2YMMA

Sulfate bound l-haloacid dehalogenase from a rhodobacteraceae family bacterium
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
225
structure length
225
Chain Sequence
SGILVFDVNETLLDLTSLSPLFERVFGDAKVLREWFPELILYSQTLTLTGLYRPFGEIAAAVFEMVAANHQAKVTPDDIAELKTRLTSMPAYPDVAPALTRLQDAGFRLVTLTNSAPSPAPSPLEKAGIASFFEAHLTVHSSQRFKPHPSVYDSTAETLGAKPEELCMIACHIWDTIGAQARGWRGGFVARPHNTPLTLAEVPQPDFIGRDMGELADQLIASLTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Marine Rhodobacteraceae L-Haloacid Dehalogenase Contains a Novel His/Glu Dyad that Could Activate the Catalytic Water.
pubmed doi rcsb
source organism Rhodobacteraceae
molecule tags Hydrolase
molecule keywords L-HALOACID DEHALOGENASE
total genus 92
structure length 225
sequence length 225
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2ymmA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2ymmA01
2YY6A 3UMCA 2D2VA 2I33A 1O08A 3QUQA 2IYEA 2ODAA 3PGVA 1RLTA 1Z4NA 2NO5A 3A3YA 1N8NA 3DV9A 4CF5A 3FM9A 4L6CA 3QU7A 2RAVA 1S2OA 3U13A 4YCMA 5AM2A 4BNDA 4J2TA 1RMYA 4ZEVA 1ZD4A 2YMPA 3EF0A 2HDOA 5AI4A 5ALJA 1QH9A 2YJ5A 2X4DA 4BKMA 3QU4A 1RC8A 3UM9A 2BDEA 3KZXA 4BEVA 5AM4A 3IRUA 3NASA 3M1YA 2AMYA 1RRCA 3RFUA 1CQZA 4FYPA 5AM3A 2B8EA 1NRWA 3L8HA 3QXGA 4EEKA 2QYHA 1RQNA 3CNHA 3MC1A 3WK4A 1L7OA 5FP0A 4ZEWA 4Y2XA 1U2TA 3E81A 5AKHA 2PR7A 1RKUA 4HYTA 1TA0A 4YGYA 1U7PA 3HLTA 2I55A 4BX2A 3PCTA 1J97A 2QLTA 2AUTA 2MSNA 5AKZA 5AVWA 4I9FA 5AKGA 4UMVA 3ESRA 2OBBA 2R8EA 3L1VA 3DAOA 4OHFA 5AVRA 1Z4QA 3L1UA 5AKXA 1JUDA 1WVIA 2FPWA 3L0CA 3B9RA 3F9RA 4KNWA 2HF7A 2ZOSA 4CF3A 3WK7A 3OCWA 2W4MA 5ALQA 5IS2A 4BX3A 3QU5A 4Y2UA 3KBBA 4JB3A 3E84A 5AVVA 3L8FA 5AKLA 3KD3A 3D6JA 4DW8A 1T5TA 3J7TA 1YJ5A 2JAOA 2MU2A 3ZX4A 5AK5A 4YIKA 2G0AA 3AR2A 3U19A 3R09A 1RMQA 5AI9A 5AESA 2RARA 2HSZA 2IOFA 1RKVA 2O9JA 1T5SA 1Z5GA 3PDWA 5ALMA 3PGLA 4G63A 4B6JA 2FPRA 1CR6A 4HGRA 2PKEA 3QYPA 3FPBA 2FDRA 2G08A 1S8OA 5AM0A 5ALOA 3SHQA 4UU0A 3QLEA 5ALVA 3ET4A 2C8LA 4KN8A 1SWVA 4BEWA 1ZD2P 1ZJJA 3L0YA 3WKBA 5AW5A 3W5DA 2B8JA 3A1CA 1Z4OA 1QQ5A 4BNDB 3WK5A 1N9KA 5ALUA 2CFRA 2G1AA 4Y2QA 3NANA 2FPXA 1TE2A 2Q5EA 2G06A 1YNSA 3U26A 1T9ZA 1Z4MA 2GHQA 4NFLA 2YJ4A 3W5BA 4UW9A 2Q4RA 3OCVA 1RDFA 5AW2A 5E0OA 2JARA 2ZBFA 1L7MA 4Y2VA 4EX6A 1NNLA 5A3SA 4J03A 2G09A 3OPXA 3IJ5A 5AW4A 4YH1A 2YMLA 5ALLA 1ZD5A 5ALXA 1TJ4A 2OA0A 2R8YA 4YCNA 2WF5A 4UAVA 3I76A 3E8MA 5AW9A 2HI0A 5AW3A 3CZ4A 3SD7A 3DNPA 2ZXEA 2G80A 3U7HB 2BDUA 2C8KA 3WK8A 4UASA 5ALNA 3L8EA 3P96A 5AVUA 2ZBDA 1Q91A 4C4SA 4L6AA 4NV0A 4BBJA 3AR9A 3U7EB 3NUQA 1XP5A 1QQ6A 4ZEXA 4H1WA 1RQLA 1Z88A 2CN1A 4Y2PA 3BWVA 5AKJA 2IOFK 3OCXA 2I54A 4O8CA 2GO7A 1RKQA 1YS9A 5ALPA 5AK4A 1K1EA 4XQ0A 3AR6A 2WF7A 3N1UA 1AQ6A 3AR3A 3RF6A 2OYCA 1L6RA 3ZVMA 1XVIA 1F5SA 3QGMA 2WHEA 5AW7A 2FPSA 5AI0A 1LTQA 4HGQA 3IB6A 2ZG6A 4CNQA 4AS2A 1Z5UA 5AI8A 3L8GA 3ONNA 1RMTA 1ZOLA 3TLMA 5IT4A 3WKEA 2BY4A 4OFZA 4E88A 1J8DA 4YIHA 1L8LA 4Y2SA 4OCZA 3ZVNA 2B1QA 1Z4IA 3WGUA 2Q4TA 2WM8A 5AKYA 3B9BA 3UMBA 2RBKA 3FZQA 3WKAA 5AW1A 4OD0A 2AGVA 2OM6A 2IOHA 1ZS9A 3SKYA 5AI5A 4XE5A 5AW6A 3ET5A 4RETA 4UMDA 3ZU6A 3QUBA 3OCZA 3ZTWA 4FFDA 2DQSA 3WKCA 2R8ZA 1WR8A 3N28A 3WK6A 3GYGA 5AIAA 3A1EA 3NALA 3KC2A 4UAUA 2WFAA 3SF0A 3U7FB 1YMQA 3ZWDA 1NF2A 4FE3A 3R9KA 4XOUA 3E58A 3QNMA 2C4NA 3N07A 1IWOA 1L7NA 2W11A 5ALHA 3NAMA 2I34A 2WF6A 5ALRA 1ZRNA 5AIBA 3U7GA 5AKKA 4C4RA 4KYTA 3VAYA 3HYCA 2R8XA 2P9JA 4Y2RA 3NRJA 2B82A 4I9GA 4UM5A 5AK3A 5AK6A 4CE6A 1YV9A 2O2XA 1Q92A 4PNHA 4HAIA 2GFHA 1Y8AA 5AKIA 1VFPA 1QYIA 3SKXA 2B30A 3NIWA 4JDPA 4Y2TA 4DFDA 1EK2A 5ALIA 5IT0A 5AVTA 1X42A 3N5KA 5AVXA 3S6JA 4BYGA 5ALWA 3SLRA 4UU1A 3AR7A 1VJRA 4XPZA 3W5AA 4EELA 2WF9A 2EATA 2B0CA 2HCFA 4GIBA 3EPRA 1L7PA 4Y3UA 4NWIA 3DDHA 2B1RA 2I7DA 5ALSA 2FEAA 5AHXA 1WZCA 3MPOA 2NYVA 5AVYA 2VKQA 2CFSA 2NO4A 3L7YA 1ZD3A 5AVSA 4HGNA 4YCLA 2JAWA 3I6BA 5AICA 3QU2A 5AI6A 3ZI4A 5AM1A 4BX0A 4QJBA 1YDFA 2FUCA 2YMMA 2GHTA 4AP9A 3AR4A 3FVVA 5ALTA 2YFYA 1MH9A 4MUMA 3SMVA 1RPZA 2RB5A 3KOOA 5ALFA 3QX7A 1Z4LA 4EZEA 1FEZA 5AVZA 2AH5A 1U2SA 4MWOA 1Z4KA 4EX7A 5ALZA 3WKDA 1RLOA 4G9BA 3WK9A 2P69A 1O03A 1VJ5A 2YBDA 4UMEA 4UM7A 3KDPA 4UATA 4AS3A 2CFTA 5JJBA 1QQ7A 2GMWA 2IA5A 2FI1A 1U02A 5ALYA 3QU9A 5AM5A 3M9LA 5ALKA 4KX3A 4IFTA 3AR5A 2HX1A 3L0BA 4F72A 1PW5A 2YJ6A 1RLMA 3ZTYA 4L57A 2HEGA 4UARA 2FUEA 4RESA 3ZUPA 5AW0A 3I1YA 2P27A 1EK1A 2FPUA 3WGVA 4HGOA 2C88A 3L5KA 3OCYA 3OCUA 5ALGA 5AW8A 4IG4A 2HHLA 1KYTA 4KX5A 4NABA 5T41A 1ZRMA 2JAUA 4EENA 4DWOA 1SU4A 2HO4A 1Z4JA 1Z4PX 3ED5A 5ALEA 2HF2A 3QUCA 3OTQA 3UMGA 2P11A 3FPSA 2I6XA 1L8OA 2YMQA 3I28A 1U7OA 2MU1A 3EWIA 4Y2JA 5AVQA 4QQFA 1LVHA 3A1DA 3ZVLA 2YN4A 2JGAA 5A3QA 3ZX5A 2WF8A 3AR8A 3QUTA 3FGOA 3ZWKA 3W5CA 1TJ5A 4Y2YA 5A3RA 3ESQA 3MN1A 3MMZA 3N8GA 1XPJA 2C9MA 2PQ0A 3B8EA 4KNVA 5AKEA 1WPGA 2G07A 3R4CA 4DCCA 2ZBGA 2YJ3A 4GXTA 5ALDA 1SWWA 1TJ3A 3BA6A 3EF1A 3K1ZA 4F71A 2EAUA 4NAVA 4UMFA 3ZW7A 2W43A 2HOQA 2ZBEA 4CF4A 2EARA 4HGPA 4C4TA
chains in the Genus database with same CATH superfamily
1QPGA 5HYVA 1R6AA 3VHXB 4IMRA 3PQ8A 3KK0A 3L6UA 1JXEA 2I33A 3KDAA 3KBOA 1CI4A 4HDOB 1NMQA 1C3EA 1SBZA 4GE0A 4OFBA 4E08A 1EFUA 3MCUA 4EG0A 3EYZA 2QMOA 3GAZA 3PDCA 5ITZB 2BMAA 1LJLA 2ZT7A 4GPZA 4KBYA 4N0QA 2YQEA 1KI6B 5FLEX 5FPSA 1CRXA 2Z9BA 3U13A 2PIDA 3KCNA 3PC2A 1XCGB 2ISOA 3DNMA 3WV5A 1KYQA 4W5JA 1XZJA 3FC4A 5DGBA 2M6SA 1RT9A 2HJRA 3G3EA 4W7SA 2JPDA 2VJBA 4B3FX 3I23A 5EEGA 2FOLA 2LP4Y 4BV8A 10MHA 2DKZA 2KVSA 4ACOA 4AVYA 4L4YA 5F7XA 3WU2U 1Q3KA 4PONA 2C03A 2CHQA 4I9NA 2DPMA 2OCBA 3BQ1A 2FPKA 4D4JA 4BUGA 1LW6E 4BN4A 1COWD 1X9IA 3DAFA 1TYCA 3IQEA 3Q11A 4W5RA 4D4IA 1JHYA 1LS1A 2C0PA 1P8JA 3A27A 4I4TB 1GPYA 3EHEA 1TFUA 1ODFA 2R86A 4BO5A 3TRDA 1Y5LA 2WLTA 5IKOA 3T34A 1ZQSA 2XOKD 3GJ4A 3AJ9A 2CD7A 1P7YA 1W59A 4I7EA 7ICIA 4RQ1A 4BFCA 1OFTA 2VYND 2OHGA 4R9RA 4D41A 4U9IS 4Q00A 2H1RA 3AYXB 3PNYA 1T4GA 4JA0A 5J2TF 3ZLVA 4NYJQ 4CFZA 1ZQMA 2GARA 4G67A 3NOOA 4Q3CA 3SMQA 3VNBA 3L4BA 4KDCA 2BIFA 2FXVA 2Q5QA 2WHPB 3JARB 2AN9A 3PQEA 5EFZA 4CGZA 4L2IB 1WPRA 1PK3A 1AN0A 2JB9A 1GN8A 5CD9A 3ELUA 4OAQA 1PUZA 3CV3A 2WV9A 4K4IA 3GP3A 2VO1A 4YMSA 2YVKA 2AUTA 1OFVA 1X15A 3D5QA 3FCOA 3QFTA 1X80B 1J8FA 1F3OA 1EZ1A 1TM3E 1BXRB 2PMCA 4V38A 3KTAA 3RH6A 3OVMA 4R8LA 1ABFA 1ZI6A 3C6KA 3S4YA 1JLMA 3IEIA 3OD1A 2I0FA 4OHFA 3E48A 4XJSA 3GUVA 1QQTA 4BQOA 4UJ5A 5IFKA 3L0CA 3W2EA 3S2YA 1M76A 3WNVA 4D8YA 4II3A 3WK7A 1E99A 2NYRA 4WNAB 4FEAA 4V0KA 1N2IA 3L92A 1K8QA 3A1FA 1FSFA 3DQPA 3IH5A 1BVSA 4QWMA 2BR5A 1VMEA 4IDHA 1M2OB 4U7PB 1NZFA 3FJOA 3WYCA 5A2QA 3K8QA 1YDWA 4ZI7B 4FKBA 1WXWA 1MOPA 4U9UA 4CDRA 4V3CA 3G8YA 5J58A 1SELA 1FQKA 1JXLA 2OCGA 4W6QA 2R1TA 4ZRDA 4DA6A 4G0MA 1KDPA 4RV9A 1GZ5A 1UJ2A 4QDZA 4Q9AA 3BMCA 3RJFA 4RTJA 4I5DA 1S97A 3I9JA 1EP1B 4YT8A 4TUSA 3G6YA 2F3RA 3QKIA 4GC5A 2FW7A 4UQPA 3ZWVA 3MAJA 4ZQEA 1DCKA 3IHWA 4U7JA 4O4JB 1K3UB 3SJ7A 4BBPA 2FRXA 2H16A 1W94A 4QELA 4J1QA 3LX8A 2J5RA 1HYQA 1ZCZA 4QUBA 3ZWXA 1FQWA 1NV9A 5CJPA 3R9IA 3MUEA 2QZ9A 2N0SA 1B15A 1QHYA 4URUR 1WKVA 4TMKA 5AESA 2HSZA 1CY7A 2D1FA 4MP8A 1X7XB 1SXJD 2Y8EA 4USAA 3HPOA 2POCA 3P2OA 4QQKA 2PXAA 2C3OA 3TZ6A 5GWXA 1D9XA 5LLDA 1QTMA 1WDKA 4R9UC 4H9GA 2CKMA 4UBCA 3SC2A 4FB5A 3HCEA 3QYAA 2W55A 4DQXA 3GFPA 1C3XA 2DKXA 1T0HB 2ECQA 1NJZA 1EQAA 1KPGA 4RK6A 3WLEA 2KKVA 1PW7A 1H5QA 2FPRA 3M82A 3M1LA 3PQ2A 1Z5OA 3CRZA 3KE8A 1HNWB 5CDFA 1L5UA 1GU7A 2JCXA 4I4TF 4IUDS 4JCCA 3DWFA 4Q7QA 7ICGA 1OTHA 3WB0A 1W0JA 4JVOA 1RI5A 3CUUA 3RUIA 4EPXA 5DGHA 1R5NA 5FUXA 3DMFA 1FDTA 1L6NA 3LA6A 4ND8B 1KAQA 2BP7A 2QTZA 3MSCA 4W9RA 5FUMA 5KSZA 1W8IA 4XWGA 5LNK6 2H3HA 4AXBA 1U4NA 1WNTA 1L5SA 4O5OA 3SQOA 3VZPA 4MW7A 3BXGA 1NONA 4F5RA 2J1LA 3L0OA 4X1IB 4Y7CA 1SIWA 1W88B 3WKBA 1CC1S 4ZJPA 2M9NA 1II9A 1LGYA 2OO3A 2QAGC 4IX9A 4MEJA 4B3TB 3BM5A 4ZVNA 1Q77A 3D59A 4XEUA 4UPEA 2FHPA 4EYHB 4L9WA 1KEEA 2PUAA 3DBOB 1LLFA 1SB9A 2V54A 2MSEB 3BILA 4W5HA 5E4FA 3IAM1 4JI3B 2V6FA 2ZAGA 4P3PA 4BZZA 1FFXB 5EMLA 1QH8B 4EBBA 4B48A 4J9RA 1WXXA 1EVLA 4GI1A 4N4AA 4N8DA 4EO9A 3CVYA 1SIUA 2Q5EA 3L02A 4Q4AA 4JELA 1WPXA 5K2MA 2VDPB 3T4PA 4C20A 1X13A 4OQXA 2QB1A 1QANA 3HDQA 3JAKA 3SI8A 5IANA 3L6OO 5HEKA 4DFMA 2A35A 1SM4A 3JR7A 4ZO6A 2Y4NA 3HUFA 3QVGA 1V71A 2CRXA 3B1XA 1OBCA 1RXUA 5E0OA 2Z8ZA 5EMMA 5FIUA 5EVCA 5B57C 4QJ5A 4C4OA 4ECTA 3TSWA 3EMDA 1W87A 2I6TA 1XWIA 4JQCA 1NNLA 3X3HA 4J76A 1PVRA 4DLNA 3LC1O 2HT1A 4W7HA 1U5AA 2W6ID 1BE8A 3HYLA 1W5EA 1ZD5A 2QB0B 3Q2KA 4KDFA 3IIJA 4PICA 3ROTA 3E5NA 1MO3A 3JV7A 4CU2A 2JLCA 3FKSA 4KLHA 1YNOA 4BX8A 3ENKA 4HVTA 3H0CA 1E64A 4HAUA 4PGGA 1N78A 2PRZA 3HU2A 2P9HA 1XMSA 2UYGA 3I01A 4FKZA 1L4MA 2QRLA 1T8TA 5G0WA 1QV9A 4RELA 3AM9A 3TGPA 1GQRA 2XT0A 3O8NA 3FMIA 3FRIA 3LL7A 4EYQA 5C1DA 3PSIA 3D54D 2IHMA 1FRNA 1GLVA 4H6XA 1QIFA 1MOZA 4X44A 4RD6A 3HFRA 1IN4A 3E35A 3IULA 4FN5A 3Q2IA 4L73A 4L6AA 3HN6A 1MTZA 3WTCA 4KP7A 2IZ0A 2ATCA 2MWMA 1SU8A 1KFEB 1V1MB 3ND5A 4K28A 4XFKA 3UTCA 4B6QA 1XTZA 1WSAA 4HVAA 2GNPA 5J63A 2C42A 3D5EA 2YRWA 4H3KB 2EDUA 3SQNA 4RQ8A 3W6NA 1M2OA 1T9DA 5CNMA 4DLLA 1BRMA 1N92A 1MA0A 1UBMS 5DCUA 2D6FA 2B9EA 4RABA 4I4TA 1TIBA 1M7GA 1TMOA 1WZ2A 2ZTVA 3N3BC 3LVQE 4TMWA 5JYEA 1B0ZA 3LX4A 3G8BA 4IDFA 5EJ8A 1G60A 5JQGB 4TLLB 4CL2A 2JH9A 4IINA 3G8CA 1BA3A 1VLQA 1L3TA 4P3OA 1S3FA 2WM2A 3WLQA 5MFPA 5F98A 4J0IA 4ICIA 3A0UA 2ZRHA 2UXDB 4RXTA 4IDOA 4BEJA 4QYWA 3TDNA 5BOSA 1J25A 4PM4A 1D4OA 1FC0A 1JKFA 1IY8A 1JLLB 4M1WA 3V2HA 3M6KA 2PVSA 4RQ6A 2VDNB 3O93A 4ZTBA 4MH0R 3G0DA 4EBCA 2IUUA 2EF0A 2Y4OA 4AJOA 2G0NA 5I01A 4D3DA 1FZQA 2J3MA 5DDYA 1LTQA 4AUMA 5AJHA 3A6LA 4E33A 3TLYA 2K6GA 1E9VA 1U0SY 3MABA 1IC6A 3TDMA 3CCCA 3ONNA 4C8LA 5EPUA 3M3HA 5KQRA 5IT4A 1T8RA 2QX9A 4GXIA 2JC3A 1DX6A 1HL7A 2B1IA 5EE5B 3BSYA 1JWAB 4ZOAA 2ZRMA 4NJEB 3TQTA 4DPLA 4IJKA 1SD1A 1X2EA 3HZHA 5DQIA 2G5CA 5TGZA 5IU6A 2HMSA 5A4DA 2XB2A 2QAIA 1Q44A 2PVPA 1VBNA 4YEDA 2CNKA 1XJ0A 4AROA 3FTPA 1GDHA 4F5EA 4RETA 2AMFA 3QIVA 4K7JA 4MVJP 2ZIGA 2WT4A 2PJUA 5KYYB 4P58A 4RX1A 2BR4A 4O4IF 2DQSA 3VR6H 4ZTZB 3WKCA 4US8A 1M8JA 2A57A 2QRMA 4JWNA 5EIXA 1G20B 1RRVA 4EQ6B 2XVTA 3N28A 3GJ5A 3X1ZA 1H2HA 2P9QA 2Q21A 1DZIA 2QXUA 3E0XA 4NM2A 4MWBA 3VKWA 2OXEA 4WX2B 1GP2A 4F2PA 3D2LA 4M53A 1E79A 4AKEA 3R3HA 4HB0A 1HLPA 4DMGA 1CFZA 4ZYLA 1NBWB 4MRAA 2R2AA 4NMWA 1P9OA 3EIOA 5IAJA 1QP4A 3C1YA 2CXPA 2HU2A 3E4DA 4HY3A 4L4SA 4XOUA 5EUQB 4DM7A 1MW8X 3TG8A 1UBJS 3K5PA 1R64A 3I45A 3I9LA 4D3XA 1KWGA 2EOAA 4HMQA 4RF5A 1CLUA 1ZNXA 2PZGA 5CCEA 1PRYA 4IG9A 1R0ZA 3VC1A 3ZZ1A 5I3ZA 1LC0A 2YZKA 4U8GA 2BI8A 2B2CA 4Q1VA 1WL8A 2EFEB 2OXTA 3FOBA 2XE6A 1G3MA 4B3GA 5CIYA 1NW3A 2QUJA 4EFKA 1A3CA 5IJ0B 4ZGGA 3AJDA 3DXZA 1Z35A 4B3DA 1UBHS 3JPPA 4W9NA 1E3WB 1QKKA 5G1OA 3UIEA 4KRYA 3GPLA 1ESDA 2GEBA 8LDHA 1YH3A 3N6VA 5IK2A 1BEUB 1DEKA 3OT5A 1R8YA 3ZZUA 2XUDA 4MRVA 1Z3CA 1EJBA 2JLRA 1JTFA 4BDPA 4KWEA 1MT0A 2Y27A 2OLJA 4IIVA 3R8XA 5IT0A 2B20A 2JHPA 1E0KA 4OQMA 4P84A 4DOAA 1OLUB 2WHQA 3KVVA 1E6KA 4GLBA 3RTAA 4KIFA 4ODIA 3DV2A 2VDJA 2DVMA 3O3CA 2C7VA 3HJCA 3U3RA 2E48A 2IHZA 4MI1A 1YB7A 3RBEA 3O1IC 4PQFA 4FFWA 3RRFA 2QN9A 3R6LA 3TLEA 3CPJB 4JBXA 4BN0A 2C92A 5ERXA 3BS5B 4MWDA 4ZT2A 2DHEA 4I9HA 4MLDA 3VYTB 9ICOA 5F1OA 3UXMA 3OWOA 3P0JA 2IE8A 4BB9A 5ENZA 1V45E 3WGYA 3PL1A 2AL7A 3KHSA 5ER6A 4AG5A 1QRAA 1XEXB 2BCEA 3JX9A 1T9BA 2GYUA 2FEAA 5CLLA 5JC8A 4O0IA 2X7HA 2VKQA 2NVBA 3DV0B 1OBOA 1BXRA 3AFNA 1NMYA 2NO4A 2Y1JA 1Z0ZA 1X6IA 2OV2A 3GLTA 3M1IA 3B0XA 5JSKA 5AVSA 4YUZA 4JNKA 2HJSA 5EZ5A 1MCZA 1NHWA 1QFSA 3N2YA 3J7AC 1T6NA 4C78A 2CLMB 1IK4A 4CLOA 3LT1A 2XECA 2XMPA 2IELA 5L7TA 1RYRA 2OQRA 3CQ9A 3PW0A 3WFIA 1NJ1A 4K1XA 4F3YA 2B9VA 1MDBA 3CPSA 3KB1A 3RJHA 4HTAA 3BE6A 9ICPA 2L17A 4Y9DA 1D8YA 5IARA 1COOA 3GZTB 3DMTA 2KJQA 2ET6A 3U7QB 4WKPA 3TBHA 1DJQA 2CNDA 3V42A 2EKPA 2XQJA 4FXOA 1F6BA 1T2NA 4X92A 2QM0A 1U63A 2MSLA 4ZT7A 2FF7A 4GEGA 1G21A 5JD4A 1FTQA 4DWIA 1E6EA 2BM1A 3WK9A 2P2NA 4WUTA 3VMFA 3LPDA 4UMEA 3KAJA 1Q50A 2EX4A 4JLSA 1SZCA 3R40A 3U4AA 3WC4A 4AICA 3AB8A 4AS3A 1ZQAA 2WABA 2DPHA 3NS7A 2V74B 3I72A 3HMQA 4C0ZA 1XJ5A 1FU4A 3FNEA 3N0VA 3TOSA 4C7OA 4BJ5A 1BROA 1QF9A 4GMXA 4NBNA 4LZOA 4ZI7F 4H3VA 2KW5A 3JQGB 5LQSA 3UG6A 4NK5A 4UVDA 1BMFA 2FUEA 2GKOA 4RVOA 3HXQA 4EDFA 4NENA 3S2GA 1E9DA 2AR9A 2P40A 4NLBA 2CLEB 1RYEA 2FPUA 4RHYA 5JPCA 3LM8A 1T8WA 3WLFA 1LRLA 1PJRA 4G09A 2GNAA 4GWKA 5L1JA 1Q15A 3OCUA 4H16A 4LGCA 4WDRA 3V4OA 5K01A 1G42A 3IR7A 1WW8A 2DUJA 3QPCA 2O8VA 2MINA 2OCDA 3H11A 5CYFA 2BGWA 4WLOA 1MQ9A 2FSGA 4CCYA 3CN7A 2LYHA 4YXMA 1XEWY 4ZAYA 3OY2A 3S99A 2HM7A 1S0MA 4F38A 5GIPE 1PHRA 3K20A 4ZQHA 3CNLA 4B09A 2FE9A 4TWBA 4JLJA 1YB1A 5LQMA 4WUVA 1L8OA 4HUQA 1EFKA 1Z8HA 4PG8A 2HBQA 2EW2A 2J5XA 4G65A 2HVHA 4ZYUA 4YCJA 3RD5A 4XH9B 3OBBA 2IIVA 3GFSA 3TAXA 4MF2A 3IE1A 1XL0A 2NPOA 1MIOB 1BW9A 3RVNA 4PJ0U 3TDKA 1CUJA 1FP4B 1CZUA 1SC1A 3M9XA 2XCAA 3NXSA 2A1TR 4KIGA 2IWRA 1ZHOA 4QXPA 3T3GA 1Z3EB 1U8TA 1XDBA 3LUAA 4X1KA 4OL0A 5TGDA 3BDAA 3H0EA 4EKEA 3KU4A 3NXKA 3TO5A 1EX6A 4B7UA 5A3RA 1B14A 4CXMA 3DQZA 4EMUA 1P1HA 4A8JB 2H1OA 4YRPA 5I9MA 1R3DA 1ZN7A 2PV0A 1Q3VA 1FP6A 1OPXA 2W2VA 4LKOA 2ETVA 3H5IA 4HDKA 2V5UA 4P6VF 1IM4A 4NJ8A 4PHGA 3L1JA 3KYIB 4BFVA 5BT8A 4QYXA 1N9GB 2QUAA 5E95A 5EINA 3IGFA 1QKIA 5H9VA 3LIIA 3V1KA 4CR6A 3FUWA 4F96A 1LV8A 3TZCA 3UC9A 3M5WA 3X1MA 5BMVA 3OQ1A 3CVJA 5LBIA 3MWEB 2OESA 4D9MA 4NK4A 1C29B 1LKYB 1FLNA 1NUUA 2AFHE 2OHXA 3KT0A 1Z33A 2WSBA 1IOZA 3FM9A 3GZ4A 2VWHA 4DLPA 2Q5OA 1IM2A 5J5CA 3DCJA 1KFDA 4EBEA 1J49A 1FP1D 1XJCA 1XKXA 3VR5D 3I32A 3JQ8B 3KVNA 4MUXA 1RMYA 4JR2A 3ECCA 1Q1QA 3HGQA 4ZDIA 1ZQEA 3K9FC 1M72A 4I1SA 4KLIA 2VPTA 3VJKA 4GC6A 3IAEA 4RL4A 3DE3X 4TKVA 1N36B 2QPOA 2X4DA 4N1AA 3QU4A 3PB3A 1I3MA 4KXYA 4OLFA 3C29A 3CUYA 3KZXA 4HVLA 1VE7A 2X4LA 2GETA 3CR3C 3GLUA 1TD1A 2PJRA 2JBAA 3BMCB 4X63A 3LYLA 2VK4A 4P7BA 3V3KA 5CLJA 3T3PB 4ND3A 1O0BA 4BGEA 3VO8A 4QT0A 4IR1A 5DBCA 3TRIA 1I9GA 3TS1A 3QPUA 5AM3A 1NP6A 1P3DA 1XALA 3ETNA 1RXVA 1K66A 2ODGA 1UK6A 4U6PA 3DFKA 3DWEX 3O8OB 1Z63A 3AZPA 3WMGA 5JZBA 1U4BA 3DCIA 4KITB 2Y1IA 1BSVA 2AR0A 2FG5A 1L7RA 1YKGA 2HLHA 4WVFA 4YRLA 1U8AA 4RE6A 5IM5A 4O4LB 5KBYA 4PCAA 5FUQA 1ZZEA 1U7XA 5C0YA 1RKUA 3WWCA 5DWVA 3ZE0B 3ZGXA 5TF4A 1TA0A 4YGYA 1U7PA 2FKNA 4M0CA 5E6UA 2YJNA 3LF1A 4M3NA 3O74A 4CG0A 4H0FA 4RZQA 4QC2A 1U2GA 4KE6A 2D6FC 2FQQA 4J7XA 3GOHA 3JPOA 4PBSA 4N0EA 2R8EA 4B74A 4MIYA 2OZPA 3TOVA 1RRKA 5HGXA 3BE8A 1EAYA 1WVIA 2OTCA 4P4LA 1L5FA 4HNTA 1EK0A 3VHXA 5D8DA 2AJ8A 2SCUB 5FULA 3TJMA 1KFJB 3K4HA 3CO5A 4X24A 2W71A 3WZLA 4B80A 1CUCA 2HUPA 1KH1A 4UOZA 3KQHA 1XXHB 4L22A 3ELBA 3M9WA 4IWXA 1W36C 4RVDA 3TOZA 3RBDA 4X3CA 1GTL1 3DONA 3IE2A 2GERA 2JANA 3H0KA 1SXIA 2PNFA 1LPSA 2ZRAA 3V4LA 2GM4A 5F4ZA 1NBME 1UK7A 3L8FA 1YJCA 1T34A 2IYLD 3BF7A 4HDNB 1Z7YA 1E2BA 1WBDA 3GIMA 3SY8A 1DUIA 2DPYA 3W79A 1ZX1A 1J0BA 3BZWA 3K8YA 1MA7A 2MR6A 3QIAA 1BDHA 2OBNA 2R7MA 1R9MA 4R81A 3FYSA 3KQWA 3NJ4A 4C2UA 6PFKA 2CLKB 4J9QA 2WC1A 3FDZB 3FHTA 2BUBA 3QX9A 4IS3A 4BGIA 4X8OA 4Q03A 4DG8A 3KYJB 4YIKA 3EC7A 3HJAA 2Y05A 3X1DA 1HRDA 1OWMA 3FN4A 3EXEB 4O29A 3VBEA 3WDSA 3QPBA 3UJ9A 3HTXA 1SHUX 1H2FA 2G9RA 2JZCA 2K2WA 2JW5A 3VJRA 4BX9C 3JQ7A 3GPDG 3OF5A 1C80A 4I55A 4PLWA 3U4GA 4R2KA 2WIGA 1DC4A 3RSOA 2NUTA 1FDIA 2ASJA 1C7JA 1JLSA 2ZWOA 2PMKA 3EZGA 2CCKA 4OH1A 1ZITA 4G4GA 4KDRA 1QFZA 4QYIB 2SNIE 3LNTA 1FFHA 4LJ5A 3ISVA 4J49A 2YUTA 1PYOA 4PLPA 2EDCA 2MOKA 1CR6A 3F3KA 2YINC 3GD7A 2WB4A 3O84A 5DI9A 1NSTA 5G4KA 5TQJA 3VVLA 5G0TA 3H83A 1Y5RA 2FG7C 4F3CA 2HIMA 3SU8A 3OQJA 5AM0A 1V8PA 3GA5A 3PZPA 7ICLA 3P94A 5HM8A 4LZJA 5L6MB 4FYKA 3D1JA 3H11B 3IDAA 2ZUVA 2W70A 3WIVA 1U7UA 3A3NA 3RB8A 2C8LA 1DJOA 1A9SA 3WXBA 3KD2A 4MV7A 2O8EA 1X6JA 1PJAA 1DS6A 2AN3A 3IUJA 1QU3A 1XZCA 3PW7A 2I29A 5ILGA 1GGNA 2X23A 1AK1A 1M7HA 2R66A 3FYHA 2Y99A 1MABB 3N2NA 4OL9A 4MQFA 3U49A 4LE2A 4L3OA 3TLMA 3W8EA 1ONSA 3WK5A 1QUEA 4K6GA 2C2YA 1N2BA 4XGRA 3H9QA 2V45A 3I39X 1RU3A 4PZAA 1BE0A 2IQ5A 3ICCA 5LP6A 1U90A 4IQWA 2OWOA 1G4UR 2OILA 2VR1A 4MV0A 2GPNA 1Z4MA 4TXMA 5ENVA 4DC9A 2YQ5A 4LJRA 3ZDRA 4JT8A 5JH7F 4LCBA 5KOHA 1CJMA 2DQKA 1QAQA 3AEUB 1IJBA 2C5FA 4D26A 5M2QA 3HL4A 5CAEA 1NPYA 3OCVA 4LJ4A 2IS1A 3QV2A 4XXHA 4G4IA 3RYHA 1Y8ZA 1QCDA 2CPRA 1OH8A 2PWBA 5JDIC 2ODTX 3IUEA 3E2PA 4Z6DA 3U1BA 1M10A 4QU0A 3DEEA 1E1QA 4MV9A 2NSJA 5JCZA 1ULZA 4EG7A 5AUOB 2PY6A 4KQFA 4I1RA 5KFKA 5TJ9A 1OZ0A 2X0EA 3TZBA 1GADO 3WY9A 4BP3A 3G9ZA 2ZRJA 1X74A 2HA6A 3JQCA 5AJXA 4C7YA 5KOYA 2QYOA 3JW8A 1WKCA 3R3SA 1QUFA 2E9SA 2P75A 2QR3A 4QULA 3SGLA 4DABA 1RHMA 2DPIA 3K1TA 3CG4A 2AK2A 3PENA 4LOLA 2ZXEA 2WE7A 4I19A 3WSWA 2F1IA 3E3NA 2YN0A 2V8BA 5SZHB 4X8HA 5CX1B 1B0PA 4AIIA 2XAAA 3U5TA 4WD3A 2B8TA 3AF3A 4DMCA 1FUIA 3A6HA 2Q3HA 4DJAA 2KSOA 2OHIA 2X22A 3B1VA 4XWWA 1Y81A 2QAJA 7REQB 4BO9A 3C2KA 5IX8A 3K05A 4IPTA 4Q37A 4OMFG 4E2FA 2UZ3A 5K03A 1KP3A 3MRXA 5IDXA 4LJ8A 1XTRA 2CMHA 4YCAA 3T5TA 2ZK7A 2VHJA 3N2IA 4L0QA 2F9FA 1N5DA 3HP1A 4X66B 4HFRA 2C4TA 4TV8B 4WPGA 4AM8A 1BO6A 5B12A 2G6TA 3GLRA 3Q3GE 5CWRA 3OLYA 5H1YA 3FPFA 4ZT6A 4I81A 5JY6A 4WJLA 4HX5A 4CKCB 2G9NA 2Q4BA 2ATVA 1HTBA 1UMCB 1C4OA 3GVCA 3UWPA 5JDCA 3OQHA 4O4LA 3TVTA 4E3ZA 1SUPA 3VR5A 4HRYA 3U3JA 3U4QA 4G41A 3QG5A 1LZLA 3QWBA 3HY6A 2V0CA 4HQRA 4O4LF 5CRIA 1I6WA 1JHUA 5CMLA 3H9BA 3TQFA 4BLUA 4B4WA 1B3RA 1G63A 1TCAA 3O94A 4KPUB 4B3JA 1VG9B 4MHOA 5D84A 2M0NA 1YXMA 3BSSA 5JJ5A 1KBZA 5IMSA 2QE6A 1TM7E 4KSBA 3EDOA 3KJNA 4DCTA 4PGHA 3HB7A 2BMDA 3RFFA 1JAIA 3DE0X 1FYVA 4BRSA 5KYWB 2C28A 1M83A 1Z0DA 3WKEA 3ISBA 1AZTA 1LQTA 3KHLA 1WY7A 2CE7A 2P5YA 4HH3C 1L8LA 4P0QA 5IINA 4Z0PA 3HVRA 1E2DA 2PZEA 1I7DA 2AEFA 4Y2SA 1Z7BA 4RK4A 1BS1A 2JXJA 1WCV1 2O2DA 2WYOA 4IVPA 5EZYA 4BO1A 2DSTA 4EYSA 4FS2A 2AHRA 2FPPA 3GCWA 2HA2A 3AUAA 2MR5A 5EZYF 5TT1A 2RRDA 3WFJA 4D0GA 4S12A 3SVLA 2XOKA 2AOTB 1EB9A 1OXMA 3X1WA 3RUFA 2JGFA 3GHHA 3V6LA 2WR8A 3NHPA 4HNVA 1JYFA 4YXWA 2BTEA 2IU4A 1Z47A 5AW1A 4QWDA 1QGUA 2AGVA 1CUVA 2HKIA 2JCGA 3AVWA 2WTBA 4NAHA 1OXBB 4R2IA 1GILA 4FNAA 4R51A 4A2CA 4JLNA 3VYUB 4RA9B 2EIHA 3FUUA 3ZZNA 4FFDA 4UAZA 2H2DA 1RXYA 3FBTA 3VSBA 2PGAA 4IGKA 1QCKA 4I3FA 4OSPA 3MR3A 5AHWA 3DBLB 4R4JA 4LW8A 3DHVA 1ADBA 1X9MA 1GRCA 4IH1A 4DWWA 4IEEA 1JA0A 1E2HA 3A36A 4XOIA 1KE2A 4UVEA 1N9GA 2DRIA 3RQSA 4UAUA 1E2QA 2WWRA 1SKWA 4XASA 3U7FB 1HT0A 1LBQA 1MB4A 4L5JA 4XUEA 3KQMA 2XCTB 1I4DD 1C1DB 1RSZA 3BWEA 2CHVA 5I7HA 1REQB 2F1RA 3Q72A 4U1RA 4TTSA 2G72A 3ZWAA 1AK9A 2QKYA 3CZ9A 3EUB2 4G9EA 1A69A 2GPAA 3NH6A 2C83A 2AEJA 4INAA 3TZHA 3UG7A 3UW1A 4BQRA 4PVCA 4XSHA 7ADHA 4U8HA 4HSEA 1MR3F 3AW8A 3JQDA 4B2YA 3IVAA 1FYEA 4CTOA 3U7GA 1SUIA 2ZIUA 1NN1A 3V33A 1KDVA 1RI4A 1CDZA 3D1VA 3HYCA 5K2OA 3KKEA 1TT7A 3QEMA 1C9EA 2AI2A 3ORSA 1FFBA 3BH7A 3JSAA 4CIWA 5JBQA 4R1NA 1G98A 1YU9A 4HDQB 1SMKA 1GR1A 4WFQA 3R7DA 3SKXA 1AZWA 3EPGA 1EFTA 1QV6A 4B8ZA 9ICNA 2P7HA 5DB4A 1EK2A 2GJAA 2Q9BA 3ZLJA 4TV9A 1N77A 4BCCA 4AZVA 4B6PA 3LK9A 5K0EA 1RTTA 4C7JA 2Z30A 3I5XA 4HDSB 1K3FA 3BCUA 3IVXA 3N5KA 2LZ0A 4WKNA 3X43A 5BN4A 3ADCA 1I1OA 2PAAA 1E20A 1E59A 1R27A 2V7UA 2VDWA 2GA9A 5TVKA 2KIWA 4BYGA 5AVXA 4AKSA 1DIBA 5KFZA 2R1TB 3SLRA 4ENQA 2P4UA 4JYCA 5J0WA 4YAKA 1P5ZB 4C6RA 4URVR 4PRKA 1O4WA 1R0LA 2AMJA 2IBMA 1ADCA 3RRJA 5K8CA 1UKEA 1TA9A 3M8SA 1H6DA 1PG2A 1TTHA 2EATA 1ARZA 1DCTA 2BSXA 3GF4A 4YRNA 5A1JA 3D3WA 1RWKA 3RVLA 3KTFA 4OB6A 4XM2A 1DHRA 1Z34A 2GAFA 1SHJA 2ZE5A 4UE6A 3VYSB 1VKRA 2DFNA 4NLGA 3TR0A 2AZ4A 1UWLA 4C0WA 2QN7A 1N48A 5CUQA 3EYAA 4M7RA 1XBTA 4XR4A 1QHFA 1VLVA 1OCEA 4NNPA 2XUPA 3OHMA 3DT6A 3KLMX 4J7UA 4IIDA 3ZU3A 4BKOA 2O5CA 1GSAA 4QZ9A 3MELA 4G5QA 1YC2A 2CF5A 3MRTA 1UMDB 3N76A 4QDJA 5AT1A 4ETMA 1BH6A 2NW6A 3HDVA 3VR6A 1FRFS 5CA7A 1QPBA 1UXHA 1Y7HA 2EYQA 2MYNA 3S1AB 3GGSA 3V2UA 4ESHA 1Q17A 1L1FA 4AKTA 4TMTA 1K6XA 3SX2A 3THOA 1A95A 2ZIVA 5EJEA 5B3AA 5GV8A 4KQIA 1WSDA 1KQOA 1Z38A 3J80A 2H1IA 5CG2A 1A88A 4YK7A 3IE0A 1N0WA 4YNBA 3I5AA 4B9SA 4MOWA 3MINA 2X8JB 3C3AA 3CX4A 1EMDA 2QIPA 4TKUB 5KZMB 1HM5A 2R8RA 2LBOA 3BIXA 3SV3A 3GFFA 2BE9A 4QJIA 3SXUA 4WA8A 2AOVA 1NM5A 3JWJA 4UTVA 5CRXA 3EIEA 1UDWA 4P4UA 2NTYC 4PC3A 3O2SB 3BDIA 5KDLA 3TEJA 2G7MC 1L7DA 1TUGA 2FWPA 1JP7A 2JATA 4JJEA 5DSTA 3IURA 5TQ0A 3RSLA 3V80A 5GY7A 4F72A 3FTFA 1LQ2A 5A6SB 4DV7B 3FMOB 2X7XA 2QDXA 2E87A 5IM4A 4AJHA 1ZRHA 1XTKA 3ZUPA 1E5VA 2IP4A 1H5UA 1I80A 2JKVA 3KS9A 3ODGA 2ZJAA 2NVWA 3NC4A 1OZAA 4NAUA 3PXDA 3CLSC 3I3SR 4NG4A 5KJFA 4P9NA 5FWDA 4I4IA 4CMBA 4F2WA 3A4YA 1I32A 2V55B 3A6KA 3LI2A 5D01A 1M6VB 3TIFA 3SEIA 2GB4A 3D0OA 1QZUA 4NABA 3H5WA 3QLVA 3W2FA 1XPUA 2C95A 3NATA 2HO4A 3L06A 1Z4JA 4IUBS 3M7IA 3B0YA 2KTQA 2B0JA 3EISA 3F8WA 5DX0A 4M21A 2P11A 3OA0A 3NORA 3HEAA 1H2WA 2AI1A 4G0NA 5L3RA 5BN5B 5JI2E 1P1RA 3GJSA 3M6FA 4ZVKA 4LF6B 1G6OA 1Y8QA 1JHAA 2VTDA 4OXYA 1U0HC 3REGA 3S2IA 3MT0A 4IRUB 4DY4A 2FLNA 2C2MA 3QM1A 3ANMA 2X1HA 3TGWA 3NHAA 2KEYA 4UHDA 1T2UA 4OI2A 3CRVA 3BGDA 3TLZA 4JENA 3UAOA 2J7KA 2YL2A 3GBVA 5EWGA 1E2PA 4ENRA 1V3TA 4IVRA 2V65A 3EARA 3MEQA 2NWQA 1Q21A 3ETEA 4OU4A 4E4YA 5LUAA 4O1MA 1YQ9A 4YHHB 2WF8A 4EBFA 1TZ2A 2BC9A 5F5XA 1ILWA 3VDXA 4L6IA 5EE9A 1H6AA 5K20A 5A5EA 2Q0QA 2X1VA 2RLTA 2PKYX 2DR0A 4KH1A 4JBHA 4KXMA 1L3IA 3CX8A 4DY6A 3SYNA 2OEHA 2Y6VA 1MX5A 1PNOA 5IYZF 2CUTA 4RD4A 4D43A 2Z3WA 4ADSG 2W43A 4QT4A 4HDRB 3EZ2A 5KVVA 3GFBA 1E3MA 1KE1A 5BOVA 3QF7A 4NQRA 1UT8A 1QYWA 1C0KA 1S76D 1NP7A 2YY6A 1WZIA 1Y3DE 1Z29A 2X4IA 3NX4A 3C3KA 1B0XA 1OU4A 2IYTA 4D2IA 4XQGA 1C1DA 5CA1A 4CL8A 3EEIA 1CQXA 1J0DA 3BORA 4XIJA 1PJTA 2PS3A 2ONCA 2VHCA 3GQVA 3UN1A 1EE9A 1ZQ1A 1Z4NA 1WXGA 2DT8A 4U7HA 2NRWA 1RXWA 3DV9A 5TQVA 5EYPA 3FYTA 1K8ZB 4DBVO 1BH2A 4E13A 3VZQA 2B7BA 1IPFA 1IULA 1LJ8A 1AUOA 1ZMRA 5AM2A 2QMUA 3DXYA 4YQEA 4BNDA 4CV1A 2O2IA 4D6PA 2P9FA 3CLRD 3F7OA 1VI2A 4ZOBA 3V2GA 1D8AA 5M5BA 4ROSA 4TMVA 3PFIA 1UOPA 4WN9B 5AH0A 5EL0A 4ECAA 3D0QA 3VGJA 5JZOA 2R00A 4PNEA 4BU0A 3UM9A 4CQNA 2BKUA 1RPNA 2CBXA 4J0FA 4J75A 2VA2A 2GUGA 4FI3C 1DKQA 4OBWA 1WMAA 5CCXA 3EZNA 2IXEA 2OPBA 3NYRA 4G37A 1EFDN 2GD0A 3GFKB 5SV2A 4DL4A 4DB2A 1LKZA 1ENYA 1OLOA 5EXSA 4WZAA 1R6XA 1CQZA 5L6LB 3FCUB 2WD7A 3DH0A 3PV8A 4H7FA 3P9XA 4M86A 1V2HE 4YR0A 4X62B 2DUNA 2QYHA 3ZW8A 5JAPA 1KO8A 4N3GA 4Q43A 3VU1A 4IXWA 2NADA 5JLJA 2XDAA 2VYFA 1A04A 1M2FA 1NC1A 3B89A 4ZVSA 1V5EA 1Y7TA 3CT4A 5KT3A 3BCRA 3FE2A 5TX7A 3SNHA 1O58A 3WGKA 4YAIA 1ZM2A 2PR7A 3NBFA 1L1EA 5CM2Z 4KLEA 3QP9A 1XT6A 1ED1A 2DH6A 1OMOA 4TYQA 5GONF 2ZUTA 2PBRA 4BKQA 2NUTB 2V4MA 3BRQA 2XAUA 4NDZA 5A05A 2MSKA 4ND4A 1U0FA 5CXSA 2W2MA 2H8GA 3IKJA 1VMIA 3WRXA 1AKTA 5CH5A 3GFRA 4M89A 4C76A 4S04A 4RXUA 4PGQA 1B93A 1XMJA 1DG9A 3AF4A 2MMGA 3HJHA 4ARZB 4B4UA 5KFJA 3AY0A 3HDYA 2ZUBA 4OP3A 4BB6A 1OAAA 1M9NA 2D4AA 1SOAA 1RYMA 3QX3A 2VI5A 2YXEA 3BH6A 1B0AA 4ACBA 2HA4A 2ZOSA 1ID1A 3TAUA 2W22A 5EIAA 1THZA 5E2AA 1ZM3A 2W4MA 3ANLA 1MAAA 4YMOA 1Z9BA 3IOMA 4RHEA 3NH9A 4AUEA 3VBCA 3SWWA 3JYLA 5DWQA 4G3IA 3QQ5A 2G8NA 1YK1A 1ENPA 2VBCA 1KFCB 2VWQA 5J8YA 3DVRX 4OQ4A 4BVFA 5KMGB 4MR9B 2IDJA 3CZ5A 1KZHA 3WGMA 3KBBA 1GL9B 4JC4A 8ICQA 1CCWA 5I9LA 3QK7A 1AF7A 1JPJA 1I24A 2PRIA 5AKLA 1UPCA 4BV9A 4XVHA 3WLRA 3I6ZA 2WJPA 1YRHA 1DX4A 2GN0A 2ONKA 4AU1A 1CULC 3BB3A 4CBVA 1SUCA 1YF3A 3CNQS 1U9YA 3B36A 3IP6A 1XD8A 3KXIA 3OPYA 1GAEO 1MG5A 1ZH6A 1K97A 5CCBA 2RHCA 2YWBA 4EF4A 4US1R 4OI4A 1OV6A 5FF9A 4D8TA 2E4YA 1KZ9A 4D96A 2FWIA 2ODPA 3PA6A 3VR6D 3QVGB 4EUEA 2EP8A 2VTKA 1F7VA 4M9NA 3DEZA 1WPQA 5FFMA 3F2DA 1BJKA 1F9AA 3KZNA 4G0PA 4NX2A 1O54A 2IS4A 4UBOA 1JZSA 2NV6A 1E2NA 2H5EA 1T5OA 2HC9A 3NPAA 4Q4HB 2X7JA 4RGBA 1HRKA 1Y7PA 3NT2A 5FFNA 3CS3A 1KOGA 1DAFA 4HUTA 1T43A 5KFLA 3PYLA 2P66A 1CF9A 4MUFA 4DS3A 1DE0A 3TQ1A 3G8AA 1Y3AA 3HBNA 4ZVLA 5TEWA 2YHAA 2ATIA 3BC1A 3LYAA 4G2NA 1ZQXA 1NJWA 1OFUA 2YDYA 3TLKA 1U2QA 3FXAA 2XCOA 1ZC3A 1QZ3A 2W6JD 4DIUA 2JCYA 1H0HA 2D54A 2GBIA 4D8UA 1E8DA 2SECE 3MGKA 3WB1A 4ELUA 3DHNA 2XDQA 5KOJB 2JGLA 1YI1A 2DUUA 3OZSA 4KLZA 1IY9A 2F9MA 1RTKA 3P52A 4BEWA 4YMLA 2WFZA 3RR2A 1FJHA 3DE5X 5LMUB 3G85A 1I13A 2EWMA 5CR0A 4MS4A 3GO4A 3VFDA 1XRLA 5E6SA 2Z2XA 3LPAA 4A8TA 2GEFA 5AFSA 2BL4A 5I8PA 1AIPA 2AQ4A 1MQ3A 3DL0A 4BV2A 4E7OA 2ST1A 1Z4OA 5JVDF 5EJ5A 4PZUA 4Y6OA 4QOSA 2N47A 5IBPA 8ICYA 1PZGA 4XJXA 3ZHRA 3PZBA 2Z5GA 3QEOA 1E7MA 4QAJA 3G6XA 1T0IA 4RQAA 1U2ZA 1KL9A 5IASA 1AA6A 1TO2E 3VR3D 3ZDBA 3AM4A 1B23P 2G06A 3ELYA 4JN6B 1NURA 1EM6A 4KMUA 1CWUA 1TUIA 3IVMA 2IHVA 3GK3A 3SE7A 1YVRA 4HQOA 4DMKA 4RJLA 5BPHA 1QKJA 4JJ6A 3PPXA 5DLFA 3BYZA 1DNPA 3OQVA 4QWWA 1M1XB 1CEQA 1KI7A 5H7XA 1NYTA 5K99A 5JDIA 5L3QB 3TD6A 3BHJA 3ROXA 2E1RA 1D7OA 2X2OA 3GRVA 4NF2A 4IGAA 3SJUA 3WMRA 5A5FA 3TGLA 1BZYA 3CF4G 4B3BA 4DDMA 1B76A 1KZGB 3BEDA 2O3SA 3UMSA 4CIDA 4DDKA 4F3RA 1WXQA 4MHVA 1COZA 5CVEA 1LK5A 4YVZA 5C51B 1G7RA 2BFBA 5ALXA 4DF4A 3FIUA 4HDRA 5COBA 1ZK2A 2VYVA 1A8IA 1GPBA 4EQ6A 2HHWA 3QWFA 5EIWA 1R0BA 1JXOA 2L0XA 5EJ9A 2AKEA 1KI9A 9ICAA 5CP8A 5LYJF 5GM2A 1KVTA 1FNDA 3OICA 3W05A 2CXNA 2RIRA 4Y1RA 3W5IA 5EWMB 2HIGA 2UUPA 2BDUA 1GYPA 3AHIA 3W8RA 5GVSA 3LUPA 2LI6A 3WK8A 4RGYA 4BLTA 3NI2A 3P96A 5D49A 2V1XA 2Z6QA 3MFIA 3Q7QA 1LWOA 3W34A 4IIGA 1OWOA 2J0QA 1C7RA 3DZIA 2CYAA 2V59A 4B6GA 3JYNA 3U7EB 1V43A 3Q7RA 4LXQA 3U1TA 1ABBA 1XP5A 1QGED 1E1CA 2XKAA 4UPDA 1X9HA 3R0VA 1RD4A 1XB2A 4WEQA 2GFIA 4YDQA 2YFHA 5JQGA 4MR8A 1UC9A 4UVGA 4F4WA 4H1WA 1R6VA 3H3XA 1OUQA 1VKHA 1V16B 5AJTA 5B1YA 4M6WB 4IH9A 1WOMA 4XIIA 4WZAB 5BN3B 1R6UA 1ISFA 2FMIA 1KMMA 5JQWA 4JJZA 4PTZA 2IZ6A 1JNXX 1BW9B 2VZLA 1PNQA 1Q2UA 1WB4A 5FPHA 3PL5A 1S2IA 3IP4B 1RI2A 4U7WA 5I8ZA 3ILVA 3IAM6 3HO8A 4UTPA 4O8CA 3C2LA 6CHYA 3SYRA 1CY2A 4AY2A 1R0WA 3EVZA 4E22A 4PHDA 3U2QA 4RWZA 5AW3A 1DAKA 2NXCA 5F2OA 3K6SA 1A2KC 2AHOA 3EVNA 2B3DA 1DQZA 1K1EA 2V6BA 3T95A 4BZXA 4F04A 2VWGA 4O2BB 2D7JA 1ULBA 5FA8A 1SU6A 3ESCA 4A0FA 4E46A 3ZVMA 1F5SA 2QROA 2XNHA 2Z9CA 3BPSA 4ZYVA 3LDFA 2W83A 4CNQA 1QIDA 3QELA 1U9JA 2QP4A 5D85A 3X2EA 4O5CA 1D0SA 2GLTA 2OCIA 4C0SA 4CQLB 2I76A 3OTWA 3PUZA 4ECZA 4XI9A 2VSNA 4OJYA 5DBIA 4QHYA 3SAFA 2HOIA 1AE1A 2G4VA 4P32A 5BRJA 4ALKA 4LNUA 4C04A 3T1HB 2RJNA 1RM4A 2A1JA 3YASA 2ALJA 1MENA 1EWKA 4UNPA 1F2UA 3JYQA 1JI3A 1T5BA 4WESA 3EXFA 4JY7A 2NYUA 3MWJA 4U0KA 5DHQA 5DB7A 1KJZA 3TI9A 1BG6A 4F8EA 5DG7A 3HRKA 4PQGA 2Q29A 3GLSA 1IZYA 4IIYA 1JR4A 1Z15A 3QPWA 3HSYA 1K6IA 3ZHCA 3R75A 2QD5A 1OSNA 5LZ5A 3IALA 4J94A 2IOHA 3QA3E 1O5IA 4RUKA 3TPCA 2ZIXA 5TPZA 3WI7A 4TKVB 4YR3A 2ATXA 2IYNA 2VP0A 3AQFA 4HR7A 4D9GA 4UMDA 4MQ4A 5F9LA 1VHQA 1PEKE 1S0UA 1W4LA 1HE8B 1TW3A 4MUEA 5JSZA 3CXUA 3UJPA 3U31A 3RG8A 2HHTA 4CEHB 4HNHA 5KKCA 4E1BA 3FMFA 3FVTA 4QE3A 1NR7A 3GNQA 1YRAA 4WADA 1DAPA 1E0AA 3PICA 4JNCA 4RQNA 3DLHA 2Q99A 2PXXA 2OCEA 4RIIA 4RBNA 4YAOA 3T3MB 2GAOA 1X19A 4HP8A 5DN9A 1NQVA 1DAGA 1ZM4A 4KJZA 4LAFA 4RHUA 3NW9A 2W37A 2QQ0A 2FPIA 4YYZA 3OE4A 1L5RA 3NHUA 2DX7A 4TMFA 2Q62A 1V47A 3DDSA 4KSYA 2QR2A 1RAIA 4Q4HA 3H84A 1SKAA 5KNIA 2WF6A 1DFIA 1N7GA 4NXZA 2ZJBA 3FB1A 3FSGA 3O31A 4MA0A 4MQEB 3VOSA 2GCPA 2Y9PB 4RHXA 4RT3A 4K81B 4RE5A 4E5DA 2EZXA 4IXNA 1KC3A 2BFBB 4KCGA 3IBGA 3CA8A 1BXKA 1Z16A 3UK1A 5CB4F 2WVJA 1WMSA 1ADJA 1NYLA 2O2XA 2NZJA 5LQRA 2IBKA 3CRW1 1NYRA 2DC1A 3OEYA 1E1YA 1FCJA 3QW2A 5DYNA 1ZMXA 2PTGA 3QNWA 3UJDA 3D2QA 2C57A 3HBAA 3EYWA 4CM6A 4MB2A 3E9DA 2W98A 3P9IA 2XICA 2LKDA 4J4HA 5EESA 3EPIA 1AGNA 2HWWA 3RT9A 1ZUHA 1ZJWA 4GMFA 3GUCA 2WNHA 3D4LA 4CV2A 2QT0A 2SKDA 3VPBA 1A5ZA 2WAQC 3HCOA 4EEXA 4NL9C 1KJ8A 3FPKA 5F9MA 4LG1A 5DBAA 3PUIA 5ALWA 2IGBA 4CM8B 1LFDB 1SJ9A 1ZJ4A 3HKEA 2JVJA 1W93A 3WLAA 4F2GA 1JKIA 2PRJA 2DWPA 2R00C 4FHEA 4WKBA 3T9EA 3M8RA 3QEJA 1VJRA 3V7FA 5HQ3B 2XQKA 5JOQA 5KWVA 1D2AA 3L79A 3DXXA 1NW9B 3JZDA 4H1VA 3MXOA 4HG2A 4UDNA 3TQSA 5ADWA 5KREA 1QFXA 3RFAA 1J2YA 4RA6B 1E2JA 3MZ0A 4X6XA 2OV1A 5L40A 4YJFB 3ZXYA 3ZNOA 2X8LA 1WX1A 3GLKA 3B7PA 2WMYA 2GFQA 2XQVA 1X1BA 2KI5A 1P1JA 2C5SA 3B8HA 1PL6A 3NBXX 2UYYA 2XE8A 3PF9A 4L02A 4G5XA 2RAFA 1QJ4A 3W1WA 1O94A 2E82A 3P26A 3H9JA 2FAXA 1X7YA 2R4QA 1M75A 2A1IA 3HU3A 1OT5A 2W04A 4HGNA 2BTQA 2P6OA 5AICA 5AI6A 2QXTA 4LY9A 1NNSA 4B3MB 2H2IA 2OFOA 2IV3A 2EAMA 4BX0A 2JLVA 2G5GX 4ZI2A 2YMMA 5AUQA 5B7GA 4JI0B 1NTRA 1K5HA 2K8CB 1VCIA 1HFKA 2FZWA 2XNSA 1J2RA 4NBVA 3WR5A 3VDMA 4R84A 1PUXA 2ZSHA 4N9WA 3TLJA 1W4CA 1YKFA 1SFRA 2DBYA 1L4FA 2F64A 2JJ2D 1A9ZA 4PLVA 4ZP1A 5M3BA 1XG5A 3RHSA 2JR5A 3ZJYA 2BZSA 4GF5A 4MEYA 5CB6A 1KQNA 3BJRA 2PWAA 5LP6C 3WBFA 2RHOA 4CKEB 4ZMRA 3HBJA 4W5TA 5A3VA 4YP9A 1FFSA 4PC6A 3EXIA 4HLCA 4QXRA 3OETA 5D2CA 4MR8B 4C01A 4AYBC 3QHQA 3MCAA 1O6ZA 2PX8A 4YJKA 1HEUA 1YDGA 5AVJA 3SAGA 1XP8A 2IPAB 1VPVA 3LVWA 2WJ6A 3O4VA 1USVA 4S0XA 3OMXA 5LZ2A 4EAQA 2GAJA 4HWRA 4HLDA 3M6IA 5DBBA 1EXMA 1UBNA 1DO2A 4I50A 3GOQA 4KBFA 1T2AA 5ECYA 1DIRA 4IFTA 4LRSB 3EPKA 4JSTA 5BR4A 2JA2A 3GV5B 1O97D 3BBLA 4MKZA 4QRIA 3IR6A 3PC8A 3MJEA 3D4IA 3WO1A 4C07A 3HR4A 4ONEA 2HDWA 1JEDA 2YIJA 4UBLA 3GLIE 4RESA 4RD2A 1FXSA 3CX6A 3I12A 3A11A 3TMYA 2FGJA 1KY2A 2C88A 3AF2A 4P98A 4PZ9A 3DAYA 3I8XA 2C2ZA 4KV7A 4OHVA 4B7CA 1ONOA 4MQLA 1CHNA 3LSTA 1J00A 2CCJA 3QE3A 5F5LA 1JDPA 2EGGA 3KB6A 2X3FA 5F52A 5LMCA 3UJHA 1YVEI 721PA 1Y88A 2VZ9A 3LECA 3IS3A 1KEJA 3VPFA 1RR6A 3H8VA 1KGDA 2R7AA 1X9SA 1ECBA 3USCS 4PLFA 5DHSA 2GZAA 1N61A 3C97A 1MO6A 3D6VA 4LCEA 4M8LA 5F5NA 4GU5A 2ERXA 4NG5A 1NI3A 4PPNA 3H87A 1U1EA 3WNCA 2D1YA 2QRUA 2PAFA 1R4MA 1AROP 1JX4A 2Z4SA 1J8MF 2CMGA 3IPXA 4Y2GA 4KXFB 5KVQA 1N2HA 1QF7A 1CF2O 3TARA 2GS9A 3H1FA 4IIJA 5AVQA 3WA7A 3CLRC 4IXMA 2BHSA 4P93A 3HVUA 1OXXK 4WI1A 1N3YA 1T0PA 3VCBA 1X7DA 3ZGVA 4AYXA 4XVUA 2RI6A 1SZJG 3RARA 1R6TA 4OJNA 2VJ4A 3D6FA 3CVVA 2P4HX 4LDJA 4QFBA 4RQ0A 1FK8A 1GRVA 3SSNA 4EJSC 1QOPB 5CX1A 3RVBA 1DHTA 2DZDA 5IF9A 1RBMA 5JHGB 2RGXA 3IKMB 4CIYA 4IC9A 5DM4A 3AOEA 5DPMA 4B9VA 1VG1A 1X40A 2P9TA 4OGLA 4I29A 4YXJA 1H85A 3RRXA 5D3QA 4E03A 4GXTA 2WSSA 2Q50A 4H18A 1SCUB 2GZDA 4LBVA 5F4BA 3M9NB 2MIIA 1Z2DA 3E1GA 2Z43A 5EQFA 2A84A 4HQ0A 5C35A 5KIAA 1O9GA 2F4VB 3ZW7A 5AXAA 3WL3A 3UHFA 1XMIA 2FWAA 4ZHQA 2YIMA 1NRXA 3OJXA 1P2VA 2AFIB 2GO1A 5GGXA 1LPPA 3QVJA 4MV8A 3MTEA 2DFTA 3IPLA 4HLQB 5DLQC 2WB1C 5DP1A 2ZUFA 3IPAA 2DLDA 2IPOA 3OZXA 4I2FA 1XZBA 5F64A 5E3HA 2HMUA 3V4FA 4YLYA 4B6EA 1D2NA 1OROA 4GFJA 3H2YA 1ZCAA 4URHA 2ZLBA 4FLMA 3LWDA 3OP1A 2QZSA 1N8NA 4WLNA 1R16A 1RQPA 2QX7A 1SCQA 2VUUA 4BNYA 4WXEA 2VF5X 1W29A 4XUCA 2HJGA 4LOAA 2GCNA 1NK8A 2O0LA 5HKBA 3STWA 2VT3A 1LFAA 1H3EA 3B1YA 5D3MB 2AFHA 2QR5A 3FLBA 3V9PA 3ACBA 1PQ4A 1X7YB 2OUIA 4PX3A 4DRXA 1Z5VA 2Y76A 4B9UA 3P2EA 3OQPA 3TQHA 5JAOA 4AQYB 2QRVB 2FZEA 3D3EA 4QUDA 2R6HA 5KYWA 2W8ZA 1NW4A 3HKBB 4UXJA 3L3FX 1B6SA 4Z3OA 3M1YA 5FBQB 1VG0B 3OKFA 3VYVA 3ND8A 4C0QC 4YAWA 3MCZA 5D00A 5GONA 1GGKA 2ZITA 3NKLA 5BV8A 1RRCA 4I1IA 4RU1A 3WAJA 4M6WA 3QZ8A 2AXNA 4QEZA 4IKOA 3KKMA 4KRXA 2PN1A 1MABA 3I52A 1LB1B 3CSDA 3HNRA 3OFKA 3QLVC 3V8QA 3ODPA 2HUNA 1AHIA 3K92A 4MVYA 2F1HA 2BCGY 4I14A 4C14A 1FYDA 2Z4RA 4ZEWA 3CKYA 1B8UA 3A1NA 4UBNA 3H5AA 3HYRA 2DPXA 4BAUA 4HXFB 5KFAA 2BV3A 4GUDA 3BXFA 4LXHA 2PFGA 1QXSA 4AS1A 3NBZC 4B32A 2ZJ3A 4EYGA 1SEVA 1L2TA 1QAOA 1TF2A 3CH5A 1FQOA 2EKDA 1GQSA 1MB9A 2HLPA 2B4RO 2MTBA 2ZAYA 3OIWA 4L4ZA 3WWEA 4HZIA 4K6HA 2NQ8A 1Z39A 3DEFA 4FYJA 1N9ZA 5FD8A 3C70A 5F1PA 3GMTA 4R40A 1T3QA 2SKCA 4RIGA 1XTUA 3ESRA 3CTPA 4B85A 3KKNA 4OEHA 2HSDA 1VE9A 1ISJA 2PJZA 4RZSA 1XXHE 2P2CA 1Z00A 5JAMA 3GDOA 1ID8A 1N6RA 2QMHA 4DE5A 1TK8A 2ZS8A 4IDAA 4TRMA 5C18A 2Y1GA 5T57A 2BCRA 4LVUA 2BH9A 2ZATA 5F77A 5G3YA 5H5JA 7GPBA 4POOA 3HCDA 3TRJA 1P7VA 1YULA 1Z37A 3CF2A 3LCUA 1PIWA 4NCXA 3SHOA 3OM0A 3HL0A 3WGHA 3PGXA 1KOLA 4OK6A 1KDYA 1E4EB 2NZWA 1Q1BA 1SUFA 4GOKA 1VBFA 3VH4A 1SCBA 4EHBA 3B82A 1LBIA 3WWOA 1NWHA 3K0CA 1H8HD 2OBXA 3G9XA 4FDUA 2JAOA 2PZMA 2WE8A 2JJQA 2OVFA 3IAFA 3M2PA 4PL1A 5AK5A 2M2IA 3L1IA 4O8ZA 7ICMA 3S8EA 1TYAE 3R5JA 3A9VA 3PJGA 1YR7A 1R8XA 3SC6A 4DZTA 2FP4A 3ER9A 1E5XA 3LX6A 4NBTA 1N2ZA 3MTQA 3P4YA 1A97A 4LHSA 4LSMA 1WMEA 2Q9UA 1ORRA 3PE4A 2G83A 2YWDA 5D1HA 2BEVB 5GVRA 3MQ2A 4CDGA 5F7JA 4LJXA 2KS6A 1E3LA 1ZH0A 4GMHA 4GP6A 4Z9FA 3UXNA 2GKGA 1WF6A 3RV3A 3FOFC 5IJ9B 5G0UA 5J4VA 1IMJA 4RSRA 3PO5A 2GILA 3A1WA 3T1TA 1SA0B 3R24A 2AE1A 3PUXA 2P6NA 3HCNA 4HRVA 1O8CA 3WQHA 2E8MA 3I92A 4JJKA 1TO1E 4KXWA 2ONYA 4XGKA 3CBGA 4LYDA 3SC3A 5KC9A 2HYIC 1FP7A 4H7IA 9ICMA 1Q3HA 1SQ6A 1J09A 2C9BA 2CUNA 4RJKA 5JU5A 1SCAA 2D8MA 4JUFA 3HRHA 4LBZA 4U7TB 2PUGA 2UUAB 5B2ZA 4DRZA 1S8OA 1E3DA 3WYGA 1XQ1A 3O0FA 3U4IA 3GJ8A 3AUUA 3F5MA 2IEAA 4UM9D 3TE7A 1OXKB 3TADA 2UYHA 2NAFA 1JPUA 3MUOA 4GSYA 3VPCA 4B71A 3DR5A 2XY5A 3WMFA 3WP1B 3PKZA 3LS2A 1W5SA 5K0JA 1TGYA 5ESDA 5EHNA 3RKSA 4LX8A 2BI4A 1D2MA 1EVIA 1XMXA 4UTOA 2A9KA 5KJEA 1PKXA 4EB6B 8ICMA 5E4YA 2X0FA 2BP7B 1MC4A 3JD3A 4H27A 1NJ6A 3C3PA 4C7BA 2EANA 5KVCA 3RYIB 4C87A 5CFMA 2I8CA 4X1IA 2FSVC 1E66A 3RFTA 4EFDA 5C3MA 4I6EA 4MX8A 1HDGO 3Q12A 4HL6A 5FUVA 4KPGA 2WZQA 4F84A 4EL5A 4TVBA 3K70B 5GGYA 3VC8A 3STVA 3PNVA 3WLIA 5HWSA 5KT6A 3CE9A 2XWSA 4DMUB 1C9MA 3OX1A 3UOGA 1ZU5A 1J1ZA 1C8KA 2BZFA 4C3UA 5KFFA 5DNUA 4UOQA 4HCJA 1Y6FA 1SVMA 1YS2X 5DIZA 2GBLC 1WABA 2ISCA 3B1ZA 4GOXA 4RZHA 4YP5A 3OQOA 1RWNA 5A3SA 4ZT5A 2GSDA 3VV3A 5HSGA 4M0UA 3V4RA 3RU7A 2ADFA 2PI5A 3D6UA 4P31A 1I3KA 5B55A 5BSUA 1J5EB 2DJIA 1GPLA 3CJRA 1OX5A 2O7SA 1JEEA 2AXPA 2G70A 4IQUA 1W96A 2WF5A 2X40A 1KSJA 4ME6A 1M66A 1GO2A 2CUZA 3IP9A 4TN1A 4ZU6X 4F91B 1GNLA 4JV5B 1PSZA 4OBEA 3VDQA 1TM2A 3AY3A 4LFAB 2C2WA 3W2IA 3OX2A 4TL9A 4E14A 4NSNA 3JTMA 1CTQA 3C1ZA 3A58B 2G80A 3GGGA 1CJSA 1II8A 1NT2A 4FS3A 1YA8A 2VJKA 3SZMA 1J20A 3F96A 2BFEB 4R2XA 1EUCB 2GZ1A 5DTIA 3LWBA 2Y93A 3Q5DA 1PQYA 4C22A 3RREA 2XO7A 1CQPA 2I6UA 3PXAA 5D7NA 1WHTB 1DO8A 1KN5A 1X14A 1SCKA 3IKLA 3H99A 2ZCUA 3CY6A 3PXGA 3QMVA 2R18A 4G0OA 5JSZB 4HNAB 5HZGA 1DGQA 1UC5B 5F2EA 1VCNA 4J9OA 4FMBB 5DLYA 5HNKA 5ED0A 3M9OB 3SOZA 5AJUA 3R9WA 3UAYA 4EHFA 4RPJA 1EHYA 1S2GA 1VJ0A 2VDLB 2A9QA 1DKLA 3MCTA 3MGGA 2WHRA 2XIQA 4R0NA 1T5LA 2PX5A 1YONA 2Q4OA 1J0AA 1POWA 2V03A 1TFRA 4TS9A 3MTAA 1PR3A 1QK4A 2QSUA 2VKTA 3T52A 4E31A 2O54A 1JALA 4NLZA 4GGMX 3TE6A 1AQJA 4RPIA 2G9ZA 5DLGA 3IR5A 4V0LA 4UNIA 1ODLA 3VJLA 5FBWB 1MC5A 2RONA 4MQEA 5IJZA 4KPYA 2AU0A 4KLGA 4ARSA 2RQ5A 2F43B 2P0YA 1GKIA 1TZKA 4OAPA 2PUDA 3DTTA 2BY4A 3G79A 4ND5A 4UVIA 5CVCA 2O5EA 4NQZA 1ZOIA 5K0CA 1B1CA 2QUHA 4KI7A 4F5DA 3FDSA 1LU9A 4OCZA 2Q5LA 3CC8A 5KG7A 3A31A 4EB3A 3OQNA 3UENA 4N5LA 5A04A 1YSCA 1KEPA 4MAFA 3R7SA 1KOFA 5B1HA 3AM1A 3OZDA 4UOEA 4OHOA 1RACA 3A14A 2YKGA 1WEKA 3LBAA 5NULA 1PJSA 3WWPA 4ND6A 3ZD9A 3HKZF 4OD0A 1Y82A 2KX7A 2Y9UA 1KFBB 5B1EA 2HO5A 1VRVA 5AW6A 3GWGA 5L7YA 1JRLA 5UKDA 3S5JA 3SJZA 4N03A 5IH7A 2ZIEA 3A4MA 3FI0A 2WMNB 4IKEA 2WY2D 1AKVA 1G55A 4JYAB 1OI2A 2X1LA 3SZUA 2BGIA 1GUYA 1MGOA 3AIKA 3CEAA 4BE4A 4JS0A 2XRMA 3KLPX 4W8GA 5H2FU 3BD9A 4BVAA 2EWWA 2H7CA 1LLQA 3AEUA 3BOSA 1A9XB 1TMGE 3WK6A 4TKUA 1SPBS 4RTQA 2WHPA 3JARA 5L7WA 5BNWA 2E5FA 2YWXA 3SF0A 3U37A 2A3NA 1JVNA 3EQ2A 4PG4A 1WUYA 3KPJA 3KR1A 3PU6A 3QTLA 4A03A 1X1DA 2FFBA 2XRYA 4OGGA 4HT3B 3W77A 1GKUB 1JIIA 4EYIB 1E9BA 1P0MA 2MSDB 1YS4A 1Y80A 4HH0A 1WQ1R 3I4CA 3EVAA 4MS3B 1E5LA 4CTJA 2L5YA 3MBIA 5FTKA 5CDTA 1UCFA 4DSFA 1FRVA 2BMWA 1XWWA 2PH1A 5G41A 3X2SA 1DIHA 1U2GC 2JLQA 3C5GA 1P0CA 3C5VA 5CJ2A 2KKPA 2XF8A 3C4VA 5DXFA 5ERYA 4MV1A 5D3KA 1UFQA 1DSSG 4DL6A 1PWEA 3ZWWA 1MGPA 4Y2RA 4Y9UA 1EFAA 4B3HA 1BGVA 4K40A 3V1LA 4BDTA 2G5IB 4MAMA 1V4VA 5CLQA 1DEXA 1V8DA 3CF6R 1U1DA 4PNHA 1G3QA 2PGNA 4C8OA 1GIAA 5AKIA 1Z6QA 3B85A 4RJTA 1NNUA 1QYIA 3L49A 3Q8WA 3REQB 4RJ2A 5IG2A 2RCNA 3FHLA 3LW7A 1VGQA 2ZIWA 4MKFA 2W03A 5I45A 2PZBA 1ZESA 3FZNA 3RVQA 4D8WA 2JEGA 2CL7X 1RAGA 3SICE 1A9RA 1DG1G 4PHHA 4V0ME 3DAHA 4YRDA 2IYXA 3U81A 5C53B 5IN5A 3CVWA 1K06A 1Z6GA 3BQ2A 2XXBA 1ISMA 1N1MA 1T3SA 4H15A 3RS4A 2ISQA 2D2FA 4GKJB 2UZIR 2VJDA 4XDHA 2AZXA 3F7MA 1R8QA 2NG1A 3GROA 4FYVA 1N5KA 1M0WA 3EEFA 3BA1A 3F3MA 3M4YA 4PHFA 3FPEA 3F53A 1S0VA 3DG9A 2QD2A 5A06A 3A9TA 4F3NA 5MN4A 4OKSA 3A04A 3LIPA 4FC6A 3NRZA 2PLRA 3ZHZA 2Y9TA 1ZQVA 4IRKA 1QBKC 4UREA 3M49A 6AT1A 3QYFA 3ANSA 5I5EA 1SVLA 1RM3A 2IXGA 4PFQA 2I7DA 2Y0BA 4YN4A 2VSQA 3WZ2A 2ZVJA 1W46A 2J0SA 1G5TA 3Q9UA 5HZHA 1ISPA 1IY0A 2QTVB 3L05A 4LZDA 1U5BA 5EY5B 3AVUA 2F44A 4DQSA 3I6BA 4NMXB 2WILA 3VU0A 3F6EX 1OB5A 5HM6A 4GRDA 4ENVA 1FE8A 2J6CA 5FDFA 3S2ZA 1DG3A 1FB5A 3KPUA 5LU9A 1GTJ1 4MAAA 1DJPA 1N5MA 3NWJA 3PXEA 2QT9A 3A6DA 1RQRA 4EKGA 4M55A 1JH8A 3BE5A 2RJ3A 4JV0A 4HQKA 4KIWA 1DRJA 1NVDA 2FEWB 1PR4A 2H5JA 1QZXA 1FXWF 1IUNA 4WBSA 3BRWD 4M0MA 1P62B 2HH9A 5C37A 4R2WA 4B9NA 3D6TB 3QXXA 3D81A 2UVRA 1JB1A 5HMLA 4CNBA 3H8MA 2PWYA 3A1TA 2Y1EA 4R1SA 3PXXA 3T38A 1B2LA 1SV0C 2PCLA 1W6RA 4NLKA 4EI9A 4TS4A 1UA1A 2CFTA 2CB0A 3STYA 3VNRA 2BFOA 1RHQA 3NYQA 3DL2A 3EY9A 4K3UA 2BEUA 4D5GA 4K9SA 1T5HX 2FDXA 5KTYA 1RWBA 2ZS7A 5AUPB 2GDJA 2V9PA 1W1IA 2CW5A 3WRXC 1PW5A 1XNQB 3D4PA 8ICVA 2B2NA 4X1YA 4HOYA 2BKVA 4JJ4A 5E7JA 5B1IA 4MMZB 4DLAA 3BZKA 1V9LA 3NM5A 1WDLA 3SENA 2IWHA 1TJNA 3DKKA 1R3UA 3GVPA 4HSGA 5EHQA 4D4HA 5KOHB 3CZRA 4IG4A 2GZSA 4R2LA 1IU9A 4RK7A 4GAEA 4LTMA 3SAHA 4WCVA 1DXHA 4QIHA 2CLOB 1Q16A 2O20A 3AHJA 1PV2A 2C8JA 5DTRA 4XIYA 3VPAA 2HQRA 4EPTA 2FSIA 3IDWA 1O9BA 1EU1A 1EP3B 1JHDA 1GUFA 3FPSA 5GZ1A 3ZIDA 1W25A 3F6BX 3WAKA 4YG2A 3GH1A 1A4XA 3RQIA 2QZJA 1H93A 2AFHB 1XV5A 3RADC 1LPOA 4ECYA 3ZTTA 3SR0A 4Z4EA 1BMQA 2QPAA 1DBWA 4ZAXA 1SKMA 2O8DA 1TMYA 1VHTA 2YQ4A 4IICA 3KE9A 4WNIA 3I53A 1ZD8A 4OXIA 5KYUA 2LKYA 1E62A 3EIHA 3FLAA 3H18A 4HAZA 2YZMA 4MCJA 4QTXA 4XYEA 3V8MA 5B7NA 3L4PA 4J8PA 3OEHD 3B5EA 1UC4B 1O4VA 3LO5A 5BSKA 1T8YA 4RA9A 1PJLA 3M70A 4ER3A 4R66A 4HX2A 3ZWKA 1G18A 1VCMA 2BKAA 2PFQA 3FLEA 1LK7A 3K31A 4UNQA 3TKLA 4I2GA 5DTMA 3Q40A 4QDKA 3O8RA 3AKCA 2C9MA 1RFGE 1XLWA 4RUAA 5AKEA 1JN0A 4LTDA 5ALDA 1Z22A 2JAPA 1E8NA 3W1EA 1OBHA 4M9HA 3VKFA 4GVPA 4YPVA 4NAVA 2FFRA 1EE2A 1PF7E 2AA3A 2WA1A 5CURA 1K4YA 4BRWA 3I9MA 1IOLA 2HREA 4HGPA 4O0MA 1OKKA 4R6XA 3NWBA 1EGMB 3VSDA 2NZXA 2JZOA 3SZGA 4AECA 5LU8A 1WUKS 1P3Y1 1QDUA 2PYDA 4K9MA 3UWDA 2BUAA 3BHNA 4AN0A 5HJ7A 3EPHA 4Q4JA 3R5XA 1AKYA 5CU7A 2XWJI 4YUXA 2GN8A 1TRKA 4YLEA 2O3TA 1IHPA 4JB0A 4KUEA 4MB6A 1JT9A 4L6CA 4GPBA 2W7OA 2HZ7A 2OFFA 1DOAA 3K8ZA 1M2GA 1BWSA 2R48A 1NKVA 3RGGA 1X1RA 2HDHA 4UFPA 4FN4A 3GY0A 3QY0A 1ZN9A 4MUAA 4BVBA 3CH4B 3GRKA 4NVRA 4X00A 3EZ7A 1LKYA 1JEQB 1U04A 2ZJ1A 4J9SA 3JATA 621PA 2F7SA 3GG9A 1NBOA 1T6XA 3KSRA 3WYNA 3PSPA 1HUOA 4GGOA 4LDZA 1VRWA 1S1CA 2B3TA 3RT1A 1SG9A 1YHZA 2DJ5A 1EDEA 2XDQB 3IP8A 3LV8A 3KJHA 5KOJA 1PUIA 4E5NA 1MJGA 2WM3A 4O2LA 1AN9A 1JR3A 2XMCA 3ROPA 2ERCA 2AMYA 4FYHA 4DLYA 1IVSA 1DRVA 3FWZA 4N5IX 5KWSA 1JHRA 1SQFA 4GW3A 2O57A 4UUQA 3MINB 5CHGA 4QAQA 4X5OA 2HQSA 5HMMA 3EVGA 2Z5VA 3L7OA 3EIFA 4WK6A 4FWIB 3D7NA 1X70A 3SLKA 3EDCA 2AN5A 1K9SA 1NBMA 3EW9A 2C78A 1XTVA 3HABA 2P68A 5LUBA 3K9QO 2ZGVA 3P9PA 3LC7O 4ZVVA 3ZPXA 3HCPA 4GX1A 2F3QA 2RIPA 1Q0TA 1J8QA 1G5RA 1M73E 2FVXA 1Y1RA 2WOJA 1YTUA 4E5YA 1KK2A 1U0RA 4MEAA 6ADHA 2KZ3A 1OXSC 1TVMA 1XZKA 1ZDMA 3MG9A 2W6OA 3A2NA 1KEWA 4M7OA 1VQ1A 1Y1QA 3BWDD 2L2QA 3SR4A 1G6Q1 1V95A 1XI2A 4NBUA 5CBKA 1NOIA 3PSTA 1RWQA 1HFEL 2KJ5A 1BNPA 4ID3A 2WD8A 4ZO7A 3AF6A 4EEYA 3G5MA 5DZSA 2ZB4A 5TQ2B 3IXQA 4MUBA 4IRMA 2JFXA 2CBZA 2OV6A 4PLCA 3ZHTA 3H1BA 4EG3A 1X94A 1QZTA 3E3MA 1PT9A 3OLXA 4IQ4A 3T1YB 3I9NA 5EIOA 3TBFA 2FPWA 2HGZA 5M04A 1E32A 4RMNA 5C4GB 2ZSEA 3ZK9A 4CF3A 5AWFC 2N75A 3ZNQA 3OCWA 4YAFA 4XGQA 5K3AA 4ABYA 2JAHA 1L3SA 1H4SA 2DEUA 5I3CA 1GUDA 1H2EA 5L1KA 1HOTA 4GSKA 1CUFA 1M34B 4X95A 2YXPX 4FB4A 2QYTA 4LUCA 2D3DA 1JI0A 1TC2A 4GMKA 4P4SA 4XJTA 4FYXA 4JB3A 4JVNA 5DHAA 1B26A 3GX1A 3E84A 1A71A 3OZVA 4MRMB 4PSUA 3HA3A 2H3FA 3TW8A 3HKDA 2PT6A 4AIRA 2H3QA 2QN8A 5IRCD 4J9NA 4EHLA 4L5AA 2IFTA 3D7MA 2CNWD 4X6LA 5CBPA 3IBSA 3NT5A 4GZMA 5T6BA 4E1VA 2IX9A 2PU5A 3NHMA 4MW0A 4BWYA 2RHTA 3V6MA 2QUZA 3EBLA 3KYCB 5EJ6A 1GTVA 5H3LA 3AR2A 4H08A 5KFMA 1G8GA 1AD2A 3NEAA 5K3SA 2FMSA 2GCOA 2VNSA 5CNKA 1WZEA 4QVGA 3BSWA 5AI9A 4KTTE 5FHRA 1Z75A 3CYFA 3HJGA 2CBGA 4J6EA 2IOFA 1E4OA 1J8YF 4IILA 3ZVRA 3V72A 4JLAA 3NV9A 1I2AA 3TADC 3REFA 4IDBA 4B9MA 3I30X 3UT0A 3AEKA 1M2HA 3COWA 1E8MA 2XXJA 1JSCA 1S2DA 3NTRA 5GPBA 3RJIA 1FMLA 1PDOA 4QOGA 3UATA 4ZOLF 5BUSA 4B6JA 4FFMA 1HG0A 4OHMA 4BBZA 5BW4A 3DL4A 5FI5A 2IL1A 5CFRA 1DCFA 5JXGA 3T5PA 3LRXA 2GTIA 2QL7A 2R62A 3ADKA 1Z2EA 1U81A 2A30A 2EJTA 3HA7A 3LBNA 4TS3A 5EQJB 2R2GA 2RHMA 5HFAA 4HX9A 1DT3A 3STHA 4E32A 1BJTA 2G04A 5IZCC 5M29A 2J08A 5BNIA 1KWKA 4IRCA 5ALVA 2YNMA 2JLXA 4XCVA 2OBLA 2CHUA 1PP4A 2W9CA 3EFEA 4Y1EA 5CYOA 4YP7A 1U49A 2O3RA 3RVPA 3S2EA 2L42A 3UOAB 1Z18A 4C05A 1A5TA 3R44A 4GLJA 4MW6A 3U3ZA 1ECGA 1UF9A 4IUCS 2VQFB 2R5WA 3GEGA 3IPCA 4Z4GA 5TPZD 1IEXA 2XYQA 5EWJA 4BLOA 1QQ5A 1YRQA 4I9UA 1P4AA 3FAHA 1F8FA 3IQZA 3RVJA 3TVYA 4BATA 4AQ7A 4LZWA 4YMNA 1DKNA 2A1JB 2G1AA 1AVTA 3FY4A 1IN5A 1V8FA 1C30A 1TYBE 3BK1A 3FFBA 1LBTA 4L51A 1TCCA 1R0KA 5J0SA 1N4DA 1YNSA 1F51E 2Q2WA 2V97A 2GHQA 5HS6A 4X64B 2PLFA 3I9V6 4PYOA 3EHDA 1A8UA 4IDCA 5BR7A 1RRGA 1XDWA 2QRQA 4OHUA 5CM9C 1V1RB 5EP1A 4LOHA 2O2SA 4FGLA 3UW3A 1M5RA 1KKXA 3QLJA 1XSLA 3VAAA 3F7TA 4YN3A 1LK0A 4UFOA 4EX6A 2BONA 4KQEA 1X1TA 2XMGA 1KQFA 2E8OA 3O83A 5AW4A 3KAQA 3UKDA 4ARIA 2FPLA 2OQ2A 2Z2KA 3KVRA 1T1SA 4FQ5A 1GPMA 3AI3A 4UAVA 4I2DA 4R2MA 1BXGB 2RHDA 1OXJA 4P36A 4RQBA 2LYAA 1DUVG 1QE3A 1V6SA 3ZOKA 1DBSA 1XRRA 4L5BA 2XVAA 4Z0HO 5IWCA 3P4XA 2A0WA 1M67A 3PNKA 3GPCA 3IV9A 4BO8A 1T2EA 2J6IA 3OU2A 5DBFA 4MEXA 5KTOA 1RPLA 4HKTA 4LF7B 1OX4B 5DNEA 5C7OO 1NI4B 2PD4A 3PT5A 3WGJA 3VHRA 3ZDXB 5CYPA 1PCXA 2IYFA 5KTQA 3IELA 5JECA 2Q3BA 2PUEA 1H66A 3S68A 4NOMA 2E49A 2P9EA 4S2EA 3KAKA 3II6X 4CCAA 3DPUA 2XBMA 1QVZA 2ZJ8A 2IHUA 1OC2A 4MDFA 4E6EA 2H63A