YA 1L4UA 4LZPA 2X8LA 1QIMA 5FULA 2PS0A 3PWTA 1NYRA 9ICJA 4LVCA 5LDHA 3NV9A 4BQQA 4C2TA 3C23A 1HEKA 4WTOA 3FYHA 4HNQA 2NTJA 5C5JA 1NU6A 3D54D 4TLDA 3OTWA 1MZPA 5CT5A 4QD3A 3AB3A 3GT0A 3D3EA 2GAIA 1G5QA 3UMCA 3PXEA 5KFLA 1G4UR 4HXYA 5TNXA 4NMWA 3FPEA 2AN5A 2PKQO 4A91A 5KX5B 1EX6A 3FFXA 5AVYA 4E5KA 2R6AA 4C8LA 2JPDA 5H82A 2Q6VA 1OI3A 3OOYA 4I9GA 5DP2A 1E4VA 3T7DA 4PL2A 1JEDA 3NXSA 2F64A 2DP4E 4YMSA 2CNDA 2GERA 2JFUA 5AT1A 1U7DA 1WCYA 2W6OA 1E9RA 4M8IA 3OTHA 3QEBZ 3RC2A 1W96A 2GCPA 3NYRA 1RU3A 3U6BA 5SICE 4BX2A 2J4FA 1TC1A 1J0XO 121PA 2VDVE 2X5XA 3N8NA 1YC2A 2V98A 2OSBA 5JPCA 3VZPA 2GJ4A 1SUDA 3O0FA 4YB8A 4DG5A 1U0OC 4N8EA 3HWSA 3H4VA 4TYMA 5JE8A 1K9VF 1W73A 1H2HA 5B30A 3PKZA 4OTZA 2XCPA 3MM4A 1IY1A 3RSOA 2C28A 2YXPX 3CUVA 1HQYE 1PFWA 3GI1A 1M7GA 5DG8A 1ULBA 3R3JA 4BXOA 2I4MA 5CK4A 2GEDA 2CVZA 1E61A 5AM2A 1S8AA 3MHPA 2OXIA 5KFNA 4YRSA 2XQIA 4F2DA 4WVLA 3U4QA 2V0CA 3BDAA 3FROA 2QZJA 2EZTA 3NHWA 4YRBA 2J9XB 1EGHA 5KWVA 1NZBA 2O0LA 5JJCA 3TIXB 1FUEA 2I34A 4UE2A 1EE9A 3VU8A 3EGDA 5L4SA 1USVA 4DVGA 2IPMA 1EWTA 4HLCA 4PHFA 1B3RA 3JVDA 2G08A 3H0LB 1PZEA 1XU7A 1DKUA 2DQNB 3OBIA 4D56A 1Q0ZA 4P33A 4II3A 4BZZA 3RTBA 1CUKA 1IUNA 4OFZA 1BPBA 1QH8B 2JI6A 1R27A 5TPWB 3WLOA 1TPYA 2GJ9A 1HPLA 4M9UA 4Y98A 2BGTA 4PF1A 2VL7A 3KSRA 1QV7A 3PKIA 5CU7A 1CI4A 3LT0A 4MAMA 1IOLA 3KSZO 4KO3S 2PANA 3KEOA 4TWAA 1SUAA 3ZBTA 1KDOA 5JYCA 4DSJA 4UBKA 3CZ5A 4FFRA 5I7SA 3VNBA 1AKMA 3RC7A 1OXKB 2PM8A 5FPHA 1ZK0A 5CRXA 2WP0A 1E4EB 2YNMA 2ZTSA 3RV4A 1RMTA 4KRXA 2C82A 4HGPA 3ZE6A 5BSFA 3TZCA 3RSCA 5FBHA 1KRPA 1SEPA 4LOLA 2H3QA 3QTTA 5A4AA 1J20A 1SKRA 2A4KA 1DQPA 3ETCA 3REOA 3AHJA 3KHLA 1XL0A 3UMRA 1MN8A 2C9YA 2WTAA 4DR6B 2O7VA 1DGQA 2I8LA 4IGKA 4KN5A 5F5XA 4D80A 1EHIA 1VE7A 4HEHA 4QU9A 3AY0A 2ODBA 2HMYB 4LYAA 5B7NA 5I6DA 4DDKA 1QO0D 1B8OA 4BLWA 4GKAA 4JDPA 4JB8A 1OC4A 3KJNA 4TYWA 1PDOA 3UAOA 1LPOA 1QMGA 4X6YA 1OYVA 4RHXA 4HKTA 4Q1BA 3RFAA 1C7EA 3L7JA 3FMFA 4MS3A 4IS3A 4LHVA 3SSMA 3O75A 4OHYA 5BVGB 1QORA 4ECUA 4C08A 4EJSB 3PNSA 4LYHA 4M1YA 2O0HA 4J7AA 4TYPA 4LJ8A 1SUPA 2Q1WA 2ZSJA 4LHZA 3P9XA 1VMKA 1JXEA 3LNTA 1ZJ5A 2ZBPA 2ZWIA 1RW4A 2X5KO 4E5YA 3WMXA 3GAZA 2XYRA 1DGSA 1HLFA 3OPNA 3MMPA 3GNQA 3RRBA 2DECA 1FUYB 1H69A 4URZR 4LCEA 2JLAA 4F2GA 1HEUA 4ZU3A 1J42A 4BU1A 3GUVA 1TVMA 3LQ1A 5LZ2A 2QY9A 1NE7A 4M21A 5P21A 4JT4A 2GZSA 2IYUA 1P5JA 3GW8A 4HDSB 4GD3Q 2A58A 1FTSA 4OHVA 2CVFA 1Q7TA 1OFHA 4Y2GA 4QXMA 1ODCA 2ALZA 4IH9A 3BGWA 1B3BA 5J0TA 3CX8A 3STYA 7ICVA 3EXG1 1JTEA 3IBTA 1UZLA 5I4IA 2B35A 5E1OA 2WSSA 2X3UA 1JSXA 2DBZA 4BO2A 1ENOA 1ISMA 3V4SA 2XUKA 1JQEA 4PSDA 4R8VA 4QEKA 1QZUA 3H65A 5EHZA 4MWCA 1I2CA 2W58A 1W1WA 2HL6A 5J2TA 1ZMXA 1CJSA 5FI3A 3NKLA 3IR6A 4TWIA 4AJ4A 3SHOA 2DTDA 2A7QA 3TQRA 4ZVRA 2VKQA 1RWQA 1WB4A 2WJVA 5CA1F 1PR1A 4B3SB 3PYLA 4CJXA 2I7VA 3ZJVA 1AKUA 3N7UA 2ZUSA 4KNYA 5F4BA 2IXGA 3OZSA 1Z6AA 2EJTA 2EAMA 1L5SA 3CT6A 3KSUA 3TM4A 4M0AA 3IKMB 2CDCA 5JEDA 1UM8A 4GI3A 1S0UA 1JQ5A 4JUBA 1FYFA 3A05A 3N4MB 4NX2A 3MPUA 7MHTA 1ML4A 3GZNA 3C3DA 3WYDA 2H2FA 4FKBA 5JHHB 3KQUA 1SU7A 1P0IA 3DXZA 3CF4A 2JKYA 4JASB 3UV7A 3SICE 4KLZA 3TI9A 5B2FA 1P2UA 4ZH4A 2XUOA 3WJ1A 2MYPA 3T3GA 3E4CA 4DS4A 1Q0PA 3JR3A 2B1IA 3ZXIA 3RR8A 1RQLA 3PV8A 5G4KA 1COWA 2OCKA 4TUQA 2PZ8A 1K9SA 5IHXA 2X7HA 4GBGA 8ICRA 4GDMA 4R3WA 2ASVA 3T06B 8ICWA 1FF9A 1JR3A 5DLFA 1NNEA 3KIPA 3P2YA 3LUJA 1MO2A 5FLEX 2OGUA 2CE2X 1XCLA 2OILA 1EFHA 4FGLA 1R7RA 3T5LA 4Z7JA 5IH3A 2F1OA 2R96A 2B1JA 4REQB 3EXEA 4RIEA 4GI1A 2XNCA 4A5SA 4BJQA 1NE2A 4HWGA 2MDTA 4CRWB 521PA 3RI3A 4AJKA 4W5RA 1KSHA 4L1KA 1L7EA 2AW3A 5JNSA 2HW8A 3OZUA 4ROSA 4L4SA 4P5PA 1GGMA 3SEZA 3PNQA 3LD9A 4MUGA 4KO2S 1TX4B 4PE5B 3RU3A 3RVSA 3A28A 2WLTA 4JIMA 4UHEA 1WD7A 2AE1A 3PIIA 2PRJA 3P0RA 2PI4A 1BDIA 2I3DA 4QW9A 1XNGA 5D85A 2WPDD 5J1SB 3QI7A 3NC4A 1NBME 1SVOA 3QTBA 4DF4A 2VJYA 4K40A 2XVTA 1CVLA 3DXYA 4EHDA 3RUPA 3CUTA 2J3EA 3F73A 2GS9A 1R0SA 2FJPA 4R64A 1QHYA 4WJ3B 2GPBA 1GOTA 3LPLA 5FYDA 1UUFA 1Y3FE 4WIAA 3HL4A 4QM6A 1LCIA 4ITVA 3OQNA 4NCBA 3RFTA 2MSEB 4PYRA 3RGWS 4EVRA 4TOIA 2BI4A 4YT4A 2HN9A 1VYUA 2AG0A 1N1GA 1QHNA 5HUHA 3K9QO 3UOGA 3NGXA 1U1DA 2D3WA 2B94A 2UZ0A 1ZAYA 2ZR7A 5J0OA 3DBRB 3GMDA 2FN7A 2CLDX 4F4JA 4MKHA 3KO8A 3NT5A 3UMSA 3ZV7A 3FCYA 3FPAA 3MXTA 2Q07A 5HBGA 4IZHA 2ASDA 1NG9A 2DWPA 5DSXA 2IZ0A 1JI0A 2IY9A 3HTXA 3KSDO 3E9RA 4XM2A 3D5EA 4AIRA 5IEJA 2FZGA 2FW6A 4E5MA 3OP1A 2PIAA 2WSMA 4B82A 3IN5A 4DXDA 4YAJA 1LK7A 4RPCA 4I9NA 4ZIRA 3A0UA 1SV0C 1XLVA 2C1ZA 5DOVA 3M4NA 3OY7A 3E05A 2FPGB 1F0NA 2DT8A 1M7HA 2J6UA 2QLTA 2GXSA 3D7MA 4AY2A 1BRTA 1VPVA 5DBAA 4I1RA 2E3TA 1PT9A 4P81A 2CCJA 4JC5A 5DN9A 4ZT5A 4CM4B 4UNRA 3M6WA 3NX4A 3PW4A 5DE3A 3V4ZA 4S1NA 5ALIA 1JR6A 2BF7A 4PZLA 5G1OA 2W2KB 4YFYA 3MVEA 1ZXIA 4MVYA 1U49A 5CNIA 5LLDA 4KLNA 4KDRA 4R2MA 1EA7A 4KMRA 7ICRA 2NU8A 2YUIA 1KKLA 1LTQA 1NN1A 3KLBA 4HH4A 4BLVA 4ZEWA 2QVLA 2R6ZA 3U3XA 1H66A 4I8XA 2RI6A 1NVWQ 3NUGA 2Q9BA 5K3SA 5K5EA 3Q8RB 3U7GA 2WKQA 5AM5A 4MPRA 1Q3HA 4HGZA 1R9GA 3RVPA 2EJWA 3REQB 3TZEA 3JWGA 1ZBQA 1E2MA 4AP6A 5IAJA 3GVPA 2O7QA 4C80A 4LVUA 1B2RA 5K9ZA 4NH0A 1XO1A 5K05A 3HQ4O 4BWMA 4AROA 5EVCA 5BMOA 4BOYA 4V0KA 2A14A 1T5BA 3BXEA 1Z63A 2WG0A 3CU5A 4KQEA 1A2QA 2ORYA 4DLNA 5C5CA 3M3HA 1BX3A 3PC8A 4I55F 3MSXA 9ICQA 3S3TA 2ZIXB 1V71A 2CHEA 2RH4A 3ZQUA 2NUPA 3LCCA 3HXPA 3Q8PB 4YRDA 4URUR 3THVA 2IDMA 5LFAA 2YQ5A 2RGNC 1K27A 1M8FA 1JYFA 4CV2A 1MIHA 2Y1WA 2E4AA 4FBGA 5CLFA 1XCOA 1L5HB 4YK7A 2M32A 3SZGA 4KAJA 3INYA 2YJNA 4US9A 5HJ2A 3STWA 3R6DA 1GY8A 1YJ8A 2M2IA 3FSGD 5AI9A 4H7KA 4RF5A 5LD2C 1RD4A 4F3NA 2ZJOA 1G6KA 2CZQA 1N7JA 1UPTA 5K0BA 2QJWA 2NM0A 2HIGA 3QVVA 5JXHA 5KINB 5AI4A 3K0FA 3SIRA 2VHCA 4P7KA 5T67A 3FTQA 1TYBE 4Z1OA 4BHTA 2VPXA 2PFNA 3WBBA 3OLWA 4NULA 1P9LA 1KVSA 1E3EA 3FH0A 4ARBA 5TY0A 3GT3A 1V8DA 2Z4TA 2IBTA 3W0LB 1RRGA 3E22A 4RVDA 3GA5A 2A5JA 3QFRA 4AG6A 2P9YA 4ISCA 1G55A 2C2OA 4GI5A 5PGMA 1U9ZA 5JRZA 2GZ1A 2WR8A 3U62A 1RC0A 1UBUS 4IHJB 1GRNA 1FA9A 4MWZA 5CR0A 4RQTA 4HC4A 1VLMA 4NBWA 2CVOA 3GAAA 2QDXA 1HL7A 3OM9A 1KDYA 5HQ3B 2WHXA 1U3CA 3K6SA 1OV6A 3VNVA 4DTCA 4ECWA 4PNZA 4YAFA 3PS9A 4U6SA 3R0JA 3V1UA 2EP7A 2NT3A 5I9BA 1Z88A 3PFGA 2I6GA 1T3ZA 4JEMA 3SR6A 2PYDA 4XYMA 1XRMA 1UT8A 1A7KA 2PA3A 2V0NA 2H51A 5IFKA 4CTMA 3KFXA 1YVPA 5HGJA 3H9BA 2VDWA 2WSLA 3G6KA 4O2AB 3WGNA 2XJ9A 2B8NA 1T3TA 4Z54A 4TL8A 3UHAA 3UMVA 3PCTA 5F73A 4BB0A 1QVVA 1C7YA 4FBLA 9ICXA 2AFVA 3LCUA 1D07A 3KFLA 4J9OA 1F17A 1ZUNB 3KTOA 4ZI7B 4WEQA 4ELVA 2CLCX 1QS0B 2AOTB 2VUUA 3LMKA 3EZLA 3WOVA 5KFIA 2GEUA 1IIRA 4DA0A 1VPWA 3G5MA 4CMHA 3KYBA 4YVFA 4DVJA 1B6GA 1H42A 2I2DA 4P93A 5DN6D 2QI9C 1ZQWA 3W04A 2CLFB 3W6UA 1XTUA 3F5QA 1OAAA 4F3YA 1WEHA 5T4FA 3I9NA 2ATCA 4OLAA 3U4DA 1BS9A 1KE1A 2WIGA 5JCJD 1G9XA 2HA5A 4KXWA 1SHLA 4U5QA 1CUXA 1MZVA 3WVNA 4DL2A 1RKQA 2C5BA 3CXUA 3B48A 2QLFA 4CTJA 4WUVA 4ZQHA 3B0XA 4K28A 4KMSA 3V1MA 3SKXA 4AUNA 1NI5A 3HL0A 5ELMA 4ZTBA 3TIVA 1X74A 2E6UX 2HOQA 4XFDA 5TGDA 1YA6A 2NU9B 4QOFA 2G04A 1FTNA 5FWYA 5BNFA 1NUAA 1VMAA 5AXBA 1UDXA 1UQVA 1MV5A 4MVXA 1WZNA 2PMCA 4PCUA 3QKSA 5DK6A 1TEVA 4N3CA 6LDHA 2PH3A 4JBLA 2JI8A 2P77A 2DB3A 1X7HA 2A86A 3QITA 5CX1A 4CL8A 2O0JA 3N2LA 1SZDA 1DBWA 2I76A 3EULA 1U4SA 2F2TA 3KT3A 4A2CA 5A9TA 2W8BB 2C2DA 4EHLA 2YXNA 1D8YA 2QYHA 2RGYA 4UXJA 2A1JA 5C9ZA 1UIMA 2BEKA 2CEKA 2I8AA 2CNLA 3C85A 2V3VA 3THSA 1JFRA 2Q3MA 2KSOA 2ZIUA 4UBMA 3HXQA 4Y2VA 3G85A 3ZE7A 2V7QD 4AYTA 2VUIB 1P1RA 3C3KA 6ABPA 4X9XA 2FJ0A 2VJ5A 1QHHB 2P9BA 2WTXA 3FNGA 1ZIOA 3A1NA 4PAMA 3A0RB 2PMWB 3BL8A 4NU5A 3V7JA 1PG0A 5EKSA 3F5EA 1XQ6A 5JNLA 1QPGA 3ODPA 5I7HA 2G1AA 1YJCA 3KR9A 4ZVTA 1JW9B 4BIMA 5ANRB 4DLSA 3CB4A 5ECGC 2GCNA 1JDBB 3A6ZA 3EXIB 3V3KA 4ZCSA 2R6FA 3EW9A 3DFKA 2GWHA 3GLIB 1PZMA 1XF1A 4GOKA 1JR3E 1HTBA 4MDEA 5LZ4A 3TOCA 3UGJA 1SUEA 5CT6A 7ICLA 3SLKA 4BNZA 1PUXA 3B3AA 3BE6A 1JNXX 5A6VA 4QJ3A 2PGJA 3ETDA 5BWNA 1ZFNA 3LZ6A 3OPYB 1PBTA 4CV3A 1F51E 3M7IA 4YUAA 2W00A 4OKIA 3EQ2A 4XJTA 2ES6A 3BB3A 4ZQIA 1OLXA 3OM8A 2WB2A 3ZTWA 2IKSA 4EENA 2VPQA 1AUPA 5IT0A 1J2YA 1YQUA 1M73E 1X6IA 2YQEA 4ENSA 4XDZA 1XXLA 4Q1DA 2HSZA 5DTJA 3RODA 3P5BA 4ZCPA 2RI0A 3C4JA 1PL6A 3L0ZA 3RWBA 1U45A 1H3NA 3A9CA 3RKRA 1E1LA 4P08A 2W37A 1ZD4A 4NZYA 2RHRA 5GV8A 2DUUA 1YL7A 1YHNA 1U1EA 5TQ2B 3FZQA 4XQGA 2DFTA 3ZYZA 1DEAA 4YP9A 4YJHB 3PFNA 2RFLA 4M9ZA 3ND6A 4AFNA 3LCVB 1EVIA 3C7TA 3TQHA 5JALA 1U7WA 4WOBA 2HRZA 3MCWA 3M1AA 3PLRA 3BSSA 4FYXA 2BKEA 4R41A 3LT4A 3ADPA 4DIMA 3B9PA 2EX4A 2IS6A 3QVOA 3CSUA 3CX3A 4GRAA 3RAPR 2CNWD 2CF6A 1TEXA 5BSGA 5A4IS 4LC0A 5JFGA 2H0QA 1ULTA 1SKYE 1N34B 1N2GA 1T6BY 1FMFA 4O4HF 4IUYA 2PO5A 3T3MB 4XKJA 1PBNA 3OZGA 3V2UA 1N2HA 3NBUA 3ANNA 1YULA 4F4DA 1DKMA 3MR3A 3KBOA 4V0RA 1Y9JA 4ZC1A 4QECA 1U7OA 3ZU6A 1CRLA 1TU3A 5MF6A 2BD0A 2X8JA 2ATVA 1A8IA 1QO0A 2YMLA 2YICA 4UZFA 3H19A 1SULA 4DSEA 4ZKEA 3JZAA 4CDRA 4DR1B 8GPBA 1IXSB 2NQ8A 4N49A 4Q7QA 1WAMA 4JLMA 1X1TA 2FPIA 4MVJF 4L0CA 4X20A 1SXJB 4DRXA 3ZNOA 3BH6A 2C0CA 2EAUA 3ZVMA 1GJRA 3SV3A 4RMIA 4FS1A 3UMGA 4ZCQA 1AOXA 3DHWC 4BBJA 3LL4A 2RGBA 4QBKA 4M0EA 4M99A 2W9XA 9ICBA 4B6RA 3AVQA 4FYYA 1QCYA 1BC5A 1WJGA 2AQ0A 1UKZA 3LH5A 4JH0A 2YBDA 3DZGA 1DAGA 3OZ7A 4K4GA 3VU9A 4MB6A 1RWBA 4OIFA 3FWZA 1KARA 3TOXA 1ZQOA 7ICJA 2O8DB 4DOMA 4JAVC 3OQJA 4I3FA 3LY5A 4C87A 3GJ0A 2GCOB 1SHJA 1NX6A 1IJBA 3FDIA 3N8DA 2B36A 1FEZA 1KZHA 4D6YA 2COEA 2J3QA 4WV3A 3O1JC 2R44A 4BKQA 1Q19A 3I9FA 4ZAFA 4JBYA 5DI3A 1E2BA 1KI4A 3WXBA 1KPHA 4BO4A 1LVUA 1JSRA 4IQFA 3TADA 2PFGA 1BE0A 5HQJA 3K15A 3HJNA 1V16A 3EOAI 1I1NA 1GPWB 3HVHA 4I66A 4FM9A 2G9VA 4RXMA 3RH6A 1Z5WA 2BFCB 5LC1A 1M2GA 1HZZA 2J33A 3K2QA 4L57A 1NVEA 2KPOA 4IDPA 4EEKA 5CLIA 4G1CA 3SQDA 1OQAA 5KUTA 1QR6A 2ABWA 3LECA 4LSMA 1IK4A 4XCVA 4COOA 4XX1A 5JXWA 4RHUA 1Q1ZA 3EDMA 1S4QA 1U3WA 2JAUA 3D8UA 3R76A 2XMGA 2EG5A 3Q72A 4B76A 4AM8A 4MEAA 1AN9A 2LDXA 4UU8A 4UM5A 3EA4A 3WI7A 2Y67A 2GM9A 2ECPA 3EHEA 4G2NA 2XA1A 1FO4A 4XYLA 2RRDA 3KAJA 4ZPXA 2ZBVA 3A27A 1J8QA 1BVRA 1WG8A 5DM2A 3EA0A 1M34B 3H8VA 1M66A 4DLAA 5AM3A 2H4FA 9ICNA 1EUQA 2XVZA 3W2EA 1IHYA 4BJ5A 5AICA 3TOSA 2ZM5A 2GN0A 2UZ1A 1EP2B 4ENTA 2X9VA 1GU7A 2NVBA 3G8AA 3RTAA 4TUYB 4YRIA 2CK3D 2IX3A 3VMMA 1UP7A 2GDZA 3Q3GE 3EXHA 2V7UA 5BRNA 2ZXUA 5FBRB 3P0EA 1QONA 3IAM1 1CJBA 3AUKA 3DDHA 4PGQA 1II0A 2MSCB 5B3JA 2R0QC 5DU2A 5EWJB 4DFKA 1Q14A 3BTVA 2Q3EA 3TJRA 3TINA 1BMFA 4PRZA 4DDVA 4WADA 4KIFA 4YECA 3T34A 1G3UA 3AVWA 1ID1A 1KO8A 3KL4A 4NONA 1XTJA 4YA6A 2C31A 3WK9A 1SCAA 2H65A 4YRNA 1Y9DA 1I3OA 4UAYA 3NATA 3OTOB 1IPFA 4F8RA 3H5AA 2NP6A 2JEJA 4D9GA 3ZHUA 4LY0A 4DPLA 1FTQA 3ZEAA 1D4ZA 3OPMA 2C5LA 3Q3IA 3L8CA 4Q3KA 1HE2A 3U9SA 3OZWA 1W29A 3SVZA 4EY4A 1U9LA 4L51A 5CCBA 6AT1A 2A0XA 3PQ4A 1R2QA 4LPKA 4M9LA 3K0CC 4RVUA 3WGYA 5DHQA 1T4GA 3N8HA 2O2GA 1B8UA 1TYAE 4FSHA 2RB5A 4NAUA 1E3LA 3WYNA 4JEIA 1UIRA 4DMFA 4M0UA 1KQPA 4P98A 4O4LA 5BV2P 3PF9A 2NXCA 4TTVA 1GPUA 4TTIA 4ZT6A 5LCXA 2HK6A 1O8BA 4Q05A 1T7PA 1IZ9A 1PUIA 1KFKB 3T54A 1KAQA 4W5JA 4TVOA 4E0BA 2XD9A 3JPSA 1WX1A 3H8JA 2JAHA 1BDMA 3U1VA 4YR7A 2YMQA 2VP0A 1G5RA 1QRAA 5T57A 1JIUA 3BERA 5KG5A 1SU4A 4ZICA 4D0NA 2JGNA 1E2HA 3HY3A 4V03A 3U3MA 2P3QA 3SX4A 3ZDBA 3ZVLA 5ITVA 1WKCA 3B1WA 3KBBA 2ZB3A 3PC4A 4YREA 3E23A 3QZUA 4J4TA 4FO6A 2BDUA 4OQFA 4WL0A 1ETUA 3WLFA 1ZI8A 1JFTA 4WLUA 2ZIEA 4YYEA 3NJRA 1PZHA 5DNAA 2R8BA 3TCXB 5IP5A 3N2NA 3WRVA 3VSCA 4UNQA 1U5BB 2POCA 2E4ZA 4UVIA 5HR7A 2XZDA 3H1EA 5T3YA 5FR1A 3FPJA 4HWPA 1ZK4A 4QELA 4DLVA 1X8LA 1E94E 3C87A 1A88A 3B7GA 3W5AA 2Z57A 1XDGA 4BP9A 3MGVA 2DFKB 1U5AA 2GK3A 3KDPA 4MW2A 1X39A 4PSUA 4TTAA 1E66A 1G6Q1 1JJ7A 1I3NA 2ODQA 4FLMA 4XD7D 4LF7B 1KSPA 3OECA 1NJWA 4TL7A 2QRJA 3E7PA 1WTAA 1YR2A 4JMPA 3D4PA 2BDPA 1D3AA 1R64A 2VDLB 2YB4A 3P9KA 4Q01A 2JH3A 4Q3DA 3ANMA 2WKRA 1NV8A 4PM4A 3S2SA 4IQTA 2R8GA 4OAOA 1DXSA 3L9WA 1VG0B 2DY1A 3EGOA 2F4VB 2ZTVA 1FSPA 3EXAA 2O2YA 1WP9A 3AJAA 2BQUA 2EDAA 2PS3A 5KOHA 2PZMA 3LBNA 3T7SA 4HAUA 1DBRA 2A1AA 5COBA 5HTOA 4DSTA 5M3BA 4Q19A 3AEXA 3BIWA 4Q4LA 3AI1A 3K05A 3IT3A 3RJ5A 3K30A 1KVRA 3OSPA 4XR4A 1WD5A 3CLHA 1OLOA 3JPOA 1LQUA 4UAWA 5FQNA 2O8BA 2KVCA 2W90A 3WWYA 1AF7A 1H4TA 3A6HA 5J43A 1W5AA 4D0SA 2JF0A 1Q21A 1R4MA 3PNKA 3D6JA 4RF3A 3I9V6 3CLRC 5HG0A 1O8CA 2QR5A 2C8LA 4LYEA 4V3CA 1PZGA 3NVMB 1F3LA 3THYA 1OD6A 2Y2UA 4MVJD 4EUSA 4XI9A 1RI1A 3WWZA 1HT0A 4BVLA 2RD2A 1XZIA 3D5QA 1WP4A 3GEHA 1F48A 2PWZA 2CXPA 2R6JA 1RC8A 5FKJA 4JV1A 5IC5A 2PD6A 4QOJA 2I2XB 1I01A 4UTRA 1F6DA 3LLUA 4F5NA 2VSXA 4OLJA 3BTUA 2PGAA 4BGVA 5KT6A 3FUUA 3L7LA 1ABEA 1A7UA 2LKDA 3QVLA 3FDFA 4ZVPA 1H4SA 1BQEA 4TVKA 2NTNA 3TLXA 1YUNA 4LSGA 4UAJA 2VPPA 2IX9A 6Q21A 4LHEA 2J0QA 3QY0A 4PANA 3BXGA 1JHPA 1WM1A 3LGSA 1G7SA 2V7TA 3LZCA 3UYKA 2GPJA 3MFQA 2Z95A 2K2WA 5DZSA 4PPGA 3VNRA 3U19A 2I2CA 4QJ5A 4QZ8A 2VTKA 3B2EA 5C8VA 3PFWO 1UXGA 4X95A 2EFHB 2BV3A 4PYLA 4HX5A 3NEPX 3C5CA 2VS1A 3QJ5A 4K6HA 4ANFA 3IP5A 1Q3UA 2HY7A 3EAQA 3WO0A 1Z4QA 1VSBA 2HHVA 1VC2A 4Y1RA 5TLSA 1V9PA 4V1CA 4RH0A 2WM2A 4NOKA 3B3GA 1B6SA 3JQFC 5DRYA 2GM3A 4RFVA 1KQGA 1RI5A 1CDOA 4GRIA 1A4UA 1N4AA 1H6DA 3VU1A 3OEHA 3RG8A 1EUYA 2H2HA 4YP5A 5DHTA 4JVOA 4E03A 5L40A 1JLLA 1ZKDA 4RTPA 2XE7A 4O29A 3H2IA 4EZ6A 3KCNA 1GL9B 3OIFA 2F43B 4KR6A 2TYSB 1QRTA 4RPJA 1KQQA 4KW7A 3ZZMA 5DPMA 1LKZA 2P9HA 4LRXA 3GGGA 5BR1A 1RXIA 1KI7A 2JIDA 3HR7A 4QOIA 2H08A 2DT5A 4S1TA 1SCIA 4Q7EA 2DJIA 5KFQA 4FCCA 1Q0TA 2ECKA 1EM6A 1KZ4A 1QP8A 1P7WA 3D4OA 3ODGA 4Q4AB 2G70A 3HFGA 4LTNA 3M83A 4GZLA 3ZWNA 8ICPA 4G9BA 2AH5A 3TIIA 2X13A 4G1VA 1H2AS 1V37A 2YVAA 4OJPA 2B8TA 2IU6A 4QBHA 1DJMA 1Y6ZA 4A8TA 3R8XA 2IY8A 4JV2A 3QBDA 4BFLA 3D7SA 1JPUA 3AY3A 1IG0A 1JVSA 1JN0A 3OZFA 2B3DA 1A4IA 1KFCB 3GOQA 3IODA 2ZVDA 2AHOA 3AR7A 1R6XA 1U6KA 4KGZA 4CR7A 3TW8B 4KQ6A 3PDIB 2XMDA 5D84A 1VTKA 2VHZA 1WB5A 4CMAA 3RDPA 4FFOA 4EO4A 3KU1A 4PTLA 3TKAA 3R7SA 2AJDA 4TPKA 4MHSA 3LIPA 1W36C 1XPOA 2B6HA 4WXYB 4O3OA 2JCVA 4BNJA 2AVDA 4XB6B 1DOHA 1H2YA 3RS3A 1JHRA 1JEOA 1T5LA 4AJJA 2R7NA 1EWKA 3R3VA 2P2GA 1IBKB 3PZRA 1EXNA 5SYMA 2FMFA 4RS4A 3TNJA 1ZJNA 4FZNA 4RNOA 4C43A 1DCTA 4M37A 4KUEA 1M74A 3UOAB 1ZQTA 4YXMA 4NYIR 3SJCA 3NUQA 4MRMA 4XTCS 3HGTA 4BVFA 5TR9A 3V00A 3TE7A 2J85A 2PD3A 2C2RA 2ID9A 2E4WA 5EZYF 1FJXA 1D1QA 2J9ZB 2PKCA 3D8BA 4QRDA 4RF4A 4AZ3B 1LSUA 3G5TA 3UGQA 4ZFNA 3I0ZA 1ZIXA 3I28A 4PR3A 2PZEA 2AK3A 3W2GA 3WG9A 4XR9A 5GY7A 3KJIA 2JGMA 4W9MC 3A9VA 4I4NA 2OYCA 1U2GC 2GT1A 4D1YA 4RADA 5GJWC 5KG4A 3SZMA 4CFSA 2PJZA 4FMBB 1MVLA 3CUWA 3D1VA 4DJTA 1AG9A 3T3DA 1AB5A 4PBRA 4FMDB 4LPSA 3JWPA 1HLPA 1A77A 4RZHA 1BPZA 1CQJA 3COSA 4Q4CA 1TVAA 4Z2YA 2NRVA 4AF6A 4KMOB 1G2IA 2W0MA 3Q3EA 2D2EA 3B52X 3SYNA 1GGKA 2GD2A 2Z30A 1Z6PA 3LVBA 1MX9A 7ICOA 1P1CA 3A4TA 3MBIA 1TF2A 3BMXA 1ISIA 3OZTA 1QZTA 2Z98A 5A9SB 2Q2OA 4ENPA 1T0JB 1QG6A 1NR5A 2XNDD 1OTYA 2VYQA 1UKCA 5AW3A 1W5EA 2WOOA 1UMDA 4B83A 3KKOA 5TX7A 3NPAA 3W5VA 1SL1A 1SXHA 1HE3A 1OXTA 2XQJA 2D2VA 1FLVA 2VUTA 3G0IA 1E4YA 1FFHA 4EW1A 3I72A 2DWUA 2KBEA 2BFDA 4P82A 4R81A 4HPWA 2ZCVA 2OYYA 3EZNA 3QOWA 3CZ4A 2AD1A 2PRKA 4WCVA 3V8RA 1L6RA 5E4YA 2AZMA 2ORWA 2V5UA 2ZFUA 4RKEA 4JI5B 3Q2KA 1R9NA 2A1UA 1X9GA 1HT2E 3DEAA 4X84A 1KJQA 2QAIA 3HYTA 4DOCA 1OGYA 4GBJA 5DBEX 1RQXA 2A9PA 2RH5A 4I50F 3Q1KA 3OWXA 4HB0A 1JV2B 5FLYA 4HGQA 5JQGF 4Y2SA 1IDN1 1T4DA 3GFKB 3I8OA 2V97A 4BE4A 3OQBA 1EVLA 4CQJA 2BSXA 3F2IA 3ZWCA 1ZGJA 2F6RA 2RGEA 2QG6A 4EJ6A 5A3QA 2PMDA 3V48A 2O7RA 5FQOA 2H11A 4MPPA 3KHHA 4EF6A 2CSXA 3M4JA 1ZL2A 3RB4A 1G6OA 1EYZA 5BW4A 1W1IA 1F2UA 4G97A 4N5MA 5C7OO 3I8XA 4JWNA 3EGEA 5TF4A 3WLRA 4XWYA 1PFKA 2W83A 4Q9AA 4ENVA 4C0AC 2G72A 5JCZA 4CMCA 2GBFA 5THXA 4BMDA 2D8AA 2XTZA 1Y63A 3LQFA 1S89A 4HRYA 3CW9A 3LNCA 4G4SP 3RM3A 1KORA 4HUTA 1IEQA 3BJRA 5BUSA 1TKDA 4G0PA 1VQ1A 3UWDA 4DJFC 1H2BA 2V7XA 2VOEA 1EE2A 3OD1A 2G7MC 1VP9A 3ULKA 2HRDA 1J33A 5KPJA 3VYWA 4AKEA 1JU3A 1ITZA 3GNSA 3BQ9A 4RD2A 1JQKA 4JYZA 5KNDA 1ZNQO 2GNPA 4KBGA 4PLHA 4C5AA 2ZW9A 3QWBA 3G9ZA 1IOWA 2OGZA 3JD3A 1V25A 6REQB 4CHGA 2AZXA 2ZITA 1T9AA 2PEYA 4DV7B 4BN5A 3Q15C 5HX7A 4R1TA 3L7IA 1Q3KA 1F8YA 1QDLB 1FS5A 2L42A 1GKYA 3RYHB 5B4TA 2RGWA 3ZDCA 5BOMA 5KFZA 3OWHA 5CHEA 4FDVA 2IIBA 3QZ8A 3WS7A 4CKWA 4D3XA 3K3PA 2QLNA 2FWAA 3AM1A 4JWMA 4WE3A 4P4OA 4D9FA 1K75A 5GGXA 4YH1A 3QLUA 1YJAA 4B3MB 3PCXA 3KWLA 1BHO1 2YS6A 4J1TC 4H6XA 1DC6A 2JDID 3TFSA 2W2QA 3CNQS 2I6FA 5KX5F 2M0NA 5ULLA 3QF7A 1J0BA 4YBRA 5DLDA 1PT6A 3S1SA 2LPMA 3QKRB 3DLHA 3GRKA 5I8PA 2Z2XA 3OT1A 5C37A 4LJLA 1CY4A 3U0VA 1DXQA 1KP3A 1U31A 5A2GA 2RKBA 4GOMD 3O9MA 2RGRA 2QD3A 3FD8A 1XBTA 3J80A 1XVIA 2ZANA 5LP1A 1OAOC 1BOFA 2ECFA 4BEBA 4O3RA 2GVNA 2ZI3A 1KAOA 1U1FA 5B57C 1C9KA 1DRVA 3FETA 4Z6CA 4BVHA 2HDHA 2BFBB 3B1VA 4KDCA 3WTCA 4ETNA 4HVCA 1EGMB 5DNUA 2FJUA 5BNTA 4TKVA 3W5CA 3PX7A 2CW5A 4HYTA 1TK3A 1CJTC 1UMCA 1H9AA 2CFOA 5KYXB 4JYPA 3DV9A 1KI2A 2G5TA 3TUJC 4L15A 3SF0A 3QHQA 1RQNA 4R71A 1VI2A 4BVBA 2BFAA 1KAHA 2DPIA 1KYXA 4AQDA 3L40A 1RXWA 1XP5A 2E8PA 1A2BA 1YCHA 4NCJA 4R16A 3I09A 2XBMA 2WWVD 1HRDA 2EKPA 5D46A 3WKDA 4U4AA 2PYIA 3B5JA 5JRTA 3BHNA 3O9ZA 1CZLA 1Z83A 4ALNA 1HA3A 4UBJA 1XEFA 3WHPA 4IGEA 4HAVA 5HNKA 3GJSA 4BV3A 4G01B 1AH2A 4ESOA 1QF9A 4KNVA 3WSVA 1CFJA 2VDQB 4DHWA 3IBGA 3ZD7A 3KPUA 1XCGB 1PVPA 3F5SA 3AUSA 5EWLA 2PYZA 4CBVA 5DTRA 4FSDA 1ZVQA 3BH0A 4J0QA 1J21A 4C3VA 4EVIA 1WCV1 1GEGA 3L01A 4S2EA 4FYWA 3JYPA 3O83A 1TMGE 1YR6A 5KQPA 5A3SA 5FTJA 2WK1A 2WU3A 2HEGA 1M1UA 5GONB 4K6FA 2AN4A 3D59A 1RYHA 4D5EA 1DAMA 1FRFS 4B8ZA 3EDRA 1KZ9A 3KOXA 3DE0X 4YCXA 1ZQFA 1AXGA 3SQIA 1JHDA 2XF2A 1LWOA 1JECA 4HH0A 3AW9A 3C6XA 3OLXA 2QD1A 1NV9A 3NLLA 1YZTA 1W25A 2IEAA 2GKSA 3NM6B 2W11A 4UCWA 1AQUA 4GS5A 1L3VA 3CLKA 4QUBA 2VK2A 5B1HA 4EKIA 1GQQA 3L0CA 1N0VC 4XDHA 1QRUA 1MPXA 4EG7A 5ADWA 4RPYA 3NP7A 1VRCA 1GZUA 5BOVA 4C4YA 4YALA 4R3UC 3N07A 3KLPX 4TM8A 1Q0HA 3SC2B 4IQVA 3BSWA 3F3SA 4V0OA 4EFMA 2ADOA 4Z7OB 4A1FA 3DZHA 2V4MA 3K2EA 5FNVA 1Z5OA 1FRVA 1AA6A 4G0YA 4L50A 1RAIA 1QQ5A 2OV3A 2HIHA 4F86A 2PX5A 3HK2A 3HRHA 3O82A 2COUA 2AK2A 1WDLA 5J4HA 3VR4D 2NQ2C 2AQIA 3VTZA 3UCXA 3COVA 4B9UA 3ANLA 4B2IA 4UDNA 5B4UA 3V1LA 2VQFB 4FQ5A 4JEUA 4US1R 4LMRA 1NJYA 5A7HA 4FOOA 4LE1A 1UBFA 3L06A 3E2IA 8ICXA 3PSTA 2PX3A 4CLRB 3FGPA 3EJ6A 3GV8B 3H2BA 4NLKA 2G1KA 2XTNA 4M60A 1EG7A 1Y7HA 2H1HA 1EVJA 3TAQA 5IUKC 3AL0C 2EFDB 4D41A 4RE5A 2WJAA 4PAOA 4KYTA 1JG2A 5FAXA 3QE4A 3SDSA 1N5KA 1Z0SA 2E4XA 5E4FA 4BKRA 5DT2A 2O2HA 4EZ9A 4E14A 3R5SA 3UMBA 2EQYA 3UJBA 1XNHA 2A6PA 3AL2A 3M9MB 1NN0A 2WD9A 4KR9A 4HQFA 3CE9A 1NK0A 4Y67A 3OQOA 2Y93A 4F5DA 2NIPA 4DREA 1Q1BA 2AC7A 1X8KA 2GPTA 4Q9IA 3WY9A 1T5OA 2AX4A 2IQ5A 3OSZA 4YV7A 4YJ3B 3IEPA 1VL6A 4RGVA 1VCIA 5C4GB 4TQUS 2P5SA 3NRZA 1K89A 5AH0A 4XVCA 2IYVA 5M5BA 2OBBA 4YVZA 1Q7GA 1ZVMA 4GSYA 5KTRA 5H7XA 2Q4RA 4RZQA 1P9RA 4LOKA 1JQLB 1J00A 2PZAA 2QSJA 3LVQE 2C8VA 1CY6A 5ALLA 4MYRA 3J81k 4DILA 1UBKS 1SQGA 2D8CA 3EVDA 4FNAA 5EHNA 2HA4A 4EPRA 5HK8A 3LC1O 4DIOA 5PNTA 2FG6C 3I39X 2QN9A 3ILVA 5JZVA 1UAAA 1KU0A 4RQBA 3RWOA 2LPEA 3RU9A 3EBPA 1NUTA 1OSNA 3T5GA 4W63A 1USWA 3ONNA 1AS3A 3B6KA 3X2SA 2F3SA 3U4IA 1IZYA 1JTFA 1R0LA 4Q82A 1JYSA 4WKNA 5B4VA 4RKYA 1DHRA 4J9NA 1H1LA 4IDCA 4AQYB 2ZYRA 4AJHA 3LQ2A 4B6EA 2VRWA 5IU6A 4BFCA 4K86A 1NUSA 3K0BA 2FTKE 2PXXA 2OZLA 3GNTA 4OOFA 4IOMA 3SGLA 2SKCA 1MU0A 1JEYA 4BFSA 2ACKA 3L4PA 2IS2A 1YUBA 1R0YA 5KNBA 4EYHB 4B44A 3AKYA 2CCKA 2FHPA 5E6SA 4EQZA 4UB8U 2LYAA 1FQKA 3W2FA 2OBMA 2JAWA 3TZLA 2GBLA 3RREA 4Z0PA 1MC8A 4DB2A 3ESXA 2G5HB 1ZY2A 5D87A 4QE3A 5I7WA 1TDJA 3ZD6A 3A1SA 1EFPB 3R0ZA 4NENA 4MW4A 2BMDA 2XSZD 5LLTA 1SPXA 5B2EA 1BW9B 4QUGA 1KNXA 4NYJR 4MLPA 5C51B 2R8PA 3DJFA 5FBWB 4U9HS 4FHZA 4O1HA 2JA1A 3DDWA 4EPYA 4O5EA 3AG6A 4KREA 1DO8A 1GAWA 4MWDA 2H54A 3HCCA 1F4PA 4NLBA 1C0EA 4A0HA 4HYYA 3PGVA 1P72A 4TLAA 2OSVA 3EB9A 5CIYA 1Q7CA 1NVAA 2OKCA 1BXZA 1S76D 2YR0A 3TAHA 3P20A 4WN9B 2YQZA 1L4FA 1TUIA 3TX6A 3RAQA 5HF8A 2H1WA 5AVKA 3O8QB 2D1RA 5T4BA 4BKPA 4MIOA 1M0WA 2Q2NA 3DH0A 4BZPA 1ISRA 2JIZA 1P17A 3VDNB 4QYXA 3VJLA 3ZE0B 5BORA 2BL4A 1WXEA 3Q8QB 3T5JA 2TMGA 2DHCA 3H13A 2XE8A 3AVVA 3IBSA 1KJWA 1LQ2A 1UOOA 2HU8A 2P9QA 2OFWA 2XWBF 2KHVA 4UAUA 5JYEA 4LDZA 1TU0A 2TECE 3CWZA 1Y6RA 3VC7A 1V97A 3K5WA 3AEYA 1G5TA 4C04A 2HVHA 2DHQA 3HS3A 2O2JA 2O8CB 5JSHA 4JEHA 4KXUA 1T5HX 3H2KA 3BSYA 4BJ6A 4L8YA 1KP2A 1PFQA 3Q7PA 4OGGA 4ZRMA 2FW8A 1YZVA 2IF2A 5GTHU 4QFMA 3PTAA 2OCYC 5IN4A 3NOXA 3ZGNA 3GLSA 2KP7A 3MMXA 3DE4X 1SKMA 2HWKA 2XUGA 5CJ7A 3WJAA 3ZVNA 2JEYA 4Q3BA 1T2EA 1B4DA 5HOQA 4QT0A 3C2QA 5FOXA 5K0GA 3THXB 3DQQA 4KSCA 4OK6A 4PG5A 1JHQA 1BS2A 4U9UA 1GG2A 4D8VA 4RVGA 3OE5A 1P5FA 3ZY2A 4C0XA 4F5ZA 2WTEA 3PNYA 1XZLA 4JOCA 1N60A 3Q4GA 1TIKA 3LRTA 1ECBA 2R8XA 4LRTB 5CCEA 3UHJA 4D9IA 2H4WA 5L3ZA 3FGNA 5KQMA 1OWMA 4I9UA 4K5QA 3CINA 4YV1A 1YONA 2R8JA 5HTKA 5EZQA 4XSHA 3ZWKA 4G9EA 2KLBA 3WZMA 4HQOA 1XMQB 1N1EA 1XHLA 1C30B 5KVCA 3CX6A 1QYVA 1B8VA 2PO7A 1QTIA 4UBNA 2V54A 3M6ZA 1E92A 2ST1A 4Q7MB 2CVPA 3SAGA 1YZGA 2D0PB 5F3XB 3GWZA 1JQAA 4EDFA 2ZYGA 1W9MA 1YMUA 3WJ7A 1V85A 2XVMA 1J0AA 1XTTA 2X9LA 2DWQA 2J4CA 3B82A 1A98A 5F9MA 1V5GA 1PGNA 3TBHA 1NVFA 3L1IA 3FSEA 3F4LA 5LYYA 4Q93A 3UK7A 4GR5A 2JJ2A 4GVLA 4CMEC 4ZYUA 3UNXA 4FZ3A 3O73A 1CF9A 3N2EA 3LPNA 4AYWA 5CB1A 4PS0A 1FPMA 4KIGA 3O4RA 3L6RA 1C1YA 1GFSA 2X6TA 5CHYA 3Q85A 3ETHA 3F7MA 3IULA 1ZH8A 2CZCA 4P3KA 1OX4B 2YXLA 2XXBA 3PV0A 1OPXA 1VZ2A 1UBLS 1NXXA 3JZFA 3MCVA 2PU5A 2W4IA 5DOZA 4IS2A 3N28A 4FDMA 1DX9A 4CF7A 4ARVA 5E6RB 1CS4C 3RRHA 4W8OA 3SHFA 3QKWA 4LHSA 4JL5A 2CJFA 4K46A 2PK3A 2IH2A 1THGA 4W82A 1KVUA 2W9MA 1J5PA 3VM6A 4JXJA 5A5FA 1A5TA 3KZVA 3PRKE 3VKFA 4TT8A 3WBJA 1P2DA 1QH1B 3L93A 2OPBA 4HRAA 4NBTA 3P9IA 2AC2A 4FIDA 5AI8A 4CFZA 2JZCA 2X7JA 2H8KA 5EMHA 3FCEA 3IR5A 1PT5A 4BPBA 4IMPA 3UY4A 1WCIB 4MGHA 4CZ2A 4XYGA 4TXNA 4DFPA 5DGBA 4W1QA 4IHAA 3KPJA 3MW8A 1X40A 1TK8A 3L0IB 3HVUA 1Y3IA 4CXMA 4M1EA 4KBFA 2FGJA 2J3IA 3GJ6A 4OH7A 1SBIA 3K5PA 4QWWA 3T4UA 2XXJA 4BYMA 5AESA 3IJEB 2GKGA 4MR9A 9ICHA 4O5AA 4ZGGA 3MT9A 4IHJF 4KQKA 4ARZA 4BJHB 4GQAA 1XVVA 1WWKA 4E2WA 5J3JA 4M2YA 2NVUA 2VC2B 1E0AA 4L3OA 4F6RB 2IOYA 3DMNA 2ZI9A 1U2RA 4AKIA 1C14A 5AOVA 2FRVA 5KWIA 4UCFA 3JQ9A 1U2PA 5EUBA 3UJ6A 1KZGB 4EG4A 2IP1A 2NUBA 4QQKA 4MP3A 2FLKA 3DAFA 4TS9A 2AQKA 2OOSA 3A37A 1XZNA 5LQMA 2XWSA 3IDSA 1DDGA 9ICLA 1U8FO 1C3OA 1R4NA 1BX1A 4BNYA 1X1BA 2X58A 2RKWA 1YAHA 4E7OA 4O2AF 1V8BA 3A6JA 3Q3JB 1N9GB 2CY0A 3E9YA 3IOEA 1WMEA 3ISTA 1S0MA 2HRRA 3KYIB 3HCPA 3ESBA 3SQMA 4ZI7F 2EKZA 1V8OA 2OD7A 2NTVA 2VJOA 2RAVA 1E98A 3GMSA 1T9GS 1TUEA 5C4IA 4EG6A 1Z7WA 5CIWA 4TQRA 3A26A 5JAMA 2LTAA 1N6KA 4PRYA 2AOVA 3C48A 2R1TB 3DV0A 1N7HA 4TWZA 3ZLVA 4OGWA 4Q18A 5ECDA 4P34A 1G8MA 1C8VB 1W88B 5J63A 3KVNA 4Z8YA 4KU4A 4ZK6A 2OXEA 3GLVA 2XE4A 4ER5A 5EJEA 1P44A 4A92A 2VJ4A 1Q6ZA 2WG2A 3M4XA 3JZIA 1ZQSA 2QVYX 4KI7A 2Y1KA 1XRPA 2OBFA 4WZAA 4ZQFA 3UG7A 2VFAA 3VC8A 1N2CA 4HSGA 4F2RA 3AUYA 2NYRA 4W5NA 3AFMA 2HPVA 3DWIA 2X3FA 5JJLA 2XYVA 1SPBS 4M36A 2ZUCA 1DADA 5ENDA 3RU2A 3ZGYA 1XG5A 3IXQA 1ZQKA 1A72A 4FX2A 4QC2A 1OY1A 1GIAA 2RCNA 4MIEA 1FIUA 1F0KA 4PN7A 1AZLA 3I0NA 4FQ8A 2VDPB 4BECA 3EC1A 4IINA 4IIBA 2I2AA 3T3HA 4DM7A 1EB9A 2IJGX 4EGSA 4JZKA 1L5UA 4HDAA 2GFHA 2QRKA 2R60A 1B0XA 2ZE5A 4H3VA 1B93A 3G2LA 4W1PA 4ZZ3A 5IK2D 5J4KA 4W5TA 4JMUA 2X4GA 1YC5A 4FHGA 4I8IA 5E95A 4DBLE 2BUAA 2HIMA 2E1PA 2O3UA 2VP3A 3MGCA 1QGZA 1QVRA 3B7WA 4FZRA 5U4XA 5EEHA 4WXMA 5EIBD 2HDNB 1C5KA 1EP1B 3E3AA 2NACA 2OP0A 4J0CA 1SIOA 4OBBA 4IQ8A 2I4IA 2R9VA 5HPYB 1P6UA 3GGJA 2UYYA 2GHRA 1K1EA 4P2BA 2G1UA 4DDHA 2PKRA 4Y3UA 4DHEA 4HNTA 3PNOA 3TGWA 2Z5FA 4ZT2A 3DEIA 2B4AA 2Z3ZA 3BK2A 3AQIA 2BFFA 4N18A 1UPFA 5LLSA 2TS1A 3RVBA 1DUIA 1GZVA 3DW3X 1RACA 3BE4A 1FFXB 1MX5A 3RSHA 1EZ4A 4BPRA 4EH1A 4WLNA 2FX3A 4J2HA 1H9CA 3EUWA 3JZMA 5KVVA 1Z15A 1M6VA 4MKZA 3KR0A 1RYNA 4CODB 3NGMA 7MDHA 3WK6A 3R40A 2FFAA 4U39A 3GG2A 3KB2A 3GAFA 1BXGB 4U7JA 4NZZA 1TRHA 1FS4A 4DNPA 2BFEB 1DIRA 5I8WA 2HMUA 1C8BA 2OM2A 2VBCA 2AQ8A 2PX0A 3VNAA 1N2XA 5BN3B 3QF4B 2IZZA 2CNBA 1GYQA 1YQ9A 3FNBA 1UMKA 3H1BA 4KVGA 1MG0A 4EKYA 4Z3KA 2UYCA 4PZDA 1IEVA 3N05A 4GLOA 3TVYA 1UC4B 1P18A 1T4BA 3CH5A 1P7CA 3L1VA 5CFQA 4Z3DA 3W5IA 3ZWAA 2J9FB 2KJ9A 5D8DA 4C7XA 1JDJA 3PU6A 1PX0A 1EXVA 3VHRA 3AV3A 1QSSA 4P0TA 3S8EA 2EFYA 4CRXA 4BDTA 3TQCA 5LPNA 4DAOA 1UANA 2F3UA 2DAPA 3AK4A 5EJ2A 2QB0A 3BTOA 2QPTA 4OO3A 2IBMA 1G19A 4V2UA 1Y8AA 4LJAA 3CEHA 3AF0A 2ZAOA 8ICIA 2Z09A 4J6EA 3F2BA 4KYIB 1SRQA 5DXFA 1ZRHA 2JFYA 4PWZA 3PUHA 4WY8A 2FCAA 3JPQA 2HHLA 3D6MA 5CM9C 3K7EA 2QM0A 3R3ZA 2AXEA 2ODAA 5D4BA 3QKIA 3OX2A 5L3VA 1N3LA 4TXMA 3GLHB 1ZRMA 1DDIA 2WPDA 5IANA 2JARA 2IUEA 3WK5A 1LSJA 4Q4HA 4NL9A 1DJPA 3R3SA 5DYNA 4PGHA 1ONSA 3RBZA 3BHJA 3GFVA 1CR0A 2AJ8A 4NM1A 2HGZA 2QRLA 1OFGA 4X5OA 1FP1D 3CYFA 1J0EA 5ESWA 4AUKA 3IUYA 1YH3A 1B0UA 4URFA 2D5LA 2FRDC 4RSMA 3CBQA 1O0SA 3JTMA 1Z0DA 4HLQB 3I4LA 2Q29A 5F2KA 4CM8A 4E08A 4GICA 2BEWA 3C1ZA 1QOZA 3MB5A 4QSMA 4IRKA 2AN9A 5MN4A 5HGXA 2FEKA 1L3TA 4YGYA 1AQNA 3GRUA 1KK0A 4MTLA 3K32A 1DNPA 5AJXA 3VR4A 2Y77A 1J09A 4WKPA 5FL3A 4F1WA 3CR8A 2FJ6A 1KS2A 2OFFA 2AI3A 4RD0A 3P45A 4P54A 3T7RA 3IVRA 3DR5A 1FDVA 2V03A 3MQ2A 1W34A 4M8LA 2PUVA 4V0MA 1W4BA 2SCUA 1QGYA 3OFJA 4CHTA 1EBBA 5BOSB 3NVDA 1LF5A 2VF7A 2NU7B 3LUAA 1G8HA 2HCBA 5I4KA 1TRKA 2CE7A 1N5OX 3VH3A 3NYIA 4IIFA 1VFNA 2JD1A 2XCOA 4DRYA 2FA9A 1L4BA 4BN0A 2XT6A 3CEAA 1ZNZA 3M5PA 4CU2A 1VSTA 4QLBA 3FI0A 2AHRA 2FSUA 5TSDA 2E85A 4F72A 2IYSA 2JFNA 4AZ0A 4N0DA 1LC3A 4ELUA 2C4NA 5L8VA 2O8EB 1CWUA 1X1SA 3L7KA 4PZUA 4NQZA 4DQUA 4RK1A 3T9CA 5CPBA 3CPSA 1AUQA 1FDUA 2P11A 3DMFA 1GUYA 4J75A 4GM4A 3BH7A 4QNMA 4AMGA 4RD4A 1P80A 5DF1A 1ULHA 2XTAA 3PHIA 3X2EA 2Q6OA 4PINA 2GESA 4U5XA 4X1YB 4GOOD 2HHHB 5I7EA 4Q3EA 4IWYA 1XDSA 5CB4B 3VHQA 2Q9CA 4B9LA 3ZZNA 1YD7A 4D4KA 5F35A 3M6MD 1UK6A 5TJ9A 2JVKA 4H7HA 1Q0RA 2O52A 5KYTA 4HFJA 1GPDG 1M1YB 5DDMA 1FL9A 4ACBA 1LS6A 3CRMA 1SCUB 1XD9A 4QLAA 4DA7A 2RMKA 1HX7A 4Y6QA 3Q6IA 3WWCA 4HXGA 2I7TA 1VJCA 4ZV9A 3E9QA 3T9FA 3NC0C 1DL5A 1PK9A 1WBBA 2BEVB 2HO4A 5GTDA 4YRKA 3DXFA 1BYIA 3ISCA 4OHZA 2XOXA 5J2KA 1RPAA 1I4LD 4HJXA 1A1VA 1PUJA 1ZRNA 1DG3A 4DCOA 2BGWA 1YOVA 3ILSA 1Z56C 4TUYF 1IY9A 2XV1A 2ZXEA 3LQ4A 1TVEA 4X1KA 3IIKA 3PEUA 1ODSA 1CEQA 2OO5C 2ZRPA 1SXDA 4LI0A 5L6MB 3NBZC 3FSGA 5FWXB 1D4FA 4O2LA 1KH3A 2VQ6A 1FCJA 1BMDA 1GZ7A 3FWYA 1LTHR 3LE8A 5EYPA 5AKHA 3AZPA 4L2IA 1KTQA 4XASA 2F1JA 2XSZA 3MEQA 2Y4OA 3DF7A 3EIEA 3HP7A 2OWEA 4BV8A 3Q5GA 3RYCB 1ZIDA 4QGBA 3MDAA 3NIWA 1NT4A 3C97A 3QUBA 3B3FA 2XTMA 2UZIR 3QWIA 3S0JA 4HJRA 3WKEA 4OB7A 2WIBA 3WLEA 3DYVA 2HZBA 2Q5LA 3CO5A 1BKYA 2F8KA 3BDPA 1CUZA 1YR8A 2HYDA 4QXQA 2O14A 3VOBA 4F4YA 1Z4PX 4O08A 3HUDA 2UZ3A 3R9XA 4N39A 4X41A 1DG1G 4CMIA 1T8SA 4HZIA 1NP7A 5L1JA 4NCKA 3AVXA 3QX8A 5LIPA 2BJWA 4NCAA 4NU0A 1TT5A 1DTEA 4R40A 1K5PA 4IR1A 4BLRA 4Y6GB 1DOAA 5AI6A 3ICPA 2VDUE 2QP9X 4MSUA 2VJMA 2ZYSA 3FLBA 1JI7A 4AT1A 2BBOA 1NMQA 1LVHA 1Z2DA 3EEFA 4AN1A 3PFFA 3JQAB 5CXUA 3DAGA 2HRQA 4EECA 3V4LA 4O9MA 5CA1A 1UC5B 1OFVA 2O5CA 2YYZA 4RVNA 4OJYA 4OQQA 4M1SA 2X76A 5JCOA 1JFFB 2E87A 3PC6A 3FZYA 3E15A 2OWOA 1R6BX 2GBPA 3IKLA 4WZAE 3LK7A 1PW5A 4MS4B 1N2CE 3EVCA 2QSZA 2J6BA 4UXHA 3R7BA 2P9GA 2WUVA 2ERCA 3LQKA 3IJRA 4DCCA 4B9TA 2B99A 1D4AA 5DSZA 1PTKA 3AETA 2R62A 3TTUA 4E15A 3FSRA 3FFAA 3H16A 3NORA 1SOAA 4FILA 2IPOA 5D1NA 4RY8A 3WB9A 4DLWA 4PC7A 2CXHA 3LX8A 1LBSA 5EWMA 1U0LA 3ADBA 1QM5A 4J9VA 5DN6A 1TCCA 3GMIA 1MRSA 3JPNA 1DTWB 1KEVA 1U8YA 3RASA 3S55A 2VTBB 4BRWA 3SHWA 2NV0A 2KZMA 2Y1EA 1C1DB 5HS6A 5EXEA 5JCJA 5AIAA 3PGKA 1FDWA 3AEKA 3NCTA 3H4DA 3PI6A 2K5UA 3NS7A 2P79A 4QOHA 2SICE 2OQIA 4XA5A 5HKOA 4Z6KA 5TDHA 2ISPA 1I2ZA 4B2PA 3ADKA 4HH1A 5HHIA 3FLAA 2GPAA 2GLEA 2XCTB 2HHXA 1ZQQA 4MMXB 4WX2B 3Q8WA 4ZAXA 2AR7A 2P3LA 3Q3HA 4FOTA 1R1DA 1A5SB 2HFKA 5FAKA 4F8JA 4JL8A 3GG9A 2IZ7A 2V58A 2A0KA 2WOJA 5EERA 2OMKA 4GZ6A 2KBFA 2GD1O 1QHXA 2KJ5A 3S2ZA 4BO8A 4JI8B 2LHTA 4M7OA 1LLQA 3DP7A 4WESA 3DLIA 1NJ2A 3DV2A 1N8TA 4G63A 6PFKA 2FE4A 3L5OA 1ZUHA 1GU0A 1ORVA 4JV5B 4ML3A 5LD2B 4UD2A 3PQ7A 4A6DA 1IE3A 2IRWA 2V7QA 5K6RA 4OYLA 2WQ6A 1O4VA 1X9MA 1SXJD 1ZM7A 4JLVA 3AI3A 5KG1A 1IM2A 1VM6A 3LAWA 5HZGA 3G2PA 3GQVA 3R5FA 1KR2A 5LQRA 5KFPA 4OQDA 4PYIA 3FTDA 2V9PA 5GJBA 5DCWA 1B1CA 2DUYA 4RD6A 4J9RA 4P1ZA 3KXIA 1YKFA 3G8DA 2PKWA 2KI5A 3VPHA 4JUCA 4BMOB 1UM9A 1SAYA 4YP1A 4KVFA 3FYUB 3NHPA 3SR3A 3BS5A 4F50A 2J6TA 1XCPA 3LSYA 1PVDA 1I0LA 1SKUA 2MSWA 4NICA 5C3MA 3FZEA 1WV0A 1PJAA 2N0SA 4EYQA 1GAQA 4R1NA 1Y1TA 5K3FA 1I4WA 3ZX5A 4IGAA 2YVUA 1OREA 1Z7BA 4R6XA 3O3CA 2VTDA 4DSNA 3BDVA 1NI4A 4P53A 3QVWA 2XNKA 4HZGA 3DFMA 1NQVA 3NCHA 4DV6B 4QYMA 4KTTE 2EF0A 1XYYA 4R9RA 3HO1A 4CIYA 1E9FA 4DYDA 1W4RA 3AWIA 4MVJG 1DX6A 3HCAA 4LBVA 1X66A 2JBAB 2GXAA 4PIVA 2IUFA 4AO6A 4PPXA 4DL4A 1FNNA 1OCEA 4PHDA 1Y48E 3OIGA 3HT3A 4MOWA 3GBPA 4YV0A 3IAXA 3TLBA 3G23A 4EG8A 1YRBA 2H4ZA 2UV8A 1EU1A 1YFJA 2W6QA 5E79U 5IXJA 4WW0A 3GROA 2Y3IA 2VPYA 2XGMA 1SJ9A 4OHKA 3C70A 1EK1A 1L7BA 1A2OA 3BCHA 4D45A 2WAQC 5BW8A 3T6KA 1RHKA 1J0CA 1FUKA 2P6MA 2EQAA 2O6HA 1Y34E 2HXGA 5JLJA 2ZKIA 3BQNB 1A7JA 2YYYA 2QF7A 2HADA 2NOAA 2XMQA 5L3SB 1NXSA 4XPIB 1Y3AA 2ZKLA 3HZOA 3UFXB 4XH9B 5DASA 1J8FA 3ZDDA 1EX9A 3BC1A 1W8DA 5DBCA 3AVUA 1CS0B 3P52A 1PP4A 1RAGA 1RJ9A 2Z8XA 5U4QA 2EGUA 2OV4A 5FWAA 3EFHA 4FSXA 3FNQA 3ZGXA 1U9CA 1O97C 1KRHA 3A58B 1KZ1A 4CLEA 2BMAA 4BX3A 1ED1A 1XTIA 4M89A 2CNWA 5GINE 1GGNA 1EX7A 1W85B 4DGSA 2MSLA 4I55A 1PSDA 5LMCA 4HATA 3JASB 1PL8A 3FTPA 4LHWA 2PFPA 4KXVA 3HBMA 4AWAA 5BW5A 1N6PA 2H2GA 1XAHA 3C24A 5KAPA 4L5CA 1ACMA 2O7SA 1DKLA 1Z0ZA 3BN3A 4MV4A 4H7PA 4OJNA 4V0ME 3MWEB 1UBRS 5HRCA 5KFFA 4NATA 3SZ3A 5LNK6 4UTOA 4D8YA 3G5AA 2CWWA 3VR5H 1E4OA 3C3EA 1XSEA 2UUBB 3AZOA 1BA2A 1ID8A 1B76A 1NW8A 3E9ZA 3OSUA 2X14A 2PDAA 2J46A 2F59A 3MN1A 5GGYA 4R7GA 3K0AA 3H11A 3EUAA 4JLAA 2L0XA 1B41A 1ISPA 4NABA 2C0PA 2VR1A 1W35A 1W5FA 2QJFA 5CP2A 3VR2D 3LK6A 2ECQA 4DG9A 1LDMA 4GUDA 1N4DA 3HRDD 4OMFG 4PLFA 3H0CA 5CB0A 4RAOA 5CVCA 1YU6A 3FWHA 1TCAA 3W5BA 3A9WA 4HO1X 4DIUA 3URMA 4HBGA 2B78A 1EVZA 4ASUD 2K60A 1IY8A 1DDOA 1LV5A 1T2NA 1CXZA 5IK2A 1XZJA 4QYTA 2D54A 1H65A 1Z6TA 2SNIE 3KJXA 4KHPB 1SHKA 3O21A 5JC1A 1ZJ4A 1MB9A 2QTWB 3CF2A 4DWVA 4RGBA 1SCQA 2HLHA 2BZSA 1IXKA 2IC5A 3KZOA 4LVSA 4XWKA 3SKVA 2EG9A 2CVQA 4S1OA 3WU2U 4QZFA 3OU2A 5EZ5A 3TEMA 1GPAA 5BN4A 2H57A 5BR7A 3H83A 2YDXA 4IYJA 3UN1A 4EBEA 2ZG6A 1YB6A 4C7OA 1QHGA 4J07A 4F3TA 1P77A 3F6EX 5IIMA 4X44A 1GPH1 3G2JA 3GZFA 3K6RA 1XK7A 5IC4A 1RWWA 3GEIA 2GILA 1RXEA 4C20A 1AM4D 4FMDF 2HT6A 4ZCRA 1G20A 3M6AA 3K09C 1U3VA 2A88A 2ZS8A 3C6QA 2VCHA 2ZYWX 2P69A 3PY8A 3DFUA 2DPJA 4JA0A 4D92A 8AT1A 2QD5A 3R3WA 5JZSA 4E0DA 1E7WA 3WA7A 3LVRE 1X38A 3KDAA 1K7CA 3N6RA 3AEUA 2PJUA 3RVQA 3FDSA 1X9SA 1V5FA 1PGOA 4YIKA 3KQKA 2QTTA 3F1KA 3H40A 3HNPA 3EK2A 1CQZA 1ZVJA 4Q9LA 2YFYA 2XMBA 2FXIA 2X6RA 5JG7A 2XADA 4MEBA 4OA5A 3WKCA 4QPPA 3RK1A 3CEMA 2WZCA 3W5JA 1E1DA 1WDTA 4EY6A 4IJMA 1GRRA 4WFQA 3E9DA 5JFTA 5D01A 4KJXA 1OVGA 3IC5A 3HPOA 2Q21A 1E6CA 1ZH0A 3HSKA 4W5HA 4KQGA 1TOAA 2YJ5A 3OX1A 5SZIA 5FBKA 1BTOA 5EP1A 4GBED 1UJMA 1ORIA 2NGRA 2ZWVA 2FX5A 3T15A 1RLUA 2P4QA 4F7DA 2JS7A 1WKBA 2H2WA