2YMMA

Sulfate bound l-haloacid dehalogenase from a rhodobacteraceae family bacterium
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
225
structure length
225
Chain Sequence
SGILVFDVNETLLDLTSLSPLFERVFGDAKVLREWFPELILYSQTLTLTGLYRPFGEIAAAVFEMVAANHQAKVTPDDIAELKTRLTSMPAYPDVAPALTRLQDAGFRLVTLTNSAPSPAPSPLEKAGIASFFEAHLTVHSSQRFKPHPSVYDSTAETLGAKPEELCMIACHIWDTIGAQARGWRGGFVARPHNTPLTLAEVPQPDFIGRDMGELADQLIASLTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Marine Rhodobacteraceae L-Haloacid Dehalogenase Contains a Novel His/Glu Dyad that Could Activate the Catalytic Water.
pubmed doi rcsb
source organism Rhodobacteraceae
molecule tags Hydrolase
molecule keywords L-HALOACID DEHALOGENASE
total genus 92
structure length 225
sequence length 225
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2ymmA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2ymmA01
2BY4A 1QH9A 3AR9A 4Y2PA 1RMQA 1Q91A 2FPWA 2B0CA 5AK3A 5AW3A 4OD0A 1O08A 5ALQA 3QX7A 3WK8A 2R8EA 2R8ZA 3QGMA 3L1VA 5A3RA 5AVVA 4UASA 5AESA 1WVIA 2MSNA 4XOUA 1YJ5A 2G09A 2EATA 2YBDA 2B8JA 4IFTA 5AI6A 1F5SA 1Z4PX 1XVIA 1Z88A 3R4CA 3L8FA 5ALEA 3KZXA 5AHXA 5ALFA 2AUTA 2YFYA 4XE5A 1RQNA 5AW4A 5ALZA 2AGVA 3SD7A 4ZEVA 2G0AA 2PR7A 3I1YA 2B1QA 5AW5A 5ALWA 4DW8A 3UMCA 1Z4IA 4KNWA 4NAVA 4HGQA 2JGAA 4BEWA 2ZBDA 4C4TA 1RMYA 3QU9A 4NV0A 5AK6A 5AVWA 3PGLA 2PQ0A 5AIBA 1X42A 4UMVA 5AI9A 2I54A 4YIHA 5AW8A 3P96A 4F71A 5AVRA 3W5CA 4HAIA 4MWOA 1N8NA 3OCZA 3WKCA 5ALIA 4BNDB 5IS2A 4C4SA 3EF1A 5ALTA 3J7TA 3L0CA 3A1EA 3NRJA 2WFAA 2JARA 5AW7A 3A1DA 2P69A 5AM4A 1WR8A 5AKKA 3QU7A 1TA0A 2I34A 2C88A 5AICA 2OA0A 3ZU6A 5AK4A 4QJBA 4UARA 3ZW7A 1ZD3A 4UM5A 3FZQA 4BYGA 3L0YA 5AIAA 2C8LA 5AKGA 3SLRA 1ZD4A 4UM7A 1MH9A 5AKEA 3KD3A 5ALLA 3PGVA 3KBBA 3OCUA 4OFZA 1SU4A 4E88A 1TJ5A 2VKQA 2ZBGA 4AP9A 3NALA 1Z4LA 3ZX4A 4UAUA 3SKXA 4KX5A 1TJ4A 3UMGA 3QU2A 2YMQA 1Z5GA 3QLEA 3DNPA 3ZWDA 4UU0A 2D2VA 1J97A 3HLTA 5ALDA 4RESA 2YMMA 4I9FA 2PKEA 3ZUPA 4BX0A 1YNSA 2ZBFA 2WHEA 3A3YA 1AQ6A 2P27A 3N1UA 2B30A 4Y2VA 3N5KA 1RKUA 2AMYA 5E0OA 2Q4RA 2HCFA 4GXTA 2IOFK 2W11A 2G06A 4KN8A 3MC1A 3CNHA 5AI4A 2R8XA 5AVXA 1Z5UA 3U7FB 4YGYA 5AKHA 1L8OA 4G63A 2HF7A 2JAUA 5T41A 3WKAA 1QQ7A 3U7HB 3AR6A 2EARA 3EPRA 3ZVMA 1CR6A 2B82A 3E81A 3AR8A 1KYTA 3DV9A 1RLMA 3MMZA 5AVTA 5AM0A 3ET5A 4ZEWA 1Z4NA 3ZX5A 1T5SA 3ZI4A 4UU1A 3M1YA 2FI1A 2FDRA 5AW9A 2I6XA 3KDPA 2ZG6A 1RDFA 3WK9A 3L8GA 2B1RA 2WF8A 3ESRA 3E84A 3QXGA 3HYCA 4PNHA 1YDFA 5ALYA 1ZD5A 3ZVNA 5AI5A 4BKMA 3L0BA 1QYIA 4YCMA 1RQLA 5ALMA 2C9MA 5AW0A 3U7EB 3NAMA 4Y2RA 2CFRA 3OCVA 4BX3A 3I6BA 2FUCA 4Y2JA 3WK6A 2JAWA 1WPGA 3SHQA 2IYEA 4EX6A 4CNQA 2R8YA 2YY6A 1Y8AA 2RAVA 2FUEA 1XPJA 4JDPA 2HEGA 3U13A 3DDHA 1IWOA 2YJ6A 3OCWA 1Z4KA 4Y3UA 4HGOA 2YMLA 4GIBA 2OYCA 2HHLA 1ZRNA 1NNLA 1FEZA 2C8KA 1L7NA 2WF6A 1N9KA 3NASA 4CF3A 4UMDA 2AH5A 3ZTWA 2HX1A 5ALVA 3W5AA 2YMPA 4MUMA 2FEAA 2P9JA 3IJ5A 3VAYA 5IT4A 2GFHA 2OBBA 2X4DA 3E58A 4YIKA 2HOQA 2MU2A 5AI0A 2W43A 1VFPA 2MU1A 3IRUA 3L8EA 4HGPA 4YH1A 2DQSA 3KC2A 5A3SA 5AW6A 4J03A 2OM6A 3ONNA 3AR4A 4O8CA 4CF4A 4FE3A 1T5TA 3F9RA 4L6AA 3E8MA 1L7PA 2CN1A 1YV9A 2ZBEA 5ALRA 2YN4A 4NFLA 1U02A 4EZEA 1S8OA 4IG4A 4ZEXA 5IT0A 1WZCA 2GHTA 2ZOSA 2G08A 2Q4TA 4CE6A 4BX2A 2HI0A 1EK2A 4DWOA 5ALNA 4NWIA 2JAOA 3U26A 1J8DA 2RARA 1S2OA 5ALGA 3UMBA 4B6JA 4BNDA 4UMEA 4Y2XA 1L7MA 2IOFA 5AVQA 2BDUA 2QYHA 3A1CA 2C4NA 2YJ4A 2FPUA 1U7OA 1LVHA 1QQ6A 4DCCA 3FPSA 3U7GA 3D6JA 1Z4QA 4JB3A 5AVZA 3I28A 2WF7A 1L8LA 2ZXEA 4EEKA 3AR5A 3QUBA 3B9RA 3BWVA 5FP0A 3OTQA 3W5DA 4L57A 5AKIA 3FPBA 4L6CA 4XPZA 1TE2A 5AK5A 1K1EA 3RF6A 4HGNA 2CFSA 5ALHA 2ODAA 1U2SA 5AKJA 4EENA 4EX7A 2I33A 4Y2TA 3UM9A 3WKBA 3QNMA 5ALPA 2RBKA 5JJBA 3R09A 5AW2A 2WF5A 4CF5A 1CQZA 2NO5A 3ED5A 4OCZA 4KYTA 2G80A 5AVSA 3WK7A 2EAUA 3SF0A 3WGVA 3I76A 5ALSA 3ESQA 3SKYA 1YMQA 3ZWKA 2G07A 4KX3A 4HYTA 3TLMA 4YCLA 1SWVA 3OCYA 1T9ZA 1VJ5A 4UAVA 1Q92A 2IA5A 3PDWA 3W5BA 1Z4MA 1NRWA 5AM1A 1QQ5A 4OHFA 2YJ3A 2W4MA 4QQFA 3SMVA 2P11A 3QUQA 4UATA 1ZS9A 4BBJA 5AVUA 3U19A 5ALJA 1NF2A 2WM8A 3AR2A 4UMFA 2NO4A 2HF2A 3WK5A 3FGOA 5AKYA 3N8GA 4AS2A 1L7OA 1VJRA 3ET4A 5AKZA 2HSZA 4RETA 4G9BA 4UW9A 1PW5A 4Y2SA 2RB5A 1SWWA 2B8EA 3RFUA 1RKVA 2QLTA 3MN1A 3QU5A 3L7YA 3QUTA 2HO4A 3AR7A 3L5KA 2BDEA 4HGRA 4F72A 2I55A 3NIWA 1Z4OA 4KNVA 2GO7A 2IOHA 4FFDA 4I9GA 1JUDA 2NYVA 1RMTA 2Q5EA 1RLTA 5A3QA 4DFDA 4Y2YA 3N28A 2WF9A 3QU4A 3R9KA 3WGUA 3B8EA 5AVYA 4Y2UA 5ALOA 2GHQA 3KOOA 1Z4JA 1O03A 1ZD2P 1ZRMA 4Y2QA 5AKLA 3FVVA 4J2TA 3K1ZA 5ALXA 3NUQA 3WK4A 1RRCA 5AW1A 5ALKA 4H1WA 3S6JA 3ZTYA 3OCXA 5AM3A 5ALUA 1EK1A 3NANA 3GYGA 4C4RA 1RC8A 4EELA 4AS3A 1RPZA 3QYPA 3L1UA 2FPSA 3EWIA 1YS9A 3PCTA 3L8HA 2O2XA 3CZ4A 3QUCA 3OPXA 4YCNA 2I7DA 3M9LA 5AM5A 1TJ3A 2YJ5A 2FPRA 3B9BA 2HDOA 3EF0A 1ZJJA 3DAOA 5AKXA 1L6RA 1RKQA 3IB6A 5AI8A 3ZVLA 1ZOLA 3N07A 3BA6A 3MPOA 3FM9A 2CFTA 2FPXA 1RLOA 2GMWA 4NABA 1U7PA 5AM2A 3WKDA 3AR3A 1U2TA 4XQ0A 2G1AA 4FYPA 3WKEA 4BEVA 1XP5A 1LTQA 2O9JA
chains in the Genus database with same CATH superfamily
5IAAA 4LBVA 2GSDA 3WDKA 1HQKA 1GN9A 4LXTA 4MFFA 3S1SA 1YU9A 3JVVA 1D0VA 2MT9A 3DW1X 1FVXA 5IX8A 3X44A 3E3OA 4IQ4A 5CT9A 2COKA 4GHWA 3VR0A 3W1WA 4W7IA 1OXVA 3SSAA 1KEWA 1YMVA 3ACDA 2Y1EA 3Q10A 5ALQA 1BMTA 5PNTA 4AK9A 2RH4A 2A1JA 1NBHA 4NICA 4RLSA 3R7BA 1I3LA 1W87A 1A9QA 3N7UA 3TF5A 1MAWA 4NCAA 1KKXA 2WV7A 1RPZA 1EFRA 4FSXA 2FN7A 4DFKA 4URZR 4QUBA 1MENA 1X86B 2HPVA 1U28C 3BZBA 3DBLA 3PJGA 4MGHA 1UPXA 4ZYYA 3I3SR 1O77A 4C6TA 1EXDA 2YQ5A 3LX4A 3HCPA 4D9IA 4XD7A 3MWLA 5KYVA 4O4LF 2C07A 621PA 2LYBA 3I0ZA 1JJBA 3SGLA 4D3SA 1I4EB 2VRCD 1QDLB 3IEPA 1MV5A 2NU7B 4MLZA 2XGOA 1HC7A 4EHFA 1NZDA 1U1DA 1L4LA 4MV9A 5T67A 3EK2A 1EFHA 4PBSA 4X9XA 3HMKA 1PQ4A 4H35A 5GM2A 5JNWA 4DSJA 1VMIA 2DR2A 1WNFA 5AW5A 4RD0A 2C2RA 1AKRA 3FNRA 3RYCB 3AUAA 4X92A 1O6BA 2A58A 2WRZA 1V11B 4UD6A 5AUQA 1Y3IA 4CHTA 3PV0A 4OHPA 4JWMA 4AO7A 5B3JA 4GM0A 2JGDB 1T9HA 2J85A 2VXYA 2BGJA 3I5AA 4I50F 4CKEB 3VCBA 1JAIA 4ALMA 3BXGA 2RAFA 3RU2A 2IZ7A 3DB1A 4F3KA 2V97A 3Q40A 2HWXA 5CX1B 3AMZA 1R12A 4OA5A 1WCXA 2DT5A 3PGA1 5HUJA 3SR6A 4QZCA 2G04A 5LZ2A 2X1MA 4PPXA 5I6DA 5KVAA 2E0IA 2PZAA 3ANLA 4C87A 2AU0A 1QUFA 3NV9A 3SF8A 4MWOA 2ZIWA 4HPXB 3W1EA 2IYFA 4AWXA 3IUPA 4OBBA 2EG5A 4DA9A 4IUYA 4WTOA 4PHFA 1P9RA 4MCJA 4BRWA 4UTNA 1UQTA 3WRYA 2Q1TA 2ECKA 4MDFA 1DV2A 2TMDA 2AL7A 4PPFA 3AQEA 4DYHA 4K5QA 1F6BA 3VDRA 4HXEB 2X2PA 2WP8J 5H3HA 1U45A 1H2FA 1XHFA 4CIWA 1VMEA 4AYXA 3KCNA 3I9FA 3K6JA 4HPJB 1Z0AA 1BA3A 4BWFB 1CT9A 3LVVA 2BKVA 3CR7A 1X8JA 3DDSA 3KOWA 4RTOA 1MIHA 1V2HE 1GUZA 4IQWA 2DFNA 2FW1A 1DZ3A 1JKIA 3AF1A 4O6VA 4Q24A 4RMHA 4UB6U 2XUHA 4OB7A 3RODA 4AZ0A 5B4TA 5J3JA 5KOHA 2A0FA 3FGZA 4XPIB 1JZSA 2KKVA 1R0YA 2VWGA 4LVCA 4OHRA 2OHXA 1UBLS 3QFTA 3GLKA 5BUQA 2C7PA 4X3CA 2Z57A 1YZQA 1RXSA 3WGKA 3OF2A 4I1IA 4E5YA 4EO7A 2IHUA 3PGVA 5JXGA 1DDOA 1E5DA 4HV4A 4A1OA 1P2FA 1YL5A 2H4YA 4RHUA 1JXEA 1I30A 1MJFA 1WMBA 3EQ8A 1XXLA 2IYOA 1C0KA 3GRAA 3LVRE 4IIJB 2IFTA 3NALA 3PNKA 4GOLD 2G5TA 2D1QA 4JN6B 4DLRA 1DRKA 1IYZA 1KVRA 3U9LA 4ME6A 1IPHA 3WV5A 4LJYA 2I62A 2IXAA 3C7AA 4FINA 5T7BA 2QHXA 4KSBA 4YCBA 3RAPR 4YRTA 4ETNA 1XKXA 5TY0A 4JJIA 5CVVA 5HJ7A 4GKJB 1XD9A 4RVDA 3HLTA 4O3FA 1B14A 1ACMA 2EX1A 1MQAA 1ECWA 4I9FA 2PD3A 1NK0A 1X1SA 2BIFA 4ECVA 2CXQA 3IUNA 2QVYX 1B93A 3MAAC 3OUUA 3B1KA 1DEXA 2NW6A 3A3YA 4EF5A 2P27A 3IQIX 2QTNA 4UULA 4DBLC 5JZVA 2KSOB 3MTAA 4IR7A 1KSGA 1UBUS 2AMYA 2CNKA 1UJNA 1HQCA 2PGOA 2PRJA 2QLMA 3FETA 3Q7TA 2HRQA 1N7HA 4GXTA 5SZJA 5EWGA 3IBCA 1C4WA 3NCTA 1AF7A 4TLMB 4X95A 1LB1B 3DYVA 2HW8A 4HZIA 1E1NA 1ONPA 5IW8A 3CR8A 1WO8A 1GJRA 4DSAA 1KJJA 1PD0A 3HKDB 4LX0A 1Q22A 1TQ4A 2EP8A 2WU4A 4KHZA 1T2AA 3E9ZA 1TEZA 4LHZA 5LMNB 4UTOA 2Y1GA 3VX4A 1QWOA 4PHAA 4JY7A 4WNYA 1GPLA 3PD0A 4UDOA 4TQUS 3MYRA 2X5OA 2AKEA 3G5TA 3LIPA 4DL6A 1QRTA 1KZHA 2C57A 3EGVA 4IO0A 5L4NA 2ZS7A 3B82A 3EAFA 1A9ZA 3KTQA 3D0KA 5DEOA 5KYWB 3NBXX 2CLOB 1NN0A 3DMTC 5KFZA 4L9RA 4MGEA 4ETIA 3CU5A 3O3MB 3G0OA 1Z4NA 1UJ5A 3M33A 1OA1A 3OG9A 1JDTA 3QP9A 4HNAA 5K7SA 3TXAA 2ZR0A 1DL5A 2FI1A 1Y3AA 1YONA 1MF7A 2HA2A 3GVHA 1ZN7A 3PI6A 4TL6A 1IB6A 1ZAKA 4AECA 2BKEA 2QL6A 5F51A 2DOKA 1E0AA 2HQSA 2OKCA 1H05A 3KDPA 1VTKA 3WLTA 4LF6B 1KRWA 3FW1A 4ND8B 1JQLB 4YUAA 1TCAA 4A8JA 1DE0A 1LKYB 1J09A 1IAQA 1PZMA 2IYPA 4UTXA 1P7ZA 5ALYA 8ICAA 4CM6A 1AGXA 3ILXA 3HRHA 1FFXA 1GR0A 2B35A 2OC4A 2NYUA 2ZATA 1IY9A 1MKYA 3U4IA 3EXHC 3KT0A 4OPMA 5CVEA 1GL7A 3SC6A 2GEKA 3DUFB 1KO1A 1R5OA 4M04A 4YN4A 5JNVA 3GBSA 2ZAYA 1LUAA 3BGSA 2H6EA 2HJVA 4GC5A 1KSJA 3QPAA 4WVLA 2D0OB 1XNQB 3MSXA 3MXOA 2JIQA 5TISU 3D8NA 1G60A 2XUAA 3M6VA 3OQ6A 1JTVA 1F3OA 1Y1SA 3B13B 4X84A 1SL0A 2ACVA 3D31A 5TVGA 2KSQA 2PH5A 2R8YA 4FFOA 2F55A 2Q5LA 1KO4A 4QECA 2CXRA 4LSZA 4Y6GB 5DASA 2QVZX 5LQRA 1WBBA 3CZPA 4BFCA 4O4JB 1XG5A 2H3QA 2PX3A 2KJ5A 2I65A 2VF7A 4LXQA 5JATA 4F1JA 3SEIA 1IWOA 1TZJA 2VJYA 1OI2A 4YROA 3ZGVA 5EOVA 4KZPA 1H38A 3ETEA 3GILA 2O1SA 5FUWA 2B7BA 3G9ZA 4ZAFA 5F64A 5IIOA 4ZT4A 1RPAA 3TW6A 1FNCA 1RD4A 1ZXIA 3A10A 3D81A 1L7NA 1A3CA 2BGTA 2G3YA 2GAFA 2TMGA 4RO0A 4TQGA 1JFLA 8ABPA 3DEZA 1TU4A 1XRRA 1MJGM 1N62A 3K2EA 1I1HA 3Q85A 4RJJA 1SKRA 3R44A 1ADYA 5B2EA 3OX1A 4QM7A 4B9VA 3DVRX 4B2YA 1HT0A 2IC5A 2SKEA 3KYCA 2YWXA 1Q19A 2AW5A 3PP8A 4IGAA 1KEEA 3O4JA 4AY4A 5IXSA 1X7XB 3IPAA 3PJFA 3O2NA 4OA8A 2BAGA 2HWUA 4RK1A 1CUXA 3W4KA 4PAMA 4WPGA 1YCHA 1C8KA 4HT3B 1Y33E 5JSFA 3F6BX 3DOUA 1NF3A 2ICAA 1ZGJA 2BFEB 3NWEA 3U7RA 1QRUA 2YOGA 4NG5A 3V7KA 3ONNA 3OSPA 3B8HA 1YHNA 2CLHB 4NY8A 1H5UA 1KS2A 2H11A 3CEHA 3MW8A 4FOLA 4MP8A 3NP7A 4QXMA 2C3OA 4S0XA 3A1TA 4OQFA 2XUFA 4J6FA 3P5BA 3ZXXA 4F8EA 1KARA 3G68A 3I1FA 3OFND 4ILEA 2BQUA 4II2A 5A4MS 4ZI7F 1GXSA 2BFNA 3IDAA 3KJEA 3KT6A 1ZLYA 4WXHA 4RF3A 1Z1VA 3PO5A 1YS2X 2XSZA 4H3KB 4WAUA 4Y1FA 3LOUA 2IW1A 1SPBS 4QWMA 4HQ0A 3JWIA 2KX7A 4KXMA 2HA4A 3K0EA 4CE6A 5ED4A 3T06B 3GMSA 3Q8MA 4QODA 3PFFA 4DG8A 1AMOA 2R66A 2ZT7A 5DI3A 1U3VA 3HM2A 4LJ4A 3CVWA 1X7ZB 3EWSA 4WRRA 2C4KA 3CNLA 2WKQA 3UMSA 3U26A 2HSEA 4KUGA 2UYCA 1NFQA 4ASUD 3PG5A 1TM4E 4CBVA 4RWEA 5L1MA 2W8ZA 3H1BA 3UAVA 3VNRA 1ED1A 2BDPA 5ARBA 3ZEIA 1W0CA 5KNBH 4AG3A 1G4UR 3A8TA 1UDRA 3DF7A 3FB4A 3ROTA 4F2PA 4ER7A 4BV9A 4ZJPA 3IIJA 1UQRA 2IPNA 1N3YA 1NZBA 4YDHB 5EGSA 3ST7A 3W3ZB 1AJEA 1VXRA 1L3VA 4PGAA 3FTNA 3D02A 1GTG1 1H2AS 4P3OA 4BMNA 1DU4A 2IZZA 3GY0A 1KOGA 3AR5A 4MP3A 1OBFO 5DZSA 2PGXA 1E1YA 4CYMA 3O82A 1TB4A 5FP0A 1YFKA 1XA3A 4IP0A 1VE6A 5EFZA 3I6YA 5EI5A 4CR8A 1ZEMA 1D8LA 3RRJA 3VA7A 5BV7A 4PINA 5CA1A 1QE5A 5E2IA 1GPYA 3CRVA 3ZV3A 1OT5A 2ZCJA 1QJ4A 1QIDA 1PE0A 2ODAA 3UANA 1K92A 2AXNA 2D1TA 2PVCA 3AI3A 1NOMA 2CE7A 2LIVA 2QXYA 3TLGA 3NH6A 2WAAA 2EBUA 1A2OA 3AHJA 1WOMA 3EDRA 1JIQA 1GCUA 3N6RA 5JLJA 3L84A 2VLBA 3HXTA 3Q87B 5FNVA 1O97D 2ZTLA 3RQIA 2FPPB 2CHEA 4F04A 3U0VA 5CEEA 5T5QA 7REQB 3ICXA 5LMUB 4QGAA 2PT6A 3DE1X 2HF8A 3LUPA 4H2DA 2GM3A 3OCJA 4N3AA 4FBUA 4V2UA 3BQ1A 1VL2A 2KK0A 3VZCA 1F0NA 4ZOHC 1WG8A 4UBIA 1QTNA 1J49A 3LOQA 3M5WA 4LI0A 3BCSA 2ZRBA 3L0ZA 4ZKDA 5LZ9A 1ZBDA 2NO0A 3WGVA 4E5VA 2F3TA 5MDHA 4ZVMA 4I2HA 2B6NA 4HXFB 1DEOA 3FSRA 4E3ZA 3PHBE 5KOJA 1OPRA 3NTLA 3BWMA 1NW4A 1F5NA 1QFXA 3OU6A 1BWSA 1VMDA 1Y9JA 4YALA 2FQQA 4EI7A 3QFCA 4US2R 2VRCA 3OJWA 1I51A 1JEYA 3TZKA 3O4RA 4H7KA 4QQFA 1YR2A 2W8BA 3O47A 5DK6A 2F8KA 3CF4G 4ZHSA 2WFLB 3Q15C 2COEA 2WWHA 3CIOA 2Y6VA 4MSUA 4EYQA 1M2NA 1G66A 4MICA 3ZXSA 4D81A 1T8RA 3LRTA 1C0IA 4XX0B 5DTRA 3NWBA 4RD6A 1RRFA 3HN6A 3ZN2A 3IUYA 3PQ8A 2B2CA 3L2OB 2OD2A 2WM8A 2WAOA 3Q3VA 3WO0A 1DOQA 1TT5A 4ZP1A 5DNDA 2GETA 3TAUA 3CF2A 5ICEA 1ZQWA 1CNEA 1G21A 3GT7A 3ZIAD 3ET4A 3HCFA 2W2LA 3R3JA 1W5SA 1AB6A 3RBVA 1K8YB 2P7HA 2WTFA 2VWQA 2XDYA 3VV3A 4BC1A 2OGTA 7ICUA 3DL0A 4CM9D 5ADUS 3ZH9B 4KN4A 1DFIA 1RP1A 1QR2A 1XALA 1SWWA 4XR4A 3QVGB 3NBYC 4NJEA 3LDFA 2BBSA 4QULA 5BR8B 3G7NA 4RPCA 2V58A 1M2OB 3V80A 3EHDA 2A9KA 4OGGA 2CSXA 2VJPA 3NS7A 4PZ9A 4JI3B 2XYGA 3C3BA 5DO9A 3LWBA 3J7AC 2AZ4A 2WM2A 3COSA 4MCIA 4YJ3A 4DMRA 1JFSA 4UXIA 1CY0A 1DT3A 2WMNB 3OT4A 5BQFA 4RIIA 2BCSA 2QE6A 5BRJA 1HDRA 4YMVA 2AMLA 2BR3A 2D3TA 2NPOA 2WQZA 3WGUA 4ZYTA 3AI1A 5B36A 5JXIA 1N61A 3PXXA 4NNPA 2ZKLA 4E70A 2NZ8A 2QLFA 5LLSA 2LV8A 4U9IS 1DKQA 1G8KA 4HAYA 5CNJA 3OHPA 4F5RA 1BROA 1PG2A 4C0QC 2P0AA 3AVVA 4C06A 2Q5CA 3VTKA 4YP1A 3M6AA 4AVYA 1PU2A 3QY0A 4XFKA 2IWRA 3TAXA 5HM8A 2GJ8A 4S1TA 2YZGA 1RZTA 1CRXA 2BGMA 2GA8A 1N2CB 3QI2A 4NLCA 1E5TA 4LI3X 2TRSB 5AOCA 3G9UA 2ZI9A 5KWEA 1HL7A 4KN6A 1LNZA 1J2UA 1P4GA 2R1ZA 3N2LA 2ZUVA 3ETDA 3O21A 4QXQA 2QU7A 1ZNWA 3F6PA 3QW2A 1Z6TA 3CPEA 1OPXA 1Z5WA 4TT3A 1UMDB 1VYTA 2NSYA 2PGLA 5GVRA 5JD3A 1HDOA 2CV2A 4LF9B 3PFHA 4G0UA 4B4KA 2KLHA 3D3JA 3D2SA 3BJYA 3OHBA 3F3KA 5CIQA 1SOUA 2HWKA 3M9LA 4GZ5A 3DBHB 2YCBA 2J1LA 3CT6A 2ZTEA 2FSGA 1IJBA 1FS6A 2HMTA 5DISB 1NF8A 3V8QA 3C7TA 3UYLA 4L0CA 1RCTE 1GZ6A 9ICNA 1T29A 1VI6A 2WUEA 2PRKA 5C31A 2BBOA 3VU8A 1SHJA 4JEIA 1USGA 2EKLA 4I4LA 5K99A 4OAPA 3U4DA 5HFJA 1KYQA 2QMQA 3GMIA 1JG1A 3RS2A 5JS6A 1TF2A 4FOPA 4QOJA 2HW3A 1ZN2A 2Z4RA 4MJ7A 2H92A 3DEHA 4OU5A 5LIPA 1COWD 3CF0A 3PSTA 2VJMB 1YZNA 4ZDJA 3OQPA 3O1LA 1SEVA 4L3OA 1SXDA 5EKSA 4QZAA 2PFKA 2GCGA 1NG9A 1EDBA 1N7JA 3FR8A 1ZFNA 5J2TF 4KR7A 1UA0A 1T35A 3JQ7B 1KEZA 3Q5GA 2VSQA 1YRAA 4PNZA 3OQNA 3L06A 4FYPA 1DWOA 1Z12A 2REBA 1PV4A 3R74A 2OQ2A 1RHQA 2J6HA 3A14A 4M7WA 3CRNA 5ILOA 1E1RA 4DUGA 5FEMA 3TL3A 2O9JA 2E5WA 5DEIA 1IVYA 2BR5A 1Y8QA 2NTYC 1JHUA 3V1YA 3AJ8A 3IP5A 3PR3A 4KMRA 3MUOA 2H2GA 3O8DA 4PLCA 2IBKA 4L4RA 3ANYB 3RSOA 5G2OA 4F21A 2NU9A 4DREA 4RVFA 1L5OA 1X0VA 5IDVA 4B3JA 4K9OA 3H17A 4EA9A 2A2ZA 4FPXA 5CDHA 1JDVA 2RG1A 4P1ZA 4Q82A 1R6AA 2Y0EA 1EA5A 1ZHOA 3RVLA 4XDZA 4CDGA 1JLRA 2BHTA 2ISOA 3GEPA 4PYMA 5HQ3B 4HNSA 1XZKA 4RPXA 2WU8A 1YJXA 4HPWA 1CHDA 1UJBA 3SBXA 1ZJMA 4OYLA 1MUUA 1BD3A 2PZKA 4MKGA 4O4LA 3WRYC 1YIAA 2OP0A 3NPAA 4UQPA 3AUOA 1J0EA 2Q50A 4RPGA 1MABB 3GFGA 1GZHB 1B8OA 1Y7HA 3MB5A 4K03A 3OPMA 1ZINA 4WESA 1UOPA 3U3KA 5AW4A 1P1BA 3O75A 4YASA 4LJKA 2YJGA 3BZCA 2R6R1 2V3VA 3RC7A 1BD4A 4QNLA 3KKLA 4EOGA 2X19A 2IHJA 1S1MA 3PX2A 1ZONA 2O5RA 4B76A 3GLIB 3DMPA 5LQJA 3OI7A 3SYMA 4DC9A 5EIWA 2Z8ZA 5EIFA 2DUMA 3SZLA 3VR5D 4DLPA 1F06A 4PW0A 1II0A 1RYEA 1TF7A 3UB2A 4HRXA 3URKA 5C2JB 1E79D 2J9XB 4YQEA 1KZGB 2WG0A 3A4YA 1XJ5A 4INPA 1E4OA 4P4UA 3VDQA 2NRWA 1F2DA 5AXCA 1E9AA 1HKUA 1W88B 3FG9A 3F5MA 3OP4A 1CEZA 2RH9B 2V59A 2C61A 4ZPJA 4F06A 3ZGXA 4QVGA 1LJ8A 2J0QA 1THGA 3WZMA 1P75A 1VA4A 4BQPA 4I4IA 2J3EA 2GM5A 1S0MA 1E89A 3T5BA 4C7BA 4J9NA 3KXDA 4BNDB 2GRAA 3UH1A 2Q4EA 4HTFA 5ALTA 2BQRA 1USWA 2UVPB 4G0QA 5DNVA 1YDEA 4XRHA 1ZUNA 3RTGA 3SPXA 1PR0A 1T1SA 3EXAA 1FMFA 2JARA 4FYJA 4K2AA 1YZUA 1YQXA 5CNKA 1VLVA 4WLOA 4DDWA 3MQ4A 1H2HA 2P9EA 4LV8B 2ABWA 2ZK7A 3MGKA 4YCAA 3EQZA 2P2YA 1WR8A 3EH2A 3UVEA 5CA0F 2X4LA 5C80A 3F2VA 3DAFA 3HU2A 1R5NA 4YRRA 3KQSA 1EK6A 1T8WA 1TM1E 3WHKA 4LBZA 3MAGA 4W5WA 3KB6A 1H23A 2R60A 2DH5A 5BW5A 5HVNA 3HVIA 2YFHA 4Q4DA 1GZVA 1WXFA 4JQSA 4UM5A 4W1QA 4J8PA 5E2AA 1MO6A 1SQSA 3LUFA 3UWOA 1C3OB 2GNAA 3FLAA 1J21A 3OZUA 1PUJA 2RGNA 4PRKA 4BO4A 3K5PA 4LE1A 3NWPA 5D5QA 4Q16A 3D43A 1SCAA 1XBTA 1ETUA 1DTEA 2PN1A 4HN9A 2VHVA 1W29A 4AY2A 1UXOA 1Q74A 4F2RA 1U0EA 2Z5LA 3AEUB 2D62A 1H4VB 3KBBA 4IIEA 4U6PA 2V5VA 2IXTA 3F3YA 2PU5A 4KQ6A 4WKOA 5J0XA 1CEXA 3VC1A 1VG0B 2KJQA 1H42A 5I7FA 3IQDB 3D2NA 2IT1A 1BS2A 2NIPA 5A4FS 4XYEA 3DFMA 3RROA 4Q3NA 4TUYF 4RGQA 2HMYB 4JYBA 1RM6C 4ISCA 1K98A 3K71B 3M81A 2YIDA 1ZCAA 2CXPA 1Q20A 2O20A 1NVWQ 2FU5C 3C3EA 4YTEA 4XJXA 4PGXA 3A11A 4W82A 2Y1IA 3SZGA 4NY1A 1QVWA 2P90A 3H6GA 2DBQA 2JASA 4WZ6A 4MUKA 3D8HA 3T8YA 5EIOA 4B2LA 1XMPA 3OHAA 1JXMA 1LW7A 2LI6A 1NSFA 2CWDA 2Z58A 4NVRA 1N2XA 5CB0A 5BMOA 1UK9A 4IRMA 4DF8A 1I4WA 3BQTA 3CGWA 3FWHA 4XCQA 2DYKA 5D6OA 1FDUA 1L4GA 1JRPA 5IAKA 1L3TA 5K0EA 2J3DA 4QZDA 4F84A 5C53B 4O2LA 3DMDA 4PRYA 4B6FA 1K5OA 4Z2AA 1YTUA 3AY7A 1URJA 1GNVA 2ZFUA 1U5BA 4I7EA 3CN7A 4EVRA 1A95A 2BV3A 2WEKA 4UVEA 2X0RA 5EJFA 3QYFA 3VZQA 5AI4A 1EWTA 1V5IA 4UHEA 1P0FA 4QHSA 2NZYA 3OWHA 3LQ2A 4IFBA 2ALJA 2G40A 2XD9A 4I4TF 4IHQA 5C4GB 5T64A 1EX9A 1BXGB 1KK1A 1VSQA 2VJMA 2NU6B 3LG2A 3L01A 4GOMD 4KAXA 4L28A 4OQYA 1ECGA 2AFVA 2QRGA 1HIWA 1NRJB 1WB4A 3IJRA 4RZHA 1X3LA 2GLUA 2H65A 4RVSA 3B89A 2R5NA 4LJLA 1IXRA 1RYRA 1GSAA 2QD3A 2WVAA 4A27A 5F7OA 1YRWA 3H5IA 3WMGA 2NNWB 4C7JA 5LWQA 2GPTA 4TMWA 4JC4A 5ECDA 1RLMA 3RYHA 3AV0B 2J33A 3ADBA 4D8VA 5KT4A 1IHDA 3LPDA 4O5OA 4TUYB 3CO5A 3ZX5A 1QGOA 1TCBA 5BUZA 4KI7A 2J3HA 4NZMA 1OZFA 2JHFA 3DTNA 5IG2A 3HCWA 1TKAA 2IXGA 4D0RA 4D74A 3TR6A 5A3JA 1JIKA 1HGXA 3P2IA 2QT1A 1EX1A 1U63A 2EKPA 1U2DA 2Z98A 4UBCA 5LUBA 1SG0A 3K1AA 1RBYA 3OIGA 4H31A 4PNHA 3HHPA 3O26A 5TSDA 1ZD5A 3U3RA 1MGOA 2UZ4A 5T4EA 3ZE2B 1KMQA 5AI5A 3EVZA 3L0BA 4RQ5A 2R68A 3BB3A 1IK6A 4NLZA 1XZMA 5ALMA 2C9MA 2MR5A 3ENKA 1BXRA 4MQLA 4YI3A 4Y18A 1ABEA 1NUPA 1IUPA 1Y1QA 221PA 1GQRA 1T9AA 2HL6A 3ABQB 3SC2B 3UKDA 3VNSA 1XU4A 3A6FA 1DCFA 1MC8A 3AB7A 3D1JA 2GGSA 1OXTA 4MEXA 1JT9A 2OZLB 3C7CB 1NJSA 1LEHA 1IB0A 1L3CA 1VG1A 3M8KA 3S0JA 4C3VA 5CB6A 5A6SA 4ZVTA 3WJ7A 1CEYA 1CIPA 2I2DA 7ICPA 1DMSA 4IY1A 3CYMA 2L69A 3MR5A 1FDWA 1YBVA 1UJMA 3I8XA 1KEPA 1L7DA 4RGVA 5FD8A 4E3WA 1AHPA 3AM1A 3NETA 2I4NA 2YTZA 3RKRA 1QYVA 1D1PA 1IN4A 4KGZA 3TS1A 3U13A 3E22B 4XYMA 4EABA 4MI6A 4P3XA 2PDAA 3T1VA 2R1TA 3L77A 3OCWA 3C1YA 3K9HA 3V4ZA 8ADHA 1C4OA 2YMLA 5DG9A 1NJ8A 3WA7A 3W5IA 1CZRA 1RHRA 1FDOA 5SZHB 2XZTA 3UWKA 3JQAA 3UT0A 1FEZA 3LP5A 4W9MC 1CYEA 2K2WA 4X93A 2NNLD 2G6TA 2JLBA 3GB9A 3FNIA 1G3IA 4RSGA 3WBBA 3TX6A 5KO2A 2AG1A 4C29A 1MHPA 1V71A 4HH4A 1ZH8A 2CRXA 3M6WA 1CRQA 3IBGA 1QMPA 4FFNA 1NBWB 2ZBQA 1REQA 2B94A 5DKWA 1GLGA 4MQUA 3U09A 4QBGB 2KZ3A 5I9IA 5LYJB 3N2IA 4KQ9A 2VXOA 2QRQA 1OFIA 4HRAA 1Z6PA 1IV8A 5JSZA 5LQDA 2LHTA 1BPYA 2FJ0A 5J5CA 2EQYA 1N56A 1E58A 4C3UA 1QIEA 1F2VA 2SNIE 2DQSA 1GV0A 3DCNA 1Z83A 3FJ1A 3QJYA 3TUIC 3WG9A 1E20A 3CWQA 5FA5A 3V2IA 1ULZA 3R40A 1X9SA 1MVOA 4UEWA 3TVYA 1A7AA 3PR4A 2XMGA 3DPIA 1RJ9A 4CF4A 2CL5A 2ZVDA 4HQFA 1I5OA 3T6KA 2W98A 1RYUA 2VCEA 4HS4A 4ZOQI 4I1YA 2AVDA 4INAA 3IP7A 4L4YA 2E4WA 3T3PB 4U4AA 2ISSD 2IHNA 4GGPA 4BMVA 1DCMA 2CB0A 1AUPA 3CBQA 4Y6OA 4DEVA 1AMNA 3W79A 1JH9A 2JBAA 1V7ZA 1AGYA 1Z33A 3S1AB 3QKIA 3PYXA 4QPPA 1W4BA 1L4FA 1EEXB 2QRPA 1GTVA 1LRLA 3HVHA 4E1VA 4URVR 3BBPA 1NX9A 5EHXA 2CZCA 3AIMA 4HAZA 1HKHA 1KO8A 1QRRA 4KCGA 5CFNA 1IMOA 2E3TA 2QSZA 4I1RA 5GQSA 3RVJA 4B71A 1PWEA 2AG8A 3EEFA 4PQRA 5ALGA 1Z1BA 4B6JA 5KFDA 4EBBA 5KSZA 1EWQA 4KRGA 1YUNA 6CHYA 3IB3A 5K4LA 1WV1A 4UPDA 5D6NA 2GT1A 3AF3A 3DHWC 1BIFA 4FLMA 4M36A 2CCGA 1I9GA 3SYKA 5I45A 1LVHA 3KK0A 1GUBA 3D2CA 4OLHA 5KFBA 4HVTA 1WULS 4KO3S 5KFAA 4CUJA 2RHGB 3H0MB 4H4DA 5BPHA 5KOHB 3DZFA 3FZNA 4QRIA 2JCGA 4Q9HA 3LQYA 1GGEA 1O87A 4ZAZA 5J2EA 3JQGB 1YS1X 3AU9A 2AI2A 4P86A 3JW8A 4WY2A 2FMIA 2IYSA 1JR4A 2WJ6A 3HZOA 2FFHA 4EG1A 1ND6A 2FX2A 1RC0A 3BN3A 3E1SA 2C20A 1W46A 5KG2A 1O1YA 4EENA 1VLJA 4KFTA 1QDEA 1Y4ZA 2JANA 3K9BA 3OT1B 4N0PA 4UBJA 3QPVA 2FLLA 2I99A 4DJFC 10MHA 2QN1A 3WJ1A 4F6CA 4LRTB 4AMUA 5KYTA 3KJHA 3EOBI 3G0IA 5JTIA 3JWJA 3LXUX 3B5IA 3EGEA 3PVXA 3D7MA 2AYZA 4QUKA 5AW2A 2AZMA 4GQIA 3ADDA 3U48A 4CMKA 2AJ8A 1Q6ZA 2KEYA 4J1TC 4QPNA 4F5DA 3BF7A 1U7DA 1EIZA 2E4VA 2X4IA 3AFIA 3GFBA 4Z99A 3EZ7A 3DFIA 4BVEA 1K6MA 1MX5A 2A14A 4FMCF 1E3QA 1NVFA 2IEZA 2EHDA 4V1CA 5KQRA 2RGAA 3QWFA 3QG5A 4DV7B 2ONYA 4MV0A 3IXLA 5C3MA 4X00A 3C5EA 2J4CA 3E7DA 5IKMA 1D2EA 1QIHA 3LT1A 3OCYA 1ABBA 3NHWA 4UAVA 5E3JA 1K5GA 3GLIE 2X5KO 4BQNA 4JZKA 1YDGA 1QF6A 2QMZA 4NMLA 1Z4MA 2JI6A 2MYNA 8ICHA 5DDMA 1OAOC 2QTLA 3G8CA 4WN9B 1SVIA 4FUQA 4I3HA 4BDSA 4XD7D 4M0MA 2HA0A 4WCFC 3L4PA 4YO7A 1N8KA 1JEYB 3OE7D 4XQ8A 1NTOA 2IEGA 2ZRQA 3OD1A 3WSWA 2O2JA 3VYTB 4R2MA 4NJMB 4RELA 2HLHA 4UEQA 2IQ5A 1NYRA 4IRXA 1M8GA 4NYMQ 1MORA 2C54A 2JLCA 4GPD1 4Y30A 3AU6A 1JQJC 1N5DA 4BBJA 1KTIA 5L7WA 3J81j 5E6UB 5F2EA 1CQJA 4OLBA 2ZSDA 4Q1EA 5HZMA 1N7GA 3UQ0A 3PVZA 4ZO6A 2RBGA 4MRAA 3FOZA 3KSBC 4JLMA 3IP4B 3QOXA 5LOVB 2E82A 1H69A 4AKIA 2SECE 4F93B 2HXSA 3ZKAA 1XWLA 2XAAA 3NM5A 2ZEJA 4UW9A 4TMKA 1HT1E 3SN6A 2B7CA 2A9JA 3GJ4A 3HPQA 4BLOA 4CRWB 4INZA 4YA6A 1ZMTA 4ZHQA 1FDTA 5IAGA 3G6YA 1ULBA 4EUSA 4V1CI 3PHGA 1OLUA 2B8EA 1D6JA 2XPCA 4JT9A 3T7EA 1ZO8A 4LN1A 4R4JA 3EY4A 2ODPA 3NIBA 4G1UC 4GVLA 3L5KA 2WJIA 3N2NA 2RKOA 1TECE 3KQOA 4MS3B 5T57A 3USCS 1R8XA 2XCUA 4QYMA 3KT8A 3RBZA 3K70D 5DBHX 5E1OA 2XB8A 4MDEA 3NT2A 1NULA 4BFVA 1XMOB 1GLVA 2WMYA 1N6RA 4LWOA 4JEUA 3QFHA 1OXXK 2ASDA 3ZZ0A 5CJ2A 2GCEA 1P7YA 1RBZA 4YECA 4TMFA 4EM6A 3AF0A 1RTTA 1ZQPA 4V39A 4TLCA 5JZBA 4ER6A 2EKZA 4LCJA 4PAGA 3C45A 1UCFA 1JI7A 1GEGA 4PX5A 5CGQB 3VDMA 4KV7A 4O2AB 1I7QB 4QT4A 5LA6B 1LK0A 1IXKA 1ZRMA 5KU1A 4TV9F 3A4NA 4ERNA 3K92A 4JQYA 3RH6A 3W5HA 1ESCA 3TSCA 1J06A 2FP3A 2LKDA 3A4MA 1ENYA 1Q16A 2RI0A 5D86A 2FWRA 4OHWA 4DWVA 1RRCA 3RIEA 1T2UA 3LY8A 4LW8A 4PZZA 4UE6A 1ISGA 2F4NA 1RRKA 3E15A 3TW8A 1SB9A 4YV1A 4TT3D 4K0RA 1HDYA 4QYIB 4ZO8A 1GNLA 1OBVA 2ZU0C 3B2EA 5I7SA 2NO6A 1N0UA 3KFXA 1IUKA 3C1OA 3QYPA 4M7OA 5H7XA 3O1IC 3ZNOA 1M34B 3IPXA 3EIWA 2HLNA 4D82A 2R7AA 4LG1A 3LCUA 2ZXUA 5G0UA 5IJZA 1GYQA 1VMAA 1EP1B 1XEWX 3KKKA 2RHTA 4Z3OA 4H7HA 1TQ8A 2RDJA 3B5EA 3KJIA 3CNBA 2RI6A 1T4MA 1XQYA 4JLAA 5HIMA 1ZL0A 3LV8A 4RPYA 4PR3A 3UHPA 1ZQIA 4AMBA 5FV4A 2I7DA 2IXEA 1IQUA 1G7RA 4TYPA 1RWNA 3O92A 5CGZA 4FDVA 4CQJA 1G6Q1 4NZYA 3QFFA 4G9EA 4L8LA 3QZ8A 2WW8A 2BH2A 4IW3B 2VIIA 1LY1A 2OLEA 1VPTA 3KR0A 3F4BA 1XEAA 2I2FA 2QRHA 3N07A 4IVQA 4LGCA 4ZHQB 1DC5A 2UZ3A 2GOYA 2CFTA 2PANA 2YR0A 5IP5A 2FYTA 2XNCA 4BS9A 1OX4A 2R8BA 4ZQBA 2ZXFA 3JASB 5EOZA 3I9V1 4WASA 3BZKA 4WCFA 4BMOB 2WVJA 4V02A 1Y4SA 3AR3A 2B36A 1G6KA 1E1QD 1NQOA 3DW3X 4ZT3A 4UPVA 3W5SA 1IM2A 2VHUA 4JUCA 5LLDA 2HJHA 2PUTA 4FX2A 4G1MB 4NFHA 4KDFA 5JC1A 1ISIA 1U8TA 2VSFA 4ZCQA 1IBKB 4BEVA 1FJGB 4PZPA 1MA3A 2EKDA 2FZ5A 1IY2A 4Q3EA 4CG2A 3D7KA 2G5PA 3BT7A 1PJBA 5IM5A 1ML4A 3OLQA 4LDQA 1I36A 5DI3B 5REQB 2PUGA 4U6NA 3PV8A 3D9QX 3JQDA 1TADA 1Q1AA 3QVGA 2HDHA 4NJEB 4RQ7A 1XC7A 3G17A 1KDVA 2R6ZA 1E3SA 3D6VA 4TPKA 2R8EA 3ZS9A 1YB5A 1YU6A 1JMSA 3AEKB 3MGHA 3QGMA 3ZLUA 1JEQA 1MBZA 4IDAA 1QOZA 2OCKA 5CDFA 5AVVA 2N47A 5L95A 2ZUFA 2MSNA 5GV8A 5HPYB 4P53A 1O94C 5BN1A 4ICIA 1L6IA 4IV0A 1TAUA 3VU1A 1CD5A 1GD1O 4W1RA 1LLUA 1U5CA 2JI4A 3UAWA 4GBJA 4RORA 3E0QA 4UU8A 3L3BA 2APJA 2HK7A 2GK4A 4FE7A 5JXJA 1ZVKA 1LFDB 3I9JA 3IBFA 1U2ZA 5JG7A 5E1DA 1M1XB 3CO0S 4M9ZA 3LVBA 1RCFA 1C4XA 1E2BA 5HK8A 2VP9A 3IERA 4AW9A 2LBPA 4DAOA 1ID8A 2C97A 1Z29A 2WU3A 3BL5A 4GWGA 2BT4A 3KIPA 3N53A 1ZQBA 1X9XA 4HATA 4QWBA 3SOPA 1G9XA 1OBOA 5E7JA 4UFOA 3ZHTA 3KQHA 3I45A 3IT3A 2IHMA 1S02A 2HHTA 1J24A 4DFMA 4KNWA 4K7JA 3HK2A 4TXHA 2JJ2D 4HDSB 4IVPA 2DE0X 3HYSA 1J33A 1MA7A 1NJXA 2V7UA 1JXQA 3A7EA 1JX4A 1RMYA 3QU9A 2F9FA 4JXJA 1OZGA 2YXEA 3ESCA 1C1DB 5AK6A 2Z3VA 3FHOA 4J7AA 1QFZA 1QPBA 2GN6A 4A2CA 3WBJA 4JI7B 2MA1A 2QJOA 1OHHD 2EWMA 3FTEA 5TMDA 1VA5A 5DM70 5C0YA 3H3FA 2VJKA 2OV1A 3RU7A 5FPKA 4EYSA 4NBRA 4Q18A 1BEEA 1SIOA 4BX9A 1FA9A 3NM4A 2DPXA 4FMDB 3W5CA 1NMZA 5KG3A 1ECPA 1U3DA 3MUNA 2ZB8A 3BDIA 3HYNA 1D8BA 2JATA 4OK5A 1CQJB 2HFJA 4DT1B 5BUCA 3AEUA 5LC1A 4BNXA 1SEPA 4LY6A 3BF8A 2ECOA 4AJHA 2CJFA 5KCZA 4LOJA 3KJQA 4GYJA 3W5VA 1I01A 3VSCA 4EI2A 1OREA 3ILSA 3A1EA 5HF9A 1I4LD 2EFEB 2FWNA 2WBLC 5AW7A 3ICQB 2KIVA 2W7OA 4HEA6 1MDBA 3ZCSA 1UKVY 1XAJA 4F3CA 5AM4A 1A1VA 2BOVA 3J81k 5K2MA 4QIWC 1FSPA 2QR5A 1JDBB 2WVHA 4MINA 1TYDE 2E18A 1VCIA 1GEEA 3F2DA 4B32A 2QRJA 5DULA 2IS2A 3NTOA 1JKMA 3KB2A 3VOSA 3KSDO 4Q47A 3EULA 5JBNA 4ENTA 4PANA 4RHYA 1T9CA 2EDCA 3KVYA 1TTHA 1MPTA 2O2SA 1EUZA 1VGQA 3MMPA 3G2LA 2OOSA 1G5IA 1MU0A 1FDIA 1XMSA 4RTMA 1MO4A 4X3OA 1G55A 5LN1A 2YJNA 1ZIPA 3RASA 2Z4SA 7MHTA 5GM1A 1NJ2A 2HC9A 3DZKA 3PTZA 1K8XB 2XCAA 1U94A 5J2BA 3E0FA 3MTIA 2QP9X 3IKVA 3OCUA 2PX6A 4JCOA 3BJZA 4PWZA 1KMIY 2Y76A 2VP0A 1KFSA 3K6RA 1O9GA 4Q4CA 1VKNA 2JC3A 4AP9A 2OCPA 3DVSX 3PNVA 1Z4LA 2QNRA 3T7RA 4D4LA 3SR3A 2WTEA 4YR0A 2GPNA 3OOJA 2E6KA 4EUKA 1KKUA 3Q3CA 2UYGA 4CDMA 4MIKA 3Q98A 1NY5A 4A7PA 4IKEA 3IVCA 3DYIA 3L4SO 2MHCA 1KS9A 3BTVA 3P9CA 3Q2IA 1QSGA 4JOSA 4MGYR 4UU0A 2A67A 1XLWA 1ZOIA 1JBQA 3HA7A 4KRYA 2VJAA 2XYRA 3U7IA 1XZFA 2WZQA 4H3SA 3BMOB 4KMOA 3OM8A 2YXDA 4BO2A 3LFHA 2V55B 2MUTB 1UK7A 3HEMA 1HEUA 1RWBA 1JX6A 2ZBFA 3FLEA 3IDZA 4D5GA 1EJBA 4M47A 1JPNA 2VPWA 5BN4B 3RUPA 5E0OA 3U1TA 3ZDAA 2R4TA 9ICUA 1QLWA 5F76A 5JPIA 3E9MA 4DMLA 3HXPA 1KDOA 4IR9A 5E38A 3P20A 3VPHA 4EJ6A 4DY6A 1HRKA 3RBEA 2R97A 3OZVA 2GEJA 2QV7A 3PITA 1G98A 3ZDXB 5IT5A 2VAMA 1Z5UA 1ZQQA 1P5RA 2MSCB 2RCYA 5EXTA 4Z5XA 2YRFA 3NBUA 3M1LA 4DY4A 4YVFA 2HSWA 1RLIA 2Q6KA 3BDVA 2JJ8A 4UUAA 3ZU2A 4BCBA 5JT1A 3PIDA 2JBWA 3BWBA 1N75A 1L0BA 2O7VA 1WCLA 2JJ1A 5AYVA 3ZH2A 4K86A 1XTJA 3K9LA 4Q9AA 5JAPA 2HIMA 3OZXA 1L8XA 4LAFA 1PJLA 4YRQA 4ZT5A 5LZ8A 4BVHA 1XOIA 3TZLA 1AN0A 3I2JA 3GNQA 3I3OA 1P2GA 2D59A 3KLOA 1UDCA 2PLFA 3WWEA 5JCJD 1FS5A 1X13A 4UU1A 3ZJ4A 2F8SA 3DEFA 2KN7A 2PUAA 4LRWA 2ZRDA 3OU2A 4HL6A 4JUDX 5GTHU 1DIHA 4HNVA 3T5DA 4Z0PA 4MVJE 5H2FU 2C4HA 5DTMA 4F85A 3EVFA 1VHLA 2V4QA 2NTJA 3TSZA 1EINA 3RAJA 3RK0A 2IUYA 3TLCA 3N2KA 3BD9A 4CKZA 2NAPA 4JBGA 5F12A 3GRVA 3UNXA 4ZDWA 4N6OA 4BO8A 4YCMA 4HDCA 1OCEA 2WWYA 4Q3OA 3O9MA 5A5VA 3NOOA 6GPBA 2F8MA 1G7CA 2GEVA 2JFGA 3D6MA 3U7EB 1U0BB 1SRRA 1N2BA 2GJ4A 2VHWA 2Q6VA 8ICWA 3Q7SA 4G5FA 5EXXA 5FR1A 3WL8A 1INLA 5DYGA 4DLXA 2O7NA 4CL8A 2Y67A 4AXBA 2XGPA 1BJRE 3CSSA 5IAJA 4NL9C 3H5RA 3K16A 4LBYA 3U4HA 2B34A 3C6KA 1NW7A 1IULA 3ND9A 4IICA 3SLGA 1GAQA 3KTAA 3DM9B 4DN6A 1OHHA 4W1SA 5I8ZA 1E6UA 5FYQA 2OORC 2YH2A 3DO6A 4CETA 1QIMA 1G8MA 4G0NA 5C8YF 4LE2A 1O96B 3AIIA 4URHA 5EHQA 2CFIA 1XVVA 2X8LA 1QKJA 4KV9A 1NKVA 3MR6A 1QMGA 1ZQVA 4HEHA 4MYRA 5DHPA 3U49A 3T5AA 3NQ41 2LNDA 3TZ6A 4AJKA 1CF4A 3AETB 4N0DA 1U9CA 1N2GA 3EG5A 2XKKA 5JTTA 4H4CA 2AH5A 1X77A 5A2QA 5K0NA 4PYJA 1Y9AA 1MB4A 1WS6A 1R8JA 5ALVA 1Q6YA 4NE2A 3THSA 4EY7A 2B8NA 1QGAA 1KEKA 3GO4A 1ZNYA 1JEDA 2VI5A 3ODPA 4DMMA 3N7RC 1GRCA 3EHEA 2XCPA 4OGLA 4UC0A 4KQMA 2CLKB 4CNBA 4OGWA 4YWHA 3S7ZA 1NW5A 1TKRA 1KI1A 1B7GO 2PR2A 1Z16A 2QTVB 4Y1EA 3SE7A 3K75D 5EUCA 4XLZA 4IDNA 5IFLA 1B6SA 4TGLA 2LKYA 3CEAA 4F60A 2IY8A 3FAKA 3UCFA 4DQLA 3QEMB 1FVOA 1PK8A 2E89A 1EDDA 4QGHA 4RMJA 2HAEA 3MIZA 3UGKA 1T2EA 1Z7WA 3ESDA 3UK1A 2GRUA 3SCZA 5HBGA 2FOLA 4C76A 3IL2A 3DEKA 2J6BA 3HQ4O 4D9GA 2ZBEA 1NBOA 2I4MA 2OZPA 4CMAA 4M1TA 1UAYA 3JTMA 4NYIQ 3IAM1 1COOA 4WFKA 5KJFA 1KP2A 4DILA 1TW3A 2ROQA 2BI7A 2W03A 4O0MA 4B5KA 2GHTA 2WUFA 3OQHA 2PVSA 2ZOSA 2LM1A 2EJBA 2ZWPA 3AWIA 4NE7A 4P7KA 4Q1AA 4ZGBA 1R0ZA 5CLFA 1OH5A 2IMWP 2PGDA 2DHCA 1G8HA 5KFJA 2M1XA 2WD9A 1OAOA 2X1HA 3KHHA 3OBIA 5D5HA 1TI7A 2QVCA 4UDXX 2QKYA 3DT9A 1NQVA 2YWFA 4MR7A 4Q7MB 4E33A 4BE4A 3BHNA 1K7YA 3C2QA 3LHSA 1QZUA 2RGEA 4D4KA 1SR8A 1I0ZA 4LZGA 1MFZA 1NXTA 4H17A 1XRQA 3A1CA 2YYAA 4P84A 5EYPA 5F2OA 1VMKA 3ICWA 1JFFA 1S0UA 1D4AA 3ZQUA 1J0BA 3ENNA 4MRRA 3BXZA 3R0JA 1CY1A 2HF9A 1G59A 2C9YA 1P3DA 3FYDA 3QELB 3QK7A 2IF0A 2HDNB 1YAHA 3ZQ4A 5CDSA 2H7XA 4U7DA 4CU2A 3UTDA 4KLDA 3ZY4A 5T8KA 1W9HA 5A1TA 1J2YA 3L7LA 1U7UA 5FBLB 1QIJA 4BFUA 4BNNA 2FZ4A 2AF4C 2QUJA 3AZOA 4E31A 4MJXA 1V47A 4GPZA 1FSGA 3QPDA 4PF1A 3EZYA 3ANTA 5JW6A 1ATZA 2E49A 7ICEA 3IOEA 1PZEA 3UM9A 4C4ZA 3NDPA 1UQUA 1UCVA 1R6VA 3IIKA 3PQDA 4AS1A 1K8QA 3KSMA 3X1YA 2C82A 3IX7A 4ILKA 3SEAA 4MYUA 4G85A 1KQGA 1VB3A 2N1RA 4Q8FA 1GGNA 1QH0A 1ZGBA 1E6KA 5CVCA 5JJBA 1DI0A 3K09A 3PJEA 3OCCA 4JOQA 3W1VA 2I67A 2ILVA 1IZZA 3FZGA 3A06A 1GUDA 1C7QA 2JGMA 4PZOA 2NO5A 3V7JA 2P6RA 1U1FA 2AWOA 3BWXA 3IVRA 3U40A 3ZJYA 4X0EA 3HC7A 1Q15A 3OZCA 4KFSA 2OCBA 2IPMA 4PSAA 3WLPA 4D25A 4Q4JA 3GT3A 4NONA 1E3WB 4TXMA 3GXOA 4MW4A 5G5HA 2WYWA 3C3MA 1OYOA 1VL6A 3DZIA 4EA7A 4OEHA 4XEHA 1J0DA 3HP7A 2RHFA 1RM3A 3SJUA 3C43A 4B6QA 2C98A 4YCLA 2NYRA 4PFSA 1EUDB 2C31A 3OUZA 1VJ5A 4U2CA 3LCCA 4H0NA 1GZ5A 1XRJA 3HRIA 3O9VA 1C41A 4HNQA 1D03A 5B3JC 1RZRA 4ZQIA 3T5GA 2W9BB 1TZCA 1S0NA 2E87A 2IRWA 2XEDA 4PEVA 3WGQA 5FHRA 4E03A 2EU8A 2HBZA 3H83A 1F0KA 5JZ9A 3BD7A 1GZUA 3NOQA 4JQOA 1OBCA 1BWQA 4P34A 4ZVSA 4KQGA 3DDOA 3LK6A 4US1R 3AVXA 3T7SA 4QOGA 5KDLA 4YMGA 4QATA 5IVHA 3SKYA 1A7KA 2AHOB 2E1EA 1FZTA 3W2HA 1ADBA 4IHKA 2HQBA 4CIYA 3U3DA 2PYIA 3M9OB 4QPZA 2QVGA 3LF1A 1E2LA 3K94A 4DA6A 2WYIA 3RYHB 1XAIA 3J80A 2IKQA 1CRPA 2YUIA 2OBFA 4WZAB 1F48A 3UCEA 3ZV5A 3KEMA 4AZVA 1EQUA 3KAQA 4QJ4A 2QMHA 4CM1A 3KQVA 2ODTX 4CIAA 5EE9A 1ZQDA 4OUKX 4YLGA 2JZCA 5B1SA 4DYVA 2Q3EA 5ELLA 5EQFA 3B6KA 2O8FA 1CDOA 2H2WA 3CWCA 4X61A 5ANRB 3TNYA 3GJ0A 3QVSA 4BNTA 5B5SA 1GPJA 2PL5A 3L7YA 2VPYA 2YHAA 3R7AA 3VSDA 4CQLA 4YR9A 4PIPA 2ALZA 1WL8A 3JVDA 3Q7RA 4OJ5A 3INGA 3IVXA 4G86A 3RUCA 3WGNA 2VJ5A 4A0FA 1X9IA 4HWOA 4IOJA 5J4VA 1SAYA 1IDOA 3NVMB 4RY2A 1RLTA 4XXHA 3AXSA 2EERA 3LUBA 4YT4A 3R2JA 2P7IA 3IP6A 2ZJ3A 1J4AA 3OZ7A 4QRHA 3ADCA 3U4QB 3NFRA 4F91B 1FX0B 3VPAA 3SEZA 4BECA 4DIEA 1CJMA 2FZCA 3UJ3X 1E32A 4KQCA 3ZGYA 2J07A 5CVJA 3N97B 4B9LA 2ZRFA 2ZYUX 1K3UB 4JELA 1TMGE 3IP8A 4HR7A 1ZUD1 5JD4A 1BX0A 2BHSA 3ZCTA 1Z4JA 3Q88A 1ZD2P 2JFFA 2WZDA 4J2TA 5EEGA 4IDOA 1SBHA 3BRCA 4CDNA 4EYIB 5CU7A 3HDGA 1KDZA 4AN0A 3H9BA 1NWCA 4NARA 4AP6A 1N48A 1DKUA 2A92A 1JSZA 2FEWB 3EMVA 1Z3CA 3ID6C 3KX2A 3MOGA 4W5JA 3JYPA 5A4KA 4PQFA 3K31A 4MTLA 4GOOD 2YW9A 1ZG3A 4YXJA 5FOSA 4AMZA 2J5RA 2J45A 2BW0A 1R6UA 1RC8A 2D6FC 1FMTA 4D41A 2I7XA 3GNLA 3PTAA 4IIHA 2NRXA 1CG6A 2FCAA 3EWIA 4TWIA 3JWGA 3P19A 3U4QA 2QX7A 1S3FA 4G4GA 3Q12A 5JRDS 3ASUA 1PNVA 2WIGA 2YJ5A 1P2SA 4IDEA 3VX3A 2R7KA 3WMXA 3C23A 5J47A 4UUBA 2H85A 1Z39A 3FRIA 4Y2HA 2AQIA 1KI2A 1C50A 1YE3A 1GRVA 3UICA 2YIVX 1E3JA 2KMLA 3OSZA 4QQRA 3N7AA 5C8XA 1T5IA 1EMDA 1TK0A 4GXKA 1YB1A 3ACCA 4J2HA 3EJ6A 1L4YA 3AC0A 1UC9A 4P7FA 4Z2YA 3SE0A 3AQIA 3AY0A 2NV3A 1WDKA 2V7QA 3N2GA 1Y9DA 3DL4A 4IKOA 3ECSA 2G6BA 4R31A 4UVIA 2HK9A 4JI2B 4D6YA 3KFLA 2P5UA 1TEVA 4MEYA 3FWNA 1SKMA 3H8JA 1CUKA 5KTQA 3QEAZ 2A5LA 4CG0A 5K8IA 4CMCA 2HIAA 4IYJA 1UODA 5IWAB 1CUSA 1FU4A 3O4FA 3QXHA 1YT3A 5EGNA 4O25A 1LTQA 1WUHS 2CC2A 4LMPA 1MX1A 1L4MA 1V3TA 2RHJA 5HE9A 4N82A 5IFKA 1GPUA 3PNMA 3THXB 4TRJA 1J2TA 4F4HA 2O54A 2J09A 3FROA 2J46A 4KLEA 1WSWA 4LRSB 1WCYA 4O63O 1M2GA 3L0DA 3BRSA 4NMMA 3X43A 4OD0A 2NV2B 3BXPA 4HP8A 3HKZF 3NU1A 3PUYA 3E2IA 4E13A 5JR3A 5MFZA 3UG7A 2JJYA 1VL0A 2ZYIA 3GUCA 3KOMA 4EPXA 4XRGA 1GKKA 5JMWA 4LF5B 5IYZB 4N7MA 1Z8NA 1SUFA 2YBEA 5J9FA 1NURA 3IPYA 3PGJA 1KAOA 3HFJA 3OHSX 1UM9B 3KUXA 2I4LA 4HQNA 4PGFA 2JEFA 3K0FB 4DUYB 3RGWS 3UGTA 1XRPA 2FSPA 2VYNA 5BOMA 3EYWA 4FNGA 1JIXA 2A9PA 2LCIA 3KJXA 1TVMA 2AUTA 3UG6A 1WP4A 5CNMA 5JECA 3B1YA 1ZSVA 2EZTA 4NLGA 3B3AA 3BKWA 3ELBA 3JYLA 3UJPA 4JGGA 2CW5A 3HZHA 3FTDA 1HG0A 2A7QA 3WYEA 1W76A 4AYBF 4FS3A 1HUZA 3ABZA 4PN7A 1WU8A 3OPYI 4G81A 1L4KA 3OZIA 4UHKA 4W9RA 1TXGA 4I9NA 4YRLA 4CLDA 5KT7A 2JFZA 1U8FO 5FCDA 3EXIB 2RGXA 3GT4A 1ZMRA 1Q3KA 3S4YA 1BRTA 1YCGA 2IPAB 4WCFB 3KQUA 3EUEA 4DMGA 4L4ZA 4C4TA 4NV0A 2OHFA 1ZVMA 4Q01A 4MYHA 1XXHE 3UTCA 1RQPA 1PS9A 1FP4B 1YB4A 1NJFA 1P60A 2FMUA 3DUFA 3GNSA 3Q41A 1ETHA 5I01A 3W8EA 2GKGA 2P66A 2KOBA 4C7MA 4WNAB 5AJWA 2CL6X 4BQIA 2EBHX 3EGIA 5COQA 1PL8A 1QZXA 4DOMA 3WMFA 4Q9KA 3VVCA 9ICIA 5KSYA 1U5AA 1NYQA 5KFWA 1OLXB 2AZDA 3K09C 2C5LA 5EMMA 1VLMA 2EZXA 2O52A 4MKIA 4XWOA 4FZNA 3O4GA 3RUFA 1D4OA 1RAHA 1KYWA 2HBJA 3GEIA 3CZRA 4PXAA 3CWZA 3OZGA 4YRKA 5IXJA 2FMXA 4EMUA 3U44B 5GJBA 1E3TA 3A2MA 1NA5A 1BPBA 1QV7A 4IZ6A 2X5JO 3IGFA 5DKFA 1CVRA 1CJBA 3QKRA 2AFHE 1YL7A 2C92A 2XMRA 3AKYA 4O2AA 1XD2B 4Q3AA 3UJHA 4C1NA 2XYPA 5K9ZA 1EFPB 4EY6A 2C88A 4UAWA 5CR9A 2TS1A 4QYWA 1U4BA 1T9KA 3DZBA 3O73A 3B6JA 3ZU5A 2GCNA 1BXZA 4AJOA 3VR4H 3G2OA 3H5WA 2G9VA 3JRNA 2ERCA 5AIAA 3LAWA 1E3MA 1NATA 3W04A 3ZDYB 1LC3A 2QTRA 4HLUA 5ENDA 1AX9A 3Q4GA 5J2CA 4WXYB 1R0CA 5JRTA 2X5XA 2DBRA 3RSFA 4CMHA 2GZ1A 1HR0B 3TPZA 2O3TA 1MOQA 2WYOA 3MWEA 4AN1A 3UQYS 2DPHA 4QDZA 2BCVA 1NBMA 2DWOA 2ORWA 1JEJA 4NK5A 1WBDA 4PLTA 5HKKA 4PH5A 4OSEA 4KHPB 2WTMA 4JJEA 2BFEA 2YHUA 1GVNB 1P5JA 1PHPA 4YD1A 3RADC 1T9GS 2GTPA 4K2HA 5IM4F 2Q8NA 1IEWA 4B4UA 4KX5A 1TJ4A 1L3BA 4G26A 2YMQA 1TFUA 4XWTA 2ODEA 3OQBA 4R81A 3JSXA 2A5GA 2YJTD 1BYUA 3AUUA 3OOHA 4UZEA 3ROXA 2ACEA 2WP0A 4QTUB 1GKLA 3VSEA 4E12A 2E21A 4PZEA 4DV2B 3NRZA 1LWNA 3OSUA 4UM8B 5JMPA 1DC7A 1I1NA 2GK3A 1WD7A 2XR1A 3BD8A 3JX9A 3IULA 2BCRA 3OHMA 3ZYCA 2FMSA 2R7LA 1I9CA 1OI3A 3LGXA 2V96A 3NV7A 4PSDA 3EXEA 2NUTA 3SU8A 1MOPA 3TSAA 3E3NA 1QVAA 1WY7A 4BDTA 4BX0A 4YAIA 5AOVA 5A05A 4OF4A 2XF8A 1O3YA 4YP7A 4W5RA 5K8TA 4AJJA 4LZDA 2MJLA 3HGQA 1FYXA 1C1XB 2G06A 1I6WA 4PIVA 1R50A 1US8B 4YFVA 2Q2VA 5KPJA 3NCHA 4JP2A 2FMKA 1OWPA 3OLZA 5EQTA 5KFYA 2R8XA 3WDSA 1KFDA 1AUXA 3CKYA 1XA0A 4OKIA 3GLHE 2C22A 1NBMD 3L0PA 2IYAA 4F2SA 1XTKA 4AJNA 4QG7A 3AL3A 1OYWA 3C6YA 2ZKIA 3ZBQA 1EWRA 1R3UA 3LD9A 5E8JA 5F5XA 1KEUA 3LGAA 4ZMBA 2ZJ1A 2J0UB 3OQIB 3QPBA 4B3HA 3REGA 1ISHA 2H54A 3UC9A 4AFNA 5CW2A 4UE2A 3BCHA 3TLEA 4FCWA 4DJAA 4AKSA 5HR7A 2VNSA 3IEKA 3P0HA 1RRGA 1MIOB 4ZI2A 3TZCA 5EP4A 5HILA 4EJFA 4LYYA 5TS2A 4PPNA 1QH1B 2MOKA 1OMOA 5IUJC 4I14A 2YINC 3WK9A 1X19A 2IYXA 3KTOA 2FW7A 3VC8A 1OY1A 2O8VA 4WBNA 3HM9A 4BAGA 2BCUA 5F5LA 4H59A 1RXYA 1ADGA 2WABA 3P9KA 2GNPA 4HX5A 1PR9A 3PK0A 4CV2A 1QIGA 2B20A 3DMGA 3AL2A 3OKAA 5BSHA 4CF7A 2I6QA 4KIUA 3MFIA 3VSAA 3AO0B 1M8FA 2ZYGA 4GM1A 4EO9A 5HHTA 2RKWA 2XITA 4U7HA 3ZHUA 2G70A 3GRFA 3KEOA 5I9NA 1H2ZA 1OGJA 3GCXA 4R1QA 4NZNA 1KZ9A 4IXTA 2WUDA 1NV8A 3CA8A 1RJGA 4NPHA 4A1FA 1SUWA 2Y1KA 3GLTA 1YZHA 5M29A 2Z2XA 2ZUUA 1SK9A 2YY6A 3CCBA 2Y1XA 3EGWA 5I7WA 1S96A 4MB6A 4ARZB 2A9FA 1L7QA 3AVOA 5FBQB 2ZT6A 3RUDA 2HEGA 2RGUA 4WE3A 1CULC 3IE0A 3NRCA 4IRUB 2PFQA 1N57A 2VL7A 3L05A 4MWCA 4O59O 4AIRA 4B3XA 3LKVA 4TZKA 1PEKE 1GZDA 2V45A 4JX8A 1XSEA 1Z22A 2EZ8A 2ORYA 2JJ1D 1KBOA 3LC2O 3MHPA 4JC0A 4A2WA 3LIIA 4Z7JA 5EINA 1CTQA 3E3LA 1A8SA 2AYYA 1Y5MA 3FY4A 1V7QA 1WF6A 2PMBA 1VPDA 3FKSA 1NJ6A 3UH0A 5KFSA 4PO1A 2GK6A 5B7PA 4G4IA 2NVUA 4ZJZA 5L3QB 3O1JC 1ZH0A 3W5AA 5DW0A 1X1BA 2FPIA 2WSBA 1N1EA 1KQOA 3UW1A 3I62A 5I7EA 2IYNA 4LFBB 3I5YA 2CJPA 3IAXA 1AVTA 4A8HA 5LQNA 2WG2A 2D00A 2QD1A 3IJPA 1C5KA 4WINA 1JHOA 3GFPA 4R69A 4RXTA 3SAGA 2CXTA 1KQ3A 2O5CA 1D1QA 4P35A 4FFMA 4N18A 5CH3A 4HGPA 4YH1A 2CXSA 3VNUA 3FPHA 1UC4B 5AW6A 2Q5JA 3HRKA 4NMXB 1W7AA 2V6FA 2D3DA 1JSRA 2D5BA 1K75A 3UUFA 2EAMA 1K6JA 3AR4A 3WU2U 1ZESA 1ZQHA 1OFGA 2DRIA 4NCIA 3WFIA 1YXMA 2GPSA 2IHKA 4W5OA 5F3XB 1S3IA 2QAJA 4H0CA 4ZCLA 4E11A 4LHYA 3E8MA 4NL4H 2ENWA 2X6RA 1I7SB 4G0WA 3EFOB 1RKBA 1OXKB 3FRJA 1M1NA 2GJAA 2YN4A 2OAEA 3LT5A 4X1IB 5YASA 3UOAB 1ZQJA 1TIPA 5AHRA 1U3TA 4JB0A 1B00A 4Z7NB 2Q5IA 4JUAA 2GLXA 4ZAGA 2HT1A 2NTEA 1WTAA 5EJGA 3U6KA 3MUEA 3RE1A 9LDTA 1SKSA 3ZY3A 2WKPA 3MTGA 5DCWA 3E9EA 5KSPA 2DFDA 2W9AA 3F9CA 4Q9IA 2X15A 4EG3A 1KWKA 5EWLB 3O2QB 1COWA 4M6WB 1KXZA 3IXMA 2DLCX 4QFBA 2DHQA 5BSUA 2D8MA 4UHBA 3B2NA 5HNKA 3I1JA 1M74A 4HLQB 2O2YA 4RDCA 2BDUA 5CH8A 1X87A 3RJMA 5DNAA 7ICNA 3D0QA 3PNPA 1RWMA 1TJYA 2RHRA 2H00A 4MGZR 2CK3D 1GPNA 1VDVA 1JTFA 5F2NA 1RE0A 4QLAA 3N5CA 2MTBA 4LZPA 1YNOA 4M7RA 5IEJA 1PWZA 4U1RA 4A15A 1LSUA 2P4EA 3HSYA 4B6PA 5E95A 5EHIA 3IEXA 3QUBA 1X80A 3ND5A 4ZODA 1W5FA 4X1YB 3RREA 3CVXA 2PX4A 2BC9A 2VCYA 3HSKA 2JI8A 3AHGA 3BXOA 2QN7A 1SKBA 3E4CA 2L5YA 5C34B 2VHZA 3R7WA 4E2ZA 2ZVPX 4KQHA 5KFOA 3RF6A 3PF9A 4CM5A 1VPLA 1WPQA 2PLWA 1FP6A 3QMPA 4K3UA 4QZHA 4F4DA 2DCMA 4P4LA 1FYEA 4AD8A 1IBLB 4IEEA 3KHUA 4MLCA 1CEEA 4NBVA 4NZ9A 2QY6A 1A6SA 1JL3A 1L5MA 1PFVA 2O48X 3T5MA 1D1SA 1XTBA 5JJKA 3KRTA 4NG4A 1IBCA 4V0RA 4BVKA 2ZWIA 3U16A 1O54A 5L3SB 1QHNA 2WF5A 1LDMA 4P0PA 4ECUA 3GQCA 1RI4A 3D7SA 3NLLA 2PZMA 4QUHA 3EIXA 3A31A 3GMDA 4WOKA 4X45A 3UMJA 3ONEA 3BQ2A 5BWNA 5EJ4A 4KN5A 1VRVA 5LM3A 3V32A 3MMNA 1RYHA 5K0CA 3C24A 1TUEA 1CZNA 1BPZA 3NKVA 1LLCA 2D5CA 2EAUA 1RS0A 3DLCA 3F49S 3MBOA 4IWNA 3SP1A 3MRTA 3VZRA 1PRYA 1Y34E 2CBGA 1U0JA 2DQKA 5LJLA 3ZWKA 1N5MA 4KXLA 4LY9A 5ED0A 3A4LA 4HYTA 4P7JA 4E4YA 1Y8ZA 2A1JB 1G20A 3I0MA 5K3AA 5IULC 1QAMA 3L6RA 1KZ6A 3OVMA 3P4YA 4FIZA 4YB8A 5DP2A 4DPLA 4F4JA 3H9QA 1QRAA 3TLAA 1JFTA 1R0SA 3SIPA 7ICGA 1CJVC 2PNJA 5AOBA 3KAJA 1NBIA 1UJ6A 4Y1GA 3RJZA 2I1VB 1HT2E 3W9SA 5GADl 4JB2A 2WWIA 4O3QA 5LKRA 1E18A 5DXAA 1ZS9A 3NAQA 1AK1A 3PE3A 3RPEA 2WT9A 3C39A 4BMCA 5B7GA 3MBYA 3MWDA 5AVUA 5ALJA 2VEDA 3UPUA 4C30A 3LT4A 4M53A 3TD2A 2NO4A 1R64A 3OH8A 4A6DA 4BMYA 4QZ8A 3CCFA 5IKOA 1NJYA 2UVDA 5J5AA 1RYYA 1UIRA 4NP6A 4LZNA 1LDEA 1EB8A 5FUQA 2FLKA 1P4SA 5FBZA 1T34A 3X1XA 4WD3A 4FTWA 5JANA 2H3HA 2QP3A 3O9ZA 4Z4IA 2BMJA 1BO6A 1NLYA 4AX4A 1EZ4A 4DA0A 5A5DA 4HUTA 3A70A 4LJRA 1MXHA 2IH5A 4D4MA 3PW7A 3MDAA 3CB4A 2RK6A 4J0IA 5JUMA 2HGSA 1HE2A 3P0EA 4G5YA 3QZ7A 4YJ2A 3IAUA 1Z00A 3P9RA 3AINA 4NS1A 2WWGA 4HGRA 1DDIA 2YYZA 4KNVA 4FFDA 1JUDA 1FNNA 1RMTA 1I24A 1TZMA 4FOTA 3AP1A 3OY7A 4MKXA 3TANA 3SY8A 3L7IA 4F5ZA 2JHAA 4YXWD 2W6MA 4MKZA 1OV6A 2EBFX 2KKPA 2QJRA 3FHJA 3K73O 4RF2A 3JPSA 3D3WA 4CWAA 3C8HA 3Q3IA 6REQB 4D1YA 4RY0A 3B60A 1VZ2A 3E9NA 2A9OA 1W85A 2I1LA 4C9BA 2VA8A 3EQ2A 2QQ0A 1RC1A 1V1MA 1WIWA 2BQ3A 2IQIA 5KHLB 1KFTA 1IG0A 1M6HA 3LT0A 3PFCA 4XWYA 1RCUA 1LC0A 3NUQA 2CLMB 2FRDA 2N42A 4JJ7A 1KDTA 2W7PA 4MB2A 5L6LB 4H1WA 3AERA 4BLSA 4EPRA 3C4QA 3F8SA 4Q7LA 4MUXA 3K5WA 3OCXA 3INYA 3OJEA 1VIDA 1QCCA 3OF3A 3QTLA 3WGOA 5BV0A 3HLKA 3WGHA 2P1ZA 3ZG6A 3JPYA 5HG0A 1E96A 3L1UA 5TEVA 2X8JB 5H59A 1R4MB 1W34A 2XKAA 2ZRJA 3H2KA 5TPZA 2KFZA 2DCUA 1PUZA 1W94A 3AWDA 1JU3A 1R6TA 3BH0A 3LKZA 4NV1A 1I8TA 3D8BA 1KU6A 2DKOA 1CDEA 2NZWA 4BKRA 2ZWOA 2O2XA 3D59A 3VPFA 4IH1A 4MUIA 2FSVC 3CZ4A 5K51A 4DARA 4DWJA 4IS2A 2JZBA 4GWLA 1HE3A 4OJQA 4U2BA 5AM5A 2F44A 3YASA 4ZT2A 1B4FA 4QYTA 4J0EA 5JSZB 1OX5A 4E5UA 2BVNA 1P2DA 3DAOA 2KI5A 3L49A 4LGMA 4N01A 4Z9YA 2QXTA 1L6RA 5DGBA 3OFVA 1JHYA 1XK6A 5AI8A 3T3HA 1R7RA 3U4MA 2HWYA 3ZVLA 2X41A 3FOBA 3BA6A 2AOTA 5CXSA 1XGKA 2QBYB 3STWA 2QRVA 2MYTA 3WLQA 2BEUB 4MIEA 1KP3A 1PFKA 4UJ3A 4ASUA 4D98A 3UMYA 3SMQA 3O1HB 2GMWA 3W7AA 2AG0A 5IIMA 4GLLA 5JISA 4ELVA 1RHMA 2IU3A 4DDTA 4NOJA 4MEAA 4PV7A 2XJ4A 4RPJA 1B0AA 4ZGGA 3GUVA 1NFFA 2P62A 1RXWA 4D5EA 2N9UA 4B46A 5ILQA 5DWDA 2PX0A 4FBLA 1BS1A 2W2PA 3VU0A 4EBEA 5TS3A 3VM6A 1DJMA 1A2BA 3C74A 2W90A 1NLZA 2R7NA 4YWJA 3GPIA 4Z3DA 4IFIA 3H40A 5KEIA 3ROEA 1DC3A 3VHLB 4YD2A 2WJGA 3EIQA 2CDCA 4WW0A 4R66A 1Z0JA 3ZCPA 3KVNA 4JASB 2C2KA 3CC8A 1I2ZA 1CJUC 3CUKA 3ICOA 1ZNQO 3GG9A 5EWJB 2R8ZA 3BCRA 2GVNA 4YPFA 2H06A 3AERB 2Q3LA 4L7QA 5DLPA 2I6GA 4OHVA 3UBMA 3ZK9A 2VP3A 3CLKA 2X0KA 2BCEA 1BXGA 1D5WA 1E4EA 4EBDA 1SOMA 2I3GA 2PT7A 3D7RA 4FW8A 1XQXA 4J16C 2I4OA 4YCJA 1CZKA 3EJWA 4WBXC 4L3VA 3UV7A 5J2KA 1RYFA 2E1PA 2JAHA 4OUDB 3RS4A 5C81A 1SOAA 5EE0A 2WWXA 4TKUA 5A03A 5H8WA 4JV0A 4O4HB 1FDSA 2EEZA 4FP9A 4YRFA 4OX9B 3SXPA 3TADA 5CEHA 1JV2B 3G2PA 1JYSA 4FXOA 4TRRA 4X5OA 5IEBA 2VRBA 4KQIA 4TTAA 4QW9A 2OV3A 5LQCA 3HT3A 1M6VB 4LQ4A 4MOWA 3JPRA 5FUVA 1KH3A 1JA9A 2GNOA 4TV8F 2ZGVA 2E37A 2GFIA 1Q7RA 5CG1A 5ALWA 1OROA 2B6GA 3R5TA 5JU5A 2ATVA 2QT0A 4TKLA 5BNFA 2VC2B 3FN4A 3AN1A 4M83A 3LBNA 4RXMA 4XI9A 4D9EA 3PUXA 1SBYA 1OU0A 1VIMA 3JCZA 1IE3A 5CD9A 3P8ZA 1Z63A 5EE1A 1HURA 4MHTA 4NLLA 3ABRB 1UMKA 2V7EA 4DCPA 5BV1A 4S1PA 1ZCFA 2BWJA 1D9ZA 5KBYA 1BJKA 1JTEA 2II6A 1EJ0A 2C2YA 2LCFA 2R5WA 4Q3CA 3WZ2A 1M1YB 4QOSA 1OT3A 3MGAA 4CJXA 4CM8A 1G3MA 3TLJA 4BO9A 3GGJA 4D8TA 3KELA 1YFZA 4IM7A 3TVTA 1U9YA 2CXHA 4HDRA 4QQ8A 2NU8B 2KHZA 4G41A 9ICGA 3P2YA 3TOZA 5BVGA 3EUWA 4O4JA 2RHOA 1V1JA 4U7PB 5FV7A 2G82A 2CMGA 4ZV9A 1MVNA 4DR7B 4M87A 2XVYA 1XEXA 4ED6A 4Q8EA 2ECFA 3E9RA 3KLMX 1COKA 3T0GA 3WNDA 1V5EA 4MUJA 1E69A 2Y71A 3ZVRA 4ZVLA 5K3CA 4AJ1A 3BULA 4CT0A 5IYZA 4KR6A 2IF2A 2Y93A 4WI1A 3EPJA 3SC3A 1YUMA 5BWBA 3B7GA 1P91A 2YN2A 1KZYC 5JCJA 4CKWB 5AK4A 2IUSA 1QGUA 2Q7XA 3OEHA 4QJBA 3A3PA 2RGNC 4IJUA 4PSKA 5B53A 3ZW7A 5KOJB 1J7KA 1M1ZA 3CB2A 4IXMA 5F7XA 4BYGA 3A2KA 2VTBA 1S3SA 4J9OA 3QITA 4J7XA 1AA9A 1T5OA 2QM8A 2C9CA 2H7VA 3MA0A 4U2DA 1RBMA 4TRNA 3D3WB 5KFTA 4H1TA 1I7NA 5I7VA 1CUBA 4RD1A 2HYDA 2G1JA 4KLNA 3SIWA 3X1MA 2LGJA 2HK8A 3RIGA 1M54A 2UYOA 3IDWA 1GZ4A 2NV6A 9ICSA 2YXPX 3PSHA 5EC8A 4PL1A 1MVLA 2DFVA 2WYHA 5ILGA 3V8PA 4C0LA 1Z3EB 2AWNA 4JI0B 1YOBA 2PIAA 4AKHA 1DJNA 1HZZA 2IELA 3JD4A 5E9WA 3OJFA 5ARCA 1JFRA 3CGGA 3EOZA 1P6XA 1PK9A 2AN1A 3SKXA 4ESEA 5EVCA 4BX8A 2AXEA 2Y66A 4QIHA 1AUVA 1VBKA 4LUCA 1Z25A 1DKOA 4X6LA 5C52B 4ZOLA 2AUMA 3OE4A 1KHHA 5KYNA 2AN5A 1DBRA 3OQIA 1VG8A 5CIYA 2JKYA 3G3EA 4M1OA 1J97A 2JBAB 3KU4A 1AHHA 1F51E 2QB0B 3K3PA 4L0DA 1KO7A 4PG6A 2DUUA 1ZQCA 3IIMA 4MARA 1QYRA 3RYIB 2X14A 4US0R 3L8DA 4PPGA 3C1AA 1RJEA 1BNCA 3HNRA 4JJFA 3BERA 4L9AA 5DBIA 3UMFA 1DJPA 3K1JA 1YR9A 1HFWA 2QRLA 2VQ3A 2WLSA 3M8SA 1SZDA 4FR5A 4Y2VA 2D2FA 3ZOZA 2WFZA 4ND3A 3VTZA 2HCFA 3F1LA 3UPDA 3KB8A 3L6BA 1GY8A 6PFKA 3GR6A 1SXIA 2B3TA 2KB0A 3KOYA 4R1LA 2N46A 2BP7A 3FZEA 2XYVA 2Y3IA 1A5ZA 2GZDA 4WMLA 1IVSA 4BXOB 1IBMB 3SHFA 3CNHA 1X40A 1FK8A 4C8OA 2NTVA 3A1WA 3E0XA 4GM4A 4NQZA 3CLRC 2ORIA 3FIUA 1P45A 4OJKA 1XZPA 2P2ZA 4G97A 5JAOA 5FBHA 8ICVA 3PZBA 4IX9A 4TL9A 4OI0A 1UIMA 1NOKA 1YVEI 3CBGA 3DC7A 4B40A 5KKAA 1UEJA 4WXPA 3WKAA 5KNLA 1EFCA 3WRWA 8ICOA 2Y1LA 1XU7A 3KFVA 4FJ1A 4UAZA 1CVLA 5BV2P 3GPDG 4RA9A 2WINI 2PGNA 1LWOA 2Q1WA 2VDKB 1H4TA 1DQRA 2PS3A 2PSFA 4FKZA 5AQ1A 3MMZA 1GNQA 4EMBA 1C7ZA 4YRPA 3ZKWB 3GPLA 4KLUA 1DOZA 1XYVA 4EHJA 1G7TA 4ZEWA 4CTKA 2OBXA 4FLFA 4MJ3A 1KMHA 4ZI7B 3QJGA 2JK1A 5AW9A 3RHFA 3LUGA 4G8JA 1CE8B 2HA5A 3GFFA 3GGCA 2AFRA 4NNOA 3TOCA 4A8JB 2ZTUA 3B3JA 1QVVA 4K6GA 1RDFA 2C3YA 4AKTA 1IUNA 2WB4A 1LSJA 1V26A 3BSWA 1LNSA 3JPPA 1GHTA 4X91A 5EIBC 5HIJA 3AFHA 3T34A 4UQLA